3D45A

Crystal structure of mouse parn in complex with m7gpppg
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
505
structure length
383
Chain Sequence
GPMEIIRSNFKINLHKVYQAIEEADFFAIDGEFSGISDSGFDTPEERYQKLKKHSMDFLLFQFGLCAFKYDHTDSKHVTKSFNFYVFPKPFSRSSPDVKFVCQSSSIDFLASQGFDFNKVFCSGIPYLNQEEERQLREQFDEYTKEQEELNDAVGFSRVIHAIANSGKLVVGHNMLLDVMHTIHQFYCPLPADLNEFKEMAICVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFDPPKVESAEGFPSYDQLHEAGYDAYITGLCFISMANYLGSSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific ribonuclease PARN
publication title Structural basis of m(7)GpppG binding to poly(A)-specific ribonuclease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 105
structure length 383
sequence length 505
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2008-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3d45A01
1SV5A 3DLRA 5KI6A 1CZBA 5KGXA 3OYDA 3I0RA 1HYVA 4DSFA 4DFKA 3HK2A 3LALA 3MECA 1W0HA 4LH5A 4LY7A 4C8MA 4BE1A 2QKKA 3C95A 5JS1A 3AVKA 1X9MA 4CJ4A 4AHVA 3AO3A 3ZSZA 4FM1A 4DS5A 4CEQA 3K2PA 4KHNA 2YNHA 4AHRA 1EX4A 4PUOA 4KI6A 4BWMA 1WSGA 4KTZA 4DTUA 2EHGA 3RRHA 4KI4A 3T3FA 1QSYA 2RF2A 2OPPA 2Y1JA 2HHTA 1NKBA 3KKRA 4CJKA 4HCCA 1ZBIA 1JLBA 2DFHA 3V9ZA 3NF7A 4CF2A 2QK9A 2G8KA 4HHTA 4FZZA 4C8LA 1RT1A 4OJRA 3T1AA 3HPGA 3L2QA 2GV9A 1WAJA 4FK0A 3HJFA 3ZT0A 2HHUA 1LV5A 3EZ5A 1XC9A 3ZSRA 3AA3A 4KHYA 1HPZA 4BDZA 3QEPA 4HUEA 2KW4A 3OYMA 1FKPA 1RBTA 1DTTA 3DRPA 3NGZA 2JGUA 2BE2A 4I2QA 3KLIA 1D9FA 4C8OA 4FJJA 4KV8A 3U3GA 3AVNA 1TGOA 4DF4A 2D5RA 4HUGA 3TI0A 2XO7A 1BIZA 3AA4A 1WAFA 3K57A 3SV3A 4CHYA 3RTVA 4O55A 4NCBA 1XHXA 3JYTA 4FLVA 4FJXA 3OYIA 3UIQA 2XY6A 4LH4A 4DTNA 1J5OA 4FJ5A 3QO9A 2PYJA 4Z4GA 3CFOA 3SCXA 3LWMA 4K8XA 4M3TA 3G10A 2F8SA 2FBXA 1LAWA 3AO5A 2X74A 1QS4A 2KQ2A 3V9UA 3MEEA 1N5YA 1BCMA 3WNFA 4F2SA 4CEZA 1DTQA 2G8VA 1QSLA 4E7LA 4KHQA 1VRUA 2VWKA 3AVFA 1KFSA 4Q0BA 3OYNA 1BISA 2RPIA 2OPQA 3P5JA 3K5NA 4MQ3A 5FRNA 3QNOA 4CEDA 1J9AA 5I3UA 3ZT1A 1TKXA 4Y1DA 1RTHA 5J2PA 3LAKA 3SUNA 3AVCA 4Q5VA 2HMIA 3PO4A 3VQ8A 4FVMA 1UOCA 3AA5X 3K5MA 1VSEA 4FYDA 2VG7A 3ZSWA 3QEVA 1X9WA 2YHAA 4ELTA 4CEBA 2OZSA 3K5OA 4DU4A 3CFPA 2PZSA 1B9FA 1J53A 1NK8A 1RDAA 5DK5A 1SKRA 1Z25A 4KKOA 3KLHA 3TABA 2YV0X 2KZMA 1S1TA 1RT4A 3WNHA 1TKZA 2HNDA 2YKNA 2W42A 1IKWA 1L5UA 2HHWA 3VQ5A 1C1BA 4OKKA 4H8KA 4Z4HA 4N56A 4FM2A 1C1AA 3HYFA 3KK2A 4AHSA 1TL1A 3KKSA 1JL1A 3L2WA 4GMJB 1NJZA 4DU1A 1U4BA 5J2NA 2O4GA 1JXBA 4RW8A 2LSNA 4DQQA 1BCOA 4FJIA 2I5JA 1CXUA 3AVMA 4B8CA 4E1MA 3OYAA 3S3MA 1UAXA 3QETA 1RILA 3ITHA 4HCBA 4Z4CA 2B6AA 2WOMA 3OYLA 3PO5A 3MXMA 5HROA 1RT2A 4OKJA 1KVBA 3LDSA 2HVHA 1XWLA 5C42A 1IG9A 2DY4A 3HL8A 3VQ4A 4FJGA 1UA1A 4DSKA 3I8DA 2XY5A 4E89A 4EZ9A 3CQ8A 1ZBUA 1FKOA 1IH7A 3VQ9A 4DSEA 5J2QA 3QIPA 5CZ1A 2QXFA 3TANA 2P51A 3QEXA 3QERA 4LSLA 1RTJA 4Y1CA 5DMRA 2VG5A 4DFJA 4E0DA 5K14A 3DLBA 3BGRA 1TAQA 4E19A 3BDPA 2HHQA 3G0ZA 1RCHA 3L2RA 3ALYA 5HBMA 3NH0A 4Z4FA 2X6NA 1TK8A 3NCIA 4FLTA 2P5GA 1J54A 4E3SA 5D3GA 3TR8A 4IDKA 5FDLA 4BWJA 3IG1A 3LP3A 4FLUA 2KZZA 4CESA 1O1WA 1FXXA 4B9LA 1Q8IA 1X1PA 3NFAA 4AH9A 2P5OA 3NF9A 4DLGA 1YVUA 3DM2A 5T7BA 2XHBA 4FK2A 1IKVA 3LZJA 3SUQA 3L3VA 3HVRA 3KIOA 3P83D 1YTAA 4FJHA 3HPHA 1YT3A 4CECA 2F8TA 2NUBA 3CG7A 4OGEA 4FLZA 3TWHA 4F4KA 4DTPA 1XHZA 4DF8A 4NCGA 1D9DA 5KGWA 2ZQBA 1VSIA 3SQ2A 2BANA 3LANA 4NYNA 4CHZA 3OJSA 4HTUA 2HW3A 3DRRA 3OYFA 4KHSA 4CEAA 3VQ7A 5C24A 4YNQA 5CYMA 1TK5A 3AV9A 4TSXA 2JLEA 1HRHA 5E41A 5I42A 4Z4IA 1IKXA 3O4NA 3K5LA 3ISNC 5HP1A 1WLJA 4GW6A 4FJ7A 3NAEA 3VA3A 2HNZA 2GUIA 2Q3SA 3TAMA 3MEGA 4B9NA 4DG1A 1RT5A 3CM5A 3C94A 4DQRA 1REVA 4OPKA 3S9HA 1A5XA 1HNVA 4E7JA 4DU3A 4B9UA 1EETA 3AVLA 3VQQA 1UWBA 1S1WA 1FK9A 1JLCA 4ID5A 1U49A 4QOZB 1RT7A 4CEEA 3DLEA 3LAMA 1NOYA 3OVNA 4W5RA 4F3TA 2YKMA 3THVA 4I9LA 4BDYA 4CGDA 5FRMA 3TARA 3VQEA 1TKTA 4G1QA 4YFUA 4JRPA 2B4JA 4CJ3A 4R5PA 5HRNA 1SL0A 4CEFA 4IKFA 3DRSA 4AHUA 4CHQA 3CM6A 3O4QA 3WNEA 3SPZA 3KTQA 2ITGA 4M41A 1SL2A 2ZD1A 3OYHA 5KRSA 3OYJA 1WSHA 3ZSQA 5KTQA 4DTXA 1HQUA 3DYAA 3C6UA 1S6QA 2ATQA 1L3TA 2PY5A 1S5JA 4M3YA 3TAFA 3QEWA 1BHLA 4OPJA 3VQPA 4B8AB 3DOLA 1GOAA 1HNIA 4AHTA 3NF6A 3A2FA 1RT3A 3OYEA 3HP9A 4B9TA 4NCAA 3AVBA 4KTWA 3DLGA 4CFBA 4B9VA 4DFMA 1JKHA 4J2BA 4CJ5A 2Z1IA 4CJUA 4KO0A 3SQ0A 1HMVA 3DLKA 3S3OA 4OLBA 4KB1A 1ZBLA 3L8BA 2VWJA 1N6QA 4I7FA 3SUOA 4C8KA 4KREA 2DTUA 1YTUA 1S1XA 2YNFA 1JL2A 4F2RA 2GBZA 3RRGA 1LAVA 4GVMA 1F21A 3NGYA 4F8RA 3ASMA 2E6MA 2G8WA 3SI6A 2E4LA 1DLOA 1ASVA 3CFRA 3LP0A 3TAEA 4J2AA 4DMNA 1TL3A 3ZCMA 4W5OA 1CZ9A 4CFDA 4Z0UA 1BQMA 4CJPA 4DQPA 3OS1A 2D0CA 1G15A 2X78A 4CF0A 5HLFA 1NK5A 1W9HA 1RTDA 4M42A 2KFNA 4IBNA 5J2MA 3MAQA 4CFAA 3KK3A 5EU7A 4DLEA 3HO1A 4PWDA 3DMJA 1IO2A 3EY1A 3ULDA 4JS4A 3V4IA 4IFVA 3KLFA 5CY4A 4JRQA 3PY8A 4OVLA 3AO2A 3B6PA 1WSFA 4JS5A 3PX6A 5HRRA 1S9EA 1NKCA 3RR8A 4CJSA 4N41A 4FJ8A 4O0JA 4FLYA 3KK1A 2ZE2A 3RWUA 2VG6A 3VQCA 3SYZA 2Z1GA 1VK0A 2RN2A 4N5SA 4KAZA 1WN7A 2YNIA 3NE6A 1NOZA 4BDPA 3AO1A 3RMAA 1KLMA 1VSHA 3WNGA 1HYZA 4H4MA 3SQ4A 1L3SA 3AVJA 1U48A 2G8UA 4CCHA 4E1NA 1BGXT 3OJUA 4IFYA 1RDDA 3ZSYA 4OLAA 3E01A 5SZTA 2KFZA 1NJWA 4CJLA 4M45A 4ELUA 1QSSA 3MXJA 1SKSA 1L3UA 3KD5E 2IDOA 3KJVA 4Z4EA 1JXEA 1BI4B 4MFBA 1S1UA 1TKDA 3OS2A 3JSMA 1ZBFA 3U3YA 4PQUA 5SWMA 4M3UA 1S9GA 3NF8A 4KB0A 3V9SA 1A5VA 1IKYA 1C0UA 1JLGA 1K6YA 5KRTA 4DTOA 1RBVA 1LWEA 3MXIA 1Q9YA 1NK6A 3V6DA 3PX4A 1LWFA 1ITGA 4DS4A 4FJ9A 4CEOA 1RNHA 2OYQA 2ETJA 3F9KA 5FROA 4BACA 4KRFA 2EX3A 3AVGA 4O0IA 1QE1A 5HRSA 5CYQA 3M8RA 3SPYA 3OYGA 4XIUA 2A1SA 4CJRA 4O44A 3IAYA 1S1VA 1RBSA 1T8EA 4K8ZA 3F73A 3AVHA 4N76A 1SL1A 4RW9A 4W5QA 4KHUA 4FW1A 4BE2A 4FK4A 4RG8A 1QQCA 3S3NA 1ASWA 3K58A 4RW4A 3VQDA 4ZTFA 4CGJA 4I9QA 4CGIA 3LPTA 4CJEA 2RKIA 3B6OA 5J1EA 4DSLA 1RBUA 1WNSA 3FFIA 3V1QA 4HVJA 1SUQA 4CIFA 4DTRA 4ELVA 2HNYA 3HP6A 3K59A 4O4GA 4DWIA 1VSJA 1NK9A 4ID1A 1B92A 2B5JA 2R7YA 1U04A 1WSJA 2E6LA 1NK7A 2OA8A 1X9SA 1NK4A 1TAUA 3I0SA 3PX0A 4FZXC 3LWLA 3CYMA 2XY7A 5HRPA 3O3GA 4B9MA 3ZSXA 1NK0A 4H4OA 2FBVA 2HHXA 4OGCA 2Y1IA 5CZ2A 4B08A 4CK2A 1LW2A 1WSEA 2BGGA 3H08A 4QAGA 4C8NA 1Q9XA 3DOKA 4NYFA 3NDKA 3LP2A 1HQEA 3D0PA 3LZIA 2FC0A 4CJQA 4CE9A 3NH1A 4DTSA 1T05A 1NKEA 2G8HA 4AILC 4M3RA 1QTMA 3NBPA 1R0AA 1KLNA 4ZTJA 3KD1E 2HHVA 1B9DA 4BE0A 1CXQA 1KFDA 3TAPA 3QLHA 3V1RA 3DI6A 3V1OA 1UA0A 1BIUA 1NJYA 4KHWA 1EP4A 4DTJA 4FJLA 3IS9A 2QKBA 4FZYA 4I2PA 3HM9A 4IG3A 3ZT2A 1XI1A 3RMCA 1RDCA 3AVIA 1HYSA 3LPUA 1I39A 1LWCA 3RR7A 1U47A 1KCFA 1MU2A 2WONA 4CHPA 3L2VA 1QHTA 1VSDA 4IG0A 4RW6A 4DQIA 4KFBA 3DLHA 4F3OA 1C0TA 1CLQA 4J2EA 2D0BA 3TAQA 2F96A 1TK0A 4CJTA 1HJRA 3T19A 4ZHRA 3EYZA 3HVTA 4EZ6A 3QESA 2OZMA 4CHOA 3SJJA 4EP4A 2YNGA 3SUPA 1JLFA 3M8PA 1NJXA 4CK1A 1BI4A 4WE1A 3PUFA 2PYLA 4DTMA 1D8YA 4PA1A 2HHSA 1BL3A 1ZBHA 3ZSVA 3AVAA 4KTQA 4FJNA 3HSTB 1JLQA 3MEDA 4JLHA 1C1CA 4CF8A 4CERA 1BQNA 4LD0A 4L8RB 3M8QA 2FBTA 4M3ZA 1RTIA 2IS3A 2DFEA 2IGIA 3TAGA 4KPYA 2OPSA 2X6SA 4O5BA 2IAJA 4CGHA 4DFPA 3C6TA 4RW7A 4FJMA 1I3AA 2IOCA 4CF1A 3V81A 1S6PA 4CJWA 3QIOA 2G8FA 3OYKA 4CIGA 3HXMA 1U45A 3SZ2A 2DFFA 1JLAA 2KTQA 3V9WA 1RBRA 1A5WA 5JS2A 1ASUA 4CF9A 3ZT3A 4UQGA 4W5TA 3KLEA 4E7IA 3QINA 4B9SA 4AHCA 4CHNA 3SNNA 1T03A 2Z1JA 2FBYA 3NHGA 3OY9A 4LSNA 4FCYA 4E7HA 2BDPA 4PY5A 2XY8A 1VSFA 3LP1A 4DQSA 3KLGA 1RDBA 3D45A 3OYCA 3HT3A 1KVCA 1JLEA 3IRXA 3O3FA 3L2UA 3PV8A 2XRIA 4CFCA 2HB5A 2HVIA 1D5AA 2OPRA 4E7KA 1Y97A 4CJFA 4FLWA 4QCLA 4N47A 2G8IA 2O4IA 1TV6A 3SV4A 3OS0A 1GOBA 3QNNA 4FLXA 1RT6A 3NGIA 3AO4A 1TVRA 3ZT4A 3QEIA 1SKWA 1KSPA 4FJKA 3P1GA 2AJQA 2IC3A 3U6FA 4DSIA 4J2DA 4FXDA 4CGGA 4DSJA 3L3UA 4FM0A 4CJVA 2D0AA 3VA0A 1VRTA 4OKEA 4B3OA 3HPOA 2P1JA 1KVAA 4ICLA 4CK3A 3OYBA 1VSLA 1L3VA 4CGFA 1VSMA 3V9XA 1WSIA 3VQAA 1C0MA 1KTQA 4HUFA 1C6VA 1LW0A 3SQ1A 5C25A 4FW2A 1VSKA 2Z1HA 3RMBA 1ZYQA 3M8SA 3O3HA 3AA2A 3VQ6A 1T7PA 4M3XA 4W5NA 1KRPA 4M3WA 1EXQA 2A1RA 2YHBA 3NH2A 3RMDA 1GOCA 3ZSOA 4EP5A 3VN5A 3VQBA 1Z26A 1EKEA 4CIEA
chains in the Genus database with same CATH superfamily
