3D3SA

Crystal structure of l-2,4-diaminobutyric acid acetyltransferase from bordetella parapertussis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
RYHLRPPRRNDGAAIHQLVSECPPLDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRAMLGHILERQECRHVRHLETTVGPDNQASRRTFAGLAGERGAHVSEQPFFDRQAFGGADHDDEMLLRIGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L-2,4-diaminobutyric acid acetyltransferase from Bordetella parapertussis.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Transferase
molecule keywords L-2,4-diaminobutyric acid acetyltransferase
total genus 45
structure length 159
sequence length 159
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.178: Diaminobutyrate acetyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3d3sA00
4KVOE 2BSWA 2WPWA 1S7KA 1MJBA 1GHEA 2FIWA 5C82A 2R7HA 2Q7BA 3R9EA 1I21A 3F0AA 4R9MA 4KOVA 1MJAA 2I79A 2QIRA 4GS4A 4H6UA 2VBQA 3SXNA 1Q2YA 2Q04A 2I00A 4KOYA 1NSLA 3QAHA 2EVNA 4KUBA 3CXPA 5GCNA 4KOWA 3RYOA 3TFYA 5IB0A 4MBUA 2NMTA 3BJ8A 3G3SA 1B87A 2IL4A 2OZUA 3EXNA 2CNSA 4E8OA 2Q44A 3TT2A 1XE4A 3D3SA 2JDDA 1Y9WA 4B5PB 4R3LA 3FNCA 3S6FA 4HNXB 1MJ9A 2JDCA 5E96A 2ZPAA 2OZGA 1YVOA 1I12A 4ZBGA 3VWEA 1M4DA 2JLMA 1YVKA 2WPXA 4XPDB 5IX3A 1S3ZA 2O28A 3I3GA 3BJ7A 3E0KA 4QUSA 4UBRA 3ZZIA 3DNSA 2ATRA 4AB7A 4B5OA 3EY5A 4AG7A 1S7NA 4CRZB 4PK3A 4NSQA 3K9UA 1J4JA 3V8IA 1CJWA 4YGOA 5FVJA 5JQ4A 4E0AA 3GYAA 2FXFA 4AVBA 4FD7A 1UFHA 2PR1A 2FE7A 5JPHA 4JXQA 2ZXVA 3DR6A 2F5IA 1PUAA 2KCWA 1QSRA 3R9GA 4XPKA 3R9FA 4JD6A 1S5KA 4CS0B 3W6XA 2VZZA 2ZW7A 2P0WA 4OADA 5C88A 1RO5A 2Z0ZA 1XEBA 4ONUA 2Y0MA 2JEVA 2B58A 2REEA 2VEZA 5F47A 5I0CA 2GIVA 4RS2A 2ZW6A 5H86A 2P6GA 4KOXA 2QECA 3FBUA 4CRYB 4H6ZA 1KUYA 3D8PA 1M4GA 4OLLA 1QSOA 3MGDA 1I1DA 2VZYA 4X5KA 1XIXA 2DXQA 3T9YA 1L0CA 4JLYA 1Z4RA 4MHDA 1SQHA 1YR0A 4XNHB 4U9YA 4I49A 4CAVA 3R1KA 2B3VA 2FIAA 2GE3A 5HH1A 4L8AA 4KVXA 1TIQA 4XPLA 1YREA 1Y9KA 1BO4A 3C26A 1WWZA 2Z10A 1M44A 3PP9A 2ARHA 2CNMA 1YK3A 2FSRA 5KTDA 1IICA 3N7ZA 3TO7A 2R98A 2A4NA 2CNTA 5KTAA 4BMHA 1VKCA 3FIXA 1U6MA 1Z4EA 2Z11A 5DWMA 1VHSA 3H4QA 2FT0A 4HNYB 3TOBA 1NMTA 3PZJA 2PSWA 2B5GA 1XMTA 4KVME 3FRMA 2REFA 3VWDA 2R8VA 5EBVA 4R57A 3F8KA 3B8GA 2Q4YA 1Q2DA 2GANA 2HV2A 2QMLA 4U5YA 2VQYA 5EC4A 1QSNA 3DSBA 4NXYA 3D2PA 4LUAA 4H89A 4QC6A 3LD2A 4ORFA 4FD6A 3T90A 2J8NA 4RI1A 4KUAA 2B5GB 1LRZA 1YLEA 1K4JA 1S60A 1Q2CA 1WK4A 1CM0A 1XF8A 4E2AA 5ISVA 3FB3A 1QSTA 2FCKA 3KKWA 3DDDA 4PSWA 4QB9A 5KTCA 1YX0A 3QB8A 5F49A 4PSXA 5DWNA 3S6GA 2J8MA 4XNHC 3P2HA 2D4PA 1IYLA 1V0CA 1Z9UA 1KUVA 2G0BA 3GY9A 2BL1A 2G3AA 3NE7A 4JJXA 4XPDC 3JUWA 2EUIA 2X7BA 4IUSA 4UA3A 3UY5A 4M3SA 2B4BA 4MY3A 4DNCA 1RXTA 3CXSA 1IYKA 5J8FA 3TO9A 3WR7A 4PK2A 2CY2A 2AJ6A 2B4DB 3FYNA 1MK4A 2FS5A 3PGPA 1IIDA 2B4DA 2G3TA 4KOTA 4M85A 1ON0A 2PC1A 3EC4A 2R1IA 4YRHA 5H84A 4KOUA 3OWCA 4QBJA 2B3UA 3R95A 2RC4A 3DR8A 2P6EA 4KLWA 3IGRA 3LODA 3EO4A 2PRBA 3S6KA 3EFAA 4JXRA 5CNPA 4OAEA 4R3KA 3S6HA 4JWPA 4MY0A 5F46A 2BEIA 2OZHA 4NEXA 4KORA 2P6FA 5HMNA 4QVTA 1NE9A 2AE6A 3I9SA 1BOBA 2C27A 2FL4A 3IWGA 4FD4A 4UWIA 1OZPA 2ZW5A 2Q4VA 1S7FA 1M4IA 3JVNA 2PR8A 4R87A 4NF1A 4CAXA 4MI4A 1Y7RA 4K30A 4AVAA 4EVYA 4NCZA 1IB1E 3GKRA 2HQYA 3F5BA 1M1DA 1R57A 4Y49B 1KUXA 4MJ8A 3W91A 2PQ8A 4CAWA 5J8CA 2BUEA 3ZJ0A 4L89A 3FXTA 4II9A 1P4NA 3TOAA 3W6SA 4AVCA 4FD5A 2HUZA 2VXKA 5IV0A 1N71A 4Y49C 2OB0A 4PV6A 2H5MA 4B5PA 2J8RA 2OU2A 4YFJA 3G8WA 3CXQA 3R96A 3TE4A 1YGHA 4HKFA 4UWJA 4HNWB 3SHPA 3P2FA 2ZW4A 4KOSA 4J3GA 2OH1A 1P0HA 2Q0YA 4AG9A 4F6AA 4U9ZA 2VI7A 1B6BA 1FY7A 4KZTA 2D4OA 1PU9A 1QSMA 3TTHA 3D2MA 3TO6A 1S7LA 4LX9A 4IF5A 3SXOA 1KZFA 4F0YA 5F48A 4KLVA 2PDOA 2K5TA 3TCVA 3BLNA
chains in the Genus database with same CATH superfamily
