3D43A

The crystal structure of sph at 0.8a
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
309
structure length
309
Chain Sequence
RASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the psychrophilic subtilisin S41 and the mesophilic subtilisin Sph reveal the same calcium-loaded state.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Sphericase
total genus 122
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3d43A00
1T1EA 1KE2A 3I30X 1BE6A 5K7SA 1SIOA 1BFKA 2SICE 2PMWB 5AVJA 2W2MA 1SN7A 1SCAA 3VYVA 1BFUA 5AMXA 1AU9A 3DE3X 1LW6E 1ST2A 2XTJA 3I34X 4FONA 1C9MA 1V5IA 4H6XA 3SQOA 4NE7A 1TO2E 5AQEA 3WQBA 1TK2A 4NE9A 2SBTA 3T41A 1BJRE 1OYOA 2Z2XA 3DE6X 1C3LA 3H42B 3TI9A 4C3VA 3DE0X 3VHQA 4HX2A 2WUWE 1SBTA 1CNMA 2DP4E 3QFHA 3DE1X 1S01A 4GI3A 2E1PA 4JP8A 4KG7A 2WUVA 1GT91 5ARBA 1EA7A 3EDYA 4I0WB 1T1IA 4AKTA 1OT5A 2DQKA 2ZWOA 1Y34E 2Z57A 1AH2A 1Y9ZA 4KPGA 1SVNA 2PWAA 3WHIA 2Z2ZA 4DJ5X 3A3OA 2W2NA 3A3NA 1TM7E 4H6VA 4ZARA 4HVLA 3DE5X 1BE8A 3Q40A 3PTLA 5FBZA 1YJCA 1VSBA 4WOBA 4AKSA 1ZVKA 3F7OA 1KE1A 1BH6A 1MEEA 3L1KA 1S2NA 1R0RE 1TM1E 1YJBA 2P4EA 1Y48E 3DE4X 1OYVA 3LXUX 3OSZA 3EIFA 4OMCA 4DWWA 1Y1KE 3DW1X 2B6NA 1AVTA 1EGQA 1Y3FE 2DUJA 2WWTA 4NMXB 1T1GA 2QTWB 5B1EA 1SBIA 2PYZA 1Y3BE 4J94A 1YU6A 1PJ8A 3DWEX 2X8JA 1SIBE 2W2OA 1AF4A 1GNVA 1IC6A 5AVKA 2HPZA 1ST3A 3CNQS 1SH7A 3VTAA 1WVMA 2Z30A 1GTL1 3WIVA 1KDYA 3ZXYA 2PRKA 3VV3A 1NDQA 4DZTA 1C9JA 5JXIA 4OV6B 1SCJA 1TO1E 2Z2YA 1PFGA 1SELA 2IY9A 3CO0S 3TI7A 1WMFA 2XRMA 3HJRA 1GNSA 1SUCA 1ZVJA 3BPSA 3I2YX 1XF1A 1SIUA 4H6WA 2SECE 1IAVA 3QTLA 4Z2AA 1SCBA 5JMOA 1P8JA 3BX1A 2X8JB 1DUIA 1TECE 2V8BA 3AJ9A 3LPDA 4OMDA 5I9SA 3GCWA 4LVOA 3DVQX 2PQ2A 1GA1A 1PEKE 1SBHA 1V6CA 3AFGA 4BWGA 1S02A 1THMA 1GTG1 1SBNE 1SUAA 1TM4E 1WMDA 1Y4DE 2GKOA 2IXTA 3I37X 5B1DA 3PRKE 4YN3A 3QMPA 1WMEA 1SCDA 1R64A 4B5LA 4C3UA 5JXGA 1C9NA 2WV7A 1SPBS 2HD4A 2PKCA 2ST1A 3D9QX 1KDZA 3ZXXA 5CW1A 3EE6A 1A2QA 1HT3A 1MPTA 1PTKA 3AJ8A 1AK9A 1AV7A 3DW3X 3VV2A 3WIUA 1Y3CE 2Z56A 3F49S 5JXHA 5FFNA 2ZRQA 4CFZA 1UBNA 2W2PA 3BGOS 1DBIA 3DVRX 1YJAA 3GT4A 5FAXA 5SICE 2PWBA 2W2QA 4LVNA 3DDZX 4CFYA 1GCIA 1NLUA 2TECE 1JEAA 3D43A 3F7MA 5ARDA 1NDUA 1WSDA 3DVSX 1GTJ1 3P5BA 1GA4A 1Y4AE 3VSBA 2SNIE 1Y33E 3DYBA 3LPAA 4M1ZA 5ARCA 2ZWPA 1SUPA 1SUBA 3UNXA 3TECE 1TM5E 2Z58A 3A3PA 1SUDA 1R6VA 1SBCA 2G4VA 4KB5A 1TMGE 1P7WA 1SUEA 2ID4A 4WOCA 3DE2X 4ZOQI 1Y3DE 1Q5PA 4CG0A 4K8RB 1KDVA 3GT3A 3DE7X 3Q5GA 1GA6A 1SCNE 1TM3E 4RYDA 2ID8A 1CSEE 3GCXA 5JXJA 1AQNA 4MZDA 3SICE 3LPCA 1P7VA
chains in the Genus database with same CATH superfamily
3QITA 2APJA 2F1KA 3KDPA 5DTJA 5EMLA 1KZ6A 3STUA 3AP1A 1UPTA 2QY9A 2HT6A 3L84A 4DIUA 2BRUC 4HDRB 3ZIAD 1H23A 4GYJA 3P20A 1LUAA 1M7GA 3J80A 3OZBA 2VJOA 4MWDA 3HFJA 4NBUA 1M2WA 4X84A 4II7A 2Z09A 4CWAA 1OJ7A 4H7KA 3TM5A 4L27A 2OD9A 1RC0A 1ISJA 4HNHA 2JGEA 1SQGA 2M6RA 2O8VA 3NHKA 3FWKA 4FFDA 4YAJA 1DS6A 3ZOKA 4P3XA 4MI3A 1T9DA 5CDYA 2FF7A 1B3BA 1UIMA 2FMIA 2X14A 3VJKA 1SBZA 3E8MA 3R0QA 2VHCA 4DE5A 4BFUA 1NBIA 1X39A 3LGSA 2HHHB 1D1SA 2H1SA 4YJHB 4AZSA 3LO8A 4TLEA 1U2GC 4KL8S 4B6JA 1F4PA 1DIRA 3O82A 1TZJA 2BM0A 4IDEA 5EXTA 5B12A 1I2DA 2F55A 3CR8A 4PC6A 4WJZA 2JIPA 5CFZA 5AKJA 2CBGA 1P9NA 3FNFA 2OGUA 2BFBA 1WO8A 4MLZA 4O59O 4OLJA 1VP9A 2BZSA 4OX9B 1ZY2A 2JIDA 3KQWA 3RIXA 4CEJA 2NXWA 4GZ5A 3MWEA 1A8PA 2XSZD 2RK3A 3ENVA 4NCHA 5HMMA 2PX2A 7ADHA 3Q11A 5EE1A 3QBDA 2GYVA 3DHVA 4IIYA 1RTTA 5EE3A 4R81A 3M2PA 4D82A 3GK3A 1Y81A 2SHKA 3EY4A 4IIJB 1P77A 4J7UA 3R76A 1N6RA 1ADGA 3H17A 3BD9A 3R5HA 2WF6A 4R2WA 5LKRA 1II8A 1AGRA 2C2ZA 2NVUA 1QLHA 2BI7A 2NO9A 3R0JA 4B73A 2WFZA 4RTJA 1IXKA 4Q3OA 1C2TA 2HK8A 2OG1A 4RD0A 2D5AA 1XF9A 4N9WA 4BP8A 2FGKA 3QELA 4H7JA 5KTSA 1ZXXA 2I6SA 4ZDIA 3COZA 4YV2A 1K2VN 3JASA 3PGA1 4NC9A 5LZ4A 2Y1EA 3R3WA 5FWAA 1JAYA 4JU8A 3R7LA 3ND8A 4C22A 5JXHA 5IAOA 2IBTA 3HTXA 2PTGA 3HCCA 2YN4A 4IXTA 1JJ7A 1I2CA 4IW3B 4MJLA 3CH5A 2RJOA 3DT9A 3GFPA 2PO5A 4JOQA 3BHNA 3WK7A 1DPFA 1TJYA 3F7MA 1TL7C 4KDCA 4X1KA 4BAGA 3GHYA 4HVAA 4HSEA 5CHEA 2XH8A 3R8FA 4MAMA 5AP9A 1U7ZA 3IRUA 3A9WA 4M1MA 1TEZA 3W2GA 5IU6A 2A4MA 2OHFA 4GPTA 1LJ8A 3DCIA 4NONA 1WBDA 4H1UA 1U5BB 2WTEA 4QJ5A 3RYTC 1EFDN 1R5OA 1Z06A 3VR4H 2W93A 4EJ6A 1DJPA 5BRNA 4IJWA 1RXSA 3GCXA 1EUQA 3BH7A 2BBTA 4YAFA 2EKBA 3DAOA 1T8YA 1U5CA 4UPVA 1P7VA 4HDMB 4MXDA 1G41A 2B7BA 2GN1A 1ORVA 3L7KA 4JLDA 3WLJA 1KI3A 5K7SA 3KTOA 3LHKA 4CIVA 2I7XA 1ZISA 2AB0A 2AXEA 4OK3A 4D81A 5IUJC 4HTAA 3VR5D 3UJ6A 1KORA 4ADSG 2A59A 1N6OA 3BGSA 2F3QA 2H4WA 1GKIA 3CE9A 4OXNA 3UAYA 1VM6A 1EJ0A 1OYOA 2QY6A 5ALIA 3H42B 3NXKA 2KE5A 4GS5A 3CS3A 1R0BA 3GVHA 1WULS 1GG2A 1JPJA 2AOWA 1QH8A 3LT0A 4CIAA 3IO5A 5IM4F 3KV3O 2Q5LA 1PS0A 3G2NA 1ANKA 1OOEA 2C0PA 5MN6A 2WYVA 5EKUA 2ZRJA 1JRLA 3BHJA 1TAGA 1K7SN 3K7EA 5EMKA 4CCAA 2BKEA 1JA9A 1MAHA 4BNIA 4GMFA 5H68A 3TMAA 4O2BA 2JGIA 2HA4A 3O1IC 2YHIB 1Q95A 3K6SB 1E6EA 5F4ZA 5FWYA 3L1JA 3T3PB 3F6SA 3FDIA 4S12A 2Q5EA 1KEPA 4RK7A 2PGLA 4K28A 4DXAA 1VRVA 2HBZA 4HXYA 3MJTA 3KUUA 4NDNE 5JZVA 3EDMA 3WIBA 2A1TR 4J9VA 4KLNA 3S40A 3ROFA 2ZUWA 1HG1A 3D3WA 4ASUA 4QWMA 3ZTWA 1NU6A 