5KI6A 4WQ5A 1OVYA 4BROA 4JI0K 5AQHA 4JI5K 5JS1A 3AVKA 3MCPA 4AHVA 3AO3A 3ZSZA 3VF2A 4CEQA 3K2PA 4KI6A 2HOEA 3T3FA 5EXWA 2HHTA 2O8CB 3KKRA 2E8AA 1ZBIA 1GLDG 1GLJO 4FZZA 4OJRA 2GV9A 3HJFA 1LV5A 3DXMB 3OYMA 1RBTA 1DTTA 4B3RK 3DRPA 1NGGA 4FJJA 4KV8A 2D5RA 1JJ2M 1BIZA 2P9NB 3AA4A 5A2QO 3UKRB 2E20A 4K25A 4CHYA 4O55A 4FJXA 3OYIA 5TKYA 2XY6A 1IBMK 1J5OA 3TSUA 3QICA 2PYJA 4DV5K 4JK9A 1LAWA 2X74A 3CQYA 1HR0K 4BGBA 4CEZA 1DTQA 2G8VA 4KHQA 2VWKA 4JKDA 4RTFD 1BISA 1HNXK 2OPQA 3P5JA 5FRNA 1G99A 1J9AA 2GWKA 4Y1DA 4BC2A 4BVOA 4DV6K 3LAKA 3SUNA 4Q5VA 4DKWA 5AZJA 5MLCQ 1X9JA 3ZSWA 1X9WA 2YHAA 2WC9A 2O8BA 4H5NA 3O6WA 5M1NA 1NK8A 4A2AA 1VQ4N 1SKRA 2Q36A 1Z25A 3EKUA 3WNHA 2HNDA 4EAHD 2PFUA 2QWRA 4IOAL 1IKWA 4JD2A 3ZEUA 4FWRA 4Z4HA 4N56A 4FM2A 1TL1A 1JXBA 2FF3B 1BCOA 3D2FA 2E2OA 2WOMA 4BRDA 3MXMA 2HVHA 3HL8A 4H0XB 4DSKA 1P8ZA 1Q81O 4E89A 4EZ9A 4Y0WA 4M7XA 1FKOA 2NRWA 2FLOA 5CZ1A 2QXFA 3VETA 4CJ7A 5DMRA 4E0DA 5K14A 3G0ZA 1WOQA 2NLXA 3CCLN 3CC7N 3NH0A 2UXCK 1TK8A 3NCIA 3BZCA 3H1QA 3LP3A 4FLUA 2KZZA 4H5TA 3NF9A 1YVUA 3DM2A 3THYA 3L3VA 3HPHA 1YT3A 3VF4A 4BRHA 3CG7A 4F4KA 4DTPA 1XHZA 3KWIA 2HW3A 4CEAA 3D7EO 1HLUA 5C24A 5CYMA 3J7YP 4MDBA 3NVMA 5E41A 4WF9L 4Z4IA 1BWFO 2QXLA 5HP1A 4FPAA 3NAEA 2Q3SA 2GUIA 3MEGA 4DQRA 3ULEA 2UU9K 1REVA 1A5XA 5ADXA 4E7JA 4DU3A 2VYPA 4B9UA 1BDGA 3CI5A 1UWBA 4DCHA 4DR5K 3O1WA 3DLEA 2BH1A 1NOYA 1HKBA 4I9LA 4BDYA 4IOXA 4DV0K 4JHDB 5JICA 4FPBA 4Q0BA 4ISFA 3KTQA 2ITGA 5BPNA 2ZD1A 5KRSA 4DTXA 3HBTA 3C6UA 2ATQA 1S5JA 1OH5A 4B8AB 1GOAA 4AHTA 3B8AX 3A0IX 3A2FA 3OYEA 5AQPA 2ITMA 3MCAB 3H46O 4KTWA 4JKGA 5DM6L 4CI6A 5LMNK 4DFMA 4CJ5A 2Z1IA 4CJUA 4OLBA 3NMUA 1N6QA 4I7FA 3VGLA 1YTUA 2YNFA 2GBZA 1LAVA 3NGYA 3ASMA 3CFRA 3ID6A 1K8AO 5AJ3K 1BQMA 4CJPA 3TTCA 2YHXA 4JK8A 4CF0A 1G15A 1RTDA 4PKIA 2KFNA 5J2MA 3EO3A 1EWRA 4CFAA 3KK3A 4PWDA 3ULDA 4IJAA 3V4IA 3PY8A 4XEIA 3AO2A 3L6QA 3PX6A 4CJSA 3KK1A 2VG6A 1NMNA 2Z1GA 3LDLA 4MLEA 2HF4A 2GX9A 2HF3A 5BRFA 3AO1A 3JXUA 1KLMA 1K8KB 1JCFA 1U48A 4FVUA 3CHWA 4B1ZA 1BGXT 3D2EA 4IFYA 1VAZA 1RDDA 4JI2K 3E01A 4DUZK 2D0OA 1NJWA 2A6AA 4CJLA 1QSSA 3BZKA 5GAEP 3KD5E 2IDOA 3FLCO 1TKDA 1N32K 3ZETA 3LDPA 4KB0A 4A61A 4BRQA 3CF5L 3MXIA 1Q9YA 3U8XA 1LWFA 4JI1K 3GG4A 2ETJA 2GEMA 4O0IA 4A2BA 1QE1A 5HRSA 4H5VA 3SPYA 3IAYA 1S1VA 4DV2K 2UUBK 4K8ZA 3CJ1A 3U9ZA 3F73A 1SL1A 3PSIA 4KHUA 1QHAA 4FWPA 1Q7YO 1OKJA 3S3NA 1ASWA 5ADXH 1HX1A 4I9QA 4CGJA 4FSVA 3B6OA 1RBUA 4CIFA 4CZHA 2E1YA 1EQYA 4PKGA 2H3GX 2B5JA 2R7YA 1U04A 4CBUA 3DLLL 1NK7A 3PX0A 3OA9A 4KH4A 4FZXC 3CYMA 3KWGA 3PIOL 1K73O 5HRPA 3UE5A 1OH8A 1NJIO 3T7ZA 4H4OA 2P9UA 5M1OA 4U67L 2Y1IA 1LW2A 4C8NA 4CJQA 3NH1A 1NKEA 3ATUA 4HTLA 3NVKA 1MA9B 3NBPA 4BRAA 3KD1E 3MMVA 1VQNN 3CPEA 1CXQA 1WBDA 3V1RA 4OPHA 4CZEA 3DI6A 1BIUA 4KHWA 1EP4A 4FJLA 4J8FA 4JKEA 1XI1A 3QB0A 3P31A 3CXCM 1U47A 3L2VA 4DQIA 4IG0A 1CLQA 1TYQA 2HBMA 4ZHRA 3SAGA 5AQKA 2VGMA 3QESA 3SJJA 1IJJA 3F5TA 1NJXA 4PA1A 5BR8K 1ZBHA 4YOYA 2Q0RA 1BA1A 3MEDA 1LCUA 3TAGA 3O1BA 2OPSA 4O5BA 4DFPA 2UUAK 1ZXOA 1I94K 3C6TA 4RW7A 2E88A 4CF1A 4CW7B 1JLAA 2HBJA 5B8HA 2KTQA 4CF9A 3RMCA 1QSYA 3KLEA 3QINA 3UKUB 2FBYA 1NGJA 1X3MA 4PY5A 3L2UA 3HT3A 3D45A 3OYCA 3Q7CA 4DQ8A 3ZLJA 2HVIA 1NGBA 4FLWA 4CJFA 1OH7A 4QCLA 5GINA 2O8DB 1RT6A 3AO4A 1TVRA 1SKWA 5AQLA 2AA4A 1C0GA 4DSJA 4FWMA 4CJVA 3VA0A 4OKEA 4B3OA 2E2NA 3O4WA 1KVAA 4ICLA 4CK3A 1VSLA 3EZWA 4NLBA 5AZJB 4R79A 5E26A 1VSMA 2O8BB 4LC9B 3RMBA 2Z1HA 4CZMA 1MDUB 3O3HA 3SK3A 4KH6A 4M3XA 2A1RA 2YHBA 3RMDA 4FL9A 2CH5A 4MO5A 3NHGA 1EKEA 4JD2B 2KHOA 3ZEUB 2WUSA 2ZWHA 3HK2A 5ELZA 3MECA 4LH5A 4ISGA 1X9MA 4CJ4A 1IBKK 4GV6A 3DWLA 4PKHA 4DR7K 5LJWA 4KHNA 3AGRA 5AZIA 5BN9A 4YOTA 4KTZA 4DTUA 4KI4A 2RF2A 2OPPA 1M90O 1NKBA 4O5FA 3NF7A 4C1NI 4C8LA 1RT1A 3T1AA 1NGFA 1YVNA 3F9MA 4FK0A 2HHUA 2KKZA 3ZSRA 2P9SA 3AA3A 4CZGA 1IV0A 4ISEA 4HUEA 3NGZA 1FJGK 2JGUA 4OX9K 4H5RA 5JLHA 1KAYA 3MX5A 3AVNA 5C10A 1NGHA 2XO7A 4YOXA 3LDQA 4NCBA 4JV5K 3K0SA 5CE3A 5C0YA 3UIQA 3DXKA 4DTNA 1MWMA 3FR0A 4Z4GA 2OANA 3THYB 3LWMA 3H3NO 4K8XA 2FBXA 3V9UA 1N5YA 1XC3A 3H1VX 3MEEA 4IEIA 1VRUA 4B3MK 2P9LA 4YDUC 3ZT1A 1TKXA 4FWSA 2ZJRL 3AVCA 5M1PA 4FYDA 1UOCA 3AA5X 3C7NB 2CGLA 4BRNA 4ELTA 4WFNL 3BF1A 2GTDA 1J53A 3VTIA 1RDAA 3ULEB 3TSQA 4QS9A 4KKOA 3KLHA 1YAGA 3K9JA 3SAHA 2W42A 1L5UA 4JEPA 2HHWA 3VQ5A 4OKKA 4B1XB 3VGMA 5KPZA 3O9QA 3LDOA 3KK2A 3L2WA 3E66A 4G9ZA 3VPZA 4RW8A 4DQQA 3EEQA 4FWNA 3I8BA 3WQUA 2I5JA 4DR4K 3AARA 4IZ9A 4K41A 4WQ5C 4YDUA 1UAXA 3QETA 3C0BA 2CH6A 4Z4CA 3EE9A 3OYLA 1ATSA 3BEXA 4OKJA 1IG9A 5AQMA 1GLFO 3O9TA 1UA1A 2P9IA 4DSEA 3QIPA 4JKGB 1SQKA 3QERA 4LSLA 4Y1CA 4MO4A 1NM1A 4DFJA 4AM6A 2YHWA 4BC5A 1TAQA 2ZJQL 2HHQA 3L2RA 5HBMA 2X6NA 4FLTA 2P5GA 5AQRA 3WXJA 5D3GA 5FDLA 4BWJA 3WQTA 3HOTA 3IG1A 1OVQA 2Q1NA 1FXXA 1C0FA 5F1XA 3QDKA 2XHBA 5KPRA 1NWKA 2O8EB 3KIOA 1YTAA 4FJHA 4AF1A 2F8TA 2Q97A 5TKWA 3VEXA 3TWHA 5AR0A 3FE1A 1D9DA 3SQ2A 1VSIA 2BANA 4NYNA 3OJSA 3OYFA 3PSFA 2ZGZA 4O8KA 4TSXA 2JLEA 3O4NA 3ISNC 2NNWA 4GW6A 3TAMA 3CM5A 3C94A 2UYTA 3D2EB 2O8FA 2QWQA 2VCPA 4LF5K 2QWLA 1T6CA 4BR4A 3A5LC 4ID5A 1U49A 1RT7A 1RDUA 2QWPA 3LAMA 3OVNA 4W5RA 2YKMA 1T6DA 1TKTA 4G1QA 4CJ3A 5HRNA 1BO5O 4FOIA 4AHUA 3CM6A 3O4QA 3WNEA 3ZETB 3OYHA 1KXPA 5KTQA 4IO8A 4PL7A 3DYAA 3BY5A 2FSNA 4DB3A 1L3TA 5AFUA 3QEWA 1BHLA 4OPJA 2RHKA 3VQPA 2YHYA 2ZM6K 5FPEA 1HNIA 1BUPA 3NF6A 1LOTB 4NCAA 4OO1J 3DLGA 3E1YA 4AQYK 4BRLA 4KO0A 3SQ0A 2IVNA 1ZBLA 3L8BA 3LM2A 3SUOA 1S1XA 5HL7L 1JL2A 3RRGA 1F21A 1BOTO 1OH6A 4F8RA 2E6MA 5JVGL 2E4LA 1DLOA 1ASVA 3TAEA 1NU0A 4Z94A 3VEZA 2P9UB 3A8YA 5FPNA 3MAQA 3HO1A 1IO2A 3EY1A 2V7ZA 1VQ5N 1Q18A 2NRHA 3KLFA 1S9EA 1NKCA 4N41A 4O0JA 5EY4A 3FFKB 5AQFA 3SYZA 4KAZA 2RN2A 1S3XA 3H3OB 1NOZA 4BDPA 3HM8A 2HBKA 2WBNA 3Q7BA 1VSHA 4XH1A 4CCHA 4E1NA 3OJUA 4X62K 3O8MA 2KFZA 5C2FA 3T1HK 4LF8K 1TYQB 4EIAA 2AP1A 1L3UA 2P9PA 3OBWA 2IVPA 1XUPO 3CCEN 3FZKA 1WBBA 1SAZA 4MFBA 3QBXA 2J4RA 3O08A 1ZBFA 4PQUA 4JKFA 1S9GA 3NF8A 1EWQA 1NLVA 1A5VA 1IKYA 1JLGA 5KRTA 4H0VB 1RBVA 1NK6A 1KAXA 2OYQA 4M7YA 5FROA 3AVGA 5CYQA 3OYGA 2A1SA 3J81O 4O44A 3CJBA 1T8EA 1V4TA 4W5QA 4RG8A 1Q86O 4RW4A 1QQMA 4ELVA 3FFIA 1SUQA 2V7YA 4BR0A 1HKCA 1NK9A 5LL6Z 4ID1A 3WUHA 1X9SA 1TAUA 4GKJK 3I0SA 3LWLA 1KC8O 2XY7A 4B9MA 3WXLA 1TUUA 5AFUH 3ZX0A 3CC4N 2BGGA 4B1WB 3H08A 1Q9XA 3DOKA 1HQEA 2G8HA 4IDHA 5AQTA 4H0PA 3TTFA 1QZ5A 1O13A 1JCEA 2NRVA 3IS9A 2QKBA 3CCUN 2EWSA 5E84A 4JI6K 4IG3A 1RDCA 2JWLA 3LPUA 1EO1A 1I39A 1LWCA 2WONA 3IDHA 2ZGYA 1VSDA 3WXMB 4F3OA 3TAQA 4CJTA 1HJRA 3GE1A 4FWOA 1K9MO 1NGIA 4CHOA 3T69A 1JLFA 4CK1A 4ILJA 3PUFA 2P9KB 4LF4K 4PHTX 4BR9A 5AZIB 4M63C 4A62A 4KTQA 1Y64A 1GLCG 4JLHA 1C1CA 1BQNA 4BREA 2OCEA 3M8QA 2IGIA 1I3AA 2G8FA 2P9SB 4IJNA 3SZ2A 2V52B 3MN9A 5JS2A 1ASUA 4W5TA 3ZT3A 2HHSA 2OTJN 1VQ9N 4AHCA 4YOUA 3SNNA 2Z1JA 1GLAG 3OY9A 4LSNA 4FCYA 4E7HA 3KLGA 2E2PA 3O3FA 3CCSN 3PV8A 3DXKB 3G25A 2O4IA 3SV4A 1GOBA 2I7PA 3ZT4A 3NGIA 5IT9O 4FJKA 2P9LB 5IWAK 2YJFA 4DSIA 4FXDA 4CGGA 5C15A 4FM0A 1VRTA 4NXNK 3HPOA 3M3ZA 1TUYA 1ZBSA 4IFEA 1KTQA 5AQZA 1LW0A 3SQ1A 1VSKA 3AA2A 4EFHA 3VQ6A 4BRMA 1HKGA 4BR5A 4M3WA 2RE2A 3P4IA 1Z26A 1KCFA 5BRDA 1SV5A 2F9TA 3DLRA 4DSFA 3OYDA 3I0RA 1HYVA 3THWA 1W0HA 4C8MA 4BE1A 5LY3A 3GL1A 4DS5A 2YNHA 1EX4A 1WSGA 2EHGA 3IUCA 2Y1JA 4CJKA 5EX5A 1VQMN 3T1YK 3V9ZA 4GY2B 2G8KA 4HHTA 4JI3K 4JN4A 3HPGA 3L2QA 1WAJA 1NBWA 3ZT0A 2QM1A 2P9IB 3OW2M 4KHYA 3LM9A 4BDZA 3EN9A 4K43A 2BE2A 4C8OA 2E1ZA 4BC3A 2W6LA 3U3GA 1E4GT 4DF4A 3TI0A 4HUGA 2F4VK 1HJOA 5JLFA 4WYBA 3ZX2A 3SV3A 1W7AA 1XHXA 3S41A 2UUCK 3JYTA 1N8RO 1U6ZA 4LH4A 4FJ5A 5KPTA 1ATNA 3QO9A 4IO9L 3SCXA 4JYAK 3G10A 3M1FA 3AO5A 3TU5A 4O8UA 2Q31A 1QSLA 4E7LA 1KFSA 3AVFA 3RSEA 3OYNA 5AQQA 3K5NA 1DEJA 4MQ3A 3L4QA 1VQON 4CEDA 3VGKA 2WFBA 3PO4A 4WQ4C 3VQ8A 4FVMA 3K5MA 1YXQA 2VG7A 4CEBA 3K5OA 4BR2A 3CFPA 1B9FA 3G6EN 1VQ8N 2W6KA 2KZMA 3M5RA 1VQ6N 2YV0X 1S1TA 1RT4A 1TKZA 2YKNA 1NMDA 1C1BA 3KKSA 1NJZA 3CJ7A 4DU1A 5J2NA 1IBLK 2O4GA 2LSNA 4H0OA 1N34K 4X65K 4FJIA 1N36K 4ILGB 4CBXA 3AVMA 4E1MA 3OYAA 1NNEA 4L3QA 3H45C 2YJEA 1RILA 3JS6A 3N4PA 3LDSA 4WQ4A 1XWLA 1DKGD 5C42A 2DY4A 4FJGA 3I8DA 2XY5A 3VEWA 1IH7A 5J2QA 3QEXA 4H03B 1RTJA 4JKBA 3DAWA 3DLBA 5FPDA 4E19A 3BDPA 1RCHA 4DR2K 3ALYA 4H0YB 4Z4FA 4MDAA 5GIPA 3TR8A 4IDKA 3DJCA 1XMQK 1O1WA 3CJCA 3NFAA 4AH9A 4DLGA 1IKVA 2A42A 2W41A 4V19S 3CMAN 1XQSC 4CECA 3JAMO 5BREA 5JVHL 4OGEA 5H1SQ 3A5MC 3K9KA 4NCGA 5KGWA 3D2FB 2ZQBA 4CHZA 4HTUA 4X66K 4CD1A 3DRRA 3VF6A 1HRHA 3K5LA 5KQDA 4FJ7A 4DR1K 3VA3A 3THXA 4B3SK 4B9NA 3M6GA 1RT5A 4DG1A 2VWBA 4OPKA 1HNVA 3CCJN 2IIRA 3AVLA 4NXMK 1FK9A 1Z05A 2YX6A 3HI0A 3P38A 4FOEA 4CZFA 3THVA 5LMUK 5F0XA 1QQNA 4CGDA 5FRMA 4YFUA 3QBWA 3OHRA 1SL0A 4CEFA 4IKFA 1RGIA 3DRSA 4CHQA 2CGJA 1SL2A 3CETA 1WSHA 2D0PA 1S6QA 4RWTA 2PY5A 4M3YA 2VQEK 3TAFA 4ILHA 2V51B 1XNQK 2BUPA 2QEXN 2A5XA 3ATVA 1RT3A 3ENHA 3CD6N 1JKHA 4BR7A 3A5NC 3QFUA 1HMVA 4KB1A 5FLXO 2YCHA 2DTUA 3UB5A 3TTDA 4LF7K 3LL3A 2G8WA 4J2AA 4OPAA 3KK7A 3CCMN 3ZCMA 4W5OA 1CZ9A 3U4LA 4CFDA 2D0CA 1NK5A 1W9HA 3SMPA 3OTOK 4M42A 4IEEA 4IBNA 3WEEA 3C6HA 3R3LA 4DLEA 4LFBK 1HNWK 4B9QA 3W0LA 4JS4A 1IG8A 4IFVA 5GADP 4JRQA 2ASPA 4OVLA 2ASOA 3B6PA 1WSFA 4JS5A 5HRRA 3VEYA 3RR8A 4FJ8A 4FLYA 2W40A 4A59A 2ZE2A 1VK0A 3R8EA 2YNIA 1FW6A 3CCRN 1YJWN 1ZC6A 4KH5A 4H4MA 3AVJA 1KD1O 4OLAA 5SZTA 1SS6A 3IMXA 3WXIA 2E5LK 1SKSA 4GNIA 3OBYA 4I6MA 1GLEG 1W2BM 1JXEA 1S72N 4A5BA 3OS2A 3FZFA 3U3YA 5SWMA 4M3UA 3V9SA 1C0UA 2BTFA 1K6YA 1T44A 3BUZB 4DS4A 2F9WA 4FJ9A 4NLCA 1RNHA 2Q2RA 4DR6K 4KRFA 1GLBG 3LDNA 4BQZA 3MX2A 4CJRA 4LF6K 3AVHA 5CHIA 4RW9A 4FW1A 4BE2A 4FK4A 3HZ6A 3WXKA 3K58A 3QFPA 4DUYK 4ZTFA 3VQDA 3BP8A 5J1EA 3E9LA 1WNSA 3V1QA 1NG9A 2HNYA 4DWIA 1VSJA 1B92A 3BF3A 1WSJA 2OTLN 2OA8A 1NK4A 4JKAA 3KHYA 1YHQN 4C1NK 3I33A 3ZSXA 4CK2A 1WSEA 2FSKA 4QAGA 1U2VA 3NDKA 3LP2A 3MN7A 3D0PA 3LZIA 2FC0A 4CE9A 3FGUA 4CBWA 1QTMA 1KLNA 1MWKA 4BE0A 4IOCL 1KFDA 3TAPA 1NJYA 4EHUA 1BA0A 3UKUA 3GDQA 1QVGM 4FZYA 3GBTA 3O80A 5JMVA 3HM9A 3ZT2A 4CVNE 3AVIA 1HYSA 3ZYYX 3R9PA 5GIOA 5CR4A 