4KVOE 4MCPA 2QYVA 4IHMA 2BSWA 2WPWA 2ZEEA 1S7KA 4IK2A 4NGNA 1MJBA 2PJ0A 1VHEA 5K8OA 1GHEA 2FIWA 5C82A 5A27A 2R7HA 2Q7BA 1X10A 2RB7A 4ZI6A 5G22A 3R9EA 1I21A 2BO9A 3F0AA 4KOVA 4R9MA 1EE3P 2EK9A 5AG7A 1MJAA 2I79A 2ZEHA 2C6PA 2QIRA 1ARLA 4GS4A 3RAMA 5A28A 4H6UA 5AGEA 2VBQA 3SXNA 1Q2YA 2Q04A 5I4MA 2I00A 4KOYA 4MFJA 4P10A 1NSLA 3V38A 5EMIA 2ABZA 3KQZA 3QAHA 2EVNA 4KUBA 4RN7A 3CXPA 5GCNA 4DYOA 3KL9A 4KOWA 1KWMA 3RYOA 3TFYA 5IB0A 4CYPA 4MBUA 4CGOA 2NMTA 2Q51A 2JBJA 4UCPA 4NGSA 2O53A 1DTDA 3BJ8A 3PFEA 3G3SA 4NFRA 3PB9X 2IMOA 3KGQA 1B87A 5HVFA 2IL4A 2OZUA 3EXNA 2CNSA 1ARMA 4X3RA 2PRQA 4E8OA 1TKHA 2Q44A 2ZEGA 3LWUA 2VL1A 1QMUA 3PBEA 3TT2A 1XE4A 3D3SA 2JDDA 1Y9WA 4B5PB 3H5ZA 4R3LA 2AFXA 3FNCA 3S6FA 3B3SA 4HNXB 1MJ9A 2JDCA 5E96A 3VARA 2ZPAA 2NSMA 2OZGA 1YVOA 3PBBA 1I12A 4ZBGA 3VWEA 1M4DA 2JLMA 1F57A 2GFQA 1YVKA 5DS0A 5K8NA 2WPXA 4XPDB 5IX3A 1S3ZA 4BD9A 4B12A 4MFQA 2O28A 4CYQA 1IOFA 5D8NA 1YQEA 3I3GA 3BJ7A 3E0KA 4QUSA 3NFZA 3IU2A 3DNSA 2ATRA 4UBRA 4R6TA 3EY5A 4AB7A 4AG7A 4MRIA 5LYDA 5JM6A 1S7NA 5JGFA 1FT7A 1YLOA 4CRZB 4PK3A 4NSQA 3K9UA 4K3NA 1J4JA 5LYFA 1X12A 4M6HA 1YW4A 3IFEA 3V8IA 2ANPA 2QJ8A 2BCOA 3SJGA 1Z5RA 3KR5A 1CJWA 4CGMA 1OBRA 4YGOA 5FVJA 5JQ4A 4E0AA 3GYAA 2FXFA 4R7MA 4AVBA 3D66A 1CPXA 2ZENA 4FD7A 4CYOA 1UFHA 2PR1A 1ZG9A 2OR4A 4B6ZA 2FE7A 4C68A 5JPHA 3TC8A 4JXQA 2ZXVA 3DR6A 2Z3NA 4C7IA 1LAPA 2F5IA 3CT9A 3H8EA 3QAYA 3D7HA 1PUAA 1IU8A 4UIBA 3SI1A 3WC7A 2KCWA 4O23A 1FNOA 1QSRA 3GIUA 1YW6A 3R9GA 4XPKA 3R9FA 2AFZA 4JD6A 1S5KA 4CS0B 3W6XA 4MFLA 2EO8A 2VZZA 2ZW7A 2PVVA 2P0WA 2POKA 3CPXA 4P44A 4OADA 5C88A 1Y7EA 1RO5A 1ZLIA 2PIZA 2Z0ZA 2ODFA 1XEBA 3HLPA 2PJ2A 3ISXA 1XBUA 1F2OA 4OC0A 3K9TA 4OC4A 4FAIA 4ONUA 2Y0MA 4P4IA 2XEJA 2JEVA 1BPMA 2B58A 2REEA 2VEZA 2BOAA 4PQAA 5F09A 5F47A 5I0CA 2DF5A 2O4HA 4MHZA 1JWQA 1LAMA 2GIVA 4RS2A 2ZW6A 1LCPA 2YNDA 5H86A 2P6GA 3BI0A 5HVGA 4KOXA 2QECA 3FBUA 3KQXA 2F7VA 2IQ6A 4EFDA 3KHXA 2Z3PA 4OC2A 3VH9A 1BPNA 2ZELA 3FEEA 4CRYB 1TKJA 1PYTB 4C2XA 3DGVA 4H6ZA 7CPAA 1KUYA 3D8PA 2C6GA 4OP4A 4X8IA 1M4GA 2V8VA 4OLLA 1RTQA 4UFWA 1AYEA 1QSOA 3MGDA 1I1DA 2VZYA 4X5KA 1XIXA 2DXQA 2PJ8A 2XEIA 3T9YA 5HXDA 1L0CA 5LRJA 3T8WA 2NYQA 4JLYA 2HB6A 2DPTA 1Z4RA 4A37A 4MHDA 1SQHA 1YR0A 4P4EA 4P4FA 4XNHB 4U9YA 2V8HA 4Q38A 4PXBA 4A32A 4C2YA 4I49A 4A39A 1NSAA 4CAVA 3R1KA 3BXMA 3PB6X 2B3VA 2FIAA 2GE3A 3IU1A 3H8GA 3L2NA 3B7IA 4L8AA 2PJ4A 3NH4A 4KVXA 1TIQA 4OIWA 4P4DA 2Z3MA 2AFUA 4XPLA 1YREA 1Y9KA 1BO4A 2WYRA 1XJOA 3C26A 3FECA 1WWZA 2Z10A 3IEHA 4NGTA 1M44A 1XOVA 3PP9A 3K2KA 2ARHA 2CNMA 1YK3A 4PPZA 2FSRA 5KTDA 1IICA 4A38A 4MCRA 2XEGA 3N7ZA 4KS9A 3TO7A 2R98A 1VGYA 1HDQA 2A4NA 4KSAA 2Z3OA 5AG6A 2CNTA 1VIXA 3S9LA 1PCAA 4NJQA 2OOTA 5KTAA 1Q7LA 4BMHA 1VKCA 2DEAA 3FIXA 3NA6A 1U6MA 3SJFA 1Z4EA 2YNCC 3ISZA 4B14A 1Z8LA 4F8ZA 2Z11A 5DWMA 2ZEOA 2GU2A 3B3TA 4MHNA 4MMOA 4EMEA 3D7DA 1JQGA 4B10A 1VHSA 3H4QA 2FT0A 1R3NA 3A9LA 4HNYB 3TOBA 4DJLA 4H2KA 4LQ6A 1NMTA 1YMEA 2PJ6A 4ONWA 4PXDA 3PZJA 2PSWA 2B5GA 4CGNA 4FUUA 1YSJA 3JRUA 3FMCA 1XMTA 3MN8A 4KVME 4MCQA 3FRMA 2REFA 4MHPA 2R8VA 3VWDA 5EBVA 4CAFA 4MCSA 1IY7A 3B3VA 5IB9A 2YGWA 4R57A 3F8KA 3B8GA 4A94A 2EBJA 2Q4YA 4MHYA 1Q2DA 2I3CA 1CPSA 2AFWA 2PJ1A 2GANA 3KR4A 4UEEA 2HV2A 4WWVA 2QMLA 4U5YA 2VQYA 5EC4A 1HDUA 1QSNA 1VHOA 3GB0A 4YU9A 4ZY2A 3DSBA 1ZG7A 4NXYA 5CBMA 3NH5A 3D2PA 4LUAA 4UFXA 3PB8X 4H89A 4QC6A 8CPAA 5LYLA 3KASA 2FVGA 3LD2A 5K8PA 4ORFA 4UEZA 4FD6A 5K8MA 2ZEMA 3T90A 2J8NA 4CGLA 3D67A 4RI1A 4KUAA 2B5GB 1LRZA 1IOIA 1Z8TA 1YLEA 3BHXA 1K4JA 4FWUA 4M6IA 1BLLE 1S60A 1Q2CA 3D4UA 4UCMA 1WK4A 1CM0A 1ELLP 3IIBA 1XF8A 4UCNA 4E2AA 5ISVA 4A2ZA 4CPAA 1H8LA 3FB3A 5ELYA 4A33A 1QSTA 3IO1A 3PFOA 2FCKA 3KKWA 3DDDA 4PSWA 4X2TA 4UEFA 4QB9A 2Q4ZA 2WUUA 5KTCA 1YX0A 3QB8A 5F49A 4PSXA 5DWNA 1A2ZA 1CBXA 3RNZA 2J8MA 3S6GA 4XNHC 4AXVA 2PJCA 3P2HA 4FBEA 3RZAA 3IJ3A 2Z3LA 5HH1A 2D4PA 4IAVA 4B13A 1QQ9A 5G1ZA 4F9UA 1IYLA 2CTCA 1V0CA 4BINA 1Z9UA 1KUVA 4C2ZA 4JYWA 3RO0A 2G0BA 2EK8A 3GY9A 4A31A 2BL1A 2G3AA 3NE7A 4JJXA 4KSIA 4XPDC 4A30A 4NGMA 4EWTA 3JUWA 3RBUA 4BBHA 2EUIA 2X7BA 4IUSA 4UA3A 3UY5A 4M3SA 3ZZIA 2B4BA 4MY3A 4OMEA 3FEDA 3PB4X 4DNCA 1RXTA 4YWYA 3CXSA 1IYKA 2YNCA 4M6GA 4OIDA 1AMPA 5J8FA 2QVPA 3TO9A 2C6CA 1UWYA 1XRYA 3WR7A 4PK2A 1DE4C 2CY2A 2AJ6A 2B4DB 3FYNA 3LACA 3D7GA 3B2YA 4MXUA 2EWBA 1MK4A 2FS5A 1XFOA 3PGPA 1IIDA 4P4JA 3S9NA 2B4DA 4MFKA 2G3TA 4KOTA 3CDXA 4M85A 1ON0A 2PC1A 3EC4A 2R1IA 3LMSA 4YRHA 4KOUA 3OWCA 4OC3A 3PRTA 4LQGA 5H84A 4ZX8A 4QBJA 3FVLA 2CTBA 2B3UA 3R95A 4PXEA 3CPAA 