3D4GA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
471
Chain Sequence
TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 144
structure length 471
sequence length 471
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA01
1JW5A 1ZIUA 4TQUQ 1LBBA 3UGWA 1LAXA 3M3KA 2RC9A 3TTRA 1TWYA 1JEVA 2Q88A 4YB5A 3IAZA 3FVOA 4NF4B 1RKMA 3FASA 3TYHA 5CMMA 1M5CA 5FHOA 1MRPA 4BDOA 4NF6B 1UTBA 1SI1A 5I57A 4L17A 4R2BA 2F7AA 2V93A 3RQTA 4O3BA 3KBRA 2Y7PA 1SW4A 4KCDA 3TEPA 2DWIA 5H8NA 4KR5A 3FIRA 3I5OA 3CG1A 1B2HA 3H06B 3K1PA 2ABHA 4HCYA 4QFPA 1CE2A 1LLSA 1IIWA 2VHAA 4ZEFA 3RTWB 1DOTA 1PB7A 1M5FA 3T66A 4R9FA 4FJPA 2FA7A 4ELRA 5BWJA 1NNKA 3H3GA 4ZEDA 1EU8A 1UTBB 5CMKA 4LA9A 4F18A 2QS1A 5CM6A 4ZZAA 5KZTA 3AXFA 4C1UA 1S9TA 1PB8A 2F35A 3B7DA 2O84X 1BLFA 2M8CA 1PC3A 4U22A 3RNNA 3UORA 3USDA 2OJTA 3FXUA 2Q2AA 3VDFA 3ODBA 4ECFA 3GLBA 3VLUA 1XVYA 1WODA 3HO7A 4POWA 4PFUA 4ELQA 4DXCA 3CG3A 4KCCA 1DMBA 4KI0E 4RYAA 1URDA 1SD3A 2X26A 4JSDA 3PUZE 3DM0A 5FHNA 2DSFA 2PYYA 1H44A 2Z8EA 4GFRA 4KYEA 4ZEIA 3T9XB 3TDJA 4R75A 3TCFA 4FEDA 3V5AA 1NFTA 5I84A 3FV2A 1GGGA 3OOAA 3IO4A 1FQFA 2FYIA 2O1MA 3CFXA 3CSBA 1A8EA 3K0VA 3FXQA 4QFNA 4LQ2A 3S9MC 2RCAA 2B3BA 4YU0A 2V25A 1DPPA 2QSXA 1O63A 3LSLA 3MVWA 1ZJLA 2I48A 2VP1A 4IO5A 1P1OA 4PETA 4XKPA 3KN7A 3ZSFA 1LB9A 4MFIA 2QJEA 4MBPA 1JQFA 3B6QA 4JXIA 1N04A 4ZS9A 2DVCA 3KGCA 2OCUA 1CB6A 4NWCA 5AA2A 1FQAA 1UIUA 2F78A 3H6TA 4EQ9A 3T22A 3UIFA 4LP2B 4NF4A 3SESA 2XX8A 1B32A 2I3VA 4OQOA 4U21A 4MLQA 4Q5TA 3S4UA 3VE1B 1LFHA 3G7WA 4OTEA 4OFJA 3W15C 1LCFA 4LVQA 1OMPA 1H43A 1XC1A 3HCQA 3H6UA 3MAMA 2DE4A 1B3EA 3KSJA 4GF8A 4PP0A 4YICA 5DVIA 1XHYA 1B3HA 1H45A 3ZS6A 4U4SA 3M3FA 3FJ7A 3TCHA 4E0XA 1LAGE 1US5A 5CC2A 5DEXB 5ICQA 4RPOA 3IOUA 3UN6A 4Q8RA 2H99A 4ZDMA 2HZKA 4Q0CA 3OSRA 4I1DA 3PMVA 3TMGA 3FATA 3IX1A 3KFMA 4NMYA 2HFBA 4N6PA 4ESWA 1EZ9A 1PBPA 1XVXA 2XXWA 1I6BA 2DWJA 5I2NA 2OWTA 1MQGA 2I49A 3CSGA 4IY6A 4PFWA 1NKXA 2PMSA 3IB1A 1II5A 4JWOA 2Q2CA 1N0TA 3RN8A 2I3WA 3A3CA 3ILUB 3K4UA 5TPAB 1UTHA 2QRYA 3FD3A 1A7LA 4WXJA 5CMBA 3S9EA 4LUBA 2B3FA 1BTJA 4QSCA 1H3DA 1OLCA 4YKPA 2PT2A 2IA4A 3CR9A 3K1MA 3VFJA 3VXCA 1VFDA 1MY2A 4DCXA 3I6VA 4QSDA 2PBWA 4HS7A 5EHSA 4XIGQ 1A40A 3PUVE 4OESA 2OK2A 1O7TA 3O9PA 1KWHA 1B7UA 2R9JA 3EQ1A 1DPEA 3C32A 2DWHA 5HPQA 3PUXE 3RT6B 3FJMA 3C4MA 2YJPA 4EUOA 4YB6A 3RY3A 2P1SA 5TPAA 5B70A 5H8QA 4X1BA 3E9XA 3MP8A 5H8HB 1D9VA 1MXXA 1Y3QA 2XX9A 3IO6A 2IEEA 4LONB 3V83A 4G8MA 3C31A 4XKNA 3LC8A 1QUIA 2RC7A 3A3UA 2F6PA 3OEMA 1T0KA 2NVUB 1DTGA 2GFEA 1IXCA 3ZKLA 1Y4TA 5EHMA 2Y7IA 1IXIA 2QS3A 3CI8A 3K6XA 4GVOA 5FTHA 2VD2A 3MZ1A 1IQ7A 1J1NA 2QS4A 2YLNA 3KN3A 1IUDA 4RNSA 1MY4A 5A5XA 3OMBA 3SDFA 1YTVA 2OWSA 3IK6B 4H8JA 4OEVA 3KJTA 5CBRA 5H8QB 3T9VA 3G3IA 1FW0A 4AB6A 3B6TA 4H67A 4OERA 1GR2A 4H5GA 4Z7EA 3N26A 5JK4A 1NNTA 3PPPA 4G68A 3BFTA 1VSOA 4IGRA 3NK3A 2I0CA 2ZYNA 2H9BA 4I62A 1JEUA 1N3WA 3LUYA 5TP9B 2XXRA 1IITA 2RC8A 3IJOB 3Q29A 2VD3A 4OWDA 1SYIA 4IO2A 4GIZA 4OYVA 1ZTYA 4R9GA 4DXBA 4ZECA 5KCJA 1IEJA 1M5EA 4FE8A 4NF8B 1BP5A 1YAEA 4YKIA 3ZKKA 5ICTA 3HV1A 3DELB 3ILTB 3IR1A 2ZYKA 1D4NA 3VXBA 1NL5A 2X7QA 3G3GA 4DZ1A 2I58A 4LZ7A 4R6KA 3FUZA 4F39A 2QL3A 4U23A 1B5HA 3A09A 2ZNUA 1MDQA 2DXRA 1MXVA 2ANJA 3HPIA 4FEBA 4GD5A 5I2KB 1NNPA 2XXTA 2F7BA 2F34A 4X9TA 5DEXA 4N07A 1MDP1 4QFLA 2HZLA 2UVJA 4GXSB 3C36A 1B7HA 3FGSA 2DYXA 3LSFB 2THIA 2PVUA 3Q27A 4R72A 2Q8JA 1HSLA 1B3FA 3D4CA 1LSTA 2OBGA 2DP8A 4R73A 2GHAA 3LSWA 4U1ZA 4NTLA 2REGA 3FVNA 1VR5A 4EF2A 1B5JA 1US4A 2F36A 2XXHA 3N94A 3OEKA 3EHSA 4MF3A 1B58A 2GHBA 4GRKA 4O3AA 5I56B 2H5YA 3EHUA 1B0LA 3LBSA 1Q1KA 1QVSA 3FJGA 2HXWA 4PFYA 1B4HA 5TU0A 4WEDA 1BKAA 3DP8A 4OVJA 1FTMA 1GVCA 2QMWA 2H4IA 4F29A 4IO4A 5H8NB 2ESNA 4F31B 1OQHA 3TTNA 1B9JA 1AMFA 2ZXTA 4POXA 5ITPA 2F97A 3EPEA 3RGYA 4F19A 4OEUA 3TAJA 1EZPA 5I57B 2DWAA 3K6WA 1LGBC 1S50A 4YMBA 1VE4A 3FVKA 2XX7A 4ZEKA 2XXUA 1POTA 4Z0IA 4WEPA 4GL0A 5DVJA 1IXGA 2XXIA 4DDDA 3F11A 1F9BA 2F5XA 3H4ZA 4OHNA 4YAHX 3RUMA 5AA4A 2QS2A 3G3KA 5JTYA 2H25A 2PX1A 1FQCA 4BDLA 1MPDA 3GBAA 3L6HA 2UVHA 1Y1ZA 2UYEA 5K2XA 3JZJA 4G2ZA 5FTIA 2X7PA 4FORA 1Y9UA 4R2FA 1URGA 3SERA 4FECA 1JW1A 2CMOA 3MVZA 4LZ8A 3G3FA 3K02A 4YZZA 4C1TA 3V8XB 1S7YA 3O6GA 3BFUA 5I59B 1PBQA 3KSXA 3OENA 4G68C 1B5IA 4ISUA 3L6GA 4C0RA 2R71A 3E13X 4TLLB 3PPNA 1P1QA 