2WVAA 3E9ZA 3MCZA 2QVLA 1OFGA 3FE2A 4NMWA 3EN0A 4BTVA 1GDDA 5K03A 4BL5A 1IEVA 4RIFA 4EUHA 4R3WA 1EWRA 2J3IA 2NYAA 1N9ZA 5CFLA 1M2HA 1Z3IX 3HEMA 4JROA 3M3PA 3JD0A 1UBOS 4NOJA 1I3NA 4R8LA 1JU9A 5FI0B 3UQYS 3BE5A 3SNKA 5KNCD 3U44A 3AVTA 4WSOA 5DLYA 4AMZA 3RS2A 4R6XA 3AR9A 4HOYA 4EQ6A 1CDOA 3ZOZA 5KOYA 4U0JA 4W5TA 2XUAA 1JR6A 5EGSA 3WLKX 2HMUA 2XA1A 3K1ZA 2FEWB 1GDHA 4MV4A 1E3SA 1JILA 3E22A 3LVFO 3ZUPA 3BWXA 3CUKA 5K0LA 4INOA 1RJFA 3THSA 1JPVA 2G8NA 2PRZA 2QEQA 1W36D 1F7VA 4N3AA 5MN4A 3BS4A 3NHWA 2QUAA 3ED1A 1LPAB 1JEYA 2FFBA 1TVEA 1I5OA 1CB7A 2WJ4A 3L6OO 4BO8A 2PPVA 4MHOA 2HDNB 3DMPA 4QNRA 4RF4A 1VSVA 4M9ZA 4Y2QA 3OF5A 5ES4B 2W11A 4G0NA 2BGJA 4S1VA 2J4CA 1ZGHA 4M0FA 4HRVA 2QJWA 3C7AA 2QI9F 2VPXA 3LPAA 2VYQA 4IDBA 2ZWPA 3ADCA 3EWIA 2O5EA 1XA0A 1Q7GA 1IQPA 1IQRA 2XDQA 1GZHB 5DM0A 4BOYA 3GGGA 1E2HA 5EKSA 3AOGA 1GV0A 1XVTA 4DTIA 2RJ3A 2W43A 2RCYA 4UKDA 1W0KA 1U80A 2QTFA 2WIAA 3PXDA 1YQDA 3D2AA 4MYUA 4XGQA 1XA4A 3KXPA 1MT0A 4DIDA 1IHDA 3KV1A 4YHHB 3C15C 1U8UA 3F97A 2WFLA 3QKUA 4GOND 1JLKA 4EELA 4BNKA 1QJ4A 3JAKA 3U37A 4GPBA 2NPFA 3N2NA 5BMVB 1LK7A 1A72A 1N3BA 2E4UA 3I34X 4AO8A 1RAHA 1W88A 3OQPA 4ZI7B 4TMYA 1WY7A 2ZB2A 1A4XA 3DHYA 1JVNA 1C3OB 1TCUA 2L42A 2QRGA 4I1YA 4IUDS 2WUWE 4MUBA 3AQIA 1H42A 3GGOA 4X93A 4EMBA 5A1TA 1G2QA 1AV6A 2WU4A 2ZTVA 2V03A 3CEJA 4GYKA 2ADMA 2XVZA 4HWKA 4X97A 5D86A 1H3FA 3NIFB 3CXRA 4NI5A 4R8SA 4E88A 2ERYA 4YRJA 1YB1A 1CT9A 5D01A 1Z6ZA 4DIBA 4WEQA 3ZG6A 3L8MA 1JQ5A 1XHFA 2NYUA 4TM8A 4Z0TA 3KFLA 1OHHA 3GGDA 4CKBA 3CC8A 1PJBA 1NBME 5HIMA 1J9ZA 2I7TA 2IKSA 3ZYCA 3NVMB 1QRSA 4E08A 1KU6A 5FPKA 1W1WA 5JANA 4AB1A 1QE5A 2IDMA 1L9KA 1I1HA 2ODPA 2H1LA 3AINA 4G1UC 1JEOA 4B44A 2Q2QA 3M81A 3GU3A 4HY3A 5AI4A 1XKLA 2RAUA 3MWKA 3LH5A 4NOLA 4PCLA 1QS0B 4IS3A 3LUCA 2IYPA 2D13A 1BEEA 1GG9A 1T8TA 5BP7A 3GGSA 3ZVLA 3CVYA 4LYGA 4F4IA 5C1OA 5IUNC 3W4JA 4CZ2A 1H2FA 2IP2A 1B0AA 2RH9B 5GZ3A 3SF0A 3OFNA 4LVUA 4XE5A 2W6JD 5DLPA 3P0JA 2CVOA 2V7GA 3RJZA 1IBCA 1LW7A 2Q8QA 2WF9A 2PS3A 3KJZA 4H17A 4KFRA 1Y1QA 4UUBA 2JC3A 3FKSA 5MHTA 3T1NA 4BNHA 3MK31 2M2IA 5H5JA 1Q50A 4KPUB 2BM9A 3PXEA 4DYHA 4J1SA 3D2LA 4F5YA 3NEPX 1XTVA 2H51A 3C74A 4HEA1 4W8HA 3VPHA 3UB3A 2ZWAA 3E18A 3X2EA 4EPYA 3IPLA 2XKJE 5KAMA 3GFVA 3AUSA 4HDRA 4RTPA 1MGOA 4X5OA 1EZ4A 3LX4A 1AK9A 2RKOA 4C7JA 1U9IA 4BRSA 3L4EA 4UHJA 3H11B 1H8ED 1B26A 1DBIA 3DVRX 5BRAA 4JVOA 4X6XA 4HRXA 5ALEA 4GR5A 4FYPA 4ZRDA 5ECWA 1VL1A 2JB9A 2KWIA 3WL8A 2JFBA 3AI3A 2OC9A 1NGSA 2PT5A 2QTVA 2RONA 3T5GA 3QYPA 3ZE1B 2ZU6A 2FQWA 5FUQA 3B82A 1AM4D 3GROA 4C88A 1EVZA 4M4SA 5EE0A 2A0WA 2N46A 5HEKA 4R5MA 3RWOA 3THOA 1UL1X 3T9AA 4G6ZA 3A3PA 1I7PA 3C5WP 2AFHE 1SU7A 3OFND 4GZ6A 4DUYB 5DHAA 2VP4A 1WUKS 5F73A 1P5HA 3KWJA 3V1MA 4ESVA 1RWMA 3DE2X 1UODA 4WLOA 3BZWA 1MU0A 4MUGA 3SC3A 2WWYA 2DFTA 4BE9A 1RS0A 3ADOA 4DC1A 4QTYA 3WWZA 2GRUA 3FUCA 4K0RA 4PLCA 3QEBZ 4FE3A 1U11A 4G4JA 1TEHA 1BE6A 1YE3A 2JH9A 3JQFA 3WGOA 1N8TA 1NU8A 5HJ2A 5I4BA 3HRIA 4QDXA 2ZYRA 1FDVA 3CGGA 4UMDA 2IUFA 3BMNA 4UVDA 3A04A 4J2TA 1CUGA 2A78A 4RK4A 3TOCA 5TPZD 4I2VA 4BNFA 2VTKA 1B8VA 1U3TA 5LBIA 2ZR8A 3P0RA 2GEUA 2D2FA 2NVUB 3VKVA 2GPBA 2AV6A 1N2EA 2QRLA 3EXEA 4LDPA 2IU3A 4RIGA 3RSLA 1T8UA 2ZYIA 5ITZA 5KPJA 5DFAA 5EXSA 2WY2D 3RFCA 5JUWA 4LG1A 4ZCSA 5I3ZA 1JG2A 3IH5A 4DB4A 3ER6A 1G0OA 3Q9SA 1VB3A 3CKYA 2VWHA 1Z38A 3Q87B 4JLAA 4OB6A 3TLKA 4XR9A 4B4OA 1JFTA 4PYRA 3K2BA 4BECA 4PLHA 2PJZA 4F3KA 1H4QA 2P2DA 1JDNA 1WCXA 4FZRA 3FI9A 3L92A 2PGAA 1SZDA 3U7RA 3AMVA 5FBQB 5A5EA 2CMHA 3FMFA 4N54A 4ZCIA 3PUZA 1P0MA 3R0VA 4AS2A 4DCPA 2QKYA 4JFRA 4B33A 2FVYA 5CXUA 4CTOA 5IAKA 1NQWA 2FFJA 3LUHA 5LP6B 2QDXA 2UVQA 3H05A 4GAEA 2R751 2ODBA 2M1XA 1KQNA 1A2KC 1FPMA 3H5VA 4CR6A 1K8XB 5C52B 1CHNA 1IPEA 2ZE8A 1V1JA 3ZDXB 4D45A 4LHZA 3ZWAA 3ORSA 1W85A 4CL3A 2EDAA 5ERXA 4EJ2A 5LMCA 3RROA 3TFOA 5IT9A 3UUFA 2LIVA 3AOEA 3NNNA 3LUPA 4MCIA 1BDMA 3M5CA 2PRJA 4DC0A 4QRHA 2QX7A 2GK4A 4BKOA 1XAGA 5ALPA 2H06A 5COQA 5EP2A 4ZXFA 1KPHA 1TLLA 1E3JA 2RC5A 3B3GA 1UMCA 3ZGVA 1NL3A 1JU3A 3ISJA 3QMPA 2P91A 4M37A 3LQYA 5IDWA 3EF3A 2XJ9A 2HD4A 4WFKA 1U9IC 3O1LA 4J0GA 5EZQA 1ZLXA 4N0QA 4XIGS 1Y3CE 4WFJA 3IT2A 4D74A 1SUSA 5BUZA 2MCFA 1ULSA 1YA6A 4Y18A 4IGKA 2W90A 2E37A 4EYEA 3DA8A 3K0FA 3E61A 1EM8B 3D43A 3G82C 2BMVA 4EO7A 2RFLA 5JPDA 1QP7A 4ARIA 4FGWA 5JCZA 4YRDA 2QRHA 3E2IA 3CVXA 1TVMA 3ACBA 4KCGA 5GONB 2BF4A 2QVXX 4MZXA 4J43A 2ZETA 3RG8A 4QFCA 3IAEA 1PT6A 3PQ2A 3U09A 3F6YA 4V0MA 4KGVA 3B48A 4ACAA 3IP7A 1USVA 3VNRA 2VQ6A 2Y66A 2P9HA 3FFAA 1PL8A 1ZOLA 1XXHA 3EAQA 1TRKA 2YHAA 4GUDA 4Q00A 5E7QA 4LY6A 4YR7A 3QEMB 3L0CA 5DO9A 2EW8A 3CH4B 3CZ9A 5HSGA 2KMLA 1TQ8A 4AJJA 1Z6QA 2VF8A 3AUFA 2WDZA 2KJQA 5GV7A 2N1MA 2Q3MA 3D2CA 3VC7A 1LX7A 1QK5A 2BISA 2DHQA 3HKBA 3R7BA 2GYYA 3TTYA 4CQMA 2HLNA 2WIFA 2ODNA 1QHFA 1YB2A 4C89A 2P9ZA 1VJ0A 2VUUA 2Y9PB 2YZMA 1KC1A 1L5HA 3FMGA 4LOLA 4QGAA 1W0JD 3VBEA 3SQDA 4JP8A 3UT6A 3KQHA 4EYKA 1CR0A 3H99A 2BTEA 2D0OB 1N2CE 4GPEA 4KH1A 4RV5A 4AKTA 1G8PA 5FO1A 4H7FA 2NM0A 4QQFA 2XGGA 5BOSA 5CFRA 4F1KA 2JRCA 3RREA 4PZDA 2RHMA 4DB2A 2ONJA 3UMJA 4IEIA 2XA9A 3A3NA 5JWHA 2EAUA 3M6FA 