4CYNA 2PVWA 3D7FA 3H8FA 5BWAB 2RC4A 3DR8A 2P6EA 4KLWA 1TXRA 2PJ9A 3IGRA 3PB7X 3SI2A 1ZG8A 3LODA 2HC9A 4P6YA 2RFHA 3EO4A 3NH8A 4ZGYB 4DUKA 4GXHA 5J1QA 2PRBA 3S6KA 3EFAA 3WC6A 1LFWA 1ZO0A 4JXRA 3B3WA 3KHZA 1TKFA 4F0XA 3DLJA 4A95A 4OKOA 2GLFA 4Z65A 5CNPA 4GM5A 4OAEA 3VATA 2Q7SA 4R3KA 3S6HA 3V7ZA 2WZNA 4JWPA 2Z3KA 4MY0A 1HEEA 4UF4A 2PE3A 5F46A 2BEIA 2OZHA 2ZEFA 4NEXA 2AFOA 5AG5A 3SJXA 4KORA 2P6FA 3HUVA 3JTKA 5HMNA 4P45A 3BI1A 4QVTA 2WSAA 1NE9A 2AE6A 3I9SA 1BOBA 2C27A 2FL4A 3IWGA 4FD4A 4UWIA 1XMBA 1OZPA 3MRUA 4OC5A 4ZX9A 4CAEA 1BAVA 2ZW5A 4NGPA 2Q4VA 5LRGA 3N5FA 1S7FA 1ZLHA 1R43A 1TF8A 1M4IA 2DPSA 3D68A 2PR8A 3JVNA 3FF3A 4R87A 4NF1A 2GREA 4PXCA 3IWWA 2ZEDA 4CAXA 5THWA 4MI4A 1Y7RA 4OC1A 4ZY1A 1CP6A 1LANA 2PJ3A 4K30A 2AFMA 4AVAA 1M4LA 4EVYA 1Y0RA 2ZEPA 4NCZA 1IB1E 4TNUA 3GKRA 2Q43A 2HQYA 4F9VA 3I1UA 4NGQA 2CF4A 3WT4A 3QNVA 1Z8WA 3SI0A 4ZY0A 5HVHA 2PJ7A 5AG4A 2ZOFA 2C1CA 3F5BA 2PJ5A 1Y0YA 4R8FA 4ZYQA 1M1DA 1R57A 3FJUA 3B35A 4Y49B 1KUXA 4MJ8A 3GUXA 2PQ8A 3S9MA 3W91A 2JBKA 4CAWA 5J8CA 2ZOGA 4NJRA 2BUEA 2PJAA 3NE8A 3ZJ0A 4L89A 1TF9A 3FXTA 4W9YA 1AUGA 4MFZA 4II9A 4B11A 1P4NA 3B3CA 3TOAA 3W6SA 4AVCA 4B5OA 4G1PA 5G21A 2CIJA 4FD5A 2HUZA 1GYTA 2VXKA 5IV0A 4JZ0A 4R76A 1N71A 3FX6A 4Y49C 2V8GA 4RUHA 2CXAA 2OB0A 3IC1A 4PV6A 2F8HA 2AFSA 2H5MA 3IWEA 2J8RA 2OU2A 4B5PA 5LRKA 4YFJA 3G8WA 1Z8XA 4UFVA 3CXQA 5JH9A 4HPSA 3R96A 4NGRA 3TE4A 1Z2LA 5LYIA 1YGHA 4HKFA 4MFPA 2G9DA 4P4BA 1F2PA 3CZXA 4WJBA 4UWJA 3PEIA 1IGBA 4HNWB 3SHPA 2JEWA 2YNEA 1CG2A 2PCUA 3P2FA 5G20A 4C7HA 2ZW4A 2PIYA 4CGPA 4KOSA 4J3GA 2OH1A 4Q7AA 3SJEA 1P0HA 2Q0YA 4AG9A 4F6AA 5D29A 4U9ZA 3FH4A 2IJZA 1ELMP 2VI7A 1B6BA 1FY7A 2PJBA 2D4OA 4KZTA 1CP7A 1PU9A 1QSMA 3TTHA 3D2MA 3TO6A 2XEFA 3KZWA 6CPAA 3TX8A 1S7LA 3WABA 4Q36A 4LX9A 4IF5A 5CPAA 3SXOA 3WC5A 2J9AA 1KZFA 4F0YA 2V77A 4UIAA 5F48A 3GLJA 4KLVA 2GLJA 2PDOA 1LOKA 3KI9A 4KSFA 2V8DA 2K5TA 3TCVA 4TWEA 1CX8A 3BLNA
chains in the Genus database with same CATH topology
4KVOE 2BSWA 2WPWA 1S7KA 1MJBA 1GHEA 2FIWA 5C82A 5A27A 2R7HA 2Q7BA 5G22A 3R9EA 1I21A 3F0AA 4KOVA 4R9MA 5AG7A 1MJAA 2I79A 2QIRA 5A28A 4GS4A 4H6UA 5AGEA 2VBQA 3SXNA 1Q2YA 2Q04A 2I00A 4KOYA 4MFJA 1NSLA 3QAHA 2EVNA 4KUBA 3CXPA 5GCNA 4KOWA 3RYOA 3TFYA 5IB0A 4CYPA 4MBUA 4CGOA 2NMTA 4UCPA 3BJ8A 3G3SA 1B87A 2IL4A 2OZUA 3EXNA 2CNSA 4E8OA 2Q44A 3TT2A 1XE4A 3D3SA 2JDDA 1Y9WA 4B5PB 3H5ZA 4R3LA 3FNCA 3S6FA 4HNXB 1MJ9A 2JDCA 5E96A 2ZPAA 2OZGA 1YVOA 1I12A 4ZBGA 3VWEA 1M4DA 2JLMA 1YVKA 2WPXA 4XPDB 5IX3A 1S3ZA 4B12A 4MFQA 2O28A 4CYQA 3I3GA 3BJ7A 3E0KA 4QUSA 4UBRA 3IU2A 3DNSA 2ATRA 3ZZIA 4AB7A 3EY5A 4B5OA 4AG7A 1S7NA 4CRZB 4PK3A 4NSQA 3K9UA 1J4JA 3V8IA 1CJWA 4CGMA 4YGOA 5FVJA 5JQ4A 4E0AA 3GYAA 2FXFA 4AVBA 4FD7A 4CYOA 1UFHA 2PR1A 2FE7A 4C68A 5JPHA 4JXQA 2ZXVA 3DR6A 2Z3NA 4C7IA 2F5IA 1PUAA 2KCWA 1QSRA 3R9GA 4XPKA 3R9FA 4JD6A 1S5KA 4CS0B 3W6XA 4MFLA 2VZZA 2ZW7A 2P0WA 4OADA 5C88A 1RO5A 2Z0ZA 1XEBA 4ONUA 2Y0MA 2JEVA 2B58A 2REEA 2VEZA 5F47A 5I0CA 2GIVA 4RS2A 2ZW6A 2YNDA 5H86A 2P6GA 4KOXA 2QECA 3FBUA 2Z3PA 4CRYB 4C2XA 4H6ZA 1KUYA 3D8PA 1M4GA 4OLLA 4UFWA 1QSOA 3MGDA 1I1DA 2VZYA 4X5KA 1XIXA 2DXQA 3T9YA 1L0CA 4JLYA 2DPTA 1Z4RA 4MHDA 1SQHA 1YR0A 4XNHB 4U9YA 4Q38A 4A32A 4C2YA 4I49A 4CAVA 3R1KA 2B3VA 2FIAA 2GE3A 3IU1A 5HH1A 4L8AA 4KVXA 1TIQA 2Z3MA 4XPLA 1YREA 1Y9KA 1BO4A 3C26A 1WWZA 2Z10A 1M44A 3PP9A 2ARHA 2CNMA 1YK3A 2FSRA 5KTDA 1IICA 4KS9A 3N7ZA 3TO7A 2R98A 2A4NA 4KSAA 2Z3OA 5AG6A 2CNTA 5KTAA 4BMHA 1VKCA 3FIXA 1U6MA 1Z4EA 2YNCC 2Z11A 5DWMA 4B10A 1VHSA 3H4QA 2FT0A 4HNYB 3A9LA 3TOBA 1NMTA 3PZJA 2PSWA 2B5GA 4CGNA 1XMTA 4KVME 3FRMA 2REFA 3VWDA 2R8VA 5EBVA 4CAFA 2YGWA 4R57A 3F8KA 3B8GA 2Q4YA 1Q2DA 2GANA 2HV2A 2QMLA 4U5YA 2VQYA 5EC4A 1QSNA 4C2ZA 3DSBA 4NXYA 4UFXA 3D2PA 4LUAA 4H89A 4QC6A 3LD2A 4ORFA 4FD6A 3T90A 2J8NA 4CGLA 4RI1A 4KUAA 2B5GB 1LRZA 1YLEA 1K4JA 1S60A 1Q2CA 4UCMA 1WK4A 1CM0A 1XF8A 4UCNA 4E2AA 5ISVA 4A2ZA 3FB3A 4A33A 1QSTA 2FCKA 3KKWA 3DDDA 4PSWA 4QB9A 5KTCA 2WUUA 1YX0A 3QB8A 5F49A 4PSXA 5DWNA 3S6GA 2J8MA 4XNHC 3P2HA 2Z3LA 2D4PA 4B13A 5G1ZA 1IYLA 1V0CA 1Z9UA 1KUVA 2G0BA 3GY9A 4A31A 2BL1A 2G3AA 