3C33A 1P1NA 4XXUA 4R6YA 1N7XA 3QUJA 2UYFA 4GLIA 4U2RA 1N76A 5L9MA 4NF8A 2XXQA 3CRBA 4HW8A 3LR1A 1TT1A 2HCAA 4YMAA 5BUUA 5KDTA 3K6UA 3TQLA 2XD2A 4OFLA 3S9NC 4OENA 2A5TA 3P7IA 2CZLA 3PD9A 1LBCA 1MQJA 2V84A 1B05A 1Y20A 3DLNA 3LSXA 4JBZA 4JSOA 4OXVA 2ONRA 4H65A 1LB8A 4P0GA 1FCKA 2O6AA 4F1VA 1ELJA 2G93A 1USYE 3IORA 3EN3A 1RYOA 5I2NB 5DTBA 3QUFA 1LAHE 5I59A 5H8FB 1H76A 1I6AA 4LQ5A 3SEXA 3G3JA 1Q35A 2O7UA 3MQ9A 4NF6A 1JETA 1B1XA 2LAOA 2Y7KA 3B6WA 2DE3A 4HCWA 3JV9A 3OO7A 4ONYA 5DT6A 5DYHA 1ZLQA 3QYTA 2ZMBA 3DP4A 4BDRA 3TFLA 1B7ZA 2V3TA 4KHZE 3GBBA 3PPRA 3U72A 1Z7ME 5IKBA 2Y7WA 2Z8FA 2ZYOA 4UA8A 3VVEA 4AB5A 3HHGA 1B51A 2E1SA 1Z7NE 1JW4A 1ANFA 1SI0A 1WDNA 2O69A 2RKMA 3QAXA 3MPKA 5I58B 2DVZA 2DS9A 3GZGA 1OIBA 3VV5A 5AA2D 1AH5A 1JVXA 4IB2A 4PFTA 2DOJA 4H8IA 4IGTA 3GXAA 3H7MA 3R7XA 5H8HA 1UQWA 1NH8A 3H6VA 4OETA 3QXMA 1LAFE 1PEBA 5AA2B 4I8CA 4UACA 1B52A 1FQEA 1M5BA 3DP6A 3OELA 3W9WA 5AE4A 4ZE9A 3O2AA 3PMXA 2D3IA 3TCGA 2VOZA 1RYXA 1MXYA 4OFOA 1MXUA 3VVDA 3VVFA 5KDTB 3K00A 1QJMA 1MH3A 2NXOA 2ONKE 2I4CA 1GTKA 2Z22A 4QFOA 1MM7A 5JEIA 2YPNA 3U92A 3QK6A 1ZKBA 3IOWA 2UVIA 4NEDA 2AYSA 3D4GA 3O66A 1N3XA 2O68A 3BBRA 3RPWA 1MQIA 1URSA 4GXAA 3PV0E 5L9SA 1O64A 1B0HA 3FVGA 3M8UA 3SEUA 4DE8A 1D9YA 2VGQA 3T9UA 3K6VA 4E0WA 3N6UA 2D5WA 3KJ7A 4X1DA 2F7CA 1MG1A 3C35A 1LFIA 4ELPA 1Y1MA 4PE5B 5EYFA 5FHMA 3O6HA 4NF5B 1DTZA 1M5DA 4KYDA 3T96B 1SDXA 4EF1A 1B40A 4MH5A 1I6QA 4JDFA 3C34A 1SBPA 1L5TA 2WKYA 1B3GA 1B6HA 4TLMB 5IAIA 3K01A 4JWYA 3IB2A 4P11A 4OZ9A 1MY0A 5L8DA 1B1HA 1FQBA 2XD3A 1USYH 3MZBA 3HN0A 4DCYA 1MQDA 1IXHA 3JYRA 3K1NA 4ZEBA 1N84A 4F3PA 4NF5A 1BIYA 1ATGA 3KG2A 5CI5A 3MWBA 3OO8A 5I56A 1QUJA 1TXFA 3OD7A 2P0SA 4H0WA 1XOCA 2XXVA 5J1DA 3PPQA 5I2KA 3MJNA 4IO3A 4X48A 1R9QA 3RTFB 2NOOA 3MP1A 1WVJA 4N13A 4XTCQ 2OLBA 1R6ZA 1P1WA 3M3LA 2OZZA 1A54A 2AL5A 1OLAA 2GH9A 2O51A 3U1OA 4BLAA 4QF9A 2GRVA 1MQHA 2A5SA 4KPTA 4QFKA 4QSEA 2RCBA 1MPBA 4GL8A 5M2VA 4F3SA 2Y84A 1FTOA 1SYHA 3E3KA 1R1NA 3OSQA 2E0SA 1AIVA 2A5TB 4F2OA 3KOSA 3IJXB 4F1YA 2H98A 2REJA 3G3HA 4F3BA 1FQDA 1MPCA 3FZVA 3ONMA 1XS5A 1IZ1A 3HSTA 4THIA 2I0BA 4U1OA 3SEYA 3O29A 4F2QA 2F6GA 4G4PA 4GOTA 3KZGA 4HTGA 3TODA 3HHFA 3RLFE 3UP9A 3SETA 3TKDA 3VLVA 2AL4A 1NMUA 2Q89A 2G29A 1ZBMA 1A8FA 1TFAA 1Y3NA 3MC2A 4ND9A 2R6GE 3MVXA 5AA1A 3NK4A 4IO6A 4DIGA 2HAUA 3MZ9A 3O6IA 3OO6A 2QMXA 1FTLA 1QUKA 3EHTA 4M1VA 2ZYMA 1SVXB 1PB9A 1SQYA 3S2VA 2XXPA 4YB7A 5A5XB 3S9LC 3U8QA 3T93B 4O3CA 3U93A 3O28A 1YCJA 4BDNA 2Y7RA 3PUWE 1A55A 3N6TA 3MVYA 3IL1B 4FATA 5H8SA 4EQ7A 4XKQA 2P2AA 4RXLA 1MS7A 4NE4A 4KQPA 5AA3A 4H1XA 3MPLA 3VLWA 2FNCA 1OVBA 1Y4CA 3C9HA 2D21A 5ELVA 3UA8A 1MY3A 4JWXA 3CFLA 4RK9A 4ZE8A 1Y3PA 5TP9A 3THIA 4F1UA 4RJZA 1FTJA 3PMWA 5DVFA 2UVGA 3KN8A 3MW0A 4YKJA 2O7IA 1XT8A 2RINA 3CIJA 3IB0A 2DXYA 1JNFA 1OQGA 2UXAA 4I9DA 1QKAA 3UK4A 3FV1A 4KYSA 1LFGA 5HBCA 2ZNTA 4G77A 5I58A 1QW0A 1MM6A 3N5LA 5ITOA 3U94A 5ISUA 1FTKA 1QKBA 1AL3A 3E4RA 3IOTA 1SW5A 5F7VA 3Q26A 4EDPA 1HSJA 1POY1 1OVTA 3KOTA 4EXLA 4QRZA 3OO9A 1I69A 4U4XA 2NWJA 4PQJA 2HEUA 3V89B 4RA1A 1B46A 4TOZA 1UTHB 4P0IA 2ONSA 4G8NA 1AOVA 4LZ5A 3TTMA 4OMBA 3BKIB 2HQ0A 3TPAA 3WAEA 1B4ZA 1B3LA 5K2YA 2I6EA 4QHQA 5F1QA 4YKKA 2RF1A 5CRYA 4ZZEA 4EQBA 4LATA 4RPNA 3W9VA 3RT8A 2BJJX 1MXWA 3OXNA 1P1UA 3MP6A 1A99A 4NWDA 4EXKA 2ALUA 4M4GA 5KCJB 4BDMA 2KLFA 5H8FA 4GWOA 3SKPA 5L9OA 3H03A 1ZU0A 3O97A 4R6HA 1PDAA 4RK2A 4DXUA 3PU5A 4F3GA 3K2DA 2Z8DA 2W7YA 1ZMGA 4WKMA 3SEWA 4KD5A 1JVYA 2DE2A 1EH3A 3KEIA 4DLDA 3CVGA 1NNFA 1TFDA 4Q30B 3SEVA 4FIMA 2HAVA 2I4BA 2PT1A 5CMCA 5CBSA 3T9HB 3I3VA 2NUVA 1N7WA 2Z23A 4GQOA 3QIMA 3H6WA 4IY5A 3QSLA 3Q28A 1QULA 2AIXA 2DQVA 4H5FA 4F22A 5LOMA 2QPQA 1VFEA 3IOVA 4IO7A 2B65A 5HM4B 3ECRA 4KFQA 1R9LA 3WAFA 2V3UA 1P99A 4AQ4A 3EF7A 1GV8A 4H6DA 4G68B 1NH7A 4XKRA 4MLVA 3TELA 1MXZA 3TTLA 3TUSA 2F8DA 2V3QA 4JB7A 4G8HA 3CFZA 3FXRA 3R6UA 4RY1A 3MUQA 4BDQA 4FAJA 3Q25A 1SW1A 1YPNA 2XXYA 3PPOA 4R74A 4K3FA 2ZNSA 3R26A 1LCTA 3PGFA 1MY1A 2XXXA 3PUYE 3TZAA 4ELOA 4ESXA 5B7DA 2O1LA 5JTYB 1SW2A 5AA4B 1EZOA 1UIVA 2Q9TA 2XHDA 1MH4A 3MBPA 1HSEA 1D3KA 3TTKA 1DSNA 3PD8A 3TQWA
chains in the Genus database with same CATH superfamily