3RR7A 1MU2A 4H5WA 1QHTA 4K42A 2DPNA 4RW6A 3KZBA 4KFBA 1C0TA 4J2EA 3THWB 2O8DA 2F96A 4C23A 1YJ9N 5C12A 4EZ6A 3CIPA 2YNGA 2PYLA 1BI4A 4WE1A 3TSPA 1W97L 4DTMA 1BL3A 3AVAA 4XH5A 5BRHA 4IXCA 3HSTB 4L8RB 4CERA 1DGKN 2FBTA 1RTIA 2IS3A 4YHHK 4KPYA 4CGHA 4EHTA 3SAFA 2IAJA 1WB9A 2IOCA 3V81A 2Q0UA 4CJWA 3EE8A 4CIGA 1XMOK 2F7TA 4JK7A 3V9WA 1H1VA 3CJ9A 1RBRA 3CCVN 3G71N 3ENOA 4UQGA 1E3MA 1ILYA 1T03A 2QA4N 2XY8A 4DQSA 5BN8A 1RDBA 3AY9A 1JLEA 4CFCA 3VERA 1NGDA 4E7KA 1Y97A 4BRCA 3H6EA 4K0KK 5DM7L 1TV6A 3OS0A 3QNNA 4A5AA 3RSEB 2AJQA 1WUAA 3U6FA 3IKMA 1J5EK 3L3UA 2P1JA 3OYBA 4DR3K 4CGFA 4LF9K 4JKHA 3V9XA 1C0MA 3MWPA 1C6VA 4JI4K 5C25A 5AQOA 5AQVA 1ZYQA 2E2QA 3M8SA 1T7PA 1KRPA 1EXQA 3NH2A 5EOYA 4EP5A 3VQBA 1D4XA 4GVEA 3PIPL 4DFKA 1CZBA 1JCGA 5KGXA 3LALA 5M1QA 2D4WA 4LY7A 2QKKA 1KQSM 3C95A 4FM1A 4AHRA 4E1JA 4PUOA 4BWMA 5AQNA 3RRHA 2FXUA 1VQKN 4HCCA 1JLBA 2DFHA 1XNRK 4CF2A 2QK9A 3C7NA 2CGKA 2NZTA 5C2DA 5LJVA 4DV3K 3EZ5A 1XC9A 1HPZA 3QEPA 2KW4A 1FKPA 4KBOA 3J7ZO 3E9OA 4I2QA 3CQXA 3KLIA 4BGAA 1D9FA 5AQUA 2D1KA 1TGOA 5BR9A 4CZKA 3L0QA 1WAFA 3K57A 1VQ7N 5AQYA 3RTVA 5AQSA 4FLVA 2A3ZA 1BU6O 5FPMA 3CFOA 4M3TA 2F8SA 1QS4A 2KQ2A 4DV7K 1YI2N 3N4QA 1BCMA 3WNFA 4XH4A 4F2SA 5M1KA 1M1KO 2RPIA 2PAVA 3QNOA 2FF6A 3FZHA 5I3UA 1RTHA 5J2PA 2HMIA 3F2KA 1VSEA 4DV1K 3QEVA 1S22A 4NB4A 2OZSA 4DU4A 3THXB 2PZSA 4GKKK 2QWOA 5DK5A 5GAGP 3TABA 5HOOA 3R6MA 3VOVA 4H8KA 4A57A 1KAZA 1C1AA 3HYFA 3VEVA 4B3TK 4JI8K 4AHSA 2O8EA 1JL1A 3C65A 3P39A 4GMJB 1U4BA 1HUXA 4DHYA 3TPQA 1CXUA 4CD3A 4B8CA 3S3MA 1RDWX 3ITHA 4HCBA 3PO5A 2B6AA 2O8CA 5HROA 1RT2A 1KVBA 3VQ4A 3FZLA 3MN5A 1YF5L 3CQ8A 1ZBUA 3CC2N 3VQ9A 3DXMA 2NRXA 1VQPN 3SBTA 4CZIA 3TANA 2P51A 1X3NA 2VG5A 1SZ2A 3BGRA 4NO7A 1DT9A 4FWQA 2P9NA 3IFRA 3UKRA 5AQIA 1J54A 4E3SA 2UXDK 2VGNA 3O9UA 1QQOA 4CESA 4B9LA 1Q8IA 1X1PA 3RWUA 2P5OA 4FK2A 5T7BA 3SUQA 3LZJA 3HVRA 3O9RA 3P83D 3WEEB 2NUBA 3CJAA 4FLZA 3W3DA 4DF8A 3SLCA 3LANA 1ATRA 2GELA 4KHSA 1CZAN 3VQ7A 4YNQA 1TK5A 3C6AA 4WFAL 3AV9A 5I42A 3RVCA 1IKXA 1WLJA 2HNZA 2QWMA 3S9HA 2JWKA 4DV4K 1ESVA 1EETA 3VQQA 4QOZB 1S1WA 1JLCA 1Z6RA 4CEEA 4F3TA 4I6MB 2FSJA 3VQEA 3TARA 4JRPA 2B4JA 4R5PA 4B1UB 3SPZA 1NGEA 5M1FA 4M41A 4BRFA 3R1XA 4F9OA 3OYJA 3ZSQA 1HQUA 2IVOA 1P90A 4PL8A 5AQGA 3ZX3A 3A5OC 3DOLA 3VEOA 3HP9A 1VQLN 4B9TA 3AVBA 4J2BA 4CFBA 4B9VA 5F2RA 3MN6A 3VTHA 2A41A 3S3OA 3DLKA 1YITN 3AAPA 2VWJA 4KREA 4C8KA 2HHHK 4F2RA 1YJNN 4GVMA 2O8FB 3SI6A 3LP0A 2A40A 4DMNA 1TL3A 1N33K 4Z0UA 4DQPA 3OS1A 4YOWA 2QW9A 2X78A 4JAXA 5HLFA 4H0TB 3KVGA 3MWTA 5EU7A 3DMJA 1Q82O 1U2VB 5CY4A 3G4SN 3O9SA 2GUPA 1QZ6A 2HMPA 3VQCA 4N5SA 1WN7A 1J6ZA 3NE6A 2I7NA 2ZF5O 3GOIA 3RMAA 4B1VA 3WNGA 1HYZA 3SQ4A 1L3SA 2G8UA 5AQXA 3FZMA 3ZSYA 1V4SA 2PBDA 4WFBL 4BQLA 4CZJA 2NRRA 4M45A 4ELUA 3VMFB 3MXJA 4WCEL 3KJVA 4Z4EA 1BI4B 4JHDA 4LFAK 1S1UA 4MLHA 3JSMA 2GWJA 3AGKA 4DTOA 1VHXA 1YUWA 1LWEA 4B1YB 3D6RA 3V6DA 3MDQA 5GAHP 3PX4A 3CERA 1ITGA 4CEOA 4BY9C 3J7AP 1R59O 3F9KA 3ENBA 4BACA 2EX3A 3M8RA 4XIUA 2KLAA 1RBSA 4IWVA 4BRPA 4N76A 4YORA 3VENA 5KQ8A 1QQCA 4UY8O 4CGIA 3LPTA 4CJEA 2RKIA 1YIJN 4DSLA 3EL2A 3WT0A 4HVJA 4DTRA 3CPWM 3HP6A 3K59A 4GV9A 4O4GA 1QVFM 4JKCA 4YY3K 4JNEA 2E6LA 4KHPK 5BPMA 4LFCK 2P9KA 3I56N 4JI7K 4X64K 3O3GA 2P9PB 1NK0A 3AAQA 2FBVA 2HHXA 4OGCA 5CZ2A 4B08A 5AQWA 4NYFA 2VQFK 2YI1A 1T05A 4DTSA 4BG8A 4AILC 2NRZA 4M3RA 3E9PA 1R0AA 4BC4A 4ZTJA 2HHVA 1B9DA 2UXBK 3QLHA 3V1OA 1UA0A 4DTJA 4I2PA 1K8KA 3EKSA 3SJHA 3J8AA 3O5BA 4CHPA 3DLHA 1HPMA 2QWNA 2D0BA 3L4IA 1TK0A 3T19A 3EYZA 3HVTA 3PLAA 2OZMA 4EP4A 3U9DA 3SUPA 2ZJPL 3M8PA 1D8YA 2HSTA 3ZSVA 3HSCA 4QS7A 4FJNA 4HWIA 1JLQA 5BPLA 3HRGA 4FO0A 3ID8A 5AQJA 4CF8A 4LD0A 2QTDA 4M3ZA 4BRGA 2DFEA 4RCHA 5EVZA 2X6SA 1E4FT 4FJMA 3I55N 1S6PA 3QIOA 4U7BA 3OYKA 4YOVA 3HXMA 1U45A 2DFFA 2QI2A 4AM7A 4BVPA 4QS8A 1A5WA 4E7IA 4B9SA 4CHNA 2ASMA 2BDPA 3LP1A 1VSFA 3CCQN 3MK6A 1KVCA 3IRXA 4FWLA 2XRIA 2HB5A 2HBLA 1T3VA 1D5AA 2OPRA 3CMEN 1NGAA 4N47A 1NGCA 2G8IA 4BRKA 4FLXA 3VESA 3QEIA 1KSPA 1GLLO 3P1GA 2WTUA 2NRTA 2IC3A 4BRIA 4J2DA 4BG9A 2D0AA 1BG3A 1HNZK 3SBGA 1L3VA 3SMSA 4CZLA 1WSIA 3QMLA 3VQAA 4HUFA 4GV3A 3HTVA 4FW2A 4FWKA 4W5NA 5I9EB 1GOCA 3ZSOA 3HOSA 3VN5A 1RFQA 3J80O 4CIEA
chains in the Genus database with same CATH topology
1SV5A 3DLRA 5KI6A 1CZBA 5KGXA 3OYDA 3I0RA 1HYVA 4DSFA 4DFKA 3HK2A 3LALA 3MECA 1W0HA 4LH5A 4LY7A 4C8MA 4BE1A 2QKKA 3C95A 5JS1A 3AVKA 1X9MA 4CJ4A 4AHVA 3AO3A 3ZSZA 4FM1A 4DS5A 4CEQA 3K2PA 4KHNA 2YNHA 4AHRA 1EX4A 4PUOA 4KI6A 4BWMA 1WSGA 4KTZA 4DTUA 2EHGA 3RRHA 4KI4A 3T3FA 1QSYA 2RF2A 2OPPA 2Y1JA 2HHTA 1NKBA 3KKRA 4CJKA 4HCCA 1ZBIA 1JLBA 2DFHA 3V9ZA 3NF7A 4CF2A 2QK9A 2G8KA 4HHTA 4FZZA 4C8LA 1RT1A 4OJRA 3T1AA 3HPGA 3L2QA 2GV9A 1WAJA 4FK0A 3HJFA 3ZT0A 2HHUA 1LV5A 3EZ5A 1XC9A 3ZSRA 3AA3A 4KHYA 1HPZA 4BDZA 3QEPA 4HUEA 2KW4A 3OYMA 1FKPA 1RBTA 1DTTA 3DRPA 3NGZA 2JGUA 2BE2A 4I2QA 3KLIA 1D9FA 4C8OA 4FJJA 4KV8A 3U3GA 3AVNA 1TGOA 4DF4A 2D5RA 4HUGA 3TI0A 2XO7A 1BIZA 3AA4A 1WAFA 3K57A 3SV3A 4CHYA 3RTVA 4O55A 4NCBA 1XHXA 3JYTA 4FLVA 4FJXA 3OYIA 3UIQA 2XY6A 4LH4A 4DTNA 1J5OA 4FJ5A 3QO9A 2PYJA 4Z4GA 3CFOA 3SCXA 3LWMA 4K8XA 4M3TA 3G10A 2F8SA 2FBXA 1LAWA 3AO5A 2X74A 1QS4A 2KQ2A 3V9UA 3MEEA 1N5YA 1BCMA 3WNFA 4F2SA 4CEZA 1DTQA 2G8VA 1QSLA 4E7LA 4KHQA 1VRUA 2VWKA 3AVFA 1KFSA 4Q0BA 3OYNA 1BISA 2RPIA 2OPQA 3P5JA 3K5NA 4MQ3A 5FRNA 3QNOA 4CEDA 1J9AA 5I3UA 3ZT1A 1TKXA 4Y1DA 1RTHA 5J2PA 3LAKA 3SUNA 3AVCA 4Q5VA 2HMIA 3PO4A 3VQ8A 4FVMA 1UOCA 3AA5X 3K5MA 1VSEA 4FYDA 2VG7A 3ZSWA 3QEVA 1X9WA 2YHAA 4ELTA 4CEBA 2OZSA 3K5OA 4DU4A 3CFPA 2PZSA 1B9FA 1J53A 1NK8A 1RDAA 5DK5A 1SKRA 1Z25A 4KKOA 3KLHA 3TABA 2YV0X 2KZMA 1S1TA 1RT4A 3WNHA 1TKZA 2HNDA 2YKNA 2W42A 1IKWA 1L5UA 2HHWA 3VQ5A 1C1BA 4OKKA 4H8KA 4Z4HA 4N56A 4FM2A 1C1AA 3HYFA 3KK2A 4AHSA 1TL1A 3KKSA 1JL1A 3L2WA 4GMJB 1NJZA 4DU1A 1U4BA 5J2NA 2O4GA 1JXBA 4RW8A 2LSNA 4DQQA 1BCOA 4FJIA 2I5JA 1CXUA 3AVMA 4B8CA 4E1MA 3OYAA 3S3MA 1UAXA 3QETA 1RILA 3ITHA 4HCBA 4Z4CA 2B6AA 2WOMA 3OYLA 3PO5A 3MXMA 5HROA 1RT2A 4OKJA 1KVBA 3LDSA 2HVHA 1XWLA 5C42A 1IG9A 2DY4A 3HL8A 3VQ4A 4FJGA 1UA1A 4DSKA 3I8DA 2XY5A 4E89A 4EZ9A 3CQ8A 1ZBUA 1FKOA 1IH7A 3VQ9A 4DSEA 5J2QA 3QIPA 5CZ1A 2QXFA 3TANA 2P51A 3QEXA 3QERA 4LSLA 1RTJA 4Y1CA 5DMRA 2VG5A 4DFJA 4E0DA 5K14A 3DLBA 3BGRA 1TAQA 4E19A 3BDPA 2HHQA 3G0ZA 1RCHA 3L2RA 3ALYA 5HBMA 3NH0A 4Z4FA 2X6NA 1TK8A 3NCIA 4FLTA 2P5GA 1J54A 4E3SA 5D3GA 3TR8A 4IDKA 5FDLA 4BWJA 3IG1A 3LP3A 4FLUA 2KZZA 4CESA 1O1WA 1FXXA 4B9LA 1Q8IA 1X1PA 3NFAA 4AH9A 2P5OA 3NF9A 4DLGA 1YVUA 3DM2A 5T7BA 2XHBA 4FK2A 1IKVA 3LZJA 3SUQA 3L3VA 3HVRA 3KIOA 3P83D 1YTAA 4FJHA 3HPHA 1YT3A 4CECA 2F8TA 2NUBA 3CG7A 4OGEA 4FLZA 3TWHA 4F4KA 4DTPA 1XHZA 4DF8A 4NCGA 1D9DA 5KGWA 2ZQBA 1VSIA 3SQ2A 2BANA 3LANA 4NYNA 4CHZA 3OJSA 4HTUA 2HW3A 3DRRA 3OYFA 4KHSA 4CEAA 3VQ7A 5C24A 4YNQA 5CYMA 1TK5A 3AV9A 4TSXA 2JLEA 1HRHA 5E41A 5I42A 4Z4IA 1IKXA 3O4NA 3K5LA 3ISNC 5HP1A 1WLJA 4GW6A 4FJ7A 3NAEA 3VA3A 2HNZA 2GUIA 2Q3SA 3TAMA 3MEGA 4B9NA 4DG1A 1RT5A 3CM5A 3C94A 4DQRA 1REVA 4OPKA 3S9HA 1A5XA 1HNVA 4E7JA 4DU3A 4B9UA 1EETA 3AVLA 3VQQA 1UWBA 1S1WA 1FK9A 1JLCA 4ID5A 1U49A 4QOZB 1RT7A 4CEEA 3DLEA 3LAMA 1NOYA 3OVNA 4W5RA 4F3TA 2YKMA 3THVA 4I9LA 4BDYA 4CGDA 5FRMA 3TARA 3VQEA 1TKTA 4G1QA 4YFUA 4JRPA 2B4JA 4CJ3A 4R5PA 5HRNA 1SL0A 4CEFA 4IKFA 3DRSA 4AHUA 4CHQA 3CM6A 3O4QA 3WNEA 3SPZA 3KTQA 2ITGA 4M41A 1SL2A 2ZD1A 3OYHA 5KRSA 3OYJA 1WSHA 3ZSQA 5KTQA 4DTXA 1HQUA 3DYAA 3C6UA 1S6QA 2ATQA 1L3TA 2PY5A 1S5JA 4M3YA 3TAFA 3QEWA 1BHLA 4OPJA 3VQPA 4B8AB 3DOLA 1GOAA 1HNIA 4AHTA 3NF6A 3A2FA 1RT3A 3OYEA 3HP9A 4B9TA 4NCAA 3AVBA 4KTWA 3DLGA 4CFBA 4B9VA 4DFMA 1JKHA 4J2BA 4CJ5A 2Z1IA 4CJUA 4KO0A 3SQ0A 1HMVA 3DLKA 3S3OA 4OLBA 4KB1A 1ZBLA 3L8BA 2VWJA 1N6QA 4I7FA 3SUOA 4C8KA 4KREA 2DTUA 1YTUA 1S1XA 2YNFA 1JL2A 4F2RA 2GBZA 3RRGA 1LAVA 4GVMA 1F21A 3NGYA 4F8RA 3ASMA 2E6MA 2G8WA 3SI6A 2E4LA 1DLOA 1ASVA 3CFRA 3LP0A 3TAEA 4J2AA 4DMNA 1TL3A 3ZCMA 4W5OA 1CZ9A 4CFDA 4Z0UA 1BQMA 4CJPA 4DQPA 3OS1A 2D0CA 1G15A 2X78A 4CF0A 5HLFA 1NK5A 1W9HA 1RTDA 4M42A 2KFNA 4IBNA 5J2MA 3MAQA 4CFAA 3KK3A 5EU7A 4DLEA 3HO1A 4PWDA 3DMJA 1IO2A 3EY1A 3ULDA 4JS4A 3V4IA 4IFVA 3KLFA 5CY4A 4JRQA 3PY8A 4OVLA 3AO2A 3B6PA 1WSFA 4JS5A 3PX6A 5HRRA 1S9EA 1NKCA 3RR8A 4CJSA 4N41A 4FJ8A 4O0JA 4FLYA 3KK1A 2ZE2A 3RWUA 2VG6A 3VQCA 3SYZA 2Z1GA 1VK0A 2RN2A 4N5SA 4KAZA 1WN7A 2YNIA 3NE6A 1NOZA 4BDPA 3AO1A 3RMAA 1KLMA 1VSHA 3WNGA 1HYZA 4H4MA 3SQ4A 1L3SA 3AVJA 1U48A 2G8UA 4CCHA 4E1NA 1BGXT 3OJUA 4IFYA 1RDDA 3ZSYA 4OLAA 3E01A 5SZTA 2KFZA 1NJWA 4CJLA 4M45A 4ELUA 1QSSA 3MXJA 1SKSA 1L3UA 3KD5E 2IDOA 3KJVA 4Z4EA 1JXEA 1BI4B 4MFBA 1S1UA 1TKDA 3OS2A 3JSMA 1ZBFA 3U3YA 4PQUA 5SWMA 4M3UA 1S9GA 3NF8A 4KB0A 3V9SA 1A5VA 1IKYA 1C0UA 1JLGA 1K6YA 5KRTA 4DTOA 1RBVA 1LWEA 3MXIA 1Q9YA 1NK6A 3V6DA 3PX4A 1LWFA 1ITGA 4DS4A 4FJ9A 4CEOA 1RNHA 2OYQA 2ETJA 3F9KA 5FROA 4BACA 4KRFA 2EX3A 3AVGA 4O0IA 1QE1A 5HRSA 5CYQA 3M8RA 3SPYA 3OYGA 4XIUA 2A1SA 4CJRA 4O44A 3IAYA 1S1VA 1RBSA 1T8EA 4K8ZA 3F73A 3AVHA 4N76A 1SL1A 4RW9A 