3NE7A 4JJXA 4XPDC 4A30A 3JUWA 4BBHA 2EUIA 2X7BA 4IUSA 4UA3A 3UY5A 4M3SA 2B4BA 4MY3A 4DNCA 1RXTA 3CXSA 1IYKA 2YNCA 5J8FA 3TO9A 3WR7A 4PK2A 2CY2A 2AJ6A 2B4DB 3FYNA 1MK4A 2FS5A 3PGPA 1IIDA 2B4DA 4MFKA 2G3TA 4KOTA 4M85A 1ON0A 2PC1A 3EC4A 2R1IA 4YRHA 5H84A 4KOUA 3OWCA 4QBJA 2B3UA 3R95A 4CYNA 5BWAB 2RC4A 3DR8A 2P6EA 4KLWA 3IGRA 3LODA 4ZGYB 3EO4A 2PRBA 3S6KA 3EFAA 1ZO0A 4JXRA 4F0XA 4A95A 5CNPA 4OAEA 4R3KA 3S6HA 4JWPA 2Z3KA 4MY0A 5F46A 2BEIA 2OZHA 4NEXA 5AG5A 4KORA 2P6FA 3JTKA 5HMNA 4QVTA 2WSAA 1NE9A 2AE6A 3I9SA 1BOBA 2C27A 2FL4A 3IWGA 4FD4A 4UWIA 1OZPA 4CAEA 2ZW5A 2Q4VA 1S7FA 1M4IA 2DPSA 3JVNA 2PR8A 4R87A 4NF1A 4CAXA 4MI4A 1Y7RA 4K30A 4AVAA 4EVYA 4NCZA 1IB1E 3GKRA 2HQYA 5AG4A 3F5BA 1M1DA 1R57A 4Y49B 1KUXA 4MJ8A 3W91A 2PQ8A 4CAWA 5J8CA 2BUEA 3ZJ0A 4L89A 3FXTA 4II9A 4MFZA 4B11A 1P4NA 3TOAA 3W6SA 4AVCA 5G21A 4FD5A 2HUZA 2VXKA 5IV0A 1N71A 4Y49C 2CXAA 2OB0A 4PV6A 2H5MA 3IWEA 4B5PA 2J8RA 2OU2A 4YFJA 3G8WA 4UFVA 3CXQA 3R96A 3TE4A 1YGHA 4HKFA 4MFPA 4UWJA 4HNWB 3SHPA 2YNEA 3P2FA 5G20A 4C7HA 2ZW4A 4CGPA 4KOSA 4J3GA 2OH1A 1P0HA 2Q0YA 4AG9A 4F6AA 4U9ZA 2VI7A 1B6BA 1FY7A 4KZTA 2D4OA 1PU9A 1QSMA 3TTHA 3D2MA 3TO6A 1S7LA 4Q36A 4LX9A 4IF5A 3SXOA 1KZFA 4F0YA 5F48A 4KLVA 2PDOA 4KSFA 2K5TA 3TCVA 4B14A 3BLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVO E;  2BSW A;  2WPW A;  1S7K A;  1MJB A;  1GHE A;  2FIW A;  5C82 A;  2R7H A;  2Q7B A;  3R9E A;  1I21 A;  3F0A A;  4R9M A;  4KOV A;  1MJA A;  2I79 A;  2QIR A;  4GS4 A;  4H6U A;  2VBQ A;  3SXN A;  1Q2Y A;  2Q04 A;  2I00 A;  4KOY A;  1NSL A;  3QAH A;  2EVN A;  4KUB A;  3CXP A;  5GCN A;  4KOW A;  3RYO A;  3TFY A;  5IB0 A;  4MBU A;  2NMT A;  3BJ8 A;  3G3S A;  1B87 A;  2IL4 A;  2OZU A;  3EXN A;  2CNS A;  4E8O A;  2Q44 A;  3TT2 A;  1XE4 A;  3D3S A;  2JDD A;  1Y9W A;  4B5P B;  4R3L A;  3FNC A;  3S6F A;  4HNX B;  1MJ9 A;  2JDC A;  5E96 A;  2ZPA A;  2OZG A;  1YVO A;  1I12 A;  4ZBG A;  3VWE A;  1M4D A;  2JLM A;  1YVK A;  2WPX A;  4XPD B;  5IX3 A;  1S3Z A;  2O28 A;  3I3G A;  3BJ7 A;  3E0K A;  4QUS A;  4UBR A;  3ZZI A;  3DNS A;  2ATR A;  4AB7 A;  4B5O A;  3EY5 A;  4AG7 A;  1S7N A;  4CRZ B;  4PK3 A;  4NSQ A;  3K9U A;  1J4J A;  3V8I A;  1CJW A;  4YGO A;  5FVJ A;  5JQ4 A;  4E0A A;  3GYA A;  2FXF A;  4AVB A;  4FD7 A;  1UFH A;  2PR1 A;  2FE7 A;  5JPH A;  4JXQ A;  2ZXV A;  3DR6 A;  2F5I A;  1PUA A;  2KCW A;  1QSR A;  3R9G A;  4XPK A;  3R9F A;  4JD6 A;  1S5K A;  4CS0 B;  3W6X A;  2VZZ A;  2ZW7 A;  2P0W A;  4OAD A;  5C88 A;  1RO5 A;  2Z0Z A;  1XEB A;  4ONU A;  2Y0M A;  2JEV A;  2B58 A;  2REE A;  2VEZ A;  5F47 A;  5I0C A;  2GIV A;  4RS2 A;  2ZW6 A;  5H86 A;  2P6G A;  4KOX A;  2QEC A;  3FBU A;  4CRY B;  4H6Z A;  1KUY A;  3D8P A;  1M4G A;  4OLL A;  1QSO A;  3MGD A;  1I1D A;  2VZY A;  4X5K A;  1XIX A;  2DXQ A;  3T9Y A;  1L0C A;  4JLY A;  1Z4R A;  4MHD A;  1SQH A;  1YR0 A;  4XNH B;  4U9Y A;  4I49 A;  4CAV A;  3R1K A;  2B3V A;  2FIA A;  2GE3 A;  5HH1 A;  4L8A A;  4KVX A;  1TIQ A;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  3C26 A;  1WWZ A;  2Z10 A;  1M44 A;  3PP9 A;  2ARH A;  2CNM A;  1YK3 A;  2FSR A;  5KTD A;  1IIC A;  3N7Z A;  3TO7 A;  2R98 A;  2A4N A;  2CNT A;  5KTA A;  4BMH A;  1VKC A;  3FIX A;  1U6M A;  1Z4E A;  2Z11 A;  5DWM A;  1VHS A;  3H4Q A;  2FT0 A;  4HNY B;  3TOB A;  1NMT A;  3PZJ A;  2PSW A;  2B5G A;  1XMT A;  4KVM E;  3FRM A;  2REF A;  3VWD A;  2R8V A;  5EBV A;  4R57 A;  3F8K A;  3B8G A;  2Q4Y A;  1Q2D A;  2GAN A;  2HV2 A;  2QML A;  4U5Y A;  2VQY A;  5EC4 A;  1QSN A;  3DSB A;  4NXY A;  3D2P A;  4LUA A;  4H89 A;  4QC6 A;  3LD2 A;  4ORF A;  4FD6 A;  3T90 A;  2J8N A;  4RI1 A;  4KUA A;  2B5G B;  1LRZ A;  1YLE A;  1K4J A;  1S60 A;  1Q2C A;  1WK4 A;  1CM0 A;  1XF8 A;  4E2A A;  5ISV A;  3FB3 A;  1QST A;  2FCK A;  3KKW A;  3DDD A;  4PSW A;  4QB9 A;  5KTC A;  1YX0 A;  3QB8 A;  5F49 A;  4PSX A;  5DWN A;  3S6G A;  2J8M A;  4XNH C;  3P2H A;  2D4P A;  1IYL A;  1V0C A;  1Z9U A;  1KUV A;  2G0B A;  3GY9 A;  2BL1 A;  2G3A A;  3NE7 A;  4JJX A;  4XPD C;  3JUW A;  2EUI A;  2X7B A;  4IUS A;  4UA3 A;  3UY5 A;  