4UUPA 3R8CA 4K9DA 3B8HA 5JNWA 2PYDA 3QF4A 3GUZA 5ENZA 5FAKA 4DR1B 3NLLA 1JG6A 1QK3A 5CEJA 1D3AA 3L0OA 1A5AB 3BMOA 3OCZA 3UOGA 4ITUA 4FBLA 1E96A 1WPGA 1OZFA 2P4EA 1UQRA 3QOXA 4R8RA 3VR5A 3PJFA 1PUXA 3BORA 5TNXA 4A36A 4RA6A 3WJAA 1AVTA 4JDPA 1SC6A 1Y3FE 2UYQA 1USIA 2CJXA 5FOUA 3WGMA 1WHSA 1YRWA 4MMYB 3WO0A 3DR5A 4G67A 2Q3EA 2W2LD 4BXOB 4IKPA 5LQMA 3LKBA 4IOJA 4RHYA 2GN0A 1ZRHA 2X1HA 3R0IA 4HX9A 1XK6A 3Q88A 2C3UA 1IG3A 4E4TA 1AQUA 4LBWA 4LZNA 1D0SA 2E4ZA 2HMTA 4F45A 5FWXB 5K0SA 4MH0R 3UOWA 3KJHA 4FI3F 3NYRA 1A9YA 3KYIB 1NPTO 3URKA 4A8PA 3H2BA 1W25A 2D62A 3JWIA 5TGTA 4FR2A 5EMNA 2WD9A 3EHDA 4NEHB 5D3ZA 3VTKA 3O7MA 3NVKI 2QW8A 3GCZA 3E1KA 1DDGA 4H3KB 1L7NA 4MPRA 3V4OA 1NUQA 4IHKA 2ZZNA 4R1OA 5L4LA 3ROPA 1SBHA 3I58A 1IPFA 1ZM4A 2VTBA 4MRMA 1K68A 1RQLA 1P2FA 4D4IA 3FPKA 2NYRA 4LW8A 1H94A 1VZ2A 4DSZA 3I5XA 2N0SA 2WOJA 2QZZA 2V7QA 3BL6A 5E6UB 3T3EA 2EFJA 4C0XA 3AI2A 4O3MA 4WJKB 4H7HA 1XD9A 1PUJA 1QG0A 1UBNA 3F6BX 5CH5A 5GGYA 4ZOQI 5C1DA 1WMSA 3H5TA 3JVDA 4UFNA 3WQQA 4A0QA 3ZWVA 3AEQA 2Q28A 4B2IA 1NV9A 4IIDA 3CCBA 2ASVA 4G8DA 4EA9A 4ESEA 3Q5EA 4DDWA 3AQ4A 4BUZA 1AOXA 1ISHA 4DILA 3SP1A 4M1ZA 4QPPA 4BQEA 5G3ZA 3RKRA 4ZHQF 2BW0A 3P9PA 1JPNA 2FEMA 3C8HA 4IGAA 3K53A 3NKVA 4OIFA 5EJ6A 2VPPA 4L7QA 3VJRA 4AJLA 1JE1A 2AI2A 1FP4B 3N87A 2H0AA 3CWZA 2YHIA 4GL4A 2BUCA 1XPOA 1QFXA 1KAOA 2DFDA 1AHPA 1A88A 4XIYA 4G84A 1BIFA 4E11A 1MP0A 2A9QA 1V7CA 3T8YA 1G3RA 3VPSA 5U1PA 3S0JA 4DL9A 3C3WA 1B8OA 2YYAA 1M1YA 1XZKA 3PICA 4UNRA 3QVOA 1YB4A 3JALA 4ZRNA 3A9UA 2JJ2D 4FDMA 4UULA 1QZTA 4QBFA 2MSWA 3G2PA 4WLEA 3H04A 4D3XA 4YCCA 1G8HA 2OO5C 1ZHOA 1REQB 3DOUA 5FNVB 1I9CA 1VI6A 1P9OA 5IUKC 3A31A 4OQDA 521PA 1GP2A 1G7SA 2PSFA 2P6UA 2VP3A 1A5SB 2G1JA 3ZC3A 5IJWA 4OHCA 1W1IA 2YZGA 3QVGA 4F6LA 4RZUA 4JC5A 4D0GA 2XB6A 4JOBA 1SNYA 3ITNA 1ADYA 5HJEA 1Q2UA 1ZOPA 4PIMA 4UVIA 2NQ2C 3PDCA 1H0HA 4L16A 1AKEA 1Z0FA 1NLMA 1YZVA 3O4FA 5CFQA 3HO1A 4CIBA 4J0QA 5JNTA 3QGMA 3KYCA 3GLFA 2CMGA 1ODCA 3O83A 3Q0IA 4URZR 3LVBA 1K92A 3AFOA 1QIJA 2F8LA 3PD7A 5DNAA 5DF1A 3IXMA 5B2ZA 5KYWB 1A5BB 4OUDB 4EJSC 4L8YA 4HTFB 1T1GA 1NN3A 1PHPA 3QH4A 4BNWA 4IDAA 1U1EA 4DUGD 6Q21A 5LQSA 4MWTA 5DT2A 4CI0B 1Q14A 4KQHA 4PYOA 4EI7A 4LSZA 2Y77A 2G1PA 3RJ9A 3IB3A 1ELOA 3KK0A 2A58A 5FH9A 4DKJA 1NQ5A 5BURA 2YHUA 3JQAA 3P4UA 4QYWA 4S0XA 4NBTA 4G81A 4YPVA 3YASA 4PG7A 1HZJA 4B6FA 3AR8A 5HK8A 1UPFA 1R0SA 4Q1VA 1T36B 2ZUCA 4E2YA 1QU3A 4JFAA 2A86A 3ABIA 4XB1A 5CVCA 2YMLA 1DAEA 4RTLA 3J81k 1DQPA 3H4MA 5GJBA 1HT1E 3GUVA 1SIUA 3H3FA 1W5FA 1MC8A 3R7WA 13PKA 4PGFA 5ITWA 3GLHB 3IAHA 4KHPB 3QWBA 4QNMA 1XWWA 3SC2A 1ABFA 3ZHOA 4CTNA 2IYAA 3L7JA 5T4EA 1K75A 4KXXA 3U60B 3KDSE 2HFKA 3DB2A 1GFSA 3DMTC 3R3YA 5DNCA 2NUPA 3A4VA 3OZSA 1L5LA 4A6PA 1J2UA 1HE1C 2LDBA 3TZ6A 4YCJA 1AGXA 2D5LA 5IBQA 4U2FA 4M76B 3FFXA 3V33A 5KB3A 5LLDA 1E92A 4M9XA 3W6OA 2PS9A 1XKQA 1WNTA 1ZFNA 1YGYA 2D8MA 2OCIA 1BRTA 3H2YA 1AV7A 1G1MA 2P1DA 3UGTA 4DLWA 3BKXA 4YQEA 1D1QA 1WMAA 1JJIA 2JFQA 3OTWA 3IOBA 3AEKA 3FZEA 3I05A 3MWEB 1JEAA 3P97A 1E6UA 4RHCA 3A37A 2X9LA 4KEAA 1I6LA 2P0AA 3K15A 2JGKA 3L7OA 4RADA 3V00A 1ORWA 3PUIA 2FSPA 4N6OA 4O1IA 4CMIB 4BQFA 2Q0SA 4JWKA 3QPDA 1V0JA 1HLDA 4HZGA 2XD9A 1CEYA 3T7EA 1I5EA 2W70A 3DV0B 2MMGA 3TBKA 4AU1A 4E5NA 4F9GA 3O0TA 3PLNA 1FYWA 1O96A 1ZC4A 1EWTA 1UPCA 2C3MA 1V2GA 3G8YA 4JU9A 4LZZA 4UVEA 3IOEA 4PICA 1UP7A 1OWPA 1PIWA 1Q7TA 2IUYA 1T0BA 4KI7A 4KWEA 4FNGA 5TPWA 2UUBB 3UWOA 3I5UA 3A2KA 1CZRA 3V6LA 2WU8A 3ZGYA 5BYBA 3LTNC 1OLUB 2H5JA 3O03A 2ZRAA 5DHSA 2YFYA 4EW6A 4W82A 2RGBA 4B45A 3KDAA 2RGYA 3VMMA 3PKZA 3R7AA 4FW8A 3W8DA 1MHTA 1OFHA 2ILTA 1PZMA 3T7CA 2O19A 4OG2A 1Q44A 2IL1A 3FKJA 2WZBA 1C0LA 1OU0A 1BYUA 2JIBA 1L7EA 3GI1A 3ZTYA 4OGLA 4A0HA 5BNZA 2N47A 5TQJA 3WIEA 1E5XA 1JSRA 4IZHA 3JD4A 3CBQA 4WWHA 4I4LA 4XD2A 1FRQA 1F8YA 3ZHZA 2NXNA 4LA4A 4BVBA 5KJEA 4LGYA 3HVUA 3ZDEA 4DSTA 1YASA 1AXRA 1HL7A 1V39A 2AEFA 3GNSA 2GBFA 4YJFB 3ZE6A 4E5UA 5J4KA 1DRJA 3LUJA 4L07A 2JCGA 3HBFA 1KI6A 3OU6A 1AS0A 3L0ZA 2VKQA 3I76A 4R2IA 1UKAA 3ROGA 1OD6A 3ETHA 4UU0A 3EQ9A 4HFRA 1VSBA 1IWBB 5JH7F 1KEZA 1D4ZA 4J3FA 4Q4HB 3ETCA 2FYTA 1YQUA 3GLUA 1P7PA 3AB8A 3Q5DA 3OSZA 1O57A 3FSGD 4WT7A 3JS5A 3S1LA 4BVJA 4ENQA 4IQFA 5DDIP 3CRNA 4LNHA 2DJIA 1WP4A 2NLOA 5IJZA 1V1RA 4NY1A 3C14C 1PYOA 1Y4SA 2HREA 3LS2A 5AOCA 4IKEA 4YP5A 3ZTTA 1U04A 1NTOA 2BCGY 3CNHA 3IDAA 4K05A 5DV9A 5F1PA 1H2AS 2HPZA 3WL3A 1RJGA 1ST3A 2DKFA 1Q7BA 3LPLA 4BMVA 4C04A 1ID8A 3DG9A 4MW5A 2E87A 1U3VA 2FTKE 1M1YB 1E18A 3SMVA 4IOKA 2EX1A 1UKYA 2I6TA 5LSAA 3CSSA 3D2BA 4QHSA 3IX7A 4V1CI 1E0DA 1TW2A 3ICWA 1WR8A 3MJFA 4C4PA 1SZJG 3NHUA 1AUVA 4II2A 3R7SA 1CQPA 3NTUA 2J9FB 2SECE 3GJ8A 4J6EA 4YJ2B 4Q3CA 1D9ZA 3VTFA 2ACVA 3DHEA 1SOAA 3ZZ0A 3W5AA 2VP5A 4KIUA 3QTBA 3R6DA 4X0EA 2PUTA 4LJSA 4C14A 1WQ3A 2GPWA 1SK9A 3PHIA 2ATIA 4F38A 1K9VF 4CN8A 2GEDA 3TTXA 1Q19A 2QX4A 2BR5A 2DPGA 2R6CA 5HHTA 5AM5A 4U2EA 2H2GA 3ZDDA 1RRPA 5AI8A 3SFVA 2OZLB 3RRNA 3V9AA 3DEZA 2IDKA 3H0KA 3PXCX 1D1PA 3C8MA 4KYTA 1J0CA 2IP4A 3ZV3A 4CNBA 2IYWA 3L6EA 1JEEA 4AWXA 2O3RA 4CCYB 5JV5A 2VZ0A 2R97A 1Z35A 2VS1A 4IXMA 1SD1A 1NJ6A 1H9BA 