4W5QA 4KHUA 4FW1A 4BE2A 4FK4A 4RG8A 1QQCA 3S3NA 1ASWA 3K58A 4RW4A 3VQDA 4ZTFA 4CGJA 4I9QA 4CGIA 3LPTA 4CJEA 2RKIA 3B6OA 5J1EA 4DSLA 1RBUA 1WNSA 3FFIA 3V1QA 4HVJA 1SUQA 4CIFA 4DTRA 4ELVA 2HNYA 3HP6A 3K59A 4O4GA 4DWIA 1VSJA 1NK9A 4ID1A 1B92A 2B5JA 2R7YA 1U04A 1WSJA 2E6LA 1NK7A 2OA8A 1X9SA 1NK4A 1TAUA 3I0SA 3PX0A 4FZXC 3LWLA 3CYMA 2XY7A 5HRPA 3O3GA 4B9MA 3ZSXA 1NK0A 4H4OA 2FBVA 2HHXA 4OGCA 2Y1IA 5CZ2A 4B08A 4CK2A 1LW2A 1WSEA 2BGGA 3H08A 4QAGA 4C8NA 1Q9XA 3DOKA 4NYFA 3NDKA 3LP2A 1HQEA 3D0PA 3LZIA 2FC0A 4CJQA 4CE9A 3NH1A 4DTSA 1T05A 1NKEA 2G8HA 4AILC 4M3RA 1QTMA 3NBPA 1R0AA 1KLNA 4ZTJA 3KD1E 2HHVA 1B9DA 4BE0A 1CXQA 1KFDA 3TAPA 3QLHA 3V1RA 3DI6A 3V1OA 1UA0A 1BIUA 1NJYA 4KHWA 1EP4A 4DTJA 4FJLA 3IS9A 2QKBA 4FZYA 4I2PA 3HM9A 4IG3A 3ZT2A 1XI1A 3RMCA 1RDCA 3AVIA 1HYSA 3LPUA 1I39A 1LWCA 3RR7A 1U47A 1KCFA 1MU2A 2WONA 4CHPA 3L2VA 1QHTA 1VSDA 4IG0A 4RW6A 4DQIA 4KFBA 3DLHA 4F3OA 1C0TA 1CLQA 4J2EA 2D0BA 3TAQA 2F96A 1TK0A 4CJTA 1HJRA 3T19A 4ZHRA 3EYZA 3HVTA 4EZ6A 3QESA 2OZMA 4CHOA 3SJJA 4EP4A 2YNGA 3SUPA 1JLFA 3M8PA 1NJXA 4CK1A 1BI4A 4WE1A 3PUFA 2PYLA 4DTMA 1D8YA 4PA1A 2HHSA 1BL3A 1ZBHA 3ZSVA 3AVAA 4KTQA 4FJNA 3HSTB 1JLQA 3MEDA 4JLHA 1C1CA 4CF8A 4CERA 1BQNA 4LD0A 4L8RB 3M8QA 2FBTA 4M3ZA 1RTIA 2IS3A 2DFEA 2IGIA 3TAGA 4KPYA 2OPSA 2X6SA 4O5BA 2IAJA 4CGHA 4DFPA 3C6TA 4RW7A 4FJMA 1I3AA 2IOCA 4CF1A 3V81A 1S6PA 4CJWA 3QIOA 2G8FA 3OYKA 4CIGA 3HXMA 1U45A 3SZ2A 2DFFA 1JLAA 2KTQA 3V9WA 1RBRA 1A5WA 5JS2A 1ASUA 4CF9A 3ZT3A 4UQGA 4W5TA 3KLEA 4E7IA 3QINA 4B9SA 4AHCA 4CHNA 3SNNA 1T03A 2Z1JA 2FBYA 3NHGA 3OY9A 4LSNA 4FCYA 4E7HA 2BDPA 4PY5A 2XY8A 1VSFA 3LP1A 4DQSA 3KLGA 1RDBA 3D45A 3OYCA 3HT3A 1KVCA 1JLEA 3IRXA 3O3FA 3L2UA 3PV8A 2XRIA 4CFCA 2HB5A 2HVIA 1D5AA 2OPRA 4E7KA 1Y97A 4CJFA 4FLWA 4QCLA 4N47A 2G8IA 2O4IA 1TV6A 3SV4A 3OS0A 1GOBA 3QNNA 4FLXA 1RT6A 3NGIA 3AO4A 1TVRA 3ZT4A 3QEIA 1SKWA 1KSPA 4FJKA 3P1GA 2AJQA 2IC3A 3U6FA 4DSIA 4J2DA 4FXDA 4CGGA 4DSJA 3L3UA 4FM0A 4CJVA 2D0AA 3VA0A 1VRTA 4OKEA 4B3OA 3HPOA 2P1JA 1KVAA 4ICLA 4CK3A 3OYBA 1VSLA 1L3VA 4CGFA 1VSMA 3V9XA 1WSIA 3VQAA 1C0MA 1KTQA 4HUFA 1C6VA 1LW0A 3SQ1A 5C25A 4FW2A 1VSKA 2Z1HA 3RMBA 1ZYQA 3M8SA 3O3HA 3AA2A 3VQ6A 1T7PA 4M3XA 4W5NA 1KRPA 4M3WA 1EXQA 2A1RA 2YHBA 3NH2A 3RMDA 1GOCA 3ZSOA 4EP5A 3VN5A 3VQBA 1Z26A 1EKEA 4CIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV5 A;  3DLR A;  5KI6 A;  1CZB A;  5KGX A;  3OYD A;  3I0R A;  1HYV A;  4DSF A;  4DFK A;  3HK2 A;  3LAL A;  3MEC A;  1W0H A;  4LH5 A;  4LY7 A;  4C8M A;  4BE1 A;  2QKK A;  3C95 A;  5JS1 A;  3AVK A;  1X9M A;  4CJ4 A;  4AHV A;  3AO3 A;  3ZSZ A;  4FM1 A;  4DS5 A;  4CEQ A;  3K2P A;  4KHN A;  2YNH A;  4AHR A;  1EX4 A;  4PUO A;  4KI6 A;  4BWM A;  1WSG A;  4KTZ A;  4DTU A;  2EHG A;  3RRH A;  4KI4 A;  3T3F A;  1QSY A;  2RF2 A;  2OPP A;  2Y1J A;  2HHT A;  1NKB A;  3KKR A;  4CJK A;  4HCC A;  1ZBI A;  1JLB A;  2DFH A;  3V9Z A;  3NF7 A;  4CF2 A;  2QK9 A;  2G8K A;  4HHT A;  4FZZ A;  4C8L A;  1RT1 A;  4OJR A;  3T1A A;  3HPG A;  3L2Q A;  2GV9 A;  1WAJ A;  4FK0 A;  3HJF A;  3ZT0 A;  2HHU A;  1LV5 A;  3EZ5 A;  1XC9 A;  3ZSR A;  3AA3 A;  4KHY A;  1HPZ A;  4BDZ A;  3QEP A;  4HUE A;  2KW4 A;  3OYM A;  1FKP A;  1RBT A;  1DTT A;  3DRP A;  3NGZ A;  2JGU A;  2BE2 A;  4I2Q A;  3KLI A;  1D9F A;  4C8O A;  4FJJ A;  4KV8 A;  3U3G A;  3AVN A;  1TGO A;  4DF4 A;  2D5R A;  4HUG A;  3TI0 A;  2XO7 A;  1BIZ A;  3AA4 A;  1WAF A;  3K57 A;  3SV3 A;  4CHY A;  3RTV A;  4O55 A;  4NCB A;  1XHX A;  3JYT A;  4FLV A;  4FJX A;  3OYI A;  3UIQ A;  2XY6 A;  4LH4 A;  4DTN A;  1J5O A;  4FJ5 A;  3QO9 A;  2PYJ A;  4Z4G A;  3CFO A;  3SCX A;  3LWM A;  4K8X A;  4M3T A;  3G10 A;  2F8S A;  2FBX A;  1LAW A;  3AO5 A;  2X74 A;  1QS4 A;  2KQ2 A;  3V9U A;  3MEE A;  1N5Y A;  1BCM A;  3WNF A;  4F2S A;  4CEZ A;  1DTQ A;  2G8V A;  1QSL A;  4E7L A;  4KHQ A;  1VRU A;  2VWK A;  3AVF A;  1KFS A;  4Q0B A;  3OYN A;  1BIS A;  2RPI A;  2OPQ A;  3P5J A;  3K5N A;  4MQ3 A;  5FRN A;  3QNO A;  4CED A;  1J9A A;  5I3U A;  3ZT1 A;  1TKX A;  4Y1D A;  1RTH A;  5J2P A;  3LAK A;  3SUN A;  3AVC A;  4Q5V A;  2HMI A;  3PO4 A;  3VQ8 A;  4FVM A;  1UOC A;  3AA5 X;  3K5M A;  1VSE A;  4FYD A;  2VG7 A;  3ZSW A;  3QEV A;  1X9W A;  2YHA A;  4ELT A;  4CEB A;  2OZS A;  3K5O A;  4DU4 A;  3CFP A;  2PZS A;  1B9F A;  1J53 A;  1NK8 A;  1RDA A;  5DK5 A;  1SKR A;  1Z25 A;  4KKO A;  3KLH A;  3TAB A;  2YV0 X;  2KZM A;  1S1T A;  1RT4 A;  3WNH A;  1TKZ A;  2HND A;  2YKN A;  2W42 A;  1IKW A;  1L5U A;  2HHW A;  3VQ5 A;  1C1B A;  4OKK A;  4H8K A;  4Z4H A;  4N56 A;  4FM2 A;  1C1A A;  3HYF A;  3KK2 A;  4AHS A;  1TL1 A;  3KKS A;  1JL1 A;  3L2W A;  4GMJ B;  1NJZ A;  4DU1 A;  1U4B A;  5J2N A;  2O4G A;  1JXB A;  4RW8 A;  2LSN A;  4DQQ A;  1BCO A;  4FJI A;  2I5J A;  1CXU A;  3AVM A;  4B8C A;  4E1M A;  3OYA A;  3S3M A;  1UAX A;  3QET A;  1RIL A;  3ITH A;  4HCB A;  4Z4C A;  2B6A A;  2WOM A;  3OYL A;  3PO5 A;  3MXM A;  5HRO A;  1RT2 A;  4OKJ A;  1KVB A;  3LDS A;  2HVH A;  1XWL A;  5C42 A;  1IG9 A;  2DY4 A;  3HL8 A;  3VQ4 A;  4FJG A;  1UA1 A;  4DSK A;  3I8D A;  2XY5 A;  4E89 A;  4EZ9 A;  3CQ8 A;  1ZBU A;  1FKO A;  1IH7 A;  3VQ9 A;  4DSE A;  5J2Q A;  3QIP A;  5CZ1 A;  2QXF A;  3TAN A;  2P51 A;  3QEX A;  3QER A;  4LSL A;  1RTJ A;  4Y1C A;  5DMR A;  2VG5 A;  4DFJ A;  4E0D A;  5K14 A;  3DLB A;  3BGR A;  1TAQ A;  4E19 A;  3BDP A;  2HHQ A;  3G0Z A;  1RCH A;  3L2R A;  3ALY A;  5HBM A;  3NH0 A;  4Z4F A;  2X6N A;  1TK8 A;  3NCI A;  4FLT A;  2P5G A;  1J54 A;  4E3S A;  5D3G A;  3TR8 A;  4IDK A;  5FDL A;  4BWJ A;  3IG1 A;  3LP3 A;  4FLU A;  2KZZ A;  4CES A;  1O1W A;  1FXX A;  4B9L A;  1Q8I A;  1X1P A;  3NFA A;  4AH9 A;  2P5O A;  3NF9 A;  4DLG A;  1YVU A;  3DM2 A;  5T7B A;  2XHB A;  4FK2 A;  1IKV A;  3LZJ A;  3SUQ A;  3L3V A;  3HVR A;  3KIO A;  3P83 D;  1YTA A;  4FJH A;  3HPH A;  1YT3 A;  4CEC A;  2F8T A;  2NUB A;  3CG7 A;  4OGE A;  4FLZ A;  3TWH A;  4F4K A;  4DTP A;  1XHZ A;  4DF8 A;  4NCG A;  1D9D A;  5KGW A;  2ZQB A;  1VSI A;  3SQ2 A;  2BAN A;  3LAN A;  4NYN A;  4CHZ A;  3OJS A;  4HTU A;  2HW3 A;  3DRR A;  3OYF A;  4KHS A;  4CEA A;  3VQ7 A;  5C24 A;  4YNQ A;  5CYM A;  1TK5 A;  3AV9 A;  4TSX A;  2JLE A;  1HRH A;  5E41 A;  5I42 A;  4Z4I A;  1IKX A;  3O4N A;  3K5L A;  3ISN C;  5HP1 A;  1WLJ A;  4GW6 A;  4FJ7 A;  3NAE A;  3VA3 A;  2HNZ A;  2GUI A;  2Q3S A;  3TAM A;  3MEG A;  4B9N A;  4DG1 A;  1RT5 A;  3CM5 A;  3C94 A;  4DQR A;  1REV A;  4OPK A;  3S9H A;  1A5X A;  1HNV A;  4E7J A;  4DU3 A;  4B9U A;  1EET A;  3AVL A;  3VQQ A;  1UWB A;  1S1W A;  1FK9 A;  1JLC A;  4ID5 A;  1U49 A;  4QOZ B;  1RT7 A;  4CEE A;  3DLE A;  3LAM A;  1NOY A;  3OVN A;  4W5R A;  4F3T A;  2YKM A;  3THV A;  4I9L A;  4BDY A;  4CGD A;  5FRM A;  3TAR A;  3VQE A;  1TKT A;  4G1Q A;  4YFU A;  4JRP A;  2B4J A;  4CJ3 A;  4R5P A;  5HRN A;  1SL0 A;  4CEF A;  4IKF A;  3DRS A;  4AHU A;  4CHQ A;  3CM6 A;  3O4Q A;  3WNE A;  3SPZ A;  3KTQ A;  2ITG A;  4M41 A;  1SL2 A;  2ZD1 A;  3OYH A;  5KRS A;  3OYJ A;  1WSH A;  3ZSQ A;  5KTQ A;  4DTX A;  1HQU A;  3DYA A;  3C6U A;  1S6Q A;  2ATQ A;  1L3T A;  2PY5 A;  1S5J A;  4M3Y A;  3TAF A;  3QEW A;  1BHL A;  4OPJ A;  3VQP A;  4B8A B;  3DOL A;  1GOA A;  1HNI A;  4AHT A;  3NF6 A;  3A2F A;  1RT3 A;  3OYE A;  3HP9 A;  4B9T A;  4NCA A;  3AVB A;  4KTW A;  3DLG A;  4CFB A;  4B9V A;  4DFM A;  1JKH A;  4J2B A;  4CJ5 A;  2Z1I A;  4CJU A;  4KO0 A;  3SQ0 A;  1HMV A;  3DLK A;  3S3O A;  4OLB A;  4KB1 A;  1ZBL A;  3L8B A;  2VWJ A;  1N6Q A;  4I7F A;  3SUO A;  4C8K A;  4KRE A;  2DTU A;  1YTU A;  1S1X A;  2YNF A;  1JL2 A;  4F2R A;  2GBZ A;  3RRG A;  1LAV A;  4GVM A;  1F21 A;  3NGY A;  4F8R A;  3ASM A;  2E6M A;  2G8W A;  3SI6 A;  2E4L A;  1DLO A;  1ASV A;  3CFR A;  3LP0 A;  3TAE A;  4J2A A;  4DMN A;  1TL3 A;  3ZCM A;  4W5O A;  1CZ9 A;  4CFD A;  4Z0U A;  1BQM A;  4CJP A;  4DQP A;  3OS1 A;  2D0C A;  1G15 A;  2X78 A;  4CF0 A;  5HLF A;  1NK5 A;  1W9H A;  1RTD A;  4M42 A;  2KFN A;  4IBN A;  5J2M A;  3MAQ A;  4CFA A;  3KK3 A;  5EU7 A;  4DLE A;  3HO1 A;  4PWD A;  3DMJ A;  1IO2 A;  3EY1 A;  3ULD A;  4JS4 A;  3V4I A;  4IFV A;  3KLF A;  5CY4 A;  4JRQ A;  3PY8 A;  4OVL A;  3AO2 A;  3B6P A;  1WSF A;  4JS5 A;  3PX6 A;  5HRR A;  1S9E A;  1NKC A;  3RR8 A;  4CJS A;  4N41 A;  4FJ8 A;  4O0J A;  4FLY A;  3KK1 A;  2ZE2 A;  3RWU A;  2VG6 A;  3VQC A;  3SYZ A;  2Z1G A;  1VK0 A;  2RN2 A;  4N5S A;  4KAZ A;  1WN7 A;  2YNI A;  3NE6 A;  1NOZ A;  4BDP A;  3AO1 A;  3RMA A;  1KLM A;  1VSH A;  3WNG A;  1HYZ A;  4H4M A;  3SQ4 A;  1L3S A;  3AVJ A;  1U48 A;  2G8U A;  4CCH A;  4E1N A;  1BGX T;  3OJU A;  4IFY A;  1RDD A;  3ZSY A;  4OLA A;  3E01 A;  5SZT A;  2KFZ A;  1NJW A;  4CJL A;  4M45 A;  4ELU A;  1QSS A;  3MXJ A;  1SKS A;  1L3U A;  3KD5 E;  2IDO A;  3KJV A;  4Z4E A;  1JXE A;  1BI4 B;  4MFB A;  1S1U A;  1TKD A;  3OS2 A;  3JSM A;  1ZBF A;  3U3Y A;  4PQU A;  5SWM A;  4M3U A;  1S9G A;  3NF8 A;  4KB0 A;  3V9S A;  