4M3S A;  2B4B A;  4MY3 A;  4DNC A;  1RXT A;  3CXS A;  1IYK A;  5J8F A;  3TO9 A;  3WR7 A;  4PK2 A;  2CY2 A;  2AJ6 A;  2B4D B;  3FYN A;  1MK4 A;  2FS5 A;  3PGP A;  1IID A;  2B4D A;  2G3T A;  4KOT A;  4M85 A;  1ON0 A;  2PC1 A;  3EC4 A;  2R1I A;  4YRH A;  5H84 A;  4KOU A;  3OWC A;  4QBJ A;  2B3U A;  3R95 A;  2RC4 A;  3DR8 A;  2P6E A;  4KLW A;  3IGR A;  3LOD A;  3EO4 A;  2PRB A;  3S6K A;  3EFA A;  4JXR A;  5CNP A;  4OAE A;  4R3K A;  3S6H A;  4JWP A;  4MY0 A;  5F46 A;  2BEI A;  2OZH A;  4NEX A;  4KOR A;  2P6F A;  5HMN A;  4QVT A;  1NE9 A;  2AE6 A;  3I9S A;  1BOB A;  2C27 A;  2FL4 A;  3IWG A;  4FD4 A;  4UWI A;  1OZP A;  2ZW5 A;  2Q4V A;  1S7F A;  1M4I A;  3JVN A;  2PR8 A;  4R87 A;  4NF1 A;  4CAX A;  4MI4 A;  1Y7R A;  4K30 A;  4AVA A;  4EVY A;  4NCZ A;  1IB1 E;  3GKR A;  2HQY A;  3F5B A;  1M1D A;  1R57 A;  4Y49 B;  1KUX A;  4MJ8 A;  3W91 A;  2PQ8 A;  4CAW A;  5J8C A;  2BUE A;  3ZJ0 A;  4L89 A;  3FXT A;  4II9 A;  1P4N A;  3TOA A;  3W6S A;  4AVC A;  4FD5 A;  2HUZ A;  2VXK A;  5IV0 A;  1N71 A;  4Y49 C;  2OB0 A;  4PV6 A;  2H5M A;  4B5P A;  2J8R A;  2OU2 A;  4YFJ A;  3G8W A;  3CXQ A;  3R96 A;  3TE4 A;  1YGH A;  4HKF A;  4UWJ A;  4HNW B;  3SHP A;  3P2F A;  2ZW4 A;  4KOS A;  4J3G A;  2OH1 A;  1P0H A;  2Q0Y A;  4AG9 A;  4F6A A;  4U9Z A;  2VI7 A;  1B6B A;  1FY7 A;  4KZT A;  2D4O A;  1PU9 A;  1QSM A;  3TTH A;  3D2M A;  3TO6 A;  1S7L A;  4LX9 A;  4IF5 A;  3SXO A;  1KZF A;  4F0Y A;  5F48 A;  4KLV A;  2PDO A;  2K5T A;  3TCV A;  3BLN A; 
#chains in the Genus database with same CATH topology
 4KVO E;  4MCP A;  2QYV A;  4IHM A;  2BSW A;  2WPW A;  2ZEE A;  1S7K A;  4IK2 A;  4NGN A;  1MJB A;  2PJ0 A;  1VHE A;  5K8O A;  1GHE A;  2FIW A;  5C82 A;  5A27 A;  2R7H A;  2Q7B A;  1X10 A;  2RB7 A;  4ZI6 A;  5G22 A;  3R9E A;  1I21 A;  2BO9 A;  3F0A A;  4KOV A;  4R9M A;  1EE3 P;  2EK9 A;  5AG7 A;  1MJA A;  2I79 A;  2ZEH A;  2C6P A;  2QIR A;  1ARL A;  4GS4 A;  3RAM A;  5A28 A;  4H6U A;  5AGE A;  2VBQ A;  3SXN A;  1Q2Y A;  2Q04 A;  5I4M A;  2I00 A;  4KOY A;  4MFJ A;  4P10 A;  1NSL A;  3V38 A;  5EMI A;  2ABZ A;  3KQZ A;  3QAH A;  2EVN A;  4KUB A;  4RN7 A;  3CXP A;  5GCN A;  4DYO A;  3KL9 A;  4KOW A;  1KWM A;  3RYO A;  3TFY A;  5IB0 A;  4CYP A;  4MBU A;  4CGO A;  2NMT A;  2Q51 A;  2JBJ A;  4UCP A;  4NGS A;  2O53 A;  1DTD A;  3BJ8 A;  3PFE A;  3G3S A;  4NFR A;  3PB9 X;  2IMO A;  3KGQ A;  1B87 A;  5HVF A;  2IL4 A;  2OZU A;  3EXN A;  2CNS A;  1ARM A;  4X3R A;  2PRQ A;  4E8O A;  1TKH A;  2Q44 A;  2ZEG A;  3LWU A;  2VL1 A;  1QMU A;  3PBE A;  3TT2 A;  1XE4 A;  3D3S A;  2JDD A;  1Y9W A;  4B5P B;  3H5Z A;  4R3L A;  2AFX A;  3FNC A;  3S6F A;  3B3S A;  4HNX B;  1MJ9 A;  2JDC A;  5E96 A;  3VAR A;  2ZPA A;  2NSM A;  2OZG A;  1YVO A;  3PBB A;  1I12 A;  4ZBG A;  3VWE A;  1M4D A;  2JLM A;  1F57 A;  2GFQ A;  1YVK A;  5DS0 A;  5K8N A;  2WPX A;  4XPD B;  5IX3 A;  1S3Z A;  4BD9 A;  4B12 A;  4MFQ A;  2O28 A;  4CYQ A;  1IOF A;  5D8N A;  1YQE A;  3I3G A;  3BJ7 A;  3E0K A;  4QUS A;  3NFZ A;  3IU2 A;  3DNS A;  2ATR A;  4UBR A;  4R6T A;  3EY5 A;  4AB7 A;  4AG7 A;  4MRI A;  5LYD A;  5JM6 A;  1S7N A;  5JGF A;  1FT7 A;  1YLO A;  4CRZ B;  4PK3 A;  4NSQ A;  3K9U A;  4K3N A;  1J4J A;  5LYF A;  1X12 A;  4M6H A;  1YW4 A;  3IFE A;  3V8I A;  2ANP A;  2QJ8 A;  2BCO A;  3SJG A;  1Z5R A;  3KR5 A;  1CJW A;  4CGM A;  1OBR A;  4YGO A;  5FVJ A;  5JQ4 A;  4E0A A;  3GYA A;  2FXF A;  4R7M A;  4AVB A;  3D66 A;  1CPX A;  2ZEN A;  4FD7 A;  4CYO A;  1UFH A;  2PR1 A;  1ZG9 A;  2OR4 A;  4B6Z A;  2FE7 A;  4C68 A;  5JPH A;  3TC8 A;  4JXQ A;  2ZXV A;  3DR6 A;  2Z3N A;  4C7I A;  1LAP A;  2F5I A;  3CT9 A;  3H8E A;  3QAY A;  3D7H A;  1PUA A;  1IU8 A;  4UIB A;  3SI1 A;  3WC7 A;  2KCW A;  4O23 A;  1FNO A;  1QSR A;  3GIU A;  1YW6 A;  3R9G A;  4XPK A;  3R9F A;  2AFZ A;  4JD6 A;  1S5K A;  4CS0 B;  3W6X A;  4MFL A;  2EO8 A;  2VZZ A;  2ZW7 A;  2PVV A;  2P0W A;  2POK A;  3CPX A;  4P44 A;  4OAD A;  5C88 A;  1Y7E A;  1RO5 A;  1ZLI A;  2PIZ A;  2Z0Z A;  2ODF A;  1XEB A;  3HLP A;  2PJ2 A;  3ISX A;  1XBU A;  1F2O A;  4OC0 