2AUNA 4J49A 4JDUA 5NULA 2DHCA 1M73E 4DSNA 5HPYB 2BTQA 3B38A 2F90A 4TMZA 3SE7A 1VPDA 4IJMA 3IMCA 1BDBA 2TMGA 5G3YA 3UCEA 3A1WA 2X9NA 1XD8A 2NQTA 5IYZB 4LX0A 4GKBA 1PFUA 1TD9A 3ESQA 2VUSA 1BWQA 4DREA 1GA6A 3EIEA 4MRAA 1C29B 1V3TA 1ZCFA 2I29A 2IBMA 2YV2A 4HBGA 3W3AA 4PNPA 4RKFA 3SR3A 4YYEA 3U7GA 3L5OA 3MT9A 1BN7A 2P2YA 2ANCA 3LECA 4KMOA 4CLEA 1C4OA 4FEYA 4U7TB 5F35A 4NXMB 3D4IA 2O0MA 3EMBA 3LWBA 4TN5A 5GJWC 4H6XA 3SQOA 3U6KA 5C32A 5JCJA 3P2YA 3LFUA 3ZD9A 4MV9A 2BGRA 3UH1A 2GCNA 2I87A 2YKGA 3HYLA 3PTAA 2Z9DA 1YZHA 3O7WA 3E03A 1V37A 1E2EA 2FCRA 1NBEA 1COWD 1HBJA 3WWCA 3WP0A 2Q3LA 2V8OA 3GEMA 1S1CA 3DAFA 1GCUA 3KEGA 1IATA 3CWQA 4K1XA 5EIOA 4P5PA 4OLHA 4LOJA 4TMTA 4KWTA 1BDJA 2W9XA 4PRKA 5CX1B 5HQJA 5B64A 4CMEC 3UMGA 3EY9A 2VZLA 3P1JA 2QJOA 1KY4A 4M7PA 2WZQA 3O3NB 4WBNB 5F78A 3CLKA 4RK5A 2H54A 1INLA 3F8SA 4H4EA 1PD0A 2ORED 3EMVA 5AK5A 1E0SA 1K8RA 2BLNA 1G16A 3UAZA 2C7RA 3PFKA 1TCVA 2SKDA 3N8HA 4Q9JA 1G20B 4JCOA 3ZX5A 4YAKA 2OV2A 3O75A 2FSHA 2JGJA 3EW7A 3N76A 4JT4A 1F0KA 1UC5B 2IX3A 3FB4A 5JBNA 2HHLA 4FX5A 4JBYA 1YE8A 2ZJYA 3FWZA 3F9IA 3GLHA 1YAJA 1ZIOA 2I2XB 3I9FA 3S7ZA 3IERA 3V1NA 4LS3A 3ZW9A 4B4KA 3ZVNA 1DEKA 4KZPA 1W36C 2R1TA 2Z30A 4XR4A 1UEIA 3DOFA 4OLBA 4KR6A 1UMBB 4QJ4A 5BQPA 3BFKA 4IQ4A 5JSHA 4L1KA 2VJQA 3PNKA 1QRDA 2F62A 3LLSA 1GG8A 4R1NA 4RPHA 4WI1A 1ZJYA 4RH0A 2P2CA 3B85A 5EPEA 1BCRA 4NPHA 4C0QC 1NJGA 5JSQA 3IDQA 3DDWA 1G8SA 2B6HA 1TECE 4IDCA 5FKJA 3ZWWA 1YIAA 3CF6R 4LQLA 1SR8A 5AIBA 4TWRA 2W4IA 4Q02A 4FHGA 1RR6A 1X1AA 5EZ5A 2DQZA 4WNYA 4HGRA 5IX8A 2GA9A 1OYWA 1X7GA 3D8UA 3L0SA 1SKUA 2C7GA 2PGOA 2OCKA 1BGWA 4ZYWA 1G5HA 2IUTA 1G4UR 2ZRQA 3HY4A 4R41A 2OBMA 4DT1B 3W2IA 5I7HA 4AQ7A 4YYZA 3B5JA 5ER6A 1XZNA 1HL3A 2YOHA 3GG9A 1E8MA 1ZG3A 4OYHA 1KO4A 3HJNA 5BMVF 2OFPA 1N1DA 1U0NA 2ZW9A 1KL7A 1T4DA 1JFRA 3DCJA 2Q3FA 1NAHA 5F7XA 3L1VA 1E61A 3DZGA 4FFLA 5JD6A 3N6RA 1NYQA 1TM2A 4ABYA 2XMBA 3OLVA 4V39A 2P69A 4ZCTA 2R7KA 3EXHB 4MGZR 1NRXA 4U6SA 1CZLA 4K6HA 3EPPA 2C83A 3PUWA 5C35A 5JI2E 2Q1YA 4KR2A 4KIFA 2HXGA 3WLSA 3ZY4A 4CUJA 4MWZA 1Z7GA 4Y6LA 5BSKA 2G5TA 4CKCB 2YS6A 1HDOA 1P3Y1 3FUUA 3KR1A 3IP8A 4BLQA 4BPRA 3HXMA 1XQ1A 3UGJA 6PFKA 5BR1A 4M9SA 1SCAA 2OHOA 3K0FB 2O3TA 2PH1A 1SHLA 3CJTA 3L7CA 3BJEA 4ZOCA 3I62A 1V4BA 2VR1A 4YUXA 3S5JA 1G6OA 1CYEA 4K9QA 1EDDA 1TAUA 4PAMA 4CGZA 3P9XA 4Q9LA 3BIFA 3DFUA 4NHEA 4P1ZA 4HX2A 5A3RA 2YIVX 4ID3A 5JYCA 3LLUA 3I73A 4DM3A 3GZTB 2HKIA 3WYNA 2XIJA 3HVKA 3U4QB 5A6SA 4AKIA 4H4CA 4D8XA 1UOOA 5BVGA 1RXEA 4LNAA 3LX5A 4TXLA 4OSPA 4ZOEA 3KO8A 4MWSA 5H1YA 2PSHA 3VOTA 1GOTA 3W3AD 3IMEA 1FVXA 3HVJA 1EUCB 3FZGA 2XZLA 3L0IB 2GSWA 5IPFA 2QW0X 3RRXA 5JFTA 4DG9A 1KSFX 1UBKS 1P2UA 2IOQA 3WK4A 2C1ZA 1GADO 4B6OA 1R0RE 1ZEMA 3DOOA 3KPYA 4GG1A 3V55A 1ZNYA 2NU9B 3MLAA 3EGVA 4R0MA 1GV1A 1WBJB 4Y2RA 3ZD8A 4DSOA 1EK6A 3ENZA 4EA7A 3STWA 3CIFA 5B4VA 1EDBA 2HAEA 3PT5A 1RKXA 2ZAYA 4G9BA 3PFGA 2CYCA 3IUBA 4N65A 4YDHB 2ISSD 1WVMA 2PZFA 1NF8A 1VP3A 3DF9A 3OLWA 3WFJA 3WK9A 3ZCVA 4R01A 4D0RA 5K0GA 1CRPA 1I7LA 1OGJA 5K4AA 1RRMA 3OJ0A 5LOVF 3VYRB 4ZDKA 1YGPA 4FP9A 3IUMA 4KGXA 4MWCA 2XCIA 1T9AA 1V71A 4G5OA 3M6UA 2IKQA 1P7YA 2HV8A 4LJYA 4EKNB 4D02A 4E1VA 3M33A 4RE6A 2IU6A 3AVYA 4HQ6A 4BUCA 3FKQA 5DN9A 3IUNA 4UM9B 4WZZA 2R8RA 1E8DA 1WMDA 4IJ6A 4XYEA 3QU5A 3IEPA 1Y1TA 1U9CA 3FZYA 3PRKE 4LN1A 4RV4A 5FLEX 2AEMA 5FXMA 3BQNB 2VJCA 3GF4A 2VT3A 3JQ8A 5IJ0A 1M83A 2JHFA 2NWQA 4LCEA 5CJPA 4GKKB 3S2YA 2RK4A 1ZNWA 2VJMB 1M1ZA 4W99A 5F12A 2KB0A 1J24A 3NNDA 4F71A 2BMDA 1UZUA 3R09A 5L6LB 1TQ6A 3EISA 3H1PA 4AJ1A 5T8KC 4BCBA 4Z4QA 4KC0A 1DKOA 3V4SA 1NG9A 3QX3A 2BCJQ 2GZ3A 4YAUA 2UVPB 4KRYA 3IKJA 4LMPA 3RM3A 5HOEA 3WIOA 3HB4X 4MKZA 4JI7B 3CFYA 3ETNA 3J7AC 5D1NA 4P0QB 2TRSB 1L7XA 2FZGA 3PQ3A 4ND4A 3TSOA 4C4RA 4AF6A 1SQ0A 1Y63A 4JELA 2VDWA 1KDVA 5CH8A 1DG9A 3STVA 1BAPA 5ICEA 1NXSA 3LXXA 3PYLA 4BU0A 4G8CA 1PNQA 1FS5A 2IP1A 2ZJ7A 3DD1A 1WW3A 2QF7A 5DW0A 2HK6A 3I6QA 2AQIA 1TJNA 1AIPA 3TNYA 5CB6A 1UUFA 4ZAVA 1CQXA 4HYTA 3OSUA 2H1VA 4OYLA 2ZUFA 1YZLA 4KWHA 3CPSA 2BY4A 1IOVA 4LYFA 4EBBA 1K6EA 2WIDA 3FOZA 3CBGA 4CKZA 1LEHA 2VXCA 1S2OA 1EFTA 4LRUA 4BMZA 5KC8A 1V48A 2F43B 1XZHA 1THTA 2E3JA 3MWJA 4GBJA 4OKSA 1ECBA 4JLVA 4RVNA 5GP1A 3HNRA 5LIPA 2JI8A 3KJIA 2WT9A 3JVVA 1OWMA 2J0UA 2ORYA 3VR3A 3TCKA 3MOSA 1PJLA 4DLAA 5LP6F 1EIZA 2HBRA 1I3MA 3W5UA 2C7BA 3TE6A 1QCDA 2QMYA 3LC1O 3QJGA 4JSYA 3ENKA 3QU7A 1QFSA 2PJRA 2XE4A 4I81A 1NF3A 3UJNA 1FXUA 5AJVB 5DJ5A 4AWBA 1YKFA 5D87A 3BCSA 3QBEA 3L1KA 4HXEB 4NU5A 3SZUA 1DEOA 4FQ5A 3V9PA 4ZVNA 3OAAA 1X80A 3W1WA 2JKVA 1TFRA 4RTSA 4AWAA 3N0VA 3E5HA 3GAZA 1C0PA 3P9YA 3GLGE 4PO8A 4AJKA 4Y2YA 1G7TA 1HT2E 3KLBA 5CG2A 4QPDA 4IO0A 1SOVA 1Y5IA 5REQA 4S35A 5KPDA 2R6AA 1AKYA 1H0SA 1OLUA 2V7QD 4NBWA 4YQFA 1LJUA 1CUBA 1D0IA 2YV1A 1PT5A 3UW1A 3HVRA 3CRQA 3LC7O 1QRAA 1TOAA 2JGAA 2DEUA 4L9AA 4BLRA 4DMHA 1QRUA 1IN1A 5KYUA 2PKEA 4CLRA 4R31A 1ZXLA 1BU5A 3EF1A 4HRYA 2BFEA 2LGJA 2QRMA 1XTRA 4GLOA 3VPFA 2J31A 1SKQA 4UCXA 3IBYA 5MDHA 3GLGB 3AJ9A 3OO1A 1G8MA 1W4BA 4QYMA 4UARA 2IIBA 2X15A 3DBLA 3IUQA 4UHFA 4A2PA 3GOHA 3VX3A 4CMKA 3INNA 3PE6A 5FTNA 3G2HA 