1A5V A;  1IKY A;  1C0U A;  1JLG A;  1K6Y A;  5KRT A;  4DTO A;  1RBV A;  1LWE A;  3MXI A;  1Q9Y A;  1NK6 A;  3V6D A;  3PX4 A;  1LWF A;  1ITG A;  4DS4 A;  4FJ9 A;  4CEO A;  1RNH A;  2OYQ A;  2ETJ A;  3F9K A;  5FRO A;  4BAC A;  4KRF A;  2EX3 A;  3AVG A;  4O0I A;  1QE1 A;  5HRS A;  5CYQ A;  3M8R A;  3SPY A;  3OYG A;  4XIU A;  2A1S A;  4CJR A;  4O44 A;  3IAY A;  1S1V A;  1RBS A;  1T8E A;  4K8Z A;  3F73 A;  3AVH A;  4N76 A;  1SL1 A;  4RW9 A;  4W5Q A;  4KHU A;  4FW1 A;  4BE2 A;  4FK4 A;  4RG8 A;  1QQC A;  3S3N A;  1ASW A;  3K58 A;  4RW4 A;  3VQD A;  4ZTF A;  4CGJ A;  4I9Q A;  4CGI A;  3LPT A;  4CJE A;  2RKI A;  3B6O A;  5J1E A;  4DSL A;  1RBU A;  1WNS A;  3FFI A;  3V1Q A;  4HVJ A;  1SUQ A;  4CIF A;  4DTR A;  4ELV A;  2HNY A;  3HP6 A;  3K59 A;  4O4G A;  4DWI A;  1VSJ A;  1NK9 A;  4ID1 A;  1B92 A;  2B5J A;  2R7Y A;  1U04 A;  1WSJ A;  2E6L A;  1NK7 A;  2OA8 A;  1X9S A;  1NK4 A;  1TAU A;  3I0S A;  3PX0 A;  4FZX C;  3LWL A;  3CYM A;  2XY7 A;  5HRP A;  3O3G A;  4B9M A;  3ZSX A;  1NK0 A;  4H4O A;  2FBV A;  2HHX A;  4OGC A;  2Y1I A;  5CZ2 A;  4B08 A;  4CK2 A;  1LW2 A;  1WSE A;  2BGG A;  3H08 A;  4QAG A;  4C8N A;  1Q9X A;  3DOK A;  4NYF A;  3NDK A;  3LP2 A;  1HQE A;  3D0P A;  3LZI A;  2FC0 A;  4CJQ A;  4CE9 A;  3NH1 A;  4DTS A;  1T05 A;  1NKE A;  2G8H A;  4AIL C;  4M3R A;  1QTM A;  3NBP A;  1R0A A;  1KLN A;  4ZTJ A;  3KD1 E;  2HHV A;  1B9D A;  4BE0 A;  1CXQ A;  1KFD A;  3TAP A;  3QLH A;  3V1R A;  3DI6 A;  3V1O A;  1UA0 A;  1BIU A;  1NJY A;  4KHW A;  1EP4 A;  4DTJ A;  4FJL A;  3IS9 A;  2QKB A;  4FZY A;  4I2P A;  3HM9 A;  4IG3 A;  3ZT2 A;  1XI1 A;  3RMC A;  1RDC A;  3AVI A;  1HYS A;  3LPU A;  1I39 A;  1LWC A;  3RR7 A;  1U47 A;  1KCF A;  1MU2 A;  2WON A;  4CHP A;  3L2V A;  1QHT A;  1VSD A;  4IG0 A;  4RW6 A;  4DQI A;  4KFB A;  3DLH A;  4F3O A;  1C0T A;  1CLQ A;  4J2E A;  2D0B A;  3TAQ A;  2F96 A;  1TK0 A;  4CJT A;  1HJR A;  3T19 A;  4ZHR A;  3EYZ A;  3HVT A;  4EZ6 A;  3QES A;  2OZM A;  4CHO A;  3SJJ A;  4EP4 A;  2YNG A;  3SUP A;  1JLF A;  3M8P A;  1NJX A;  4CK1 A;  1BI4 A;  4WE1 A;  3PUF A;  2PYL A;  4DTM A;  1D8Y A;  4PA1 A;  2HHS A;  1BL3 A;  1ZBH A;  3ZSV A;  3AVA A;  4KTQ A;  4FJN A;  3HST B;  1JLQ A;  3MED A;  4JLH A;  1C1C A;  4CF8 A;  4CER A;  1BQN A;  4LD0 A;  4L8R B;  3M8Q A;  2FBT A;  4M3Z A;  1RTI A;  2IS3 A;  2DFE A;  2IGI A;  3TAG A;  4KPY A;  2OPS A;  2X6S A;  4O5B A;  2IAJ A;  4CGH A;  4DFP A;  3C6T A;  4RW7 A;  4FJM A;  1I3A A;  2IOC A;  4CF1 A;  3V81 A;  1S6P A;  4CJW A;  3QIO A;  2G8F A;  3OYK A;  4CIG A;  3HXM A;  1U45 A;  3SZ2 A;  2DFF A;  1JLA A;  2KTQ A;  3V9W A;  1RBR A;  1A5W A;  5JS2 A;  1ASU A;  4CF9 A;  3ZT3 A;  4UQG A;  4W5T A;  3KLE A;  4E7I A;  3QIN A;  4B9S A;  4AHC A;  4CHN A;  3SNN A;  1T03 A;  2Z1J A;  2FBY A;  3NHG A;  3OY9 A;  4LSN A;  4FCY A;  4E7H A;  2BDP A;  4PY5 A;  2XY8 A;  1VSF A;  3LP1 A;  4DQS A;  3KLG A;  1RDB A;  3D45 A;  3OYC A;  3HT3 A;  1KVC A;  1JLE A;  3IRX A;  3O3F A;  3L2U A;  3PV8 A;  2XRI A;  4CFC A;  2HB5 A;  2HVI A;  1D5A A;  2OPR A;  4E7K A;  1Y97 A;  4CJF A;  4FLW A;  4QCL A;  4N47 A;  2G8I A;  2O4I A;  1TV6 A;  3SV4 A;  3OS0 A;  1GOB A;  3QNN A;  4FLX A;  1RT6 A;  3NGI A;  3AO4 A;  1TVR A;  3ZT4 A;  3QEI A;  1SKW A;  1KSP A;  4FJK A;  3P1G A;  2AJQ A;  2IC3 A;  3U6F A;  4DSI A;  4J2D A;  4FXD A;  4CGG A;  4DSJ A;  3L3U A;  4FM0 A;  4CJV A;  2D0A A;  3VA0 A;  1VRT A;  4OKE A;  4B3O A;  3HPO A;  2P1J A;  1KVA A;  4ICL A;  4CK3 A;  3OYB A;  1VSL A;  1L3V A;  4CGF A;  1VSM A;  3V9X A;  1WSI A;  3VQA A;  1C0M A;  1KTQ A;  4HUF A;  1C6V A;  1LW0 A;  3SQ1 A;  5C25 A;  4FW2 A;  1VSK A;  2Z1H A;  3RMB A;  1ZYQ A;  3M8S A;  3O3H A;  3AA2 A;  3VQ6 A;  1T7P A;  4M3X A;  4W5N A;  1KRP A;  4M3W A;  1EXQ A;  2A1R A;  2YHB A;  3NH2 A;  3RMD A;  1GOC A;  3ZSO A;  4EP5 A;  3VN5 A;  3VQB A;  1Z26 A;  1EKE A;  4CIE A; 
#chains in the Genus database with same CATH topology
 5KI6 A;  4WQ5 A;  1OVY A;  4BRO A;  4JI0 K;  5AQH A;  4JI5 K;  5JS1 A;  3AVK A;  3MCP A;  4AHV A;  3AO3 A;  3ZSZ A;  3VF2 A;  4CEQ A;  3K2P A;  4KI6 A;  2HOE A;  3T3F A;  5EXW A;  2HHT A;  2O8C B;  3KKR A;  2E8A A;  1ZBI A;  1GLD G;  1GLJ O;  4FZZ A;  4OJR A;  2GV9 A;  3HJF A;  1LV5 A;  3DXM B;  3OYM A;  1RBT A;  1DTT A;  4B3R K;  3DRP A;  1NGG A;  4FJJ A;  4KV8 A;  2D5R A;  1JJ2 M;  1BIZ A;  2P9N B;  3AA4 A;  5A2Q O;  3UKR B;  2E20 A;  4K25 A;  4CHY A;  4O55 A;  4FJX A;  3OYI A;  5TKY A;  2XY6 A;  1IBM K;  1J5O A;  3TSU A;  3QIC A;  2PYJ A;  4DV5 K;  4JK9 A;  1LAW A;  2X74 A;  3CQY A;  1HR0 K;  4BGB A;  4CEZ A;  1DTQ A;  2G8V A;  4KHQ A;  2VWK A;  4JKD A;  4RTF D;  1BIS A;  1HNX K;  2OPQ A;  3P5J A;  5FRN A;  1G99 A;  1J9A A;  2GWK A;  4Y1D A;  4BC2 A;  4BVO A;  4DV6 K;  3LAK A;  3SUN A;  4Q5V A;  4DKW A;  5AZJ A;  5MLC Q;  1X9J A;  3ZSW A;  1X9W A;  2YHA A;  2WC9 A;  2O8B A;  4H5N A;  3O6W A;  5M1N A;  1NK8 A;  4A2A A;  1VQ4 N;  1SKR A;  2Q36 A;  1Z25 A;  3EKU A;  3WNH A;  2HND A;  4EAH D;  2PFU A;  2QWR A;  4IOA L;  1IKW A;  4JD2 A;  3ZEU A;  4FWR A;  4Z4H A;  4N56 A;  4FM2 A;  1TL1 A;  1JXB A;  2FF3 B;  1BCO A;  3D2F A;  2E2O A;  2WOM A;  4BRD A;  3MXM A;  2HVH A;  3HL8 A;  4H0X B;  4DSK A;  1P8Z A;  1Q81 O;  4E89 A;  4EZ9 A;  4Y0W A;  4M7X A;  1FKO A;  2NRW A;  2FLO A;  5CZ1 A;  2QXF A;  3VET A;  4CJ7 A;  5DMR A;  4E0D A;  5K14 A;  3G0Z A;  1WOQ A;  2NLX A;  3CCL N;  3CC7 N;  3NH0 A;  2UXC K;  1TK8 A;  3NCI A;  3BZC A;  3H1Q A;  3LP3 A;  4FLU A;  2KZZ A;  4H5T A;  3NF9 A;  1YVU A;  3DM2 A;  3THY A;  3L3V A;  3HPH A;  1YT3 A;  3VF4 A;  4BRH A;  3CG7 A;  4F4K A;  4DTP A;  1XHZ A;  3KWI A;  2HW3 A;  4CEA A;  3D7E O;  1HLU A;  5C24 A;  5CYM A;  3J7Y P;  4MDB A;  3NVM A;  5E41 A;  4WF9 L;  4Z4I A;  1BWF O;  2QXL A;  5HP1 A;  4FPA A;  3NAE A;  2Q3S A;  2GUI A;  3MEG A;  4DQR A;  3ULE A;  2UU9 K;  1REV A;  1A5X A;  5ADX A;  4E7J A;  4DU3 A;  2VYP A;  4B9U A;  1BDG A;  3CI5 A;  1UWB A;  4DCH A;  4DR5 K;  3O1W A;  3DLE A;  2BH1 A;  1NOY A;  1HKB A;  4I9L A;  4BDY A;  4IOX A;  4DV0 K;  4JHD B;  5JIC A;  4FPB A;  4Q0B A;  4ISF A;  3KTQ A;  2ITG A;  5BPN A;  2ZD1 A;  5KRS A;  4DTX A;  3HBT A;  3C6U A;  2ATQ A;  1S5J A;  1OH5 A;  4B8A B;  1GOA A;  4AHT A;  3B8A X;  3A0I X;  3A2F A;  3OYE A;  5AQP A;  2ITM A;  3MCA B;  3H46 O;  4KTW A;  4JKG A;  5DM6 L;  4CI6 A;  5LMN K;  4DFM A;  4CJ5 A;  2Z1I A;  4CJU A;  4OLB A;  3NMU A;  1N6Q A;  4I7F A;  3VGL A;  1YTU A;  2YNF A;  2GBZ A;  1LAV A;  3NGY A;  3ASM A;  3CFR A;  3ID6 A;  1K8A O;  5AJ3 K;  1BQM A;  4CJP A;  3TTC A;  2YHX A;  4JK8 A;  4CF0 A;  1G15 A;  1RTD A;  4PKI A;  2KFN A;  5J2M A;  3EO3 A;  1EWR A;  4CFA A;  3KK3 A;  4PWD A;  3ULD A;  4IJA A;  3V4I A;  3PY8 A;  4XEI A;  3AO2 A;  3L6Q A;  3PX6 A;  4CJS A;  3KK1 A;  2VG6 A;  1NMN A;  2Z1G A;  3LDL A;  4MLE A;  2HF4 A;  2GX9 A;  2HF3 A;  5BRF A;  3AO1 A;  3JXU A;  1KLM A;  1K8K B;  1JCF A;  1U48 A;  4FVU A;  3CHW A;  4B1Z A;  1BGX T;  3D2E A;  4IFY A;  1VAZ A;  1RDD A;  4JI2 K;  3E01 A;  4DUZ K;  2D0O A;  1NJW A;  2A6A A;  4CJL A;  1QSS A;  3BZK A;  5GAE P;  3KD5 E;  2IDO A;  3FLC O;  1TKD A;  1N32 K;  3ZET A;  3LDP A;  4KB0 A;  4A61 A;  4BRQ A;  3CF5 L;  3MXI A;  1Q9Y A;  3U8X A;  1LWF A;  4JI1 K;  3GG4 A;  2ETJ A;  2GEM A;  4O0I A;  4A2B A;  1QE1 A;  5HRS A;  4H5V A;  3SPY A;  3IAY A;  1S1V A;  4DV2 K;  2UUB K;  4K8Z A;  3CJ1 A;  3U9Z A;  3F73 A;  1SL1 A;  3PSI A;  4KHU A;  1QHA A;  4FWP A;  1Q7Y O;  1OKJ A;  3S3N A;  1ASW A;  5ADX H;  1HX1 A;  4I9Q A;  4CGJ A;  4FSV A;  3B6O A;  1RBU A;  4CIF A;  4CZH A;  2E1Y A;  1EQY A;  4PKG A;  2H3G X;  2B5J A;  2R7Y A;  1U04 A;  4CBU A;  3DLL L;  1NK7 A;  3PX0 A;  3OA9 A;  4KH4 A;  4FZX C;  3CYM A;  3KWG A;  3PIO L;  1K73 O;  5HRP A;  3UE5 A;  1OH8 A;  1NJI O;  3T7Z A;  4H4O A;  2P9U A;  5M1O A;  4U67 L;  2Y1I A;  1LW2 A;  4C8N A;  4CJQ A;  3NH1 A;  1NKE A;  3ATU A;  4HTL A;  3NVK A;  1MA9 B;  3NBP A;  4BRA A;  3KD1 E;  3MMV A;  1VQN N;  3CPE A;  1CXQ A;  1WBD A;  3V1R A;  4OPH A;  4CZE A;  3DI6 A;  1BIU A;  4KHW A;  1EP4 A;  4FJL A;  4J8F A;  4JKE A;  1XI1 A;  3QB0 A;  3P31 A;  3CXC M;  1U47 A;  3L2V A;  4DQI A;  4IG0 A;  1CLQ A;  1TYQ A;  2HBM A;  4ZHR A;  3SAG A;  5AQK A;  2VGM A;  3QES A;  3SJJ A;  1IJJ A;  3F5T A;  1NJX A;  4PA1 A;  5BR8 K;  1ZBH A;  4YOY A;  2Q0R A;  1BA1 A;  3MED A;  1LCU A;  3TAG A;  3O1B A;  2OPS A;  4O5B A;  4DFP A;  2UUA K;  1ZXO A;  1I94 K;  3C6T A;  4RW7 A;  2E88 A;  4CF1 A;  4CW7 B;  1JLA A;  2HBJ A;  5B8H A;  2KTQ A;  4CF9 A;  3RMC A;  1QSY A;  3KLE A;  3QIN A;  3UKU B;  2FBY A;  1NGJ A;  1X3M A;  4PY5 A;  3L2U A;  3HT3 A;  3D45 A;  3OYC A;  3Q7C A;  4DQ8 A;  3ZLJ A;  2HVI A;  1NGB A;  4FLW A;  4CJF A;  1OH7 A;  4QCL A;  5GIN A;  2O8D B;  1RT6 A;  3AO4 A;  1TVR A;  1SKW A;  5AQL A;  2AA4 A;  1C0G A;  4DSJ A;  4FWM A;  4CJV A;  3VA0 A;  4OKE