A;  3K9T A;  4OC4 A;  4FAI A;  4ONU A;  2Y0M A;  4P4I A;  2XEJ A;  2JEV A;  1BPM A;  2B58 A;  2REE A;  2VEZ A;  2BOA A;  4PQA A;  5F09 A;  5F47 A;  5I0C A;  2DF5 A;  2O4H A;  4MHZ A;  1JWQ A;  1LAM A;  2GIV A;  4RS2 A;  2ZW6 A;  1LCP A;  2YND A;  5H86 A;  2P6G A;  3BI0 A;  5HVG A;  4KOX A;  2QEC A;  3FBU A;  3KQX A;  2F7V A;  2IQ6 A;  4EFD A;  3KHX A;  2Z3P A;  4OC2 A;  3VH9 A;  1BPN A;  2ZEL A;  3FEE A;  4CRY B;  1TKJ A;  1PYT B;  4C2X A;  3DGV A;  4H6Z A;  7CPA A;  1KUY A;  3D8P A;  2C6G A;  4OP4 A;  4X8I A;  1M4G A;  2V8V A;  4OLL A;  1RTQ A;  4UFW A;  1AYE A;  1QSO A;  3MGD A;  1I1D A;  2VZY A;  4X5K A;  1XIX A;  2DXQ A;  2PJ8 A;  2XEI A;  3T9Y A;  5HXD A;  1L0C A;  5LRJ A;  3T8W A;  2NYQ A;  4JLY A;  2HB6 A;  2DPT A;  1Z4R A;  4A37 A;  4MHD A;  1SQH A;  1YR0 A;  4P4E A;  4P4F A;  4XNH B;  4U9Y A;  2V8H A;  4Q38 A;  4PXB A;  4A32 A;  4C2Y A;  4I49 A;  4A39 A;  1NSA A;  4CAV A;  3R1K A;  3BXM A;  3PB6 X;  2B3V A;  2FIA A;  2GE3 A;  3IU1 A;  3H8G A;  3L2N A;  3B7I A;  4L8A A;  2PJ4 A;  3NH4 A;  4KVX A;  1TIQ A;  4OIW A;  4P4D A;  2Z3M A;  2AFU A;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  2WYR A;  1XJO A;  3C26 A;  3FEC A;  1WWZ A;  2Z10 A;  3IEH A;  4NGT A;  1M44 A;  1XOV A;  3PP9 A;  3K2K A;  2ARH A;  2CNM A;  1YK3 A;  4PPZ A;  2FSR A;  5KTD A;  1IIC A;  4A38 A;  4MCR A;  2XEG A;  3N7Z A;  4KS9 A;  3TO7 A;  2R98 A;  1VGY A;  1HDQ A;  2A4N A;  4KSA A;  2Z3O A;  5AG6 A;  2CNT A;  1VIX A;  3S9L A;  1PCA A;  4NJQ A;  2OOT A;  5KTA A;  1Q7L A;  4BMH A;  1VKC A;  2DEA A;  3FIX A;  3NA6 A;  1U6M A;  3SJF A;  1Z4E A;  2YNC C;  3ISZ A;  4B14 A;  1Z8L A;  4F8Z A;  2Z11 A;  5DWM A;  2ZEO A;  2GU2 A;  3B3T A;  4MHN A;  4MMO A;  4EME A;  3D7D A;  1JQG A;  4B10 A;  1VHS A;  3H4Q A;  2FT0 A;  1R3N A;  3A9L A;  4HNY B;  3TOB A;  4DJL A;  4H2K A;  4LQ6 A;  1NMT A;  1YME A;  2PJ6 A;  4ONW A;  4PXD A;  3PZJ A;  2PSW A;  2B5G A;  4CGN A;  4FUU A;  1YSJ A;  3JRU A;  3FMC A;  1XMT A;  3MN8 A;  4KVM E;  4MCQ A;  3FRM A;  2REF A;  4MHP A;  2R8V A;  3VWD A;  5EBV A;  4CAF A;  4MCS A;  1IY7 A;  3B3V A;  5IB9 A;  2YGW A;  4R57 A;  3F8K A;  3B8G A;  4A94 A;  2EBJ A;  2Q4Y A;  4MHY A;  1Q2D A;  2I3C A;  1CPS A;  2AFW A;  2PJ1 A;  2GAN A;  3KR4 A;  4UEE A;  2HV2 A;  4WWV A;  2QML A;  4U5Y A;  2VQY A;  5EC4 A;  1HDU A;  1QSN A;  1VHO A;  3GB0 A;  4YU9 A;  4ZY2 A;  3DSB A;  1ZG7 A;  4NXY A;  5CBM A;  3NH5 A;  3D2P A;  4LUA A;  4UFX A;  3PB8 X;  4H89 A;  4QC6 A;  8CPA A;  5LYL A;  3KAS A;  2FVG A;  3LD2 A;  5K8P A;  4ORF A;  4UEZ A;  4FD6 A;  5K8M A;  2ZEM A;  3T90 A;  2J8N A;  4CGL A;  3D67 A;  4RI1 A;  4KUA A;  2B5G B;  1LRZ A;  1IOI A;  1Z8T A;  1YLE A;  3BHX A;  1K4J A;  4FWU A;  4M6I A;  1BLL E;  1S60 A;  1Q2C A;  3D4U A;  4UCM A;  1WK4 A;  1CM0 A;  1ELL P;  3IIB A;  1XF8 A;  4UCN A;  4E2A A;  5ISV A;  4A2Z A;  4CPA A;  1H8L A;  3FB3 A;  5ELY A;  4A33 A;  1QST A;  3IO1 A;  3PFO A;  2FCK A;  3KKW A;  3DDD A;  4PSW A;  4X2T A;  4UEF A;  4QB9 A;  2Q4Z A;  2WUU A;  5KTC A;  1YX0 A;  3QB8 A;  5F49 A;  4PSX A;  5DWN A;  1A2Z A;  1CBX A;  3RNZ A;  2J8M A;  3S6G A;  4XNH C;  4AXV A;  2PJC A;  3P2H A;  4FBE A;  3RZA A;  3IJ3 A;  2Z3L A;  5HH1 A;  2D4P A;  4IAV A;  4B13 A;  1QQ9 A;  5G1Z A;  4F9U A;  1IYL A;  2CTC A;  1V0C A;  4BIN A;  1Z9U A;  1KUV A;  4C2Z A;  4JYW A;  3RO0 A;  2G0B A;  2EK8 A;  3GY9 A;  4A31 A;  2BL1 A;  2G3A A;  3NE7 A;  4JJX A;  4KSI A;  4XPD C;  4A30 A;  4NGM A;  4EWT A;  3JUW A;  3RBU A;  4BBH A;  2EUI A;  2X7B A;  4IUS A;  4UA3 A;  3UY5 A;  4M3S A;  3ZZI A;  2B4B A;  4MY3 A;  4OME A;  3FED A;  3PB4 X;  4DNC A;  1RXT A;  4YWY A;  3CXS A;  1IYK A;  2YNC A;  4M6G A;  4OID A;  1AMP A;  5J8F A;  2QVP A;  3TO9 A;  2C6C A;  1UWY A;  1XRY A;  3WR7 A;  4PK2 A;  1DE4 C;  2CY2 A;  2AJ6 A;  2B4D B;  3FYN A;  3LAC A;  3D7G A;  3B2Y A;  4MXU A;  2EWB A;  1MK4 A;  2FS5 A;  1XFO A;  3PGP A;  1IID A;  4P4J A;  3S9N A;  2B4D A;  4MFK A;  2G3T A;  4KOT A;  3CDX A;  4M85 A;  1ON0 A;  2PC1 A;  3EC4 A;  2R1I A;  3LMS A;  4YRH A;  4KOU