4OAQA 4X20B 4ZO8A 2IY7A 2I3DA 2HA5A 2NZ2A 2L0XA 2QAGA 3WMWA 5HIKA 5GIPE 1KYXA 3VKHA 3WKBA 5KJ6A 4N40A 1YA8A 1KDZA 5CW1A 1KFKB 3IBSA 4LTMA 2Y0PA 1ISPA 2IIQA 4OHVA 4NTZA 5CFOA 5BUCA 3C5CA 2QGNA 4EECA 5DMXA 2R79A 3FCEA 3PZBA 1TDJA 1RZUA 3DTYA 2BFCB 1WZNA 2RAVA 4RKWA 4KXQA 5K0EA 1FY2A 1UXGA 4OXQA 4KQFA 4Q24A 4EHJA 1G9XA 3IHLA 4B1FA 5ED4A 4FEGA 5JNUA 2R87A 3FM9A 4HADA 3KHSA 1E79A 1HZZA 1NR5A 1YFKA 3ZJVA 4L8WB 5HZMA 3JZMA 3V4ZA 2HY7A 3SBOA 3CEPB 4ALKA 4MJXA 2AX3A 5AVQA 1N5DA 4UNNA 3MMPA 1JIJA 2FUKA 1P7WA 4CL2A 1E62A 2DG2A 1PJCA 2CYAA 2PVSA 3LFHA 1EGAA 4ZCLA 1OVGA 1I1OA 3R24A 1C8KA 3AR7A 1R27A 3F4BA 3R6TA 4CMBA 3FW1A 2VCYA 4LPSA 4M6WA 1T6NA 5DHUA 3HXLA 4DANA 3ND6A 1N9GB 5CA0A 1VLMA 3FMOB 1VG1A 1X1CA 2ZROA 2IE0A 1VYUA 3CNOA 4GWLA 5T41A 3RTAA 3HU2A 3SF8A 1Y8ZA 3VR0A 1SCUB 1WVGA 3KT6A 1EVYA 4FBMA 4JODA 2AXQA 3EVAA 4L08A 5E4JA 2OHVA 4QD3A 3THYA 5BR4A 1RMYA 1ONOA 2B5WA 4D4JA 4DEXA 1H2ZA 2VYFA 4TL6A 1N0VC 2O0KA 3ROXA 4DTCA 2V65A 5TXGA 3HU1A 2GBCA 3WIDA 4N5DA 3TIIA 1B2LA 2B4AA 3PNLA 1EFCA 3S2GA 2ZTUA 2GOYA 3VHXA 3E9YA 2FDXA 3SXPA 4UBNA 4J4TA 4RVCA 3PJDA 5DWVA 1N4DA 3CXUA 1F2UA 1JWAB 2QM0A 3DKRA 5NLLA 4PPGA 4PG8A 1CETA 1KYZA 1BN6A 3LC2O 2EHJA 1QH8B 2FJUA 3WGZA 1MC5A 4F2WA 4D9NA 2X4IA 4ND5A 1Y9AA 2PUDA 4BN0A 4JJ8A 4E32A 2G1KA 2EYQA 1DAKA 3GFBA 5B4UA 5KVCA 2K4MA 9MHTA 5K0ZA 3AUAA 1IJFA 4HB3A 1H3NA 2NAFA 2A5DA 1KERA 4IOMA 1U65A 4Q82A 1PUIA 1EK1A 2D54A 4B6GA 5KTMA 2JLQA 4DLXA 2PE5A 2QVBA 2FZWA 2PMKA 2K7ZA 3EVFA 2D0DA 3AUYA 4J4HA 3U0VA 2RBGA 2ZIZA 1W5EA 1T4CA 3A1TA 1EUDA 2BGNA 4PFKA 1JKFA 3NDRA 4M9RA 1PV2A 4URUR 1DC8A 1JHQA 1G6HA 3U81A 2DY0A 1BXGA 1KBQA 2MYPA 2RJNA 4XYMA 5K1ZA 3UTDA 1TKCA 4KKVA 4X60A 1TK3A 2X1LA 1TZBA 2B4QA 4GRAA 1GU1A 1VG8A 1NN1A 1OASA 1TTQB 1X0VA 2ODEA 1SUAA 4QWWA 4Y1FA 2BEVB 5E3HA 3B52X 4D44A 4W5RA 4L28A 2R25B 1Y8QB 3LHIA 4ENSA 5EJ9A 3VH2A 5EP3A 1MRNA 2RH8A 4P36A 1J99A 1K0FA 1UOEA 1ZNZA 3BXGA 3LQKA 4DDKA 1V5WA 1MPTA 1WLSA 5BWOA 3QPVA 4G89A 2W58A 1IBLB 5DEOA 4D25A 4LWOA 4NQRA 1IEXA 2IYTA 3G5AA 3GY0A 5ALTA 2ZATA 4L74A 3RVKA 4QGSA 4IJQA 1ZNQO 1W5AA 1ZM7A 1HUQA 4OQZA 8LDHA 3Q0EA 1JWLA 2CUNA 2OXEA 2SNIE 2X22A 3C2QA 1KO1A 4GWKA 2CUZA 2WSYB 2ZRNA 2ZJZA 3CMCO 3I92A 2AOVA 1KY3A 1OXKB 2WM3A 1EFHA 1NBOA 2JK1A 1BMDA 1SUEA 2GHQA 1Z7YA 3DPSA 4Q5IA 1Z75A 1L7BA 5FUBA 3SJAA 4CG0A 1UZAA 2P68A 3Q6MA 4K8RB 3D3JA 2GARA 4O4LF 4RXMA 1OX5A 3Q15C 2G9RA 1M34E 2WRZA 2ZRMA 1IMJA 4EA6A 2CEKA 5E6SB 3LOQA 4FIDA 5JNRA 2FSSA 3HLTA 3IVAA 2GETA 4E2WA 2P5SA 5DHQA 1ODIA 2JIOA 5EIBC 1KYVA 1OXVA 3BQMB 1ODJA 3R0ZA 4ZQIA 3R9IA 5KQPA 1PWXA 1GAEO 4RA6B 4P5EA 3ZBUA 4E21A 1F20A 2C5FA 4DZRA 4RZIA 1J42A 5JNVA 4GPD1 1CS0A 3DBLB 3C16C 5CT6A 1QF7A 2EWMA 1YIDA 2GN6A 2RHRA 1OGIA 4P3YA 5AICA 3EDYA 4I0WB 3HVHA 1L8AA 4I36A 2IHZA 3OIVA 4HX5A 1Z15A 3JWPA 2VRBA 4YJ3A 3ZKAA 2ZT5A 3UAGA 2ZWIA 3R3HA 4YMUA 2PG3A 3D7SA 4O2BF 4XGKA 3IUPA 4K6FA 4F4CA 3D6VA 3G3EA 2O59A 1CY7A 1ZI9A 3KKMA 3W9BA 2H48A 3HY6A 1Y9DA 1ZD1A 3H8SA 2JK0A 3TTTA 4BBJA 1C3JA 1GJRA 2YYYA 4QSHA 1YB7A 3KCNA 1KJ8A 1JIVA 2XB9A 3P19A 2JAUA 4BATA 2EATA 4OIMA 5T6BA 5BN1A 4OH1A 2CC2A 3QXJA 1CDDA 4QTTB 4R8MA 4RVDA 3AJDA 1ZD4A 3RSGA 1ZGBA 3C6KA 3ILSA 4TV9B 1HGXA 1OV4A 4XW2A 4ZKDA 1U2QA 3KZKA 1R9NA 3IRVA 5P21A 1M34A 3ZV4A 2G1UA 3GDOA 2W2TA 1SBYA 1NKVA 2BZ0A 4NR0A 4ILKA 1FFXA 4LOAA 1ZOSA 4J91A 1GU0A 3ESBA 3OIUA 4R1UA 5EJMA 1FL9A 3GD5A 3BHIA 2EBWA 4NCAA 3JWEA 1JJFA 3DBHA 3PRJA 1F2DA 3KQNA 4MYCA 4UAUA 4E5VA 5CYGA 4B3RB 2P67A 3A25A 1E1QD 1IBKB 4G0ZA 4MQ4A 1CUIA 4CRWB 1DAPA 1OXBB 3G5MA 5CA1B 4F85A 1J33A 1N3IA 3Q4GA 1SKMA 3U62A 4A91A 5E9AA 2Z98A 4GLLA 2X1VA 1RJWA 1P2GA 2E85A 1ESCA 1UFQA 3JQAB 1QCZA 2HQRA 4H59A 2F48A 2XECA 5AKGA 5GAJA 4ALIA 4CIWA 2VNSA 2YCBA 5ENVA 3AF3A 3U3OA 2E89A 1N1MA 2A6PA 1CR4A 1E2FA 3LUFA 4KP7A 1RI4A 2JFYA 3O2SB 4V38A 4MVJA 2ZBDA 3K1YA 2X0KA 3G1WA 2F59A 2HDOA 1CKEA 5FFMA 5B6JA 1YD7A 3FX2A 1Q6ZA 3PNYA 2GTIA 5K3FA 2PQMA 1GUZA 1J97A 1MJGM 2GWRA 2QRUA 4QYTA 3IAS6 1TAHA 4M89A 3RUIA 3V6MA 4LZWA 3WBFA 8GPBA 5LIRA 5CB4B 1AZSC 4MQ5A 1Z37A 5JS8A 5JISA 1GL6A 3PC8A 2GHTA 4YC7A 2MINB 3HBJA 3HSSA 1UXOA 2BN4A 4KBFA 4EIWA 3HJBA 2GCPA 4C07A 5LLTA 5CBKA 3A9TA 4KQIA 5GTDA 5I7WA 1GPKA 1V4NA 3SX0A 1LPMA 2WF8A 4JYAB 1Y6QA 5CDFE 3SQWA 3OQ1A 4L9SA 4ZOLF 1EVIA 2PH5A 3O2NA 3SVZA 3WKDA 3ZGNA 4I50F 5I9LA 3AM5A 3RGGA 1TVKB 4OBWA 4O02B 3D8TA 3ZNOA 5MN5A 1WJGA 3I04A 2D1FA 5JBQA 3RK4A 1Q74A 2WTMA 2GBPA 3E9DA 1F3LA 1ZGGA 4R1SA 3TLZA 3VC2A 2XMRA 5JH7B 4P4UA 1SVIA 2A5YB 1KIFA 1FP2A 5IH7A 5LKAA 3T41A 3IELA 1JHXA 4NS4A 3QKTA 1T0PA 3TUZC 1UBRS 1S4QA 5FNZA 1AZWA 2FQ1A 3CR3C 4KO8A 5ARBA 1Z39A 1QHGA 3MG9A 3QW2A 2VG8A 2VSXA 1A27A 3OA0A 4S1NA 1N3YA 2AFIB 4MRRA 1SKAA 4I66A 1C1XA 3LHSA 4I6EA 4DCVA 5LDDC 5K8IA 2JASA 5BV7A 2AG5A 2VDRB 3QE4A 1ULTA 1YR1A 4PX9A 2WWVD 4F4UA 2G70A 3PEWA 1S7CA 3BRCA 5HNKA 3UH0A 4MIYA 3OZIA 4R7GA 4QOEA 3QM1A 1GFIA 2P41A 3RT1A 5L6MB 2XXAB 4X8MA 5TARA 1FP1D 1VTKA 4GM1A 3RFXA 1OKKD 4BGUA 1N92A 4YMWA 1O96B 4FLMA 3B6MA 4UFPA 3AXTA 2PMEA 2CB9A 5CM2Z 3NIWA 2NVWA 4L3WA 4UDXX 4CM8A 1XJ0A 5B3JC 3REFA 5AK0A 1EFUA 3KVOA 4QUIA 3TTVA 3JAWB 