1LQSR 4UQ2A 1CZ8L 3QZWB 5B8CA 5DD5L 1YC7A 1B0GA 3RWFB 4LAQL 1WPCA 2GJZB 1S5IL 4R7LA 4PAFA 1TJIL 1UWXK 1ZV5A 5G4MA 4M7LT 4WI2A 5EF1A 3NZSA 35C8L 1LL1A 4HCYA 1QHQA 4PD4K 2Q2EB 5I71C 1A6UL 2XT1B 4UQAA 4YVNA 1H8LA 1OF2B 1OP5K 4ZEDA 3TFBA 5KZTA 1BVKA 2D7TL 5FGCE 4BKSC 2G2NA 1HH6A 3FN9A 1TQUA 5CILL 1F11A 5GISH 5CZVL 1BLFA 1ROWA 15C8L 1MFEL 2F08A 1PC3A 4O5LH 4TULL 4F1ZA 3HUJE 5T5NF 3AXLA 2A73A 1G7QB 2YN5A 1WODA 1TETL 5IW6B 1ETB1 5KYNA 1NDMA 3D2UA 4K2UH 1TFHA 4XMWA 1L9OA 5DU7A 4KI0E 3GUTA 1H44A 1YY9C 1USZA 1M05A 1ZLEA 3LPGA 1YO4A 1PMYA 4MD0A 2W07A 1YVLA 3T6XA 3G5XB 1AI1L 3SOBL 4WEMB 2ZWLT 2AERT 2D3VA 2V25A 5JOPE 3U4BH 1X9RA 4I87A 4XCEB 3KN7A 3KAAA 1FPBA 1ND0A 3JWOL 5HHOD 3D4YA 3GKWL 1WRFA 4Y9BA 4DKDC 1MKFA 1YYZA 2DVCA 1ZHLA 4ZW3A 1JZ3A 2C3VB 3LRSA 1NFKA 4TNWF 3REVA 2OMVA 3N5AA 5CIPA 5HHXH 2VH5H 4BDVA 4JDTL 1AZCA 3MV7B 1HTYA 4QO1A 1E3XA 2D8KA 2EIBA 1X6NA 4OZGB 4U2YA 4YNYB 4ANVA 1TJMA 2BS9A 4J2XA 3W15C 1N5AA 3E6FB 4XZUB 5EIVA 2IFFL 5C6TH 2EUVA 1A4AA 2Y36H 3QA3A 2EYTB 3EBGA 1B3HA 2IOOA 2Y0SA 3DJTA 1OY3B 1LAGE 5CC2A 2YQ3A 3CFDB 5I74B 3U9PH 1BZEA 3B9KD 2DLHA 5B39A 1UB6B 4LOVA 4U3CA 4XVTH 4WKZA 4N1HB 4PRBB 3OX8A 4DKAA 3U7WL 5MERA 1SZNA 1J5IA 1E4XI 1FE8H 4JVIA 4A6YB 1Z1WA 1E5BA 3RX5A 5JORA 3QDAA 4G70B 1LDPH 3TJEH 1NV4A 5TPAB 2IMNA 3MZGB 2ZP0T 3MRRB 1NCNA 3S9MC 1DJYA 3NGBB 2W0KA 3VSUA 4CJ0A 4LSRH 4M8RA 4O7MA 5EHSA 1DFBL 1T03H 2Z1KA 3MCLH 3QWNA 5IROD 1BA9A 2PYEE 3O8XA 4PS4L 3JV6B 4OKVA 5BMFL 2CBPA 3U9UB 3KDPB 1WQVT 4YDLC 3PUXE 3MRDB 3QXTA 1BVNT 4JPKL 3NCYS 1OGTA 1UGKA 5BZXA 3C8DA 5B70A 1KEGH 5FX3A 1OANA 2DLFH 4YHYB 4DCQB 3QS2A 2ZOTA 3V83A 2OYMA 4M48H 2A9ML 4JJOA 4L29B 4UAHA 1DDTA 5JDSA 3O3EB 3U0WL 5FYLD 1HYSC 3JBG7 4OUUB 3NJXA 3V4VB 1ROCA 4FABH 4EI5C 5FTHA 3G04A 1C5CL 4OFPA 4LL4A 5SWSA 4M7LL 3UTSD 4BRVA 4MQTB 2FYYA 2X42A 4PBDA 1DQDL 4BBWA 4LEEA 3NGBC 4HLEA 2E8YA 1FVEA 3BUPA 3GMPA 4UZSA 4TS6A 3ABKB 3NPSC 4QDGA 2WUCL 4IJ3B 3PDGA 1NNTA 3PPPA 3OXRA 3WY2A 1T0MB 2XA8H 1GSKA 3O41A 4Q6IC 4L1LA 4NOBA 1KTDB 5DVMA 1XMEB 5HXMA 3LUYA 1S7QA 5F24A 5L0QB 2L04A 4EVNA 2YD9A 4ZAKC 3X13B 1F4WH 3I3EA 2OQJA 3ZIYA 2NXYB 3L5XH 4OLVH 3SY0A 3BLPX 3DSNA 3TM6A 4BK4A 3ILTB 2ZICA 3IJ9A 4YBLB 1G9MC 3NA9H 1FG9C 4HEPG 5EUOE 3KE0A 4RMRA 2QVRA 2W9EH 5IBTL 3WL9A 4U23A 5EYGA 1LMKA 4MBRA 4JDVB 2RALA 2UX6A 4H1LG 4BZ2H 5I1DA 4ODSH 4GD5A 1A3LH 3OZLA 2J44A 3ZUNC 1F3DH 5JPMB 4O4YL 1A6TA 4GW1B 3V2AR 1V05A 4FKHA 4QXWA 1T04A 4JZJC 4WK0B 4E41A 3OR6B 5F1SA 1CLVA 1JGIA 4NTLA 1OAZL 4Q2ZA 3DV4A 1CXIA 4KVPA 3BLBA 1JVKA 3UCQA 3GMQA 1SVCP 3EHSA 1KTKE 5KW9L 4UB0L 2P5WD 1PIGA 3O3BA 3SKJL 4ZFOL 4X6DE 3ULSB 5ADOL 4ZXBB 5HI5C 3NABL 2FJSA 4AVHA 1OQHA 3F05A 4OVTA 1UJTA 5C0RL 4JFHE 4X7FC 5I57B 1IIIA 3MBEC 3FTGA 2WO4A 3QNFA 5B7MA 4P46C 1BQKA 4N0RA 1FYTD 1U3NA 1Z9SA 3KPOA 3FN0H 4I9XA 3P0VH 1TQCB 4AUJA 4AYID 4C83A 3U7WH 5IHUH 2ATKA 43CAB 5IB5A 1K8DA 4NI3A 5JZ7C 1JN6B 1Y0LA 1W9XA 3PXLA 4XMPH 2PW2B 3HC2A 2IIJA 5E9DB 3TVMA 4KITB 2VAJA 3LNEA 5K2XA 1IFGA 3D3VD 2VQ1B 2NNFA 1TLKA 4MQXC 1URGA 1J9QA 3A0OA 3QFJB 2A5UA 3DHUA 4PAIA 4H8PA 1FO0H 4UI2A 4ZOEA 4JZNA 4ISUA 2OXGA 4JDZB 1FRGH 4Y9CA 1FFQA 1QTYT 1F97A 2VDMB 2ALAA 2V2WB 5K93A 4A2LA 3BISA 2X28A 3IGUA 3OZKA 4U2RA 3SY0B 4R3SA 1OGAB 3OB8A 4WUUA 5K5YA 1NCAH 3UGXA 3S9NC 1MH5B 1JIBA 3HR5A 4IOFC 4OENA 3ULVE 4HWBA 5F9DC 1LBCA 1HN1A 4GXFA 3MC0A 3LSXA 1G7MA 1BP3B 2XN9E 4QGYA 3FQXA 5KVEE 4J3OD 5DTBA 5AWNH 2XN9A 3KYMB 4M1DH 4YBHA 3VXPA 2Y7KA 3DX7A 1J8RA 1FZJA 4ZOAA 4FG0A 5DFTA 5AAWA 3FT2B 1XZWA 4M7LH 1KJMB 3PPRA 3IS0X 5HGGS 4AB5A 4MS8D 1DN2A 3H9SE 1IGJB 3DVGB 2EO1A 3RJDA 4JANA 4A55A 4GBXD 5J1AA 3Q5OA 2WUCH 1T2JA 2KZKA 3HVNA 3W82A 1P5UB 2FUQA 4MD4B 3LZFH 3ZRSA 1QTPA 4RFOL 4A2MA 2XWIA 5EBMA 3JZJA 3TIEB 1KN4L 1FLRH 1DO5A 1I1AD 1IL1A 2VLRD 2X5PA 2ZWYA 1HHGA 1OT4A 2PPDA 5E2VH 1LEKB 4U1HB 4OF3A 3ZXAC 3DP6A 5AOLA 4NUPA 3P3SA 4N20A 1UD2A 2JELL 3HHSA 4UYPA 1GVIA 1NCAL 5I1EL 2E7LA 3WY3A 2A4CA 1MH3A 4F7CA 4DKEL 1YMMA 1K8IA 3KLKA 4ONOA 2V2TA 1H5BB 1QW8A 2NYYC 3GXMA 4RFNB 2WX9A 3ZO0A 4KX8A 1CLZH 3BP5B 3QZWA 1IMAA 2NW2B 1URSA 1QRND 3T4YB 2F1AA 2UY6A 4MJ6B 1FZMB 3KPNB 4GX4A 4EN3C 3FZUC 4G72B 2DQUH 3IXTB 1Z5YD 3WTXA 2HVJB 1QQDB 1AY1H 5FHMA 4M03A 5LDUA 5IB2A 1Y18A 3PCYA 4PRDA 3VFOA 1W8EA 2PO6D 1U58B 5GS0C 5HYSB 2VDQH 3P0GB 1CDCA 1CL7H 2V3EA 2FX9L 3FONB 4PI2A 5FYLH 3IB2A 4FQIL 1NZRA 4PJBF 5L8DA 1AR2A 1UASA 4P48A 5EEXA 2JTDA 1HH6B 5E9DD 4N22A 5AEAA 1S2EA 3U4KA 3UIZA 5KW9H 2F3DA 