A;  3OWC A;  4OC3 A;  3PRT A;  4LQG A;  5H84 A;  4ZX8 A;  4QBJ A;  3FVL A;  2CTB A;  2B3U A;  3R95 A;  4PXE A;  3CPA A;  4CYN A;  2PVW A;  3D7F A;  3H8F A;  5BWA B;  2RC4 A;  3DR8 A;  2P6E A;  4KLW A;  1TXR A;  2PJ9 A;  3IGR A;  3PB7 X;  3SI2 A;  1ZG8 A;  3LOD A;  2HC9 A;  4P6Y A;  2RFH A;  3EO4 A;  3NH8 A;  4ZGY B;  4DUK A;  4GXH A;  5J1Q A;  2PRB A;  3S6K A;  3EFA A;  3WC6 A;  1LFW A;  1ZO0 A;  4JXR A;  3B3W A;  3KHZ A;  1TKF A;  4F0X A;  3DLJ A;  4A95 A;  4OKO A;  2GLF A;  4Z65 A;  5CNP A;  4GM5 A;  4OAE A;  3VAT A;  2Q7S A;  4R3K A;  3S6H A;  3V7Z A;  2WZN A;  4JWP A;  2Z3K A;  4MY0 A;  1HEE A;  4UF4 A;  2PE3 A;  5F46 A;  2BEI A;  2OZH A;  2ZEF A;  4NEX A;  2AFO A;  5AG5 A;  3SJX A;  4KOR A;  2P6F A;  3HUV A;  3JTK A;  5HMN A;  4P45 A;  3BI1 A;  4QVT A;  2WSA A;  1NE9 A;  2AE6 A;  3I9S A;  1BOB A;  2C27 A;  2FL4 A;  3IWG A;  4FD4 A;  4UWI A;  1XMB A;  1OZP A;  3MRU A;  4OC5 A;  4ZX9 A;  4CAE A;  1BAV A;  2ZW5 A;  4NGP A;  2Q4V A;  5LRG A;  3N5F A;  1S7F A;  1ZLH A;  1R43 A;  1TF8 A;  1M4I A;  2DPS A;  3D68 A;  2PR8 A;  3JVN A;  3FF3 A;  4R87 A;  4NF1 A;  2GRE A;  4PXC A;  3IWW A;  2ZED A;  4CAX A;  5THW A;  4MI4 A;  1Y7R A;  4OC1 A;  4ZY1 A;  1CP6 A;  1LAN A;  2PJ3 A;  4K30 A;  2AFM A;  4AVA A;  1M4L A;  4EVY A;  1Y0R A;  2ZEP A;  4NCZ A;  1IB1 E;  4TNU A;  3GKR A;  2Q43 A;  2HQY A;  4F9V A;  3I1U A;  4NGQ A;  2CF4 A;  3WT4 A;  3QNV A;  1Z8W A;  3SI0 A;  4ZY0 A;  5HVH A;  2PJ7 A;  5AG4 A;  2ZOF A;  2C1C A;  3F5B A;  2PJ5 A;  1Y0Y A;  4R8F A;  4ZYQ A;  1M1D A;  1R57 A;  3FJU A;  3B35 A;  4Y49 B;  1KUX A;  4MJ8 A;  3GUX A;  2PQ8 A;  3S9M A;  3W91 A;  2JBK A;  4CAW A;  5J8C A;  2ZOG A;  4NJR A;  2BUE A;  2PJA A;  3NE8 A;  3ZJ0 A;  4L89 A;  1TF9 A;  3FXT A;  4W9Y A;  1AUG A;  4MFZ A;  4II9 A;  4B11 A;  1P4N A;  3B3C A;  3TOA A;  3W6S A;  4AVC A;  4B5O A;  4G1P A;  5G21 A;  2CIJ A;  4FD5 A;  2HUZ A;  1GYT A;  2VXK A;  5IV0 A;  4JZ0 A;  4R76 A;  1N71 A;  3FX6 A;  4Y49 C;  2V8G A;  4RUH A;  2CXA A;  2OB0 A;  3IC1 A;  4PV6 A;  2F8H A;  2AFS A;  2H5M A;  3IWE A;  2J8R A;  2OU2 A;  4B5P A;  5LRK A;  4YFJ A;  3G8W A;  1Z8X A;  4UFV A;  3CXQ A;  5JH9 A;  4HPS A;  3R96 A;  4NGR A;  3TE4 A;  1Z2L A;  5LYI A;  1YGH A;  4HKF A;  4MFP A;  2G9D A;  4P4B A;  1F2P A;  3CZX A;  4WJB A;  4UWJ A;  3PEI A;  1IGB A;  4HNW B;  3SHP A;  2JEW A;  2YNE A;  1CG2 A;  2PCU A;  3P2F A;  5G20 A;  4C7H A;  2ZW4 A;  2PIY A;  4CGP A;  4KOS A;  4J3G A;  2OH1 A;  4Q7A A;  3SJE A;  1P0H A;  2Q0Y A;  4AG9 A;  4F6A A;  5D29 A;  4U9Z A;  3FH4 A;  2IJZ A;  1ELM P;  2VI7 A;  1B6B A;  1FY7 A;  2PJB A;  2D4O A;  4KZT A;  1CP7 A;  1PU9 A;  1QSM A;  3TTH A;  3D2M A;  3TO6 A;  2XEF A;  3KZW A;  6CPA A;  3TX8 A;  1S7L A;  3WAB A;  4Q36 A;  4LX9 A;  4IF5 A;  5CPA A;  3SXO A;  3WC5 A;  2J9A A;  1KZF A;  4F0Y A;  2V77 A;  4UIA A;  5F48 A;  3GLJ A;  4KLV A;  2GLJ A;  2PDO A;  1LOK A;  3KI9 A;  4KSF A;  2V8D A;  2K5T A;  3TCV A;  4TWE A;  1CX8 A;  3BLN A; 
#chains in the Genus database with same CATH homology
 4KVO E;  2BSW A;  2WPW A;  1S7K A;  1MJB A;  1GHE A;  2FIW A;  5C82 A;  5A27 A;  2R7H A;  2Q7B A;  5G22 A;  3R9E A;  1I21 A;  3F0A A;  4KOV A;  4R9M A;  5AG7 A;  1MJA A;  2I79 A;  2QIR A;  5A28 A;  4GS4 A;  4H6U A;  5AGE A;  2VBQ A;  3SXN A;  1Q2Y A;  2Q04 A;  2I00 A;  4KOY A;  4MFJ A;  1NSL A;  3QAH A;  2EVN A;  4KUB A;  3CXP A;  5GCN A;  4KOW A;  3RYO A;  3TFY A;  5IB0 A;  4CYP A;  4MBU A;  4CGO A;  2NMT A;  4UCP A;  3BJ8 A;  3G3S A;  1B87 A;  2IL4 A;  2OZU A;  3EXN A;  2CNS A;  4E8O A;  2Q44 A;  3TT2 A;  1XE4 A;  3D3S A;  2JDD A;  1Y9W A;  4B5P B;  3H5Z A;  4R3L A;  3FNC A;  3S6F A;  4HNX B;  1MJ9 A;  2JDC A;  5E96 A;  2ZPA A;  2OZG A;  1YVO A;  1I12 A;  4ZBG A;  3VWE A;  1M4D A;  2JLM A;  1YVK A;  2WPX A;  4XPD B;  5IX3 A;  1S3Z A;  4B12 A;  4MFQ A;  2O28 A;  4CYQ A;  3I3G A;  3BJ7 A;  3E0K A;  4QUS A;  4UBR A;  3IU2 A;  3DNS A;  2ATR A;  3ZZI A;  4AB7 A;  3EY5 A;  4B5O A;  4AG7 A;  1S7N A;  4CRZ B;  4PK3 A;  4NSQ A;  3K9U A;  1J4J A;  3V8I A;  1CJW A;  