3RC8A 5EIWA 2ZTSA 1U8AA 1TVCA 2H92A 2TMKA 1CUUA 1NJ2A 4G1BA 4EPTA 1D6NA 4F11A 2FPUA 1G21E 3DEJA 2YN0A 2A92A 5CPBA 3GLHE 1KI2A 4V2UA 1R8SA 4CV0A 3Q2OA 4NU0A 2H0RA 1E3QA 4PF1A 1BVYF 1UT6A 3ABSB 3IXLA 4RM2A 4ZT2A 3DZHA 1E2QA 2CBXA 4JYPA 1B8PA 1IHOA 4KKXB 5LXTF 3IQWA 3N8GA 5F1KA 3F73A 3UAXA 2PZBA 3DPUA 3JZDA 4ZVVA 1W4ZA 5TDHA 4AULA 1XC7A 4KODA 4CCWA 3KS9A 2C92A 3AX6A 1ZONA 2GCGA 2NU7B 3FDJA 1W35A 3EJ6A 2AA3A 1MA0A 1SHTX 1W29A 1THZA 1E1RD 4DRXB 4P38A 4PAOA 1Z33A 4D80A 1SVMA 4B7CA 1B8NA 1Q12A 1FU8A 1WXGA 3NX4A 3OE7D 4KRXA 3IKMB 1Z56C 1VLLA 2GXUA 5ILQA 3ROQA 3INRA 3IR7A 4MV1A 2ZQYA 5BSFA 3NMUF 3URMA 2XZPA 3PPYA 3P9IA 1LDGA 2Q9CA 1PGNA 3DD5A 4JVLA 1ZRNA 3GRCA 5IXYA 3OMWA 4IDDA 4EMTA 1RM3A 3PQ7A 3OJCA 4E6PA 3SQLA 3O90A 1GPWB 1PWYE 3RTCA 1EP2B 3ISTA 1KR2A 3BXFA 4HDNB 2JANA 2AUMA 3BWYA 3Q7EA 3GP3A 2PXCA 2RB4A 5D6OA 3KYDA 4M83A 4XB6B 2CXXA 1JGTA 1W581 2BE9A 1RM4A 3LMKA 4J0JA 1R6VA 3CUVA 4QEDA 4E1AA 1FNDA 1T5HX 1QP8A 1VHTA 1KVTA 2P1ZA 2Y4NA 5H83A 5K09A 3RTDA 1WD5A 4GBED 1AKRA 1XWIA 2XSZA 2EZ8A 3EUEA 2IV7A 3U3XA 5ALDA 2VDQB 3BN3A 2ZDQA 1F4VA 3BE4A 2JS7A 1ZBQA 5EZSA 2FU5C 4N01A 5HQ3A 3FR8A 3EHEA 4HB4A 3IXQA 3EIUA 4C4YA 5IN4A 4JQZA 4HB0A 1TF7A 1ZEJA 3QU4A 1DC6A 1JTVA 2GCIA 2GEKA 1TIPA 2C78A 4Z99A 4BO7A 3L4KA 4EABA 4J1TC 2QK4A 3PUHA 1IULA 1FQWA 2JGDA 1TA4A 3FVTA 4WH0A 5CK5A 3C3XA 3IVCA 4V24A 1JDBC 3HCWA 4CM4A 1RBZA 1QLWA 2ZIFA 4OTZA 3K3PA 3QLJA 4MKGA 4OBEA 2AR7A 3PDJA 2QUKA 5LP6A 3Q7IA 4J7CA 4CF7A 3UJ3X 3GHHA 4KR3A 5TQ0B 3A36A 6GPBA 1L5KA 3H16A 1BDHA 2XOXA 1NXTA 5C5CA 5SYMA 5IHPA 5TRTA 1JT2A 2XOKA 4FFVA 3LL4A 3BZBA 1GTMA 3UUGA 1QZ3A 1EE1A 5FBKA 4D4MA 2QL7A 3JWJA 4LZJA 4WXEA 5I7FA 4GR9A 4JYCA 3TQSA 5C2JB 1J1IA 3KSUA 2P7IA 1PDVA 4C2AA 4IVQA 2Y05A 8ATCA 1OPXA 3T3GA 5CA0B 2I1QA 2E7ZA 1HSZA 1IZ7A 4U7FA 5K3AA 3MBIA 4HSGA 4OHUA 3V8PA 4ACBA 4E13A 1KNQA 9LDBA 5JECA 3CT4A 1D4OA 1H8HD 3N07A 1F1JA 4JK3A 1JH8A 2RI6A 1VHLA 1YR2A 4WBNA 2XUFA 3TLGB 2GYUA 4AS3A 3OX4A 2VQ3A 1F17A 3I6ZA 1DAHA 4ATNA 1XMSA 5DLEA 1JQ3A 3HM9A 3E7WA 2FOIA 3L4SO 1EFPA 3F3KA 3HYTA 3SS9X 1JR4A 2ZSDA 4MO9A 1IPHA 2J3QA 4I1PA 1JDVA 1KIMA 1II0A 1YSCA 3GJ7A 4JEHA 5F4BA 4IMPA 1Y5NA 1Z2NX 2FUG6 1FRFS 2I67A 3WLLA 1KS9A 3C97A 2H2WA 3DP9A 2C8JA 3MRXA 1SQFA 2I6UA 3AB3A 1J8FA 2GA8A 5ANRB 3RWBA 3S44A 2VAXA 4PC2A 1E9RA 4LRWA 4GDFA 2FZVA 4M7WA 5D3MB 2FPWA 4OO3A 2R5NA 1C7ZA 5LUBA 3SCZA 2BFDA 3OEWA 2YOGA 4GT1A 3VYSB 4D8TA 4EG0A 3EK2A 3VJMA 4I9NA 4C4SA 3HO8A 1OU4A 1YZNA 3O93A 2RHDA 4G97A 4GVPA 1XZQA 3HDYA 1RCTE 3TTSA 1IN7A 2W2VA 4E4YA 1S5PA 1V9LA 1ZZEA 4U6QA 4IHJB 1V6AA 2A9RA 2AC2A 4AG3A 1Q0TA 1PZGA 3G0CA 4G5XA 4N7RA 2CXSA 2PEYA 3ILXA 2GO1A 3O6VA 1KGSA 5J63A 3O3MB 3E6AA 3HCBA 4CR8A 4ZAYA 3B3QA 3P5BA 4G24A 4Z54A 3USZA 2SKEA 2R66A 4HPWA 4P5DA 1SVKA 4UBOA 4AUKA 2IIVA 3EWSA 2ORWA 4OJKA 1R6XA 2VH2A 3C7TA 2JEZA 1M1XB 3OPYA 5G53C 1U2DC 3UPDA 1NKTA 2PMCA 1ZIYA 2YXBA 2HA6A 5CGZA 4XRRA 4ZFNA 2Z6UA 4LGMA 1OT3A 3KLOA 3O73A 1A2OA 2L18A 3GVPA 2P6OA 1P9RA 2G8LA 3TAUA 2QL5A 3JXEA 3D0QA 4RPGA 1DO8A 1QQ6A 5EXXA 1YR7A 3E05A 3L8YA 2VPYA 2WSIA 3U1TA 2B4KA 1B8UA 3VI3B 3UWPA 1NVMB 4FNOA 1RYNA 2C9CA 2GM9A 4MWBA 4Y6RA 2GDZA 2R2AA 2SICE 2ZPAA 4Y2XA 3OLQA 1S96A 4TWAA 4FLEA 2PRSA 1HE5A 1DXOA 4R1LA 2Z5VA 4UQPA 4V3CA 5H82A 4BFXA 4TV8B 4DAEA 1HDEA 4NAVA 2ZRIA 4US2R 1P1IA 3PNBA 4R9NA 5CFNA 4MW4A 4F91B 3NYIA 1DCKA 1MRSA 2GBLC 1ZJZA 2AR9A 4IVPA 1KMIY 2ZB3A 4RQTA 5CVVA 3ETJA 2QSZA 3DLPX 1SBTA 2C2HA 3EXIA 5D1HA 3TGWA 3W78A 4C0JA 2BONA 4E12A 2HHAA 5CDHA 4L0DA 4LJ9A 1IXSB 1UADA 2P9TA 4X9XA 1T0UA 1WXEA 4EPWA 2DULA 1QTIA 2NOAA 2NAPA 3PD1A 3RVJA 1LVGA 2VTEA 3F7TA 4IMRA 4U2GA 1XPUA 3GBVA 2C9BA 3SKYA 3BMXA 4A9AA 1KBZA 3BIXA 3ZLVA 4G86A 4KXVA 4ECEA 2Z4SA 3G9UA 3PTLA 3L9WA 4HQRA 4ZKEA 3WSTA 4AUEA 5JS7A 3N2LA 2WSSD 1JDSA 1ZU4A 5FFFA 3MXOA 1QOQB 1T5DX 3JU3A 3GRZA 3OY7A 2C2WA 2EX4A 1L4BA 3EVGA 4KUGA 4CTKA 3D6UA 1H4VB 2OFXA 4MA4A 3BSWA 4KV7A 1QFZA 2R44A 3TW8B 3DOJA 3CWCA 1MX3A 2AG0A 4XEUA 2R4TA 1DZ3A 5EY5B 3SYTA 3Q98A 1JEDA 1OWNA 5HYVA 2GRJA 4JITA 4FINA 3FD8A 4Q3EA 5KWVA 1C50A 1NZDA 2QMEA 2PLFA 3KT8A 5K45A 1USKA 2CFTA 1GRNA 1HT0A 4ND8B 1PZXA 2WHEA 1PE0A 3IEXA 4N9QA 4WKCA 5BV8A 2Z2KA 1DJLA 3LYUA 4KTTE 4O0LA 5JAPA 1NXOA 2O1WA 4RJKA 5EZYF 1BGVA 4JJFA 5A7FA 1W88B 1JMYA 1AURA 1GUYA 1JQAA 4ONEA 1K3UB 1CG6A 4GI1A 4DJAA 4MR7B 4WLUA 2IBSA 5IW8A 3IHTA 5ELMA 1KO7A 2GHRA 2Q3HA 3Q85A 4XZ3A 4UDNA 2PSJA 2BHLA 4BWGA 4XX1A 2C2GA 2FFAA 2Y27A 2QGZA 3WFIA 4X1KB 5KC9A 3SDSA 2G0NA 5JPIA 5KOIA 4JC8A 4HDNA 2HCRA 4LZPA 1XT6A 3JW8A 4KBYA 4PIVA 4V0SA 1VCNA 2GJ4A 4KXLA 4JC4A 3OO0A 3RDPA 4BQIA 4Q15A 1Z17A 4DLZA 2QZ9A 3WDLA 1G5QA 4J75A 1U6IA 2GJ8A 4MIOA 1KHHA 1B6RA 3MQFA 3NT5A 1I36A 3LYAA 3E4DA 3G68A 3D5QA 4YMGA 2I2FA 2ZBRA 4Z5XA 4MJ7A 1MT3A 5HOQA 1NLUA 2HOQA 3H6HA 3ICVA 3V4FA 1RRKA 5GVRA 1FE8A 1OILA 2GILA 2X58A 4M55A 5I4KA 2C98A 1MC4A 1VJRA 1XQ6A 2WDPA 3SOZA 3ZWYA 1ZQ9A 1DXQA 4CGYA 4IXDA 4G0WA 2PLAA 2XUGA 4L73A 3DFFA 3ZV6A 2XEDA 2GD0A 3UKJA 4RLHA 1YCDA 1DIHA 2A57A 4TV8F 3T34A 5M5BA 1WB6A 3PS9A 1NV8A 5EI5A 2EGUA 2JIQA 2IDJA 2X0JA 1AMOA 1ULUA 1JZQA 2GTPA 4AECA 4CDNA 4YMVA 