A;  4B3O A;  2E2N A;  3O4W A;  1KVA A;  4ICL A;  4CK3 A;  1VSL A;  3EZW A;  4NLB A;  5AZJ B;  4R79 A;  5E26 A;  1VSM A;  2O8B B;  4LC9 B;  3RMB A;  2Z1H A;  4CZM A;  1MDU B;  3O3H A;  3SK3 A;  4KH6 A;  4M3X A;  2A1R A;  2YHB A;  3RMD A;  4FL9 A;  2CH5 A;  4MO5 A;  3NHG A;  1EKE A;  4JD2 B;  2KHO A;  3ZEU B;  2WUS A;  2ZWH A;  3HK2 A;  5ELZ A;  3MEC A;  4LH5 A;  4ISG A;  1X9M A;  4CJ4 A;  1IBK K;  4GV6 A;  3DWL A;  4PKH A;  4DR7 K;  5LJW A;  4KHN A;  3AGR A;  5AZI A;  5BN9 A;  4YOT A;  4KTZ A;  4DTU A;  4KI4 A;  2RF2 A;  2OPP A;  1M90 O;  1NKB A;  4O5F A;  3NF7 A;  4C1N I;  4C8L A;  1RT1 A;  3T1A A;  1NGF A;  1YVN A;  3F9M A;  4FK0 A;  2HHU A;  2KKZ A;  3ZSR A;  2P9S A;  3AA3 A;  4CZG A;  1IV0 A;  4ISE A;  4HUE A;  3NGZ A;  1FJG K;  2JGU A;  4OX9 K;  4H5R A;  5JLH A;  1KAY A;  3MX5 A;  3AVN A;  5C10 A;  1NGH A;  2XO7 A;  4YOX A;  3LDQ A;  4NCB A;  4JV5 K;  3K0S A;  5CE3 A;  5C0Y A;  3UIQ A;  3DXK A;  4DTN A;  1MWM A;  3FR0 A;  4Z4G A;  2OAN A;  3THY B;  3LWM A;  3H3N O;  4K8X A;  2FBX A;  3V9U A;  1N5Y A;  1XC3 A;  3H1V X;  3MEE A;  4IEI A;  1VRU A;  4B3M K;  2P9L A;  4YDU C;  3ZT1 A;  1TKX A;  4FWS A;  2ZJR L;  3AVC A;  5M1P A;  4FYD A;  1UOC A;  3AA5 X;  3C7N B;  2CGL A;  4BRN A;  4ELT A;  4WFN L;  3BF1 A;  2GTD A;  1J53 A;  3VTI A;  1RDA A;  3ULE B;  3TSQ A;  4QS9 A;  4KKO A;  3KLH A;  1YAG A;  3K9J A;  3SAH A;  2W42 A;  1L5U A;  4JEP A;  2HHW A;  3VQ5 A;  4OKK A;  4B1X B;  3VGM A;  5KPZ A;  3O9Q A;  3LDO A;  3KK2 A;  3L2W A;  3E66 A;  4G9Z A;  3VPZ A;  4RW8 A;  4DQQ A;  3EEQ A;  4FWN A;  3I8B A;  3WQU A;  2I5J A;  4DR4 K;  3AAR A;  4IZ9 A;  4K41 A;  4WQ5 C;  4YDU A;  1UAX A;  3QET A;  3C0B A;  2CH6 A;  4Z4C A;  3EE9 A;  3OYL A;  1ATS A;  3BEX A;  4OKJ A;  1IG9 A;  5AQM A;  1GLF O;  3O9T A;  1UA1 A;  2P9I A;  4DSE A;  3QIP A;  4JKG B;  1SQK A;  3QER A;  4LSL A;  4Y1C A;  4MO4 A;  1NM1 A;  4DFJ A;  4AM6 A;  2YHW A;  4BC5 A;  1TAQ A;  2ZJQ L;  2HHQ A;  3L2R A;  5HBM A;  2X6N A;  4FLT A;  2P5G A;  5AQR A;  3WXJ A;  5D3G A;  5FDL A;  4BWJ A;  3WQT A;  3HOT A;  3IG1 A;  1OVQ A;  2Q1N A;  1FXX A;  1C0F A;  5F1X A;  3QDK A;  2XHB A;  5KPR A;  1NWK A;  2O8E B;  3KIO A;  1YTA A;  4FJH A;  4AF1 A;  2F8T A;  2Q97 A;  5TKW A;  3VEX A;  3TWH A;  5AR0 A;  3FE1 A;  1D9D A;  3SQ2 A;  1VSI A;  2BAN A;  4NYN A;  3OJS A;  3OYF A;  3PSF A;  2ZGZ A;  4O8K A;  4TSX A;  2JLE A;  3O4N A;  3ISN C;  2NNW A;  4GW6 A;  3TAM A;  3CM5 A;  3C94 A;  2UYT A;  3D2E B;  2O8F A;  2QWQ A;  2VCP A;  4LF5 K;  2QWL A;  1T6C A;  4BR4 A;  3A5L C;  4ID5 A;  1U49 A;  1RT7 A;  1RDU A;  2QWP A;  3LAM A;  3OVN A;  4W5R A;  2YKM A;  1T6D A;  1TKT A;  4G1Q A;  4CJ3 A;  5HRN A;  1BO5 O;  4FOI A;  4AHU A;  3CM6 A;  3O4Q A;  3WNE A;  3ZET B;  3OYH A;  1KXP A;  5KTQ A;  4IO8 A;  4PL7 A;  3DYA A;  3BY5 A;  2FSN A;  4DB3 A;  1L3T A;  5AFU A;  3QEW A;  1BHL A;  4OPJ A;  2RHK A;  3VQP A;  2YHY A;  2ZM6 K;  5FPE A;  1HNI A;  1BUP A;  3NF6 A;  1LOT B;  4NCA A;  4OO1 J;  3DLG A;  3E1Y A;  4AQY K;  4BRL A;  4KO0 A;  3SQ0 A;  2IVN A;  1ZBL A;  3L8B A;  3LM2 A;  3SUO A;  1S1X A;  5HL7 L;  1JL2 A;  3RRG A;  1F21 A;  1BOT O;  1OH6 A;  4F8R A;  2E6M A;  5JVG L;  2E4L A;  1DLO A;  1ASV A;  3TAE A;  1NU0 A;  4Z94 A;  3VEZ A;  2P9U B;  3A8Y A;  5FPN A;  3MAQ A;  3HO1 A;  1IO2 A;  3EY1 A;  2V7Z A;  1VQ5 N;  1Q18 A;  2NRH A;  3KLF A;  1S9E A;  1NKC A;  4N41 A;  4O0J A;  5EY4 A;  3FFK B;  5AQF A;  3SYZ A;  4KAZ A;  2RN2 A;  1S3X A;  3H3O B;  1NOZ A;  4BDP A;  3HM8 A;  2HBK A;  2WBN A;  3Q7B A;  1VSH A;  4XH1 A;  4CCH A;  4E1N A;  3OJU A;  4X62 K;  3O8M A;  2KFZ A;  5C2F A;  3T1H K;  4LF8 K;  1TYQ B;  4EIA A;  2AP1 A;  1L3U A;  2P9P A;  3OBW A;  2IVP A;  1XUP O;  3CCE N;  3FZK A;  1WBB A;  1SAZ A;  4MFB A;  3QBX A;  2J4R A;  3O08 A;  1ZBF A;  4PQU A;  4JKF A;  1S9G A;  3NF8 A;  1EWQ A;  1NLV A;  1A5V A;  1IKY A;  1JLG A;  5KRT A;  4H0V B;  1RBV A;  1NK6 A;  1KAX A;  2OYQ A;  4M7Y A;  5FRO A;  3AVG A;  5CYQ A;  3OYG A;  2A1S A;  3J81 O;  4O44 A;  3CJB A;  1T8E A;  1V4T A;  4W5Q A;  4RG8 A;  1Q86 O;  4RW4 A;  1QQM A;  4ELV A;  3FFI A;  1SUQ A;  2V7Y A;  4BR0 A;  1HKC A;  1NK9 A;  5LL6 Z;  4ID1 A;  3WUH A;  1X9S A;  1TAU A;  4GKJ K;  3I0S A;  3LWL A;  1KC8 O;  2XY7 A;  4B9M A;  3WXL A;  1TUU A;  5AFU H;  3ZX0 A;  3CC4 N;  2BGG A;  4B1W B;  3H08 A;  1Q9X A;  3DOK A;  1HQE A;  2G8H A;  4IDH A;  5AQT A;  4H0P A;  3TTF A;  1QZ5 A;  1O13 A;  1JCE A;  2NRV A;  3IS9 A;  2QKB A;  3CCU N;  2EWS A;  5E84 A;  4JI6 K;  4IG3 A;  1RDC A;  2JWL A;  3LPU A;  1EO1 A;  1I39 A;  1LWC A;  2WON A;  3IDH A;  2ZGY A;  1VSD A;  3WXM B;  4F3O A;  3TAQ A;  4CJT A;  1HJR A;  3GE1 A;  4FWO A;  1K9M O;  1NGI A;  4CHO A;  3T69 A;  1JLF A;  4CK1 A;  4ILJ A;  3PUF A;  2P9K B;  4LF4 K;  4PHT X;  4BR9 A;  5AZI B;  4M63 C;  4A62 A;  4KTQ A;  1Y64 A;  1GLC G;  4JLH A;  1C1C A;  1BQN A;  4BRE A;  2OCE A;  3M8Q A;  2IGI A;  1I3A A;  2G8F A;  2P9S B;  4IJN A;  3SZ2 A;  2V52 B;  3MN9 A;  5JS2 A;  1ASU A;  4W5T A;  3ZT3 A;  2HHS A;  2OTJ N;  1VQ9 N;  4AHC A;  4YOU A;  3SNN A;  2Z1J A;  1GLA G;  3OY9 A;  4LSN A;  4FCY A;  4E7H A;  3KLG A;  2E2P A;  3O3F A;  3CCS N;  3PV8 A;  3DXK B;  3G25 A;  2O4I A;  3SV4 A;  1GOB A;  2I7P A;  3ZT4 A;  3NGI A;  5IT9 O;  4FJK A;  2P9L B;  5IWA K;  2YJF A;  4DSI A;  4FXD A;  4CGG A;  5C15 A;  4FM0 A;  1VRT A;  4NXN K;  3HPO A;  3M3Z A;  1TUY A;  1ZBS A;  4IFE A;  1KTQ A;  5AQZ A;  1LW0 A;  3SQ1 A;  1VSK A;  3AA2 A;  4EFH A;  3VQ6 A;  4BRM A;  1HKG A;  4BR5 A;  4M3W A;  2RE2 A;  3P4I A;  1Z26 A;  1KCF A;  5BRD A;  1SV5 A;  2F9T A;  3DLR A;  4DSF A;  3OYD A;  3I0R A;  1HYV A;  3THW A;  1W0H A;  4C8M A;  4BE1 A;  5LY3 A;  3GL1 A;  4DS5 A;  2YNH A;  1EX4 A;  1WSG A;  2EHG A;  3IUC A;  2Y1J A;  4CJK A;  5EX5 A;  1VQM N;  3T1Y K;  3V9Z A;  4GY2 B;  2G8K A;  4HHT A;  4JI3 K;  4JN4 A;  3HPG A;  3L2Q A;  1WAJ A;  1NBW A;  3ZT0 A;  2QM1 A;  2P9I B;  3OW2 M;  4KHY A;  3LM9 A;  4BDZ A;  3EN9 A;  4K43 A;  2BE2 A;  4C8O A;  2E1Z A;  4BC3 A;  2W6L A;  3U3G A;  1E4G T;  4DF4 A;  3TI0 A;  4HUG A;  2F4V K;  1HJO A;  5JLF A;  4WYB A;  3ZX2 A;  3SV3 A;  1W7A A;  1XHX A;  3S41 A;  2UUC K;  3JYT A;  1N8R O;  1U6Z A;  4LH4 A;  4FJ5 A;  5KPT A;  1ATN A;  3QO9 A;  4IO9 L;  3SCX A;  4JYA K;  3G10 A;  3M1F A;  3AO5 A;  3TU5 A;  4O8U A;  2Q31 A;  1QSL A;  4E7L A;  1KFS A;  3AVF A;  3RSE A;  3OYN A;  5AQQ A;  3K5N A;  1DEJ A;  4MQ3 A;  3L4Q A;  1VQO N;  4CED A;  3VGK A;  2WFB A;  3PO4 A;  4WQ4 C;  3VQ8 A;  4FVM A;  3K5M A;  1YXQ A;  2VG7 A;  4CEB A;  3K5O A;  4BR2 A;  3CFP A;  1B9F A;  3G6E N;  1VQ8 N;  2W6K A;  2KZM A;  3M5R A;  1VQ6 N;  2YV0 X;  1S1T A;  1RT4 A;  1TKZ A;  2YKN A;  1NMD A;  1C1B A;  3KKS A;  1NJZ A;  3CJ7 A;  4DU1 A;  5J2N A;  1IBL K;  2O4G A;  2LSN A;  4H0O A;  1N34 K;  4X65 K;  4FJI A;  1N36 K;  4ILG B;  4CBX A;  3AVM A;  4E1M A;  3OYA A;  1NNE A;  4L3Q A;  3H45 C;  2YJE A;  1RIL A;  3JS6 A;  3N4P A;  3LDS A;  4WQ4 A;  1XWL A;  1DKG D;  5C42 A;  2DY4 A;  4FJG A;  3I8D A;  2XY5 A;  3VEW A;  1IH7 A;  5J2Q A;  3QEX A;  4H03 B;  1RTJ A;  4JKB A;  3DAW A;  3DLB A;  5FPD A;  4E19 A;  3BDP A;  1RCH A;  4DR2 K;  3ALY A;  4H0Y B;  4Z4F A;  4MDA A;  5GIP A;  3TR8 A;  4IDK A;  3DJC A;  1XMQ K;  1O1W A;  3CJC A;  3NFA A;  4AH9 A;  4DLG A;  1IKV A;  2A42 A;  2W41 A;  4V19 S;  3CMA N;  1XQS C;  4CEC A;  3JAM O;  5BRE A;  5JVH L;  4OGE A;  5H1S Q;  3A5M C;  3K9K A;  4NCG A;  5KGW A;  3D2F B;  2ZQB A;  4CHZ A;  4HTU A;  4X66 K;  4CD1 A;  3DRR A;  3VF6 A;  1HRH A;  3K5L A;  5KQD A;  4FJ7 A;  4DR1 K;  3VA3 A;  3THX A;  4B3S K;  4B9N A;  3M6G A;  1RT5 A;  4DG1 A;  2VWB A;  4OPK A;  1HNV A;  3CCJ N;  2IIR A;  3AVL A;  4NXM K;  1FK9 A;  1Z05 A;  2YX6 A;  3HI0 A;  3P38 A;  4FOE A;  4CZF A;  3THV A;  5LMU K;  5F0X A;  1QQN A;  4CGD A;  5FRM A;  4YFU A;  3QBW A;  3OHR A;  1SL0 A;  4CEF A;  4IKF A;  1RGI A;  3DRS A;  4CHQ A;  2CGJ A;  1SL2 A;  3CET A;  1WSH A;  2D0P A;  1S6Q A;  4RWT A;  2PY5 A;  4M3Y A;  2VQE K;  3TAF A;  4ILH A;  2V51 B;  1XNQ K;  2BUP A;  2QEX N;  2A5X A;  3ATV A;  1RT3 A;  3ENH A;  3CD6 N;  1JKH A;  4BR7 A;  3A5N C;  3QFU A;  1HMV A;  4KB1 A;  5FLX O;  2YCH A;  2DTU A;  3UB5 A;  3TTD A;  4LF7 K;  3LL3 A;  2G8W A;  4J2A A;  4OPA A;  3KK7 A;  3CCM N;  3ZCM A;  4W5O A;  1CZ9 A;  3U4L A;  4CFD A;  2D0C A;  1NK5 A;  1W9H A;  3SMP A;  3OTO K;  4M42 A;  4IEE A;  4IBN A;  3WEE A;  3C6H A;  3R3L A;  4DLE A;  4LFB K;  1HNW K;  4B9Q A;  3W0L A;  4JS4 A;  1IG8 A;  4IFV A;  5GAD P;  4JRQ A;  2ASP A;  4OVL A;  2ASO A;  3B6P A;  1WSF A;  4JS5 A;  5HRR A;  3VEY A;  3RR8 A;  4FJ8 A;  4FLY A;  2W40 A;  4A59 A;  2ZE2 A;  1VK0 A;  3R8E A;  2YNI A;  1FW6 A;  3CCR N;  1YJW N;  1ZC6 A;  4KH5 A;  4H4M A;  3AVJ A;  1KD1 O;  4OLA A;  5SZT A;  1SS6 A;  3IMX A;  3WXI A;  2E5L K;  1SKS A;  4GNI A;  3OBY A;  4I6M A;  