4H8WC 3KLDA 4AUYA 4PCSA 1G7IA 1IEBB 3MFGB 1XOCA 4XMXA 5D6CB 2QDWA 3SJVE 4IO3A 4DEUA 1NTDA 3QUZC 3EXLA 4GIAA 5FUCE 2K78A 3MV9E 3EYFA 4M7JL 2OTPA 4UM9A 3ULUF 1CFNA 2UVFA 2WXIA 2EO9A 3KPRA 5AVVB 3WKML 2Y84A 1KIQB 3QJFB 5EU4B 3FQRA 3IJXB 3NZHH 5GJSH 4KRPB 3P0VL 5CEZH 2MTPA 4JPSA 3CZSA 5KBLA 4IRZA 4NZ8A 4XPTL 2YFNA 2VABA 4JVCA 2Y22A 1XS5A 4XCEA 3KEDA 4OB5L 1BVZA 4RAVA 2XFXA 4X0KB 4HTGA 3HHFA 3UP9A 2FGWH 3Q7JA 2GSGB 3F12A 5C0BA 4I1PA 2FIXA 2EIZB 3IKKA 1EMTL 4HAKA 2CNYA 1TFAA 2C5DC 4F3PA 3Q1SH 3QXWA 1B9ZA 3D8MA 3MAWA 4HHGA 1ORQB 3KPPB 5F7WC 1RJZA 1Z3GL 3B43A 1PB9A 3S2VA 1WE5A 3F7KA 1URZA 4IGBA 1XF4B 4AL8C 1R6VA 2X7LA 1CDHA 3CFCL 6TAAA 2C9AA 3BESR 4EQ7A 1FHNA 1AYOA 5ID0A 2EADA 2E59A 4KMTL 3C9HA 5ELVA 1PKQB 4F1UA 1LEIB 1IKFL 1Q94B 3OMZA 1T7WA 4C58B 1XT8A 2ZUUA 1ZT1A 1I1AA 2VLRA 4W93A 4JFFD 3UK4A 2OQJB 3F7LA 3B5GA 4LBAA 3CC1A 3UBXB 5IGXH 1WJ3A 1UXLA 2O93L 4R26L 4Z3FA 2KQNA 3U83A 1U8QB 1QW0A 2AKRB 1MM6A 1T83C 3EBHA 4H26B 2B9BA 4KK8C 3S37L 4PFRA 3UYRH 4NUQA 1M7XA 2E7BA 3OG6B 4AT6A 4EXLA 3PY9A 4MB5A 4QHLA 5EUOA 1V7NH 4G6AC 3VNZA 5IB3A 2HG5B 2ZX8A 3QE5A 4QHUB 1T7XA 4CC4C 1U4FA 1J5OL 2Y3NA 4QBAA 5I0XA 4RIRB 2RH0A 5I75B 4U7KA 1M42A 3SODB 5E2VL 2GAZB 1JNLH 5B1AB 4LHUB 4ZAKD 2DI9A 3UTOA 3QR2A 5DFAA 3KPRD 4WO0A 4YE0A 3QO0B 2Z1PA 2FJGB 4KXBA 2VDOB 4AGPA 1RUQL 2QQKH 4Z78A 4WUKL 3U4EB 5IZ7A 2NR6C 1IC1A 4I3EA 3H3BC 4WKMA 5C0AD 4PJ7F 4P2OD 4K4KA 4M4RB 4YDNA 1TTGA 4QOKD 3VVWA 2Q8MA 4FJ6A 5EIIB 5JIPA 1KXVC 4Y16C 2M83A 4YNYA 1X5XA 3RJOA 3B34A 3L95A 3TYFB 2ITCB 3FT3B 4OLWH 2F74A 3ECRA 4JQVA 5LB1A 5F7UA 1U8OA 3SZKC 4LMQI 3SE3A 2EE0A 4M8QB 5L6YL 2CA3A 1GCYA 4LCWD 1TMCB 4OZIF 4QUOA 1UB6A 5DGQA 2Y24A 2N1KA 4U1HA 1YPNA 3C8HA 4EDXA 1YDPA 4E41D 1MY1A 1FBGA 2IDTA 1RSFA 4A6YA 1SW2A 1HC1A 4HWEL 5ISZE 5EWIH 5GRXG 1RIHH 3MI6A 1SJEA 5E94B 2WLIB 3IDMA 3CBKB 5LKNA 5DYOB 4NF6B 1U8PA 1IBYA 4GRWB 2UYLB 4PJ8B 3PD8A 2AEWA 1TVHA 3MUY1 1JRHI 3QSKB 4X98B 4J1UB 4HHAA 3T0JA 3TTRA 3LZRA 1MQKH 4NF4B 3H2WA 4GQPH 4QAWA 2IVFC 4X9HA 3TNMA 2WWMD 1U4EA 2JB5L 3QEQB 4N15A 3K1PA 4R0LC 1MPAH 2EIMB 1OK0A 4KXZI 1MFUA 4PJCF 3IJSB 4Z0BL 1ACCA 3H1ZA 2NZIA 4JRFA 4HJJH 3NRPA 3MJ9L 3HB3C 4GS7C 1EU8A 2OL3H 4TUKH 2FBJH 2WMPB 4LIQH 3GS4A 2FQEA 3WDJA 1CFMA 2ZT9C 1NMCC 4HU8A 2Y7NA 2CJUH 1KLGB 4PBWD 4HV8B 3SPGA 1BFTA 2XBZA 4MQSB 4AEIH 4EN3B 2MOVA 1DUYA 1W16A 1HDMA 1FSKC 4CC4A 1CF8L 2QADC 2W0FB 2ZUSA 2OX5A 4KKNA 1KXHA 3GLBA 4POWA 4R4ND 2F3BA 2ZXCA 2AXHA 2GG1A 4N28A 3FYIB 5DURD 2AITA 4NP4H 4JSDA 4RYAA 2ZAIA 3D30A 3LHAA 2Q8BH 1Y07A 4XPFL 5IIEA 1U3JA 2Q76B 2PCFB 1AOZA 3ARWA 5CLXA 3TA3A 3CUPA 4MDIA 1UWFA 1HDMB 4P9HH 4N2GA 3VWJD 2RA1A 4B7IA 3F6IA 3DYOA 2RCAA 4O9HH 4LKCB 3C5ZA 4MBOA 2ZOKA 2AQPA 4PY7B 5D7KE 1AO7E 1MCLA 2BMKA 2VZSA 4P5SA 4PV9A 3WJLA 2GKIA 1FFNA 5C9JB 5ICUA 3B6QA 1DCLA 4N85A 3P40A 1MNNA 2Z92A 1ZY9A 2OSXA 4XNXL 6FABH 3IAQA 3WN5A 5KYUB 5F6HJ 3PF2A 3QAZC 1MCIA 3O9WA 4U0QB 4YFDB 3AM8A 5L2KB 4XC1L 1OV8A 2BZ7A 4JO2L 4HCFA 2XX8A 1WFUA 2R9HC 4P23C 1OHZA 4MLQA 3WSQH 1V7NL 2JJSC 5B7FA 1RZJH 4ZS7H 2IH3A 2J1XA 4RMBA 4G6KH 2K8MA 4NGHH 1Y1DA 1IGMH 4YUEL 1AXIB 3HE6A 1CE1L 3VRJA 1BJ8A 1R0AH 1GY1A 2R29H 3U0PB 3GMMA 4K15A 2ZZVA 4KXPA 3OJ2C 4JFTA 4LCWB 2D03H 5INCB 4I1DA 3ELQA 3NG5A 3WJJC 1E9OB 2IG2L 4P2QB 1OWRM 4E41B 4PI0A 2F53B 3LZLA 2VMEA 1MQGA 3B9AA 4N90D 5IHZB 5B39G 3N3EA 3GXPA 4PJAE 5FO8A 2EIJB 4JHAL 3ZE0F 4FYSA 1VIWA 1E50A 1INQB 3VFPB 4U1KA 3K1MA 1CU4H 5D96C 1VFOA 2PBWA 1NH6A 1A40A 1BVKB 2BNRB 4XH2B 5D55A 4Y7OC 4CADB 1N6QH 2KZ1B 1IQDA 3CU1A 1L7IL 1YEIL 1G7LB 3CC5B 5I73B 2BHFA 5DMIL 5JW4R 3IETB 5LVEA 2M2DA 2Y7OA 3NMEA 1PG7H 1U30A 2PYEB 3C4MA 3EJUA 4DTGH 2XLLA 3VB8A 1INPA 4X1BA 1MW0A 4ODUB 4UAOC 1Y6MR 2EDKA 3HG1A 4RCAA 2IEEA 2FO1A 2X4QA 4PEEA 1NFDA 2JSFA 4L0YA 3OEMA 2B16A 2F6PA 3PQYB 1MI5D 9PCYA 2V0AA 5DURB 5F72S 2Y7IA 3UTQB 2DMCA 3MZ1A 5LTCA 4JCMA 3HG1B 1M6OA 3BVWA 5BNXD 2WAHA 3AADB 3BD4A 3V4VH 3WIAA 5FO9B 4G7QB 3II2A 1SJXA 1GR2A 1WS7A 1DLFL 4FQLL 3JQOB 4H5GA 1A1OB 2OP4H 4ZUSB 2MOQA 5I8EB 4IR8A 3QEGH 3B7RL 3AM8C 3RG1C 4UOJA 4ZMWA 1NGWB 1X4ZA 2H2PC 3W2DH 4OWDA 2RCSH 1ZE3C 2HLAA 4JPQA 1RMFL 3RGVB 5DMIH 4ZTPH 1G9NH 5FA3B 4KGJA 5JXAH 4PV8B 4NQSA 4G9FD 4CVZB 3RGBA 1R3JA 2O61A 4PDHA 2OTUB 3NQKA 3ZE1B 1JYWA 4XPHL 4HAGA 3IR1A 4H88L 4MX7B 4XPFH 1NINA 3ZDXB 5JA8B 1BOGB 5F7KC 2C4XA 