4DHWA 5KNBA 3KLMX 3NWOA 2QUIA 2QWXA 1I10A 2AZDA 4OXRA 5IAJA 2AOXA 1YDMA 4KK4A 4ZHSA 3M9LA 4JNCA 4EBFA 2EJVA 3VAZA 4X65B 1PN3A 1T5SA 1IZZA 1JSLA 1CZNA 1LSOA 3EQZA 4HN2A 1PO7A 4PCVA 5BQFA 1DUSA 2WP8J 3VA7A 3OCYA 2AN9A 1KJZA 5LUAA 1W9HA 1GGEA 1KVRA 1LB1B 1QQTA 1T6XA 4JIMA 4RF2A 2J6HA 5H59A 6REQA 5J58A 4EAQA 1JYSA 1C3LA 2B92A 1YT5A 2XWBF 3MD0A 5BOVA 1SRQA 3MM4A 5KQGA 3OHMA 4RCYA 5JJLA 2ZSUA 1FFWA 2QM8A 2W22A 3DT6A 4NULA 1KI9A 1Y9EA 4UCFA 3TNJA 1KJNA 3MRTA 3ILHA 1PG5A 1S8FA 1DKQA 2X23A 2I3AA 3DNMA 3GA0A 1B43A 3Q3HA 4DGSA 1O0BA 2BV3A 5UKDA 4WXRA 1MO3A 2WM8A 1GQQA 1K7YA 4ARUA 2FPGA 5IVDA 3W8NA 4B7UA 3ID6C 1QQ5A 4MAAA 1XZGA 5J2UA 5FBRB 3NFYA 3R5SA 5EUBA 2BFAA 3IJEB 1Q1GA 3N2ZB 2X2EA 3LRXA 5LXTB 3R6WA 1K86A 1FXWA 3T06B 3NIGB 1VMKA 4YH1A 3MBOA 2CSXA 2BRUA 3BYZA 2WG2A 3BJMA 4HQOA 2J48A 5FQNA 3B7GA 1JMKC 4N3GA 4DXHA 3MW8A 4EARA 4YMSA 4R9UC 2ZJAA 1J0XO 4J6FA 1EDOA 3RT9A 4AICA 2ZKLA 1SVWA 3OCXA 2GKGA 1X2BA 2FUNB 2ZJ2A 2E82A 3ONVA 1KZ4A 2NIPA 5F2EA 3SE0A 2ZIUB 3RRYA 2CL0X 4MWOA 1XR3A 1U7UA 1FMCA 3UZUA 4Y2SA 5F33A 1RJ9A 4I2NA 1NXWA 2O6LA 3S7TA 1V1RB 2ERCA 5TC4A 2FLVA 1Z4IA 1CY6A 4LRQA 3N2KB 4RMIA 2UZIR 5YASA 4TYQA 4CV3A 1VZ3A 4ND6A 4RLFA 3QQPA 4BEBA 2Y67A 2ZK7A 4QXPA 2R7MA 3W7AA 1K4YA 1IAQA 1T3SA 2DFNA 1FX0A 3AFGA 4HAUA 4F2GA 3P94A 1BDIA 1M5TA 4HEQA 2WJGA 4PYQA 5GQSA 3WQSB 3I39X 4GXRA 4A8JA 1W48A 2I4TA 5CPFA 2XPCA 3HXQA 2DTEA 2AJLI 2VQSA 2EFEB 2Z1DA 4XVQA 1LTQA 2PIDA 3QFTA 2HTFA 5HUQA 3U1BA 2UYYA 4HEA6 4AQYB 2HDHA 1AKVA 4Y2PA 5FFNA 1LQTA 4TTAA 2OWEA 3IE2A 2CJPA 1JN0A 2ZRBA 3IAAA 1YVRA 3H1GA 1ZSYA 4Z1MD 1V47A 2IH2A 1T4CB 4HVCA 4R2JA 3WRXA 4JI0B 2ERXA 4HJRA 3S2SA 1H6DA 821PA 3L6CA 2C5BA 2PWZA 3THXA 1W87A 1XNHA 5L53A 3C1AA 3L8FA 3PNSA 4IM7A 5I3CA 5A3QA 5EJGA 5KYGA 2WTAA 3D1JA 1QQAA 4Q3BA 1B23P 2FRDA 2OKCA 3U4GA 3GXOA 2M9MA 3V46A 5BQ3A 1JHMA 1TW3A 3RVBA 3V5NA 1N0IA 4NG5A 3STTA 4DV7B 1DTSA 4TVOA 5IZCC 5JU6A 3LI2A 4JJEA 1QO9A 3L7NA 5JSZB 3TMYA 3H1FA 3FHTA 2ZT7A 3C6XA 1ZN7A 5HF5A 3Q7RA 2QD5A 3U4MA 1NSYA 5TMBA 4EQZA 2WA2A 4TSFA 4B3IA 1DC3A 3K8ZA 1FVHA 3WDMA 4ESOA 2XRZA 4QBKA 2QD3A 5ERYA 4ZC8A 2XGSA 1MAWA 2B82A 2EIXA 2FG5A 5K8JB 4B4DA 3UMYA 4C2TA 4K0KB 2VNAA 3DMFA 3EUWA 4KR9A 3NV7A 1UMDA 3JSXA 4OFZA 1QPBA 3GJQA 1XTBA 1RRFA 2COKA 2XOKD 4YS6A 3W90A 2P77A 2XGOA 4OCZA 5BW6B 5CXSA 4EA8A 2AG1A 4JJAA 4PE5B 1GGHA 4W8GA 2Y93A 2BOVA 4L0CA 4OHZA 3K09A 3U48A 3OEED 5HILA 2JRLA 3H7AA 4WMLA 3SWWA 3G0OA 5DHPA 1FZQA 3J81A 3ZQ6A 1RPAA 3KKKA 3I52A 1M8GA 4INZA 5JOQA 4ENVA 4NBLA 1A1SA 2OVBA 1UKBA 4RHXA 1XRMA 2ONCA 5FPTA 1Q1ZA 3BCRA 3K0AB 1VXRA 4JC0A 3Q40A 1X87A 4YMLA 1VG9B 2DSTA 3T7DA 4ARAA 5KDOA 2GJ9A 2HZ7A 2HBQA 3P9KA 2FPPA 1FNSA 1XTJA 3BGWA 1P4AA 1PR6A 2E4YA 3DE4X 2BJVA 3LIPA 2ZI9A 4KG7A 5T3YA 2XB4A 3K9HA 5CYOA 3C6QA 5DB4A 4CETA 3WRYA 4PW0A 4DIMA 1TZ2A 1JVSA 3WAGA 4KX5A 4GM4A 1QU2A 1QTRA 3G2IA 2C97A 4CMIA 4ENRA 4I3HA 3PFFA 1CEQA 2NZJA 1M33A 1OAAA 1KJIA 3WNCA 5FJJA 1HA3A 1RQXA 3B51X 3GZJA 3DDSA 1WUHS 3HE3A 5G2OA 4L85A 2EKPA 5TIIA 4OB8A 1KZHA 1A7JA 4N0DA 4H3VA 5ERGB 2I2WA 1EH5A 3MSCA 3ABQB 2XV1A 3G23A 4C0HA 5LQCA 1AMUA 4RIHA 1J2JA 2GF0A 2XT6A 3G88A 4Z3OA 4N48A 3NEAA 4TTPA 1YZ3A 1N34B 1SXJC 4IP0A 1DFGA 1X7HA 3NBQA 3JQEA 2AKEA 5EERA 4GQBA 5BO5A 2XQFA 3TO5A 4MVXA 2FY8A 4QEKA 4MV7A 2DQYA 3WL6A 3OMLA 1FFYA 1T9ZA 5DXJA 1IY0A 2BT4A 3BRWA 3GX1A 1ZJ4A 4QT4A 5IXJA 1WXDA 1C8LA 3T4PA 1AKUA 4WIAA 3RI3A 4B9AA 2UV8A 3ZBQA 3N3AC 4MQEB 2XQJA 3LDHA 4M2LA 3VR4D 1HH4A 1E6KA 2Q0HA 4YUYA 3QXXA 2I8AA 2DECA 3FHOA 2Q2VA 4NH4A 1Z4NA 1OI7A 1Z5WA 3NUQA 4BV8A 4DR4B 1JFLA 4JVNA 2DC1A 2NO5A 3QVGB 3MCAA 4RSHA 4F06A 4F04A 4OLFA 4YRFA 5F2OA 3TGLA 2ZAIA 2G67A 1S6YA 2RIRA 4IOLA 3PEVA 2QZSA 3T52A 1CF9A 4IHQA 2E4XA 1G60A 2IYOA 3A10A 4M0EA 2YWHA 5B3AA 3QVMA 4FXPA 4YRBA 3NW9A 1WHSB 1Z18A 3LV8A 4JBLA 3WRWA 1ARZA 4C9BA 1EA5A 2KI5A 3PHCA 5A71A 2CHUA 5KX5B 4MGKR 1FTWA 1WG8A 3L7YA 4GGMX 1ZWKA 3FSGA 2ZUTA 3EZFA 4OH7A 4F7DA 3GAAA 4V0QA 1LH0A 1LPSA 2MR6A 4XCVA 4C4TA 3FHLA 4UHEA 5EJ8A 1B0UA 3DWFA 2HGSA 2PV0A 3K1AA 3KBOA 4GMKA 3GLFB 3OOWA 3DE7X 3OFKA 4MQUA 3EMKA 2F1JA 1VB5A 2P3QA 3I9OA 4TXHA 3OJEA 4MHSA 5A9TA 4O2BB 4FK8A 1U4OA 2Y1DA 3ACDA 4JLKA 4KNYA 3KNZA 4O2AF 4M0CA 3VH1A 4Q1CA 4EEKA 5JRJA 1H5UA 1OKKA 1KOLA 1A7AA 3DEAA 3ZR4B 1ST2A 1PWHA 4UATA 3WA7A 2GGSA 3E7FA 4RFSB 4HH4A 1Z4PX 4M1KA 4BU1A 4GKVA 4YROA 3NT4A 1P6UA 1U2ZA 4GLBA 3SJZA 4F3YA 4LJKA 4ZMBA 2A3NA 1SQ6A 4N3NA 5KSYA 1P2BA 3KEQA 5LMUB 3EGDA 5BMOA 1IUOA 3ZLBA 2XLBA 3HO6A 1SGWA 3LAWA 4Q6WA 1R74A 1GYRA 2AF3C 3GZ4A 1BW9A 5ECGC 1E60A 1W5SA 3FJYA 3WHLA 1Y9ZA 1GZDA 4M9QA 4BLUA 1DGQA 5G40A 4Q9DA 5KUTA 1TQDA 3Q12A 4KVAA 4L8GA 2WYOA 5KKAA 2V9ZA 1H2WA 4A4DA 4AD8A 3CKMA 3M89A 1F9EA 4PQYA 1EQAA 2IXGA 3ZQ4A 2VSNA 1HFKA 5F3DA 3ZI7A 4KAFA 4BVKA 1UXKA 4JH0A 4FT4A 4WASA 3UJ7A 3TZHA 5CCDA 4F93B 2FPXA 2JG3A 1P2DA 5HRUA 1XPRA 3RTEA 1XU4A 1P31A 3FZQA 5LZ2A 1MIHA 2BCEA 3OTGA 1JFVA 2XUDA 3K9BA 2VVTA 1I4DD 2EARA 2GFHA 4M54A 5AW1A 1J7JA 1G63A 3DTTA 4UTOA 1OPRA 4RQUA 2QRPA 3I9KA 4Z86A 4U9HS 4CHTA 4Q1EA 3OE7A 1JLLB 3LT4A 5CT4A 4ENTA 1VKOA 3IFSA 3RBVA 3WFZA 4IL5A 4K8OA 2LCFA 5LP6C 