4CGM A;  4YGO A;  5FVJ A;  5JQ4 A;  4E0A A;  3GYA A;  2FXF A;  4AVB A;  4FD7 A;  4CYO A;  1UFH A;  2PR1 A;  2FE7 A;  4C68 A;  5JPH A;  4JXQ A;  2ZXV A;  3DR6 A;  2Z3N A;  4C7I A;  2F5I A;  1PUA A;  2KCW A;  1QSR A;  3R9G A;  4XPK A;  3R9F A;  4JD6 A;  1S5K A;  4CS0 B;  3W6X A;  4MFL A;  2VZZ A;  2ZW7 A;  2P0W A;  4OAD A;  5C88 A;  1RO5 A;  2Z0Z A;  1XEB A;  4ONU A;  2Y0M A;  2JEV A;  2B58 A;  2REE A;  2VEZ A;  5F47 A;  5I0C A;  2GIV A;  4RS2 A;  2ZW6 A;  2YND A;  5H86 A;  2P6G A;  4KOX A;  2QEC A;  3FBU A;  2Z3P A;  4CRY B;  4C2X A;  4H6Z A;  1KUY A;  3D8P A;  1M4G A;  4OLL A;  4UFW A;  1QSO A;  3MGD A;  1I1D A;  2VZY A;  4X5K A;  1XIX A;  2DXQ A;  3T9Y A;  1L0C A;  4JLY A;  2DPT A;  1Z4R A;  4MHD A;  1SQH A;  1YR0 A;  4XNH B;  4U9Y A;  4Q38 A;  4A32 A;  4C2Y A;  4I49 A;  4CAV A;  3R1K A;  2B3V A;  2FIA A;  2GE3 A;  3IU1 A;  5HH1 A;  4L8A A;  4KVX A;  1TIQ A;  2Z3M A;  4XPL A;  1YRE A;  1Y9K A;  1BO4 A;  3C26 A;  1WWZ A;  2Z10 A;  1M44 A;  3PP9 A;  2ARH A;  2CNM A;  1YK3 A;  2FSR A;  5KTD A;  1IIC A;  4KS9 A;  3N7Z A;  3TO7 A;  2R98 A;  2A4N A;  4KSA A;  2Z3O A;  5AG6 A;  2CNT A;  5KTA A;  4BMH A;  1VKC A;  3FIX A;  1U6M A;  1Z4E A;  2YNC C;  2Z11 A;  5DWM A;  4B10 A;  1VHS A;  3H4Q A;  2FT0 A;  4HNY B;  3A9L A;  3TOB A;  1NMT A;  3PZJ A;  2PSW A;  2B5G A;  4CGN A;  1XMT A;  4KVM E;  3FRM A;  2REF A;  3VWD A;  2R8V A;  5EBV A;  4CAF A;  2YGW A;  4R57 A;  3F8K A;  3B8G A;  2Q4Y A;  1Q2D A;  2GAN A;  2HV2 A;  2QML A;  4U5Y A;  2VQY A;  5EC4 A;  1QSN A;  4C2Z A;  3DSB A;  4NXY A;  4UFX A;  3D2P A;  4LUA A;  4H89 A;  4QC6 A;  3LD2 A;  4ORF A;  4FD6 A;  3T90 A;  2J8N A;  4CGL A;  4RI1 A;  4KUA A;  2B5G B;  1LRZ A;  1YLE A;  1K4J A;  1S60 A;  1Q2C A;  4UCM A;  1WK4 A;  1CM0 A;  1XF8 A;  4UCN A;  4E2A A;  5ISV A;  4A2Z A;  3FB3 A;  4A33 A;  1QST A;  2FCK A;  3KKW A;  3DDD A;  4PSW A;  4QB9 A;  5KTC A;  2WUU A;  1YX0 A;  3QB8 A;  5F49 A;  4PSX A;  5DWN A;  3S6G A;  2J8M A;  4XNH C;  3P2H A;  2Z3L A;  2D4P A;  4B13 A;  5G1Z A;  1IYL A;  1V0C A;  1Z9U A;  1KUV A;  2G0B A;  3GY9 A;  4A31 A;  2BL1 A;  2G3A A;  3NE7 A;  4JJX A;  4XPD C;  4A30 A;  3JUW A;  4BBH A;  2EUI A;  2X7B A;  4IUS A;  4UA3 A;  3UY5 A;  4M3S A;  2B4B A;  4MY3 A;  4DNC A;  1RXT A;  3CXS A;  1IYK A;  2YNC A;  5J8F A;  3TO9 A;  3WR7 A;  4PK2 A;  2CY2 A;  2AJ6 A;  2B4D B;  3FYN A;  1MK4 A;  2FS5 A;  3PGP A;  1IID A;  2B4D A;  4MFK A;  2G3T A;  4KOT A;  4M85 A;  1ON0 A;  2PC1 A;  3EC4 A;  2R1I A;  4YRH A;  5H84 A;  4KOU A;  3OWC A;  4QBJ A;  2B3U A;  3R95 A;  4CYN A;  5BWA B;  2RC4 A;  3DR8 A;  2P6E A;  4KLW A;  3IGR A;  3LOD A;  4ZGY B;  3EO4 A;  2PRB A;  3S6K A;  3EFA A;  1ZO0 A;  4JXR A;  4F0X A;  4A95 A;  5CNP A;  4OAE A;  4R3K A;  3S6H A;  4JWP A;  2Z3K A;  4MY0 A;  5F46 A;  2BEI A;  2OZH A;  4NEX A;  5AG5 A;  4KOR A;  2P6F A;  3JTK A;  5HMN A;  4QVT A;  2WSA A;  1NE9 A;  2AE6 A;  3I9S A;  1BOB A;  2C27 A;  2FL4 A;  3IWG A;  4FD4 A;  4UWI A;  1OZP A;  4CAE A;  2ZW5 A;  2Q4V A;  1S7F A;  1M4I A;  2DPS A;  3JVN A;  2PR8 A;  4R87 A;  4NF1 A;  4CAX A;  4MI4 A;  1Y7R A;  4K30 A;  4AVA A;  4EVY A;  4NCZ A;  1IB1 E;  3GKR A;  2HQY A;  5AG4 A;  3F5B A;  1M1D A;  1R57 A;  4Y49 B;  1KUX A;  4MJ8 A;  3W91 A;  2PQ8 A;  4CAW A;  5J8C A;  2BUE A;  3ZJ0 A;  4L89 A;  3FXT A;  4II9 A;  4MFZ A;  4B11 A;  1P4N A;  3TOA A;  3W6S A;  4AVC A;  5G21 A;  4FD5 A;  2HUZ A;  2VXK A;  5IV0 A;  1N71 A;  4Y49 C;  2CXA A;  2OB0 A;  4PV6 A;  2H5M A;  3IWE A;  4B5P A;  2J8R A;  2OU2 A;  4YFJ A;  3G8W A;  4UFV A;  3CXQ A;  3R96 A;  3TE4 A;  1YGH A;  4HKF A;  4MFP A;  4UWJ A;  4HNW B;  3SHP A;  2YNE A;  3P2F A;  5G20 A;  4C7H A;  2ZW4 A;  4CGP A;  4KOS A;  4J3G A;  2OH1 A;  1P0H A;  2Q0Y A;  4AG9 A;  4F6A A;  4U9Z A;  2VI7 A;  1B6B A;  1FY7 A;  4KZT A;  2D4O A;  1PU9 A;  1QSM A;  3TTH A;  3D2M A;  3TO6 A;  1S7L A;  4Q36 A;  4LX9 A;  4IF5 A;  3SXO A;  1KZF A;  4F0Y A;  5F48 A;  4KLV A;  2PDO A;  4KSF A;  2K5T A;  3TCV A;  4B14 A;  3BLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...