1GLE G;  1W2B M;  1JXE A;  1S72 N;  4A5B A;  3OS2 A;  3FZF A;  3U3Y A;  5SWM A;  4M3U A;  3V9S A;  1C0U A;  2BTF A;  1K6Y A;  1T44 A;  3BUZ B;  4DS4 A;  2F9W A;  4FJ9 A;  4NLC A;  1RNH A;  2Q2R A;  4DR6 K;  4KRF A;  1GLB G;  3LDN A;  4BQZ A;  3MX2 A;  4CJR A;  4LF6 K;  3AVH A;  5CHI A;  4RW9 A;  4FW1 A;  4BE2 A;  4FK4 A;  3HZ6 A;  3WXK A;  3K58 A;  3QFP A;  4DUY K;  4ZTF A;  3VQD A;  3BP8 A;  5J1E A;  3E9L A;  1WNS A;  3V1Q A;  1NG9 A;  2HNY A;  4DWI A;  1VSJ A;  1B92 A;  3BF3 A;  1WSJ A;  2OTL N;  2OA8 A;  1NK4 A;  4JKA A;  3KHY A;  1YHQ N;  4C1N K;  3I33 A;  3ZSX A;  4CK2 A;  1WSE A;  2FSK A;  4QAG A;  1U2V A;  3NDK A;  3LP2 A;  3MN7 A;  3D0P A;  3LZI A;  2FC0 A;  4CE9 A;  3FGU A;  4CBW A;  1QTM A;  1KLN A;  1MWK A;  4BE0 A;  4IOC L;  1KFD A;  3TAP A;  1NJY A;  4EHU A;  1BA0 A;  3UKU A;  3GDQ A;  1QVG M;  4FZY A;  3GBT A;  3O80 A;  5JMV A;  3HM9 A;  3ZT2 A;  4CVN E;  3AVI A;  1HYS A;  3ZYY X;  3R9P A;  5GIO A;  5CR4 A;  3RR7 A;  1MU2 A;  4H5W A;  1QHT A;  4K42 A;  2DPN A;  4RW6 A;  3KZB A;  4KFB A;  1C0T A;  4J2E A;  3THW B;  2O8D A;  2F96 A;  4C23 A;  1YJ9 N;  5C12 A;  4EZ6 A;  3CIP A;  2YNG A;  2PYL A;  1BI4 A;  4WE1 A;  3TSP A;  1W97 L;  4DTM A;  1BL3 A;  3AVA A;  4XH5 A;  5BRH A;  4IXC A;  3HST B;  4L8R B;  4CER A;  1DGK N;  2FBT A;  1RTI A;  2IS3 A;  4YHH K;  4KPY A;  4CGH A;  4EHT A;  3SAF A;  2IAJ A;  1WB9 A;  2IOC A;  3V81 A;  2Q0U A;  4CJW A;  3EE8 A;  4CIG A;  1XMO K;  2F7T A;  4JK7 A;  3V9W A;  1H1V A;  3CJ9 A;  1RBR A;  3CCV N;  3G71 N;  3ENO A;  4UQG A;  1E3M A;  1ILY A;  1T03 A;  2QA4 N;  2XY8 A;  4DQS A;  5BN8 A;  1RDB A;  3AY9 A;  1JLE A;  4CFC A;  3VER A;  1NGD A;  4E7K A;  1Y97 A;  4BRC A;  3H6E A;  4K0K K;  5DM7 L;  1TV6 A;  3OS0 A;  3QNN A;  4A5A A;  3RSE B;  2AJQ A;  1WUA A;  3U6F A;  3IKM A;  1J5E K;  3L3U A;  2P1J A;  3OYB A;  4DR3 K;  4CGF A;  4LF9 K;  4JKH A;  3V9X A;  1C0M A;  3MWP A;  1C6V A;  4JI4 K;  5C25 A;  5AQO A;  5AQV A;  1ZYQ A;  2E2Q A;  3M8S A;  1T7P A;  1KRP A;  1EXQ A;  3NH2 A;  5EOY A;  4EP5 A;  3VQB A;  1D4X A;  4GVE A;  3PIP L;  4DFK A;  1CZB A;  1JCG A;  5KGX A;  3LAL A;  5M1Q A;  2D4W A;  4LY7 A;  2QKK A;  1KQS M;  3C95 A;  4FM1 A;  4AHR A;  4E1J A;  4PUO A;  4BWM A;  5AQN A;  3RRH A;  2FXU A;  1VQK N;  4HCC A;  1JLB A;  2DFH A;  1XNR K;  4CF2 A;  2QK9 A;  3C7N A;  2CGK A;  2NZT A;  5C2D A;  5LJV A;  4DV3 K;  3EZ5 A;  1XC9 A;  1HPZ A;  3QEP A;  2KW4 A;  1FKP A;  4KBO A;  3J7Z O;  3E9O A;  4I2Q A;  3CQX A;  3KLI A;  4BGA A;  1D9F A;  5AQU A;  2D1K A;  1TGO A;  5BR9 A;  4CZK A;  3L0Q A;  1WAF A;  3K57 A;  1VQ7 N;  5AQY A;  3RTV A;  5AQS A;  4FLV A;  2A3Z A;  1BU6 O;  5FPM A;  3CFO A;  4M3T A;  2F8S A;  1QS4 A;  2KQ2 A;  4DV7 K;  1YI2 N;  3N4Q A;  1BCM A;  3WNF A;  4XH4 A;  4F2S A;  5M1K A;  1M1K O;  2RPI A;  2PAV A;  3QNO A;  2FF6 A;  3FZH A;  5I3U A;  1RTH A;  5J2P A;  2HMI A;  3F2K A;  1VSE A;  4DV1 K;  3QEV A;  1S22 A;  4NB4 A;  2OZS A;  4DU4 A;  3THX B;  2PZS A;  4GKK K;  2QWO A;  5DK5 A;  5GAG P;  3TAB A;  5HOO A;  3R6M A;  3VOV A;  4H8K A;  4A57 A;  1KAZ A;  1C1A A;  3HYF A;  3VEV A;  4B3T K;  4JI8 K;  4AHS A;  2O8E A;  1JL1 A;  3C65 A;  3P39 A;  4GMJ B;  1U4B A;  1HUX A;  4DHY A;  3TPQ A;  1CXU A;  4CD3 A;  4B8C A;  3S3M A;  1RDW X;  3ITH A;  4HCB A;  3PO5 A;  2B6A A;  2O8C A;  5HRO A;  1RT2 A;  1KVB A;  3VQ4 A;  3FZL A;  3MN5 A;  1YF5 L;  3CQ8 A;  1ZBU A;  3CC2 N;  3VQ9 A;  3DXM A;  2NRX A;  1VQP N;  3SBT A;  4CZI A;  3TAN A;  2P51 A;  1X3N A;  2VG5 A;  1SZ2 A;  3BGR A;  4NO7 A;  1DT9 A;  4FWQ A;  2P9N A;  3IFR A;  3UKR A;  5AQI A;  1J54 A;  4E3S A;  2UXD K;  2VGN A;  3O9U A;  1QQO A;  4CES A;  4B9L A;  1Q8I A;  1X1P A;  3RWU A;  2P5O A;  4FK2 A;  5T7B A;  3SUQ A;  3LZJ A;  3HVR A;  3O9R A;  3P83 D;  3WEE B;  2NUB A;  3CJA A;  4FLZ A;  3W3D A;  4DF8 A;  3SLC A;  3LAN A;  1ATR A;  2GEL A;  4KHS A;  1CZA N;  3VQ7 A;  4YNQ A;  1TK5 A;  3C6A A;  4WFA L;  3AV9 A;  5I42 A;  3RVC A;  1IKX A;  1WLJ A;  2HNZ A;  2QWM A;  3S9H A;  2JWK A;  4DV4 K;  1ESV A;  1EET A;  3VQQ A;  4QOZ B;  1S1W A;  1JLC A;  1Z6R A;  4CEE A;  4F3T A;  4I6M B;  2FSJ A;  3VQE A;  3TAR A;  4JRP A;  2B4J A;  4R5P A;  4B1U B;  3SPZ A;  1NGE A;  5M1F A;  4M41 A;  4BRF A;  3R1X A;  4F9O A;  3OYJ A;  3ZSQ A;  1HQU A;  2IVO A;  1P90 A;  4PL8 A;  5AQG A;  3ZX3 A;  3A5O C;  3DOL A;  3VEO A;  3HP9 A;  1VQL N;  4B9T A;  3AVB A;  4J2B A;  4CFB A;  4B9V A;  5F2R A;  3MN6 A;  3VTH A;  2A41 A;  3S3O A;  3DLK A;  1YIT N;  3AAP A;  2VWJ A;  4KRE A;  4C8K A;  2HHH K;  4F2R A;  1YJN N;  4GVM A;  2O8F B;  3SI6 A;  3LP0 A;  2A40 A;  4DMN A;  1TL3 A;  1N33 K;  4Z0U A;  4DQP A;  3OS1 A;  4YOW A;  2QW9 A;  2X78 A;  4JAX A;  5HLF A;  4H0T B;  3KVG A;  3MWT A;  5EU7 A;  3DMJ A;  1Q82 O;  1U2V B;  5CY4 A;  3G4S N;  3O9S A;  2GUP A;  1QZ6 A;  2HMP A;  3VQC A;  4N5S A;  1WN7 A;  1J6Z A;  3NE6 A;  2I7N A;  2ZF5 O;  3GOI A;  3RMA A;  4B1V A;  3WNG A;  1HYZ A;  3SQ4 A;  1L3S A;  2G8U A;  5AQX A;  3FZM A;  3ZSY A;  1V4S A;  2PBD A;  4WFB L;  4BQL A;  4CZJ A;  2NRR A;  4M45 A;  4ELU A;  3VMF B;  3MXJ A;  4WCE L;  3KJV A;  4Z4E A;  1BI4 B;  4JHD A;  4LFA K;  1S1U A;  4MLH A;  3JSM A;  2GWJ A;  3AGK A;  4DTO A;  1VHX A;  1YUW A;  1LWE A;  4B1Y B;  3D6R A;  3V6D A;  3MDQ A;  5GAH P;  3PX4 A;  3CER A;  1ITG A;  4CEO A;  4BY9 C;  3J7A P;  1R59 O;  3F9K A;  3ENB A;  4BAC A;  2EX3 A;  3M8R A;  4XIU A;  2KLA A;  1RBS A;  4IWV A;  4BRP A;  4N76 A;  4YOR A;  3VEN A;  5KQ8 A;  1QQC A;  4UY8 O;  4CGI A;  3LPT A;  4CJE A;  2RKI A;  1YIJ N;  4DSL A;  3EL2 A;  3WT0 A;  4HVJ A;  4DTR A;  3CPW M;  3HP6 A;  3K59 A;  4GV9 A;  4O4G A;  1QVF M;  4JKC A;  4YY3 K;  4JNE A;  2E6L A;  4KHP K;  5BPM A;  4LFC K;  2P9K A;  3I56 N;  4JI7 K;  4X64 K;  3O3G A;  2P9P B;  1NK0 A;  3AAQ A;  2FBV A;  2HHX A;  4OGC A;  5CZ2 A;  4B08 A;  5AQW A;  4NYF A;  2VQF K;  2YI1 A;  1T05 A;  4DTS A;  4BG8 A;  4AIL C;  2NRZ A;  4M3R A;  3E9P A;  1R0A A;  4BC4 A;  4ZTJ A;  2HHV A;  1B9D A;  2UXB K;  3QLH A;  3V1O A;  1UA0 A;  4DTJ A;  4I2P A;  1K8K A;  3EKS A;  3SJH A;  3J8A A;  3O5B A;  4CHP A;  3DLH A;  1HPM A;  2QWN A;  2D0B A;  3L4I A;  1TK0 A;  3T19 A;  3EYZ A;  3HVT A;  3PLA A;  2OZM A;  4EP4 A;  3U9D A;  3SUP A;  2ZJP L;  3M8P A;  1D8Y A;  2HST A;  3ZSV A;  3HSC A;  4QS7 A;  4FJN A;  4HWI A;  1JLQ A;  5BPL A;  3HRG A;  4FO0 A;  3ID8 A;  5AQJ A;  4CF8 A;  4LD0 A;  2QTD A;  4M3Z A;  4BRG A;  2DFE A;  4RCH A;  5EVZ A;  2X6S A;  1E4F T;  4FJM A;  3I55 N;  1S6P A;  3QIO A;  4U7B A;  3OYK A;  4YOV A;  3HXM A;  1U45 A;  2DFF A;  2QI2 A;  4AM7 A;  4BVP A;  4QS8 A;  1A5W A;  4E7I A;  4B9S A;  4CHN A;  2ASM A;  2BDP A;  3LP1 A;  1VSF A;  3CCQ N;  3MK6 A;  1KVC A;  3IRX A;  4FWL A;  2XRI A;  2HB5 A;  2HBL A;  1T3V A;  1D5A A;  2OPR A;  3CME N;  1NGA A;  4N47 A;  1NGC A;  2G8I A;  4BRK A;  4FLX A;  3VES A;  3QEI A;  1KSP A;  1GLL O;  3P1G A;  2WTU A;  2NRT A;  2IC3 A;  4BRI A;  4J2D A;  4BG9 A;  2D0A A;  1BG3 A;  1HNZ K;  3SBG A;  1L3V A;  3SMS A;  4CZL A;  1WSI A;  3QML A;  3VQA A;  4HUF A;  4GV3 A;  3HTV A;  4FW2 A;  4FWK A;  4W5N A;  5I9E B;  1GOC A;  3ZSO A;  3HOS A;  3VN5 A;  1RFQ A;  3J80 O;  4CIE A; 
#chains in the Genus database with same CATH homology
 1SV5 A;  3DLR A;  5KI6 A;  1CZB A;  5KGX A;  3OYD A;  3I0R A;  1HYV A;  4DSF A;  4DFK A;  3HK2 A;  3LAL A;  3MEC A;  1W0H A;  4LH5 A;  4LY7 A;  4C8M A;  4BE1 A;  2QKK A;  3C95 A;  5JS1 A;  3AVK A;  1X9M A;  4CJ4 A;  4AHV A;  3AO3 A;  3ZSZ A;  4FM1 A;  4DS5 A;  4CEQ A;  3K2P A;  4KHN A;  2YNH A;  4AHR A;  1EX4 A;  4PUO A;  4KI6 A;  4BWM A;  1WSG A;  4KTZ A;  4DTU A;  2EHG A;  3RRH A;  4KI4 A;  3T3F A;  1QSY A;  2RF2 A;  2OPP A;  2Y1J A;  2HHT A;  1NKB A;  3KKR A;  4CJK A;  4HCC A;  1ZBI A;  1JLB A;  2DFH A;  3V9Z A;  3NF7 A;  4CF2 A;  2QK9 A;  2G8K A;  4HHT A;  4FZZ A;  4C8L A;  1RT1 A;  4OJR A;  3T1A A;  3HPG A;  3L2Q A;  2GV9 A;  1WAJ A;  4FK0 A;  3HJF A;  3ZT0 A;  2HHU A;  1LV5 A;  3EZ5 A;  1XC9 A;  3ZSR A;  3AA3 A;  4KHY A;  1HPZ A;  4BDZ A;  3QEP A;  4HUE A;  2KW4 A;  3OYM A;  1FKP A;  1RBT A;  1DTT A;  3DRP A;  3NGZ A;  2JGU A;  2BE2 A;  4I2Q A;  3KLI A;  1D9F A;  4C8O A;  4FJJ A;  4KV8 A;  3U3G A;  3AVN A;  1TGO A;  4DF4 A;  2D5R A;  4HUG A;  3TI0 A;  2XO7 A;  1BIZ A;  3AA4 A;  1WAF A;  3K57 A;  3SV3 A;  4CHY A;  3RTV A;  4O55 A;  4NCB A;  1XHX A;  3JYT A;  4FLV A;  4FJX A;  3OYI A;  3UIQ A;  2XY6 A;  4LH4 A;  4DTN A;  1J5O A;  4FJ5 A;  3QO9 A;  2PYJ A;  4Z4G A;  3CFO A;  3SCX A;  3LWM A;  4K8X A;  4M3T A;  3G10 A;  2F8S A;  2FBX A;  1LAW A;  3AO5 A;  2X74 A;  1QS4 A;  2KQ2 A;  3V9U A;  3MEE A;  1N5Y A;  1BCM A;  3WNF A;  4F2S A;  4CEZ A;  1DTQ A;  2G8V A;  1QSL A;  4E7L A;  4KHQ A;  1VRU A;  2VWK A;  3AVF A;  1KFS A;  4Q0B A;  3OYN A;  1BIS A;  2RPI A;  2OPQ A;  3P5J A;  3K5N A;  4MQ3 A;  5FRN A;  