1OBCA 1NNLA 2H52A 3FCAA 4H2DA 4R9SA 3VDMA 4B71A 1T0JB 1A69A 4HUJA 4AP5A 1YRQA 3R8XA 3G89A 1KMNA 2WMYA 1FFSA 4Y30A 2I0FA 5BYKA 3OQOA 4M88A 3OPYB 1QONA 3E9QA 1L4EA 1DT5A 1P1BA 2ISQA 3PNPA 4LJLA 4R83A 2XBUA 1X38A 2IEAA 4URHA 4DOMA 3ETEA 3R9KA 5BT9A 2UYOA 2OV6A 1DIAA 1Y6JA 4M1TA 4MVJD 2CL6X 5DPMA 1YA4A 4F5EA 1Z6GA 4YCDA 1KI7A 4ROTA 3DW3X 5EWMA 2AQKA 4X8LA 3X3HA 3SBDA 3OKAA 1P0PA 2VAMA 3B6EA 2PLNA 4NAUA 3M82A 4F21A 3GLQA 4PYIA 3Q8MA 1N0HA 2IWRA 1BX0A 1CQIB 3NC0C 1JQLB 2VPZA 1JIIA 1WD7A 2AFVA 2IRWA 3K6KA 2X0RA 5AW0A 1XEWY 1GTJ1 2FWJA 4N0EA 1GUBA 2R47A 4MCHA 4OFBA 4DUGA 2EERA 3BXEA 4P4TA 1G291 2Z9BA 4O4JF 3QVSA 3VKUA 4ZJZA 3GB9A 2FR8A 4XPZA 5AUQA 5EUCA 1OB5A 4Q9AA 3UYLA 3JQ7A 4CMCA 2V0NA 4CW7A 2Q5JA 3EPLA 3AR2A 4JKIA 2VSYA 1UKZA 1O6CA 4KFTA 3DYVA 2W6QA 3BFXA 221PA 4LDJA 3TW6A 4R16A 3OD1A 4RBNA 3EZ9A 4D4KA 4G8JA 2WBLC 4ZU6X 4OBXA 1V7ZA 5CBPA 3VFDA 4PNHA 2J32A 4B82A 2P4HX 2Q27A 3DT8A 2I80A 4RC9A 1NVFA 2UYCA 2A30A 1HO3A 9ATCA 4NS1A 1P81A 4WGFA 5IF9A 4DMMA 3G0HA 3M5DA 4ZHQB 3VZPA 2O2YA 1YKSA 4L3OA 1N8KA 2CNOA 1AZLA 4MK4A 4QRIA 4AKSA 1N75A 1Z88A 5CLLA 1U7PA 1IZYA 4J2OA 3DXFA 4I9FA 2WAXA 4V0OA 1MVOA 1ZMTA 1B1AA 2Q1XA 1O97D 3LCRA 4PBSA 4QECA 5F1YA 5AW3A 1V1MB 4CNQA 4KI0A 2HO4A 1E6LA 2ZBEA 4TZTA 1TM7E 4LF5B 5C5IA 1LU9A 3EDQA 4KE7A 4NX2A 4Z8XA 2WT4A 1O77A 1Z4KA 1MNQA 1UJMA 4GLJA 2Y2UA 5GPBA 3IPCA 1MEEA 4MB6A 1NUAA 4MDHA 3A2NA 4QELA 4ZPJA 4A2QA 5MFZA 3MWLA 4OPMA 4XFDA 4IJVA 3E1GA 1LNSA 3EAGA 3CVVA 5JYBA 2EL9A 3CHYA 4NDZA 3TPCA 3O3CA 4Y67A 5LYJA 1V8BA 3CEHA 2PFKA 4EUFA 1XVLA 1VSQA 2HSZA 2VPIA 4H0CA 5IKXA 2QTGA 1RU3A 1WV1A 3I32A 4OI4A 1U2EA 2O3UA 1BKYA 1SBQA 2H6EA 5ENDA 3RTBA 2W4MA 3ASUA 1TLTA 2DMRA 1GGFA 3TNDA 5B3JA 1ISIA 3TQCA 4BVAA 4FUQA 4HH3C 1Z34A 4XVRA 3ZQKA 3TI7A 1NF9A 4BNTA 3KSZO 4ZZ3A 1OH8A 3GL9A 3ANMA 1WQ4A 3FGPA 2C2YA 5C8DA 3UJBA 3G8AA 5KZMB 1X7XA 3IQEA 1TTHA 2DM6A 2GVDC 1KK0A 2X13A 2JI7A 1MB9A 1XK7A 5AKHA 2WP0A 4EL0A 2H8GA 3ESRA 4ZCMA 5L3QA 1ETUA 1HI9A 1ZD3A 3IKVA 5ALOA 4RGQA 4BNNA 4ERXA 2IPOA 2XYPA 1TJ4A 3L82B 1Z25A 1G5RA 4FDLA 1HDZA 4YPFA 5H9WA 2CFCA 1G8JA 1TK9A 1C9NA 1SPBS 4A16A 1VE7A 1ISMA 1TYAE 2AC7A 3DM5A 3KWFA 4PVCA 3UXEA 3KPUA 4F1WA 1Z0AA 1NRJB 3ND5A 4K88A 4RSMA 2RAFA 3TXXA 1G18A 2HJGA 2RGCA 3N2YA 3PDWA 1HFEL 4O33A 1G42A 3V8MA 3A6LA 1DDIA 4KXMA 2IYSA 5HBRA 3OM8A 4JL5A 4RGYA 2MSDB 2QT1A 4JSRA 1XDDA 2G82A 2X3UA 2HNAA 1M0TA 2P30A 1RIIA 3B12A 5JQGF 5I4CA 1HRDA 4AZ3B 3U9TA 4EKYA 3INYA 4GHWA 2YYZA 4X7BA 3RHTA 1WP9A 1XMIA 1KYIA 3KPWA 4R1MA 3BG5A 2GB4A 5CCBA 2G5CA 4FLFA 1TJ5A 1U9ZA 2VDKB 4NH0A 2W0SA 4AX4A 3GDGA 3GUHA 3KAKA 1O6ZA 2HRRA 3PU6A 2OLJA 3W6NA 4QL3A 5CTJA 1Z2DA 1U9YA 3PVSA 5K4GA 2F7SA 3OZWA 3VR6D 1TM3E 3RQSA 3HKCA 3U7IA 1CSEE 3OJFA 3OZUA 2VHUA 3NBMA 3TG8A 2QX9A 1E3DA 2E5FA 3FYHA 2QPAA 2CXQA 2AHOA 2PUJA 4X94A 1KZYC 3I1IA 4MV5A 4YFYA 4TLAA 1FLAA 2QJTA 5ITZB 1YI8A 2A9PA 3FOFC 4K9RA 4UQLA 1OFVA 2BDUA 1PF7E 1YBFA 2XTJA 3E3AA 2AJBA 1GQSA 3COWA 4ER0A 1XLTC 5DNEA 5TLSA 4R6WA 2RGRA 3I4FA 5CW2A 2Z2XA 2C96A 3EF0A 3PFIA 3R44A 5DHTA 1I6MA 4GGOA 3TPFA 4L8VA 4CQMD 5J9FA 2DP4E 4EG6A 5JZBA 2E1PA 1K5GA 5HFJA 2FWIA 2AN3A 4GQAA 3REGA 3QMMA 4KLAA 1R4NB 2WAYA 3LCMA 3BIOA 4YMIA 2VDJA 3B6JA 3C5VA 1QGZA 1R66A 3RWMB 2O8EA 3RS8A 3IP9A 2O7RA 5JJCA 3EBLA 2X86A 2ZWMA 2V3VA 3WYBA 1PJZA 1Y1RA 1JQBA 2HL6A 1ZLYA 1L1FA 1KKLA 2J9FA 3DMNA 2GZ1A 4CE6A 3CB2A 3FNRA 1XTQA 3MTJA 1A9RA 4ZAXA 1XXHE 4NYIQ 4DA0A 1A82A 3PJEA 5E9JA 4YCAA 4LYAA 1XZAA 1FNMA 1X77A 2HRQA 2FN3A 1WB4A 2PUHA 2FW1A 2BZ1A 2Y1LA 1JW9B 1OX6A 5KWJA 4XIFA 1CRWG 2IYNA 3T3IA 1J8DA 4A8JB 4GPIB 2XHEA 2XR1A 4F3RA 5IRCD 4YI3A 1Y7TA 1NI5A 2IEGA 2WYHA 3K4QA 4YIKA 3S6JA 4ETIA 4CEHB 2DU8A 3IDOA 4XJTA 4FWTA 1VIDA 2RHBA 2RHWA 3DXXA 4EGCB 1WOMA 2D1TA 1DWQA 3NM4A 3FPGA 2OGTA 4IHJF 4BO6A 2H65A 3QK7A 5GM1A 3R5KA 1N1EA 3VNUA 3WR5A 4A15A 1FUYB 2QYOA 3A26A 3HJRA 4LE1A 2XHZA 5HTKA 5E1DA 4ZGGA 1JPUA 1ONSA 3BWCA 2FDRA 3LQRA 4L72A 4ARBA 1YRBA 4Q4AB 5ALSA 2Q5QA 3MINA 4OHYA 5BPHA 1UJNA 4OYRA 1WB5A 4N0PA 1AZTA 2UZ3A 3KUKA 2D5CA 4FNAA 2BD0A 4RK1A 3EIWA 3UK1A 1F2TB 4BGEA 3QFRA 1E32A 4L5IA 3V8RA 4LSGA 1VBMA 4O1HA 1DX4A 1KDTA 1MRZA 4PBTA 1RYEA 4IG9A 1N6NA 1V1MA 3AFHA 2FWAA 3P7MA 3RIHA 5A5GA 1FUEA 3IE0A 3QI2A 4OQ4A 1JDJA 1QFMA 1XQXA 2WWXA 1RFGE 1WEHA 1YR9A 1GQFA 2FH5B 2IGBA 5ECDA 3WIUA 3ZX4A 4AZ0B 5CDTA 2WHRA 1NVVQ 4GC9A 2W00A 3MD9A 2BGUA 1FUKA 2PL9A 4W5WA 2H5LA 5FORA 7YASA 1EHYA 3DF7A 3OUTA 4IKOA 4LVNA 1P0QA 2CK3D 1TF2A 3ASZA 3EZ2A 3U61B 4PXSA 1R88A 1OH6A 4MP3A 4ROSA 3CH6A 1W0JA 4GX1A 3S27A 4RPLA 4PLGA 5LLSA 1N2CB 4COOA 4F6RA 2CDCA 3THYB 1X6VA 4HQFA 3LYLA 3JTEA 3BBLA 3D6FA 3QKRB 4LGCA 4XXHA 2JHGA 1T0IA 1LFAA 4DIKA 1NVAA 2IZ5A 3L49A 3I2JA 2RKBA 2ID4A 4QAJA 3CONA 2OWDA 2WVJA 3K20A 3EVZA 5ADWA 1P7CA 1XVIA 3CNLA 5CJ2A 3M6IA 3FWPA 4AIIA 1R50A 3CG4A 4NHOA 4MDEA 2O07A 1HSOA 2HIMA 5B4TA 2B2CA 2OHIA 5LQUA 4E3ZA 1MG0A 1HFJA 2P2ZA 4FYHA 4UU1A 5AT1A 1QKIA 3SFTA 2HCJB 5DGXA 3OAAD 4FMBB 2BHNA 1M8PA 2ZSKA 3WP1B 4DADA 2ZYUX 2I4LA 4PZLA 2J5KA 2XNCA 2XQKA 4QPCA 5FIUA 2YWJA 3H2KA 3U9SA 2O8FB 3UWDA 2PUBA 5JJKA 3SPXA 2FV8A 5E95A 4INAA 3AUTA