1OB1A 2NY1D 4J1UA 4LZ7A 3EXJA 4XBMA 2MHAA 4YHMH 4FFZA 5EUOB 2YRBA 1X7TA 4LHUD 2Z7UA 4W9LC 2F7BA 4X9TA 4D8OA 1HHJA 5JXEC 2FX7H 1SPIA 2HFGL 3C36A 1SYVB 2JJVA 1G5GA 1SJHB 1W72A 5EIIG 3F04A 5GGSY 5IB1A 3SDDB 3WJMB 5L8JB 1RKRA 1NBYB 1ILSA 4JUSA 5D7HA 1DLFH 3OQ3B 4FQLH 3BPCA 3UJIH 4N0FB 5HDBB 5LAXA 5A1AA 3N91A 2GCYB 4AYBA 4XP6H 4J5VA 3FO9A 4MF3A 2G60H 4YICA 3MV11 1JPFA 5D1ZD 5DRXB 2YD7A 4FHKA 3MGOB 4HGMA 4KJPC 4WJ5B 4OVJA 3VXMA 4DGIH 4HUWB 4U3XA 3TTNA 4X8XA 3CX2A 1EK3A 1OO2A 5D72H 4DKFH 5AWNL 2ZSWA 2J7LA 4FFZL 2B4CL 4X42A 3T2QA 5I8KL 1FFOA 1X9LA 2G0KA 4K3EL 3TVMC 4CILA 3FVKA 1HHIA 3L3JB 1X5IA 3MROB 4NYLA 4I18B 1OXYA 3RDTA 1YEEL 4A6YL 1KA0A 3JTBA 4Q97A 1A8JH 2GC7C 1N9PA 1YG9A 1ZLDA 3PGFH 5CBAA 2GITA 2LLGA 2WSDA 3T8MA 3RWGA 2D31B 3G3KA 5GZNC 1QEXA 3IFPB 4ETYA 3BIKB 2WYIA 2VXTH 4GQ9L 4G1MB 5E2UL 5ISZD 5K9OB 5EU7E 3VWKA 3CLFH 4K7PX 2CMOA 3MVZA 4PF6A 2P8PA 4AQAB 3G6AA 4FQHB 1S7YA 1SOQA 2WCPA 2Y1AA 1RUML 3NZ8B 2GVYA 1BX2A 2R2EB 3FTWA 4D0DB 2JCCE 2K9UA 2VLJA 4JG1L 4Q8BA 3OPUA 1JNJA 4L1BA 2UYFA 2ZUQC 3AACA 4TL5A 1N19A 4YMAA 1TT1A 2EEXA 5CLTA 2A5TA 3ZHKA 1YJDH 1A4KB 2BHZA 2DKMA 4ZO6A 3S36H 2V84A 3TPUA 1K9ZA 2EDEA 2W94A 3D33A 1AXSA 4YVUA 3V4PH 1FCKA 3MCG1 1HH9B 1JZIA 4UQDA 1HYRC 3HC4L 2XYCA 2LU3A 4A7QA 5MEOA 3IFOB 3VRLF 4LQ5A 4A6YH 1E5CA 1PVHA 1U91A 3F01A 1CWVA 5EA0L 1THAA 9CGTA 5J1AB 5EQ8A 1FFPA 1M71A 3RKDD 1DQDH 5IHZA 4DZBA 3DP4A 5FHBL 1CL7L 1B7ZA 1RIVH 3ZX1A 3QQ3A 2XZAH 2NYYD 1EPFA 5FB8B 3KPPA 4PLJC 1FO0A 1KXQA 3GJEA 1JW4A 4LKXB 4KQ4H 2OR8A 2O69A 3B56A 4GXVH 4F2MB 4JZOA 1OIBA 2YPLD 2ADFL 5ANME 2GK2A 3NPSB 5C0EA 1D6EA 1NH8A 1O9WA 1PEBA 2A6JB 2AQ1A 4FTVB 4HXBH 4NO0B 2R4SL 5FPIA 3GSUA 1FQEA 1CJYA 4U6XA 4WENB 1X3DA 4OFOA 4I5BB 3QMFA 4BINA 2QADD 1MXUA 5C09D 3HRZB 5GHWH 4HJGA 1YAZA 1JGUL 5FF6B 4YDKL 1B2WL 4E9WA 2VXSL 5BS0B 2BJMH 3PS6A 4MNQE 1JOIA 3O9WB 3ARBB 3VFWB 3O11A 5B3JE 3WNPA 5EBLA 1MQIA 3BW9A 5IMMB 3FVGA 2FH8A 2KZBA 4QCIB 3O2DL 1FBEA 4NRXB 1KPRB 2OYPA 2IQAA 5BRZE 3Q06A 2R29A 1PBYA 3MKKA 5FHBH 1UA7A 3NVQA 3O6HA 3HG4A 1GYCA 1M5DA 4GXUN 5ICZA 2M8XA 2J5WA 3SKNB 4FQHA 4KX7A 1NMBL 4LARL 3ZL4L 5JO5A 1JPSL 2PO6B 2XD3A 1HJBC 1EHLL 1KGIA 1AIFB 4IOIB 1CBVL 5TDNB 4N26A 1RJLB 5LNGA 2GIMA 5KG9A 1TR7A 1A6VH 1LO0L 2GTZA 1J1OL 2OX5B 2YXFA 2DQCH 3GUFA 1YHPA 4IIQC 4N13A 3UZVB 3K8LA 3PHOA 1A9EB 4M4RA 3OKKA 4J6RL 1KB5L 3VSTA 3LXCA 1T7ZA 2J5LB 4XH2A 4YDKH 1CUOA 1BQRA 1QFWL 1XX9C 2EECA 4OIIH 3OSQA 4DP7X 1RFDH 5I18L 3U2JA 1DEEB 2E4TA 1BXAA 1J0IA 3HTLX 4YK4C 3WS6A 3VI4B 1BQHB 3VD0A 3R8BB 3H9HA 4PG2A 1DBAL 1UVQA 2PPEA 3EGDA 4P2RB 4U1OA 2X41A 3NCJH 4MKMA 4BH8A 3RFZC 1RDZA 1R24A 3VLVA 4CBZA 1X5ZA 2FHBA 1QOKA 1P5UA 4MD4A 1TQBC 4PJDF 4HBQA 1ZS8A 1X9QA 4X9YA 2QMXA 2DJMA 1CXEA 1Y18B 4FQ1H 1SXAA 1L3NA 1V3KA 2L7QA 1MN4A 2LAGB 1Q90A 3FRPA 1A6VL 3P3UA 5BOJA 3BRDA 3RUGF 3FFCB 1KYOK 4WWKC 1RUQH 2QQKL 1ZJBA 4NBZB 5ET8A 4G7YL 5EFIB 4R4BA 3IL1B 5K59E 4X80H 2DIEA 1LO5A 1EAQA 1XL6A 3QARA 3DOIA 2VIRB 3K2UH 5GS1B 3MPLA 3FB8B 2J71A 1NEPA 5HHME 4AQEB 3HG2A 1NGQH 4JFDB 3DTDA 3OXRB 2O7IA 3SE4A 4R4FL 4QTIH 2DXYA 3SDCC 2ROXA 4YHOL 1IILE 5BS0E 3MLVL 3C5SB 4KTGA 3IU3A 1UWEH 3F84A 4QKTA 5DD3L 4X7EC 2J8OA 1PZ5A 2H4EA 3ILQC 1EWHA 4MNHB 3RTQA 5KSUB 1NAMH 4HF5H 4Z7OE 5BV7L 3MOBH 3DTUB 2H32A 4MCYA 4PJGA 4LP8A 3F8UB 4NZTL 1X5LA 3TTMA 4KMLB 3QS3A 5DRZA 1TU2B 2HQ0A 2XFXB 4ZDHA 3L5WA 1V10A 3KYNA 4L4VE 4DQAA 5K2YA 2APXA 2H2PD 2X4SB 1BEYH 1MJ7L 1TTAA 1WT5A 2AMUA 3B9KA 4PJXB 4OSUH 5EUKA 5I66A 4NF0A 3MRDA 4AS4A 5TTRA 5TK4A 4X9FA 1E4JA 3BIAX 2WZPA 4MHHI 1E28B 3RPBA 2WXOA 5D2NA 4R6HA 3KWVA 3KPRB 4J3WA 4PJHA 2GSIA 1JVYA 4KPHH 4N2NA 2NLJB 5AAMA 1EO8H 3KWTA 4PJBB 4P4RA 3MJ8B 4KKQA 1ETA1 3QUYC 5SWZD 1TCMA 2W88A 2VRKA 4O2EA 4PHXA 3GMLA 2EICA 3GFUA 4HAFA 3G08A 4LQ1A 1GZHC 4JDEA 4NQUA 1FZOA 3WS6C 3TBTB 2MEJB 1KXQE 2V3UA 1N18A 4DIXA 1C08B 3GSXA 4YOKA 3GHEH 4XKRA 3OKEB 1EEZB 3EOAB 3TELA 2ZQKA 3IDXH 3P4MB 4KOBA 2MNUA 2V3QA 3CFZA 5E94A 2CKBA 3MLYH 4C4KO 1CFSB 4Q4IA 5BXFB 4R74A 2XXXA 2H6OA 1RZKC 1OP3H 4ELOA 2DDQH 2O1LA 1T7YA 4JY4B 1RZIA 43CAA 3K71A 1EZOA 5JHDD 4UUJB 1HL9A 1U8JA 4PSPA 3P4MA 1DBJL 2MPAH 2ZCZA 4JX0A 4U1NA 3V9FA 4OTXL 1ZIUA 5T5NG 3SJVB 3M07A 4HH9B 2JIXA 1U58A 2H5UA 4DESA 4F15C 3W0WB 1BJ1H 1QFWH 3CDCA 1U3YA 2FX8H 1RL1A 2W60B 4I3GA 2EVHA 1LBXA 5CCJA 3HBZA 3LV0A 3O0RL 