3QNO A;  4CED A;  1J9A A;  5I3U A;  3ZT1 A;  1TKX A;  4Y1D A;  1RTH A;  5J2P A;  3LAK A;  3SUN A;  3AVC A;  4Q5V A;  2HMI A;  3PO4 A;  3VQ8 A;  4FVM A;  1UOC A;  3AA5 X;  3K5M A;  1VSE A;  4FYD A;  2VG7 A;  3ZSW A;  3QEV A;  1X9W A;  2YHA A;  4ELT A;  4CEB A;  2OZS A;  3K5O A;  4DU4 A;  3CFP A;  2PZS A;  1B9F A;  1J53 A;  1NK8 A;  1RDA A;  5DK5 A;  1SKR A;  1Z25 A;  4KKO A;  3KLH A;  3TAB A;  2YV0 X;  2KZM A;  1S1T A;  1RT4 A;  3WNH A;  1TKZ A;  2HND A;  2YKN A;  2W42 A;  1IKW A;  1L5U A;  2HHW A;  3VQ5 A;  1C1B A;  4OKK A;  4H8K A;  4Z4H A;  4N56 A;  4FM2 A;  1C1A A;  3HYF A;  3KK2 A;  4AHS A;  1TL1 A;  3KKS A;  1JL1 A;  3L2W A;  4GMJ B;  1NJZ A;  4DU1 A;  1U4B A;  5J2N A;  2O4G A;  1JXB A;  4RW8 A;  2LSN A;  4DQQ A;  1BCO A;  4FJI A;  2I5J A;  1CXU A;  3AVM A;  4B8C A;  4E1M A;  3OYA A;  3S3M A;  1UAX A;  3QET A;  1RIL A;  3ITH A;  4HCB A;  4Z4C A;  2B6A A;  2WOM A;  3OYL A;  3PO5 A;  3MXM A;  5HRO A;  1RT2 A;  4OKJ A;  1KVB A;  3LDS A;  2HVH A;  1XWL A;  5C42 A;  1IG9 A;  2DY4 A;  3HL8 A;  3VQ4 A;  4FJG A;  1UA1 A;  4DSK A;  3I8D A;  2XY5 A;  4E89 A;  4EZ9 A;  3CQ8 A;  1ZBU A;  1FKO A;  1IH7 A;  3VQ9 A;  4DSE A;  5J2Q A;  3QIP A;  5CZ1 A;  2QXF A;  3TAN A;  2P51 A;  3QEX A;  3QER A;  4LSL A;  1RTJ A;  4Y1C A;  5DMR A;  2VG5 A;  4DFJ A;  4E0D A;  5K14 A;  3DLB A;  3BGR A;  1TAQ A;  4E19 A;  3BDP A;  2HHQ A;  3G0Z A;  1RCH A;  3L2R A;  3ALY A;  5HBM A;  3NH0 A;  4Z4F A;  2X6N A;  1TK8 A;  3NCI A;  4FLT A;  2P5G A;  1J54 A;  4E3S A;  5D3G A;  3TR8 A;  4IDK A;  5FDL A;  4BWJ A;  3IG1 A;  3LP3 A;  4FLU A;  2KZZ A;  4CES A;  1O1W A;  1FXX A;  4B9L A;  1Q8I A;  1X1P A;  3NFA A;  4AH9 A;  2P5O A;  3NF9 A;  4DLG A;  1YVU A;  3DM2 A;  5T7B A;  2XHB A;  4FK2 A;  1IKV A;  3LZJ A;  3SUQ A;  3L3V A;  3HVR A;  3KIO A;  3P83 D;  1YTA A;  4FJH A;  3HPH A;  1YT3 A;  4CEC A;  2F8T A;  2NUB A;  3CG7 A;  4OGE A;  4FLZ A;  3TWH A;  4F4K A;  4DTP A;  1XHZ A;  4DF8 A;  4NCG A;  1D9D A;  5KGW A;  2ZQB A;  1VSI A;  3SQ2 A;  2BAN A;  3LAN A;  4NYN A;  4CHZ A;  3OJS A;  4HTU A;  2HW3 A;  3DRR A;  3OYF A;  4KHS A;  4CEA A;  3VQ7 A;  5C24 A;  4YNQ A;  5CYM A;  1TK5 A;  3AV9 A;  4TSX A;  2JLE A;  1HRH A;  5E41 A;  5I42 A;  4Z4I A;  1IKX A;  3O4N A;  3K5L A;  3ISN C;  5HP1 A;  1WLJ A;  4GW6 A;  4FJ7 A;  3NAE A;  3VA3 A;  2HNZ A;  2GUI A;  2Q3S A;  3TAM A;  3MEG A;  4B9N A;  4DG1 A;  1RT5 A;  3CM5 A;  3C94 A;  4DQR A;  1REV A;  4OPK A;  3S9H A;  1A5X A;  1HNV A;  4E7J A;  4DU3 A;  4B9U A;  1EET A;  3AVL A;  3VQQ A;  1UWB A;  1S1W A;  1FK9 A;  1JLC A;  4ID5 A;  1U49 A;  4QOZ B;  1RT7 A;  4CEE A;  3DLE A;  3LAM A;  1NOY A;  3OVN A;  4W5R A;  4F3T A;  2YKM A;  3THV A;  4I9L A;  4BDY A;  4CGD A;  5FRM A;  3TAR A;  3VQE A;  1TKT A;  4G1Q A;  4YFU A;  4JRP A;  2B4J A;  4CJ3 A;  4R5P A;  5HRN A;  1SL0 A;  4CEF A;  4IKF A;  3DRS A;  4AHU A;  4CHQ A;  3CM6 A;  3O4Q A;  3WNE A;  3SPZ A;  3KTQ A;  2ITG A;  4M41 A;  1SL2 A;  2ZD1 A;  3OYH A;  5KRS A;  3OYJ A;  1WSH A;  3ZSQ A;  5KTQ A;  4DTX A;  1HQU A;  3DYA A;  3C6U A;  1S6Q A;  2ATQ A;  1L3T A;  2PY5 A;  1S5J A;  4M3Y A;  3TAF A;  3QEW A;  1BHL A;  4OPJ A;  3VQP A;  4B8A B;  3DOL A;  1GOA A;  1HNI A;  4AHT A;  3NF6 A;  3A2F A;  1RT3 A;  3OYE A;  3HP9 A;  4B9T A;  4NCA A;  3AVB A;  4KTW A;  3DLG A;  4CFB A;  4B9V A;  4DFM A;  1JKH A;  4J2B A;  4CJ5 A;  2Z1I A;  4CJU A;  4KO0 A;  3SQ0 A;  1HMV A;  3DLK A;  3S3O A;  4OLB A;  4KB1 A;  1ZBL A;  3L8B A;  2VWJ A;  1N6Q A;  4I7F A;  3SUO A;  4C8K A;  4KRE A;  2DTU A;  1YTU A;  1S1X A;  2YNF A;  1JL2 A;  4F2R A;  2GBZ A;  3RRG A;  1LAV A;  4GVM A;  1F21 A;  3NGY A;  4F8R A;  3ASM A;  2E6M A;  2G8W A;  3SI6 A;  2E4L A;  1DLO A;  1ASV A;  3CFR A;  3LP0 A;  3TAE A;  4J2A A;  4DMN A;  1TL3 A;  3ZCM A;  4W5O A;  1CZ9 A;  4CFD A;  4Z0U A;  1BQM A;  4CJP A;  4DQP A;  3OS1 A;  2D0C A;  1G15 A;  2X78 A;  4CF0 A;  5HLF A;  1NK5 A;  1W9H A;  1RTD A;  4M42 A;  2KFN A;  4IBN A;  5J2M A;  3MAQ A;  4CFA A;  3KK3 A;  5EU7 A;  4DLE A;  3HO1 A;  4PWD A;  3DMJ A;  1IO2 A;  3EY1 A;  3ULD A;  4JS4 A;  3V4I A;  4IFV A;  3KLF A;  5CY4 A;  4JRQ A;  3PY8 A;  4OVL A;  3AO2 A;  3B6P A;  1WSF A;  4JS5 A;  3PX6 A;  5HRR A;  1S9E A;  1NKC A;  3RR8 A;  4CJS A;  4N41 A;  4FJ8 A;  4O0J A;  4FLY A;  3KK1 A;  2ZE2 A;  3RWU A;  2VG6 A;  3VQC A;  3SYZ A;  2Z1G A;  1VK0 A;  2RN2 A;  4N5S A;  4KAZ A;  1WN7 A;  2YNI A;  3NE6 A;  1NOZ A;  4BDP A;  3AO1 A;  3RMA A;  1KLM A;  1VSH A;  3WNG A;  1HYZ A;  4H4M A;  3SQ4 A;  1L3S A;  3AVJ A;  1U48 A;  2G8U A;  4CCH A;  4E1N A;  1BGX T;  3OJU A;  4IFY A;  1RDD A;  3ZSY A;  4OLA A;  3E01 A;  5SZT A;  2KFZ A;  1NJW A;  4CJL A;  4M45 A;  4ELU A;  1QSS A;  3MXJ A;  1SKS A;  1L3U A;  3KD5 E;  2IDO A;  3KJV A;  4Z4E A;  1JXE A;  1BI4 B;  4MFB A;  1S1U A;  1TKD A;  3OS2 A;  3JSM A;  1ZBF A;  3U3Y A;  4PQU A;  5SWM A;  4M3U A;  1S9G A;  3NF8 A;  4KB0 A;  3V9S A;  1A5V A;  1IKY A;  1C0U A;  1JLG A;  1K6Y A;  5KRT A;  4DTO A;  1RBV A;  1LWE A;  3MXI A;  1Q9Y A;  1NK6 A;  3V6D A;  3PX4 A;  1LWF A;  1ITG A;  4DS4 A;  4FJ9 A;  4CEO A;  1RNH A;  2OYQ A;  2ETJ A;  3F9K A;  5FRO A;  4BAC A;  4KRF A;  2EX3 A;  3AVG A;  4O0I A;  1QE1 A;  5HRS A;  5CYQ A;  3M8R A;  3SPY A;  3OYG A;  4XIU A;  2A1S A;  4CJR A;  4O44 A;  3IAY A;  1S1V A;  1RBS A;  1T8E A;  4K8Z A;  3F73 A;  3AVH A;  4N76 A;  1SL1 A;  4RW9 A;  4W5Q A;  4KHU A;  4FW1 A;  4BE2 A;  4FK4 A;  4RG8 A;  1QQC A;  3S3N A;  1ASW A;  3K58 A;  4RW4 A;  3VQD A;  4ZTF A;  4CGJ A;  4I9Q A;  4CGI A;  3LPT A;  4CJE A;  2RKI A;  3B6O A;  5J1E A;  4DSL A;  1RBU A;  1WNS A;  3FFI A;  3V1Q A;  4HVJ A;  1SUQ A;  4CIF A;  4DTR A;  4ELV A;  2HNY A;  3HP6 A;  3K59 A;  4O4G A;  4DWI A;  1VSJ A;  1NK9 A;  4ID1 A;  1B92 A;  2B5J A;  2R7Y A;  1U04 A;  1WSJ A;  2E6L A;  1NK7 A;  2OA8 A;  1X9S A;  1NK4 A;  1TAU A;  3I0S A;  3PX0 A;  4FZX C;  3LWL A;  3CYM A;  2XY7 A;  5HRP A;  3O3G A;  4B9M A;  3ZSX A;  1NK0 A;  4H4O A;  2FBV A;  2HHX A;  4OGC A;  2Y1I A;  5CZ2 A;  4B08 A;  4CK2 A;  1LW2 A;  1WSE A;  2BGG A;  3H08 A;  4QAG A;  4C8N A;  1Q9X A;  3DOK A;  4NYF A;  3NDK A;  3LP2 A;  1HQE A;  3D0P A;  3LZI A;  2FC0 A;  4CJQ A;  4CE9 A;  3NH1 A;  4DTS A;  1T05 A;  1NKE A;  2G8H A;  4AIL C;  4M3R A;  1QTM A;  3NBP A;  1R0A A;  1KLN A;  4ZTJ A;  3KD1 E;  2HHV A;  1B9D A;  4BE0 A;  1CXQ A;  1KFD A;  3TAP A;  3QLH A;  3V1R A;  3DI6 A;  3V1O A;  1UA0 A;  1BIU A;  1NJY A;  4KHW A;  1EP4 A;  4DTJ A;  4FJL A;  3IS9 A;  2QKB A;  4FZY A;  4I2P A;  3HM9 A;  4IG3 A;  3ZT2 A;  1XI1 A;  3RMC A;  1RDC A;  3AVI A;  1HYS A;  3LPU A;  1I39 A;  1LWC A;  3RR7 A;  1U47 A;  1KCF A;  1MU2 A;  2WON A;  4CHP A;  3L2V A;  1QHT A;  1VSD A;  4IG0 A;  4RW6 A;  4DQI A;  4KFB A;  3DLH A;  4F3O A;  1C0T A;  1CLQ A;  4J2E A;  2D0B A;  3TAQ A;  2F96 A;  1TK0 A;  4CJT A;  1HJR A;  3T19 A;  4ZHR A;  3EYZ A;  3HVT A;  4EZ6 A;  3QES A;  2OZM A;  4CHO A;  3SJJ A;  4EP4 A;  2YNG A;  3SUP A;  1JLF A;  3M8P A;  1NJX A;  4CK1 A;  1BI4 A;  4WE1 A;  3PUF A;  2PYL A;  4DTM A;  1D8Y A;  4PA1 A;  2HHS A;  1BL3 A;  1ZBH A;  3ZSV A;  3AVA A;  4KTQ A;  4FJN A;  3HST B;  1JLQ A;  3MED A;  4JLH A;  1C1C A;  4CF8 A;  4CER A;  1BQN A;  4LD0 A;  4L8R B;  3M8Q A;  2FBT A;  4M3Z A;  1RTI A;  2IS3 A;  2DFE A;  2IGI A;  3TAG A;  4KPY A;  2OPS A;  2X6S A;  4O5B A;  2IAJ A;  4CGH A;  4DFP A;  3C6T A;  4RW7 A;  4FJM A;  1I3A A;  2IOC A;  4CF1 A;  3V81 A;  1S6P A;  4CJW A;  3QIO A;  2G8F A;  3OYK A;  4CIG A;  3HXM A;  1U45 A;  3SZ2 A;  2DFF A;  1JLA A;  2KTQ A;  3V9W A;  1RBR A;  1A5W A;  5JS2 A;  1ASU A;  4CF9 A;  3ZT3 A;  4UQG A;  4W5T A;  3KLE A;  4E7I A;  3QIN A;  4B9S A;  4AHC A;  4CHN A;  3SNN A;  1T03 A;  2Z1J A;  2FBY A;  3NHG A;  3OY9 A;  4LSN A;  4FCY A;  4E7H A;  2BDP A;  4PY5 A;  2XY8 A;  1VSF A;  3LP1 A;  4DQS A;  3KLG A;  1RDB A;  3D45 A;  3OYC A;  3HT3 A;  1KVC A;  1JLE A;  3IRX A;  3O3F A;  3L2U A;  3PV8 A;  2XRI A;  4CFC A;  2HB5 A;  2HVI A;  1D5A A;  2OPR A;  4E7K A;  1Y97 A;  4CJF A;  4FLW A;  4QCL A;  4N47 A;  2G8I A;  2O4I A;  1TV6 A;  3SV4 A;  3OS0 A;  1GOB A;  3QNN A;  4FLX A;  1RT6 A;  3NGI A;  3AO4 A;  1TVR A;  3ZT4 A;  3QEI A;  1SKW A;  1KSP A;  4FJK A;  3P1G A;  2AJQ A;  2IC3 A;  3U6F A;  4DSI A;  4J2D A;  4FXD A;  4CGG A;  4DSJ A;  3L3U A;  4FM0 A;  4CJV A;  2D0A A;  3VA0 A;  1VRT A;  4OKE A;  4B3O A;  3HPO A;  2P1J A;  1KVA A;  4ICL A;  4CK3 A;  3OYB A;  1VSL A;  1L3V A;  4CGF A;  1VSM A;  3V9X A;  1WSI A;  3VQA A;  1C0M A;  1KTQ A;  4HUF A;  1C6V A;  1LW0 A;  3SQ1 A;  5C25 A;  4FW2 A;  1VSK A;  2Z1H A;  3RMB A;  1ZYQ A;  3M8S A;  3O3H A;  3AA2 A;  3VQ6 A;  1T7P A;  4M3X A;  4W5N A;  1KRP A;  4M3W A;  1EXQ A;  2A1R A;  2YHB A;  3NH2 A;  3RMD A;  1GOC A;  3ZSO A;  4EP5 A;  3VN5 A;  3VQB A;  1Z26 A;  1EKE A;  4CIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...