4LESA 3CG1A 4PRPD 1FPIA 4FI6A 2R7EB 4W6WB 1OEZW 3BUYA 2ZUWA 5HYJB 5A5XB 5C0ND 3T66A 1R5WA 4NQCA 2GQ1A 2VISA 1SRDA 3NCJL 2QVVA 1HNYA 3ARDC 3BXNA 3P02A 5C07B 2EH8H 2PO6A 3RNNA 1ZPUA 5LCVA 5GRJL 1MF2L 2ENJA 3THML 2JJTC 3L4CA 2R29L 4NQCE 1XVYA 5CEXB 3OSKA 2WLLA 4KCCA 1DO6A 3QQ3B 3RZCC 2BHUA 4F22A 1AGCA 3C5ZB 3H9SD 2PCPA 4P23D 2H6UA 4Z0XA 1DZ0A 3QG7L 4G2AA 2Q7AA 2WYPA 1O6VA 4OD3L 1OAKH 2BLFA 4PHZA 3IO4A 3K5SA 2NSQA 5I2IB 2DIBA 3DVGA 3N41F 4N9GB 5EO1A 5BV7B 1FN4B 4YU0A 1Q0XL 3IRZA 2WTOA 2P42B 3QIUA 3ZTJH 1XAUA 5CMAA 1CO1A 4K94H 1PKQE 1U6AL 4MMXB 4ODWB 1JHLL 2YAFA 2ZP9A 1SMOA 2OK0H 4CGUB 3IDNB 1KMGA 4FXGC 1ZDQA 1KGYE 2YAQA 4BJLA 3H6TA 5H37G 4NWUL 2V3DA 1OE2A 3N85L 4YXKL 4ZXBD 1KCSL 3EAKA 3RY4A 5KVMC 4Q9QL 5LXGH 3DETC 3QDJD 1RZ7H 3DIFB 4HS8H 5L2KE 4Q9BA 4JG0H 4NO2B 4PREA 1OT1A 5E4EC 1OMPA 5ILTH 3H6UA 2ZPKL 1SFHA 2B2XL 1Q72H 4F37F 3MOQA 3KSJA 4GF8A 2DD8H 1XF2A 2V2WA 4ZS6C 4CSPA 5I1KH 1R3IH 1RY7B 3FJ7A 4LSDA 2YUVA 3FSOA 5DEXB 3T8XA 3H0TA 2VDOL 4Z7WE 3B9VA 2YD1A 4XO4A 4APQA 3LNGA 3ULUE 1VADB 2CKNA 4DPBX 4AYEC 2WIMA 1TDQA 3VM7A 3TMGA 3HS9A 3VI4F 2OX3A 4NMYA 4PVNA 5T3ZD 1MCNA 4PMEA 4IBUA 5IZ3A 2IH9A 2DQFA 4A7GA 3CFQA 4HCIA 5DDHA 4JHUA 3JZYA 1Q9KB 4NN7B 5ABZA 3RN8A 1ASQA 5ICXB 2DQIL 4ILDA 1NC4D 2IBGA 2G30A 4I7ZC 1YEFH 2JQZA 1XSJA 4ZMLA 4BZYA 1BTJA 1AQMA 3W0WE 3VXCA 3A6BH 5EZOH 4X6BB 5GS3A 3J27A 4TPRL 2CJSA 1VPOL 4L4JA 2Z0BA 4ZK8A 3UYPA 3IVKB 4OGAC 4Y5YA 3GMPB 4AZ8B 5EZLB 4XGZA 5CJQH 3V5KA 2EDFA 4MJID 4B41A 4W9EC 1P0SE 3WY4A 1S46A 1ZLVK 2DDQL 1EXUA 2IAMD 5I1KL 1QI4A 3NEEA 2IAAC 2D31A 2WHVA 5CN3A 4XKNA 4Q0XL 2Y1VA 1F5WA 3MBWB 4YJZL 1T0KA 3RI5K 1CD1B 5FYJD 4UOZA 3CDFA 4GVOA 3GO1H 3WELA 1AR1D 1FNEA 5A6MA 4NKDA 3D1RA 3V0VA 3AC0A 2WLNA 3E9UA 1YYCA 3T9VA 1TJHL 1H19A 2CO2A 5EU3A 2L5VA 1FZMA 3OTTA 3VAEA 4Z95H 2BY2A 3PP3H 3RWCA 2EEAA 3Q6FA 4JRXD 3T4YA 3WL9B 5C0CA 4OZGE 4PJ5B 4J39A 4G68A 5JIIA 5D2NE 1VSOA 1GOHA 3O2DA 3MJGX 3LS4H 4WVRA 4PGCB 1KWKA 4Z3IA 2OMYB 1T22A 4GO8A 3FB8A 4WZ9A 2NNAB 4W9IC 3GLDA 3CSYB 1LNUB 2JKSA 3KL0A 3T77A 5KUKA 4FG2A 4M43H 1M5EA 5DEFA 1TIUA 1UFGA 2Y7LA 3CCHA 2AK1L 2GTZB 1IX2A 3DVNA 4U6VL 1NCIA 4F8NA 2OMYA 3VXBA 2FZ3B 2WGXA 1HHJB 3OZ9H 4JO3L 2OI9B 3SJVA 1LP9F 3MUUA 4JPWL 1SOXA 3A09A 4MCYB 2J57A 5IM7B 4FNUA 4Y5XA 3GJEB 4MYWB 5FOBB 1FNHA 3HS0C 4PVLA 4D3CL 2Q86B 4QR7A 3CXDH 3AY2A 3KDMA 3L5WB 4FFVC 5AZ2L 2AI0L 2Z93B 3V6ZA 1WITA 1HSLA 3P11L 3SGKC 1NUDA 2X9XA 4G6MH 1XD1A 4ZFOA 3ARYA 5L88H 1HX0A 3VGAC 5D1QD 3RVVC 3V6FB 5JDSB 5EU6E 5DS8B 1Z9SB 1QSZA 5GRUL 2NUPA 5ESVB 3WS3A 5MI0C 3ZE1F 3BX7C 1MAKA 5TE4H 2FL5A 1SEBA 3N85H 4DH2A 2WQAA 2G0LA 4C59B 1AS6A 1JGVL 1WA1X 4XAWH 3ZIMA 4JEGB 1JI1A 4YUEH 1GVCA 3KYOB 3DVIA 2EXYC 2QT6A 1FG2A 1UQSB 3ULUL 2OAAA 5H8NB 4NO5A 4ZX5A 3ZR5A 1YEGH 4ZFFB 1N4XH 3TAJA 2DWAA 2UWEB 5BOPA 1AC6A 4X7SL 1JGLH 1NANH 2K1MA 1RK1B 3WMSA 2EYRB 3IGAA 1MVUB 2OSLA 5ICYB 4I9WE 1OSPH 3FTZA 5DK2B 4ANUA 2TSAA 1GPOL 1TYJA 2AJ3B 2A6IB 2KKQA 2CUAA 4G82A 4PIRF 4QYOB 2YWYA 4N2LA 1SLXA 1BD2B 3LNIA 5IB4A 1YQVL 4YC2B 3L6FB 2E3VA 3RZCA 1BMZA 1JGEB 4ZW5A 4JM2A 1N6QL 2ZUVA 3NZUA 3RKDC 3OENA 3V8XB 4NHUA 5C2BH 5KVDE 1WCQA 1TZ8A 3CHGA 2IFFH 3FQTA 3L4XA 1BLNA 2C9PA 3GWJA 5G4NA 1JGUH 5T1LA 2VR3A 2R27A 1X6LA 1T21B 3FUDA 2BJML 3N2JA 1X5JA 4KKPA 4PTUB 4RQQA 4BSWA 3DLNA 1L0QA 1MCSA 1LB8A 4OJEH 5J1TC 1DVYA 2BNUB 2J2ZB 1PW3A 1KYAA 1L3WA 3HEIB 3OAUL 4QY8A 5DRNA 3T6QC 4GSDH 3V4LA 2VT5A 5I2NB 2GBTA 4HXAH 1SHXA 2W8CA 3FCGA 4LKXA 1MLCA 3JV9A 1O75A 2F7PA 5DYHA 4XXDA 5ICXA 2ZMBA 3MRIB 4HCGA 4TVPH 3FYEB 4QNPF 4U1MB 3CDZA 4UA8A 3AT8A 3MLSL 4BCYA 5T3XH 1Z7NE 4WU7B 5EYHA 4N8VA 3RVWC 4OCXH 3MPKA 1CR9H 2K3HA 4A39A 3APMA 2R2HB 3IU4L 3VGEA 4H8IA 1SJMA 5KVDH 3WTVA 4HBCH 5D7KD 3H7MA 2YD2A 1JN6A 1Y0LB 2ICWI 1S7UA 3QXMA 1YNTB 2WQSA 3ZSTA 1O6SA 1UUSA 4PWFA 3ARZA 3OGCB 2I9TA 7FABH 3MR9B 1HCZA 2DTSA 3CHSA 4HK3J 3TH2T 3BW9B 3RTQD 1MXYA 4JM4H 4ZFGL 3RVUD 5JEIA 2KPNA 3C6LC 3ATFA 3GSOA 3OZ9L 4ZD3L 1G84A 5EQ9A 3D0AA 3QT2A 5K39A 3RWDA 2X4OB 4AW4A 2ZJSH 3PV0E 1AGBA 4JJ5B 4WUUB 2WLIA 3IDMB 2JI1A 5I0VA 4TQEL 2HN7A 3MV8B 3NJHA 4NF5B 4AYFB 1IE5A 5LGYA 3L45A 1B40A 4HJTA 3WLWD 4WFFD 2QSTA 3VFVB 2VR7A 3OB0K 1QHPA 4UF7C 1U91B 2C1OA 4A37A 4UDTA 2VLMD 4JL1A 5I66B 4ELMB 1VEPA 1BQ5A 2X2UA 1MHHA 1W72H 4NCC1 5F6HI 3GSNL 1N84A 5D7IE 2YJLA 3IGFA 2NTSP 2NDFA 4M1GH 1CT8B 3MWBA 1A5FL 3OD7A 3CAFA 1K4DA 1E6OH 4B9JA 1EHKB 2OMZA 7FABL 3MP1A 2CR6A 3E80A 1IGTA 2O5ZL 3Q6GH 4G8GD 5I8KH 4PJDE 3F5WA 3QUXB 4OKVB 5IBTH 3KPSA 1HH9A 1UD4A 4XVSL 3AY4A 5LAXB 4LDEB 2ESVD 3F00A 3MXWH 2XN1A 3NFSH 2WBWB 5E5MB 3KZ8A 2R69H 2YAEA 2WBJA 3L5JA 1DTUA 4OFIA 4BK5C 2AXFB 1S7XA 3VFRB 1S4IA 2ZOUA 1WG3A 3HC3H 4NO3B 5FK9B 3CLFL 4L3EA 3UOAB 3O29A 4I0KA 4WW1B 1XGRB 3US0A 3BJLA 2O72A 4Y5VC 3UTTD 4IK6A 3IDYC 1ZAGA 2BRRH 3SCMC 3ZTNL 5IP4A 5KYYA 3SDCD 4F2MA 4Z7UB 1DQIA 1JWMA 1OAXH 1IAKB 3M45A 4BKLA 1NFDB 5T3XE 3TJHC 1N0XL 1SVXB 4LMQE 1UH2A 3FH8A 3SQBB 2NY2C 1U8QA 4H0LC 4O3CA 3P73A 3MRCB 4ZMPA 4GBXA 2AJSL 3C6LB 3L3OC 2R0LL 1QR4A 4LSPL 2WN2A 1EQWA 4I8DA 1PAZA 1PSKL 3ULVH 5TH2B 1FTJA 3PMWA 3I75A 4IGBC 2UVGA 4AOFA 1BVLA 1PX8A 2ZCHL 5JOEA 2DWEB 5J16A 3MRMA 3QIUC 1NQBA 3MXWL 4XI5C 3D69B 1JNNH 3UPAA 4F5CE 1BBJA 4UT6H 3Q5TA 1EFXD 2VW7A 4ZUWA 3MRHA 3U94A 3HE7A 4LPVA 4HIQA 3B2UC 3IOTA 4FA8A 3B9KC 5T8IA 4NX0A 1ZTXL 4U4XA 5DHYA 1GGIH 4PIBA 4PQJA 1D6VH 3D39B 4P0IA 1OB1B 5CSBA 2Q76A 4NNPH 1AOVA 2WYZA 3PHSA 3TPAA 5F93C 5D1QB 1TEYA 1II4E 3EDEA 4XVJL 1VFBA 5E8DH 5KSBA 1M71B 3KM2A 5KANG 3RT8A 4BGLA 1BXUA 3OXNA 2X89A 4JO4L 5DHYB 2AJSH 1A99A 1OKEA 3I85A 1JERA 1MDAA 2JNZA 2O5XL 3DUUB 1FORH 2GK0B 2PP8A 1T1XB 1SPDA 4V1DE 3CFKB 2GJRA 2Z8DA 2W7YA 4PCDA 4MNGE 1NFDE 1ZD6A 1BDYA 3ETTA 5KYUA 5BV7C 1XGQB 3CVGA 5CBSA 4HA1A 3I3VA 1HINH 1VF5C 2ORBH 3LXAA 2COVD 3LKOB 3X11B 2QPQA 1CICC 2IF7A 1M6OB 3NESA 4OV6F 5FO9A 3S3DB 3CFKA 4XB7A 2B65A 3WD5L 5B1KA 2HX9A 4O02H 3T3PE 1JPGA 1Z32X 2EINB 3CVHB 2D2OA 1ZVHA 5D1QC 1D6VL 3CH1A 2EDRA 1XGYL 4HS3A 3PPOA 3BZFB 4MVBD 1TZHB 1UHVA 1XGPA 4K3FA 1JPTH 1KIUA 2E9BA 3DURB 1MFBH 5KZCB 2EUWA 6PCYA 1UB5B 1TYEB 4LHJB 2GITB 3BRFA 4X4MA 1HCYA 3IJHA 4E5XB 2VXQH 4PGDA 5ES4B 2OULB 2YD3A 1DSNA 4KO5A 3SDAA 1LBBA 4JVPA 2DYXA 3M3KA 4QRRD 5GRVK 3JZ7A 3ARRA 3AU1A 5F89A 3L3OA 3QFJE 1ZA3A 4NG7A 4MAYC 3FU7B 5DUMH 5IW6A 4Y2OA 3OD3A 1HXYA 3CJJA 5KYWA 4PP1D 3S8WA 2VLME 1NNKA 4M6MH 4PP2A 3VXRE 2E0PA 1MHCA 1T89C 4C1UA 3NFPA 1S9TA 3EHBD 3PV6B 4PWIA 1XR9B 4P2RD 4B3EA 2M8CA 2QVUA 1S7WB 3L3IA 5ESAB 5IOPA 3UACA 5BRQA 4P3LA 2FWUA 1IGJA 3WGUB 3IXAB 1SNRA 3L7FA 3IBEA 3I6GB 4MA8H 1SD3A 1J86A 4QXGH 4U31A 3MRIA 2JVUA 1LLAA 3F7QA 5K9KA 3B2VL 3LZOA 1VJSA 1MXGA 2I9LB 3D39E 2XG4B 2YHGA 2R0LH 3WKNA 3FHAA 4M8QA 4WHTB 3MPCA 4MCNA 3GD1C 1NIAA 2BY3A 3K0VA 3FTSA 3PJSA 5F7MC 4S0HA 1RK1A 4OLXL 3NZHL 3FQ4A 5CEZL 4ODXB 5KYXA 3B8SA 1FPGA 1J9CT 1GYVA 3LSLA 3MVWA 2K6WA 2XZCL 3FPYA 4X8CA 4ERSL 2YBRB 4R97C 5JHMA 2EKJA 4HKBA 3T0EA 4ZS9A 2C4FT 4JKLA 3VI3A 2FLMA 5D9SA 3MJWA 5AA2A 3VFMA 5EF2A 4I0PA 4Q58C 3Q2NA 3GSOB 3L9RA 1O6TA 4TLSA 4A63A 4NF4A 3SESA 2VDNH 3PWPA 4BH7A 4QD2E 4X4ME 4Q5TA 3S4UA 2C9SA 4JM2B 4JQIA 3G7WA 5AVSB 4KJYB 5SWSE 4K73A 1LCFA 2FK9A 4HKXA 3I9PA 4DSYA 4KVNL 1M7IB 5D5MA 1F3JB 2NX5A 4TOYL 5D7SL 1WEJH 2R2EA 4IQHA 4TUJB 3RVTC 3VX1A 1B0WA 3M3FA 2VRAA 3UTSE 3ZMRA 2Q86A 1DVFD 1KB3A 1KBPA 4ZDMA 2XQ0A 2O6DA 2XQBL 1M7DA 3ZJAA 4GO6B 1ZANL 5B8CC 3IX1A 4JS7A 4ABUA 3SDDA 5KZCD 5DRNB 5I2NA 3SCMA 3I02B 5G5DA 3QDMA 5BQ7B 3EJSA 2LLLA 3LQAH 3CFIC 2Z8WC 3D12B 5CP7B 4HFUH 4N24A 1E2WA 2P1YA 4G59C 4AI7A 3DO7B 3CXHK 3LTVA 5EEVA 1OLCA 1ZJAA 5D5MF 4K3DH 1BFVL 3QJFA 2IQ9L 5EU4A 4DW2L 5SWZB 3PV6A 1WUZA 4FFYH 5T1DH 5D2LF 4PGEA 4G8GA 1O7TA 1H0DB 2DYRB 3Q8EA 1DJXA 4FQ2H 5HI4D 3JVFC 1WAEA 3F58H 4NB7A 5J89A 5GGQH 2UZYB 2VC2B 1PY4A 4JO3H 5CHNB 3ZTJG 1YNTA 3NYKA 4YLBA 3QC5X 5D7SH 4DP9X 5FECB 5H8HB 2UX7A 1SF5A 2D0HA 4G8MA 3ES6A 2R4RH 2D9CA 4UU9A 3GZOA 2FBOJ 1JWMB 5E8PA 3QRGH 4E9TA 5JHDB 1ONQA 3SDXF 3T04D 5EHMA 1QLFB 3KLAA 4FNSA 2GABA 3K4AA 3WEAA 2NRDA 3VRJB 1JGDB 4UM8A 1IM3B 4R7DA 4E9SA 4LLYA 1A66A 4F15B 3E1F1 4NQDD 1YNLL 3DMMA 1PQZA 3OMAB 3BP5A 4TTGA 1PZ3A 3ISYA 2J55A 5B4MD 1UUNA 3BYYA 2EQDA 3T0EC 2XVBA 1EXHA 4GRWE 2VD3A 3BDXA 1KBKA 1SYIA 3MUZ1 4BFIA 2UXTA 3SDXA 1CD0A 2RR3A 2GBVA 2DWEA 3X1EA 2NT1A 3QWOB 4JN1L 1CYWA 3O9WD 2PFYA 3QWRD 2NY2D 4DZ1A 3DIDA 3BZEA 3BDBA 4LLQB 3H7BB 4G80B 4CDGC 3MZTA 4R6KA 4MZIA 4QYAA 5BVPL 1RZJC 4CC1A 2C26A 4FG6C 2ANJA 5IGAA 2ZOLB 3QJOA 3OKOB 4GAJL 1NNPA 5AOKA 2F34A 3VG0L 4HVBA 4PC9A 3UDWC 4GXSB 1RULL 1KJMA 3GLZA 3TBSB 2BK8A 2YQ2A 4Y2NA 1S5HA 2EXWC 1GJIA 4P1EA 2Q8JA 1ECYA 1I7TA 3T1FA 1B3FA 1XEDA 5FIEA 1ZSDB 4QTFA 3WNKA 2W9DH 4IDLA 3K6FA 4U1ZA 5E4OA 4R97B 5C07E 4R83A 3T2NH 3EDFA 1FYHB 3T0EE 3T08A 3TN0A 2FH6A 1B5JA 2X6MA 2XXHA 3OEKA 1B58A 2GHBA 3L4UA 1KTDA 1B0LA 4NSKA 2B2XH 5TU0A 2MKZA 1J11A 5KWYC 3RI5F 4WEDA 4N8CH 2YIHA 3Q6FB 4HHWA 2XV2A 3R7RA 2H4IA 2FHFA 3NSYA 1QO3A 4MAYA 4XMUA 4R5TA 3IK2A 4DK6A 2YOAA 1PCSA 2VDOH 5D4IA 3BYTA 1YPZB 1E42A 4ZMVA 5JDJA 2CEXA 1JE6A 4NRYA 4RZKA 2AJVH 2ZXBA 1DVSA 2XWKA 2JLPA 1KTLB 2XXUA 3ARFC 2ENYA 5IQ7H 1F4XH 4Z7WB 5IB4B 2EEBA 1CD8A 2YPLA 5DJAB 3F11A 2BIHA 3NACH 3RUMA 1DJWA 4D9LL 3ZO9A 3WIIH 1DQML 5AVZB 1CFSA 4G2ZA 2X7PA 2R23A 1MIEH 4DEPC 2GJ6E 4YZZA 4C1TA 1J87A 2HLFC 4JKNA 1NPNA 3KSXA 4G68C 2VDKH 3VXSD 4QRSA 5L4JA 3VGBA 5DFWH 3PPNA 5TGBB 2OMTB 4P3WA 2GHZA 3ARSA 5GGTH 2EZ0D 3OHMB 2HCAA 1RURL 2ZKYA 2VZTA 3LIZA 2X2JA 4NJAH 5FGCB 3VACA 1C8PA 1WV7T 3QORD 2OYLA 1FVDB 4GXUM 5CWSA 5AW7B 5JR1H 1G6RL 2MRYA 3B2MA 2V8LA 1HZHL 1MHCB 2FE0A 3OHXA 4PB0H 2AHIA 1ELJA 3LEYL 5IEKB 3EN3A 1RYOA 3HBPA 3W39A 2E6JA 4X5RA 3FB6B 1QNIA 4GG6A 1NEUA 1UXSA 3GC3A 3G3JA 2EDOA 3ECBB 3X1GA 4UTBH 4AH2B 1EAPB 3C5JB 3VXNB 1EBAA 4Z7NF 2CUMA 5IKBA 1MCEA 2WK2A 3U1PA 2YAHA 4R26H 1CBJA 1TITA 5FYJH 2C9UA 4UBDD 1WDNA 4GJTB 3CHPA 5KSAD 3ABLB 1ZHKA 5CJXA 3B1TA 5EU5A 2H0JA 1RLWA 3ULVC 4PFTA 4LQFL 5DMKA 1CYXA 2Y25A 1T6BX 3CZNA 2BP3A 3CPLA 3IGKA 2X87A 4BZ2A 2NY4B 5AE4A 3GI9L 5HGAA 2C7UB 2Y23A 3AQXA 2CR0A 1UQSA 4TQPA 4X6CA 5F9WC 3KXFE 1YEWA 4OW6A 3SSGA 1KPUA 3T0EB 1FPJA 3VVFA 1U8KB 2A9CA 1EGJH 2NXOA 4H2AA 3KLHD 1Q94A 4YR6A 1AIZA 2X89D 2UVIA 3O66A 3BO8A 3F7YB 1B0GB 2CBMA 3RWFA 5D8JH 5L2KD 4IW4C 4E0WA 3N6UA 4HEME 4MXWH 3Q0HA 2CU9A 1E2ZA 4EOWL 4U6YA 4WUUE 4EF1A 3EGSA 4J23A 2EE6A 1D2PA 5HY9A 2WANA 3SO3C 2DI7A 2F19H 5KTEH 3W2DL 2FEJA 4FNPA 2OZ4H 3K72A 4AQ8C 3KG2A 3EGDB 1U0QA 4LNRB 2WWMC 2VR4A 1I4FB 3RBSA 2QLVB 2UXVA 3SOTA 3LV3A 2F8XC 4FQQA 4X7SH 5CR1A 1ZEAL 3NJLA 4RFEB 2GH9A 1RD6A 3TJHD 3BHBB 3HCVA 4BFOA 1ZGLP 5IM2A 3H9YA 1CFBA 3GRBA 4KKLC 4IKLA 4NNYB 1R1NA 2BFVH 2CPUA 3KJ6L 1NCUA 2D4DA 3FQWB 3MGTA 4DHLA 5AUMA 4DETA 1F4XL 5IQ7L 1LHZA 2BNRD 5D8JL 5EIIA 1F4AA 4F1YA 2EDTA 4GO9A 5EFIA 5F88A 1LWRA 2FHCA 3GJFA 4ANWA 3DYPA 3Q44A 1KN2H 4F2ME 3SEYA 3QIUB 4HOZA 1QEWB 4KQ3H 1N2RA 4YHZL 3KHQA 1BVOA 2QJDA 4NKOB 3QGVA 1ZHKB 3GF8A 2C9QA 2P7TA 5DCCA 2R6GE 4DIGA 3FH7A 4UU9B 4P49A 3APCA 1RZIB 1LBYA 4PJ8D 5B1BB 3EHTA 4GLRI 1SQYA 1N2RB 3S9LC 1A22B 3O28A 5CD3B 2AJ3A 4FFZH 1HHKB 2J88L 2RIKA 3D5OF 4MZ2A 4NQDE 1R3KB 5HI4C 2P7TB 3ZTEA 5B3NA 2NY3B 1VDWA 3QEQD 4YDIL 4NE4A 1S9XB 4NRYB 1S7VA 4LLWA 4PJ9A 3BO8B 3F7YA 4EVNB 4XNZC 4HPOL 2DI8A 3A4FA 1TVDA 4S10A 3HN5A 4HWUA 4OT1L 1Y3PA 3THIA 3ILDA 4L23A 2NNXA 3MUJA 2VDMH 3PDOB 1OQGA 1CGTA 5T3ZE 1XXFC 3SHSA 4Y1AB 5A6LA 4KYSA 2WXHA 3SKOB 2IPKA 3IDIB 3CVIL 5F7YC 1F56A 1VFAA 2VZ1A 5ITOA 4KQ3L 3QXAA 4YHZH 3U1SH 5DO2D 1T1ZA 2VN6A 4NCC2 1KV3A 1ADWA 3TZVD 5I1DB 3CN1A 1FRPA 1J0KA 1U3HD 1XBDA 3OGOE 2QHRL 2VUKA 4RA1A 3JYBA 3D18A 3FCUB 3VWJB 4P47A 1OCRB 3LKNA 4FNLH 4FJZA 3BQUA 3GSRB 4HPYL 5FOBA 2UZYA 1YNKH 5AKRA 4LDLB 3JV5A 2AV7B 1EEZA 3PREA 4BDMA 1L9SA 3BGFB 2CIIB 4I48B 2EDHA 3DK0A 1QKZL 1IC4H 4UT9H 1LP9A 1FTAA 4IRJA 1EXGA 3LRHA 2X2IA 1G0IA 2WVVA 1WZ1H 1SUHA 3WUWA 2ZYIA 5L2JB 1QULA 1CYGA 2XKNA 4UM9D 1TKWB 5D7LD 5FUZL 4NAPA 2Q6WB 1GV8A 4UQ2B 5C0CB 4Q6IA 1PAMA 1I9IH 4GIPD 2B14A 5KTEL 5FM8A 3AWEA 1IBGH 1XIWB 4MRCA 5E9DE 4GMTL 4HWNA 4EEEA 3BKCH 3P3RA 1ZWIB 4P5RA 5E9DA 3TVMB 3TZAA 3L3HB 4I18C 1QX1A 5GHWL 3ABZA 3RB5A 2N01B 1YNKL 4KJWD 5HHMB 5IZ1A 1HSEA 5FDWA 4GRMA 2X1PA 3T65B 2RC9A 3BAXA 3HPJB 4NBXB 4WHDA 4LLQA 1CFTA 3JV4B 2Q5BA 3U4BL 1WIOA 2P3VA 2CMRL 1PDKA 3O2DH 4PP2B 4RRPA 2PP7A 5SWZA 4PS8A 1A4KA 4JRXB 4KKRA 4LCUB 4Y1AA 4LN5A 1BQHA 3N1GC 3B5TA 2DDKA 5FAAA 1YAIA 1LLSA 1TSHA 1PB7A 5BWJA 5GGVL 4K9EC 5DF0A 5HHXL 3LMJH 5DHDA 3FTUA 2IBZY 4WTXA 3O8XC 3J8F7 3QEGL 3B7DA 4Y1AE 3PHOB 5F7FA 1L0XA 4POYA 2YA2A 4RDQF 5LDSA 3R0NA 1WAAF 4P2YA 3KGUA 4W4NA 5C08A 3RJQB 4PJEF 4XP9L 5E99H 5JXED 4XMKH 5CCKL 1JPEA 4UINL 1WA0X 4ZEIA 4PFEA 2YD4A 1VGEH 3U6XS 4S2SB 2J88H 3KBFA 1OZTG 1JZDC 1YYMH 2IADA 3FCBA 4OCWL 1AHWC 3ULVL 5JHLA 1CFQA 4PG2C 4HPOH 3RVTD 4PDDA 4H4NA 3SE4C 2H9GB 3VDAA 1DZBA 1IJNA 3LNFA 4I0PB 1V3JA 3MJ7B 4NS0A 4Z3GA 3VRIB 3HRZA 5E23A 2YPLB 1TPXB 3WEMA 7CGTA 4IEFA 2JTYA 1KGCD 4KJYA 4R6UA 3GSNA 1FP5A 4PJEA 1O6SB 5DO8A 4NUMA 4EBQH 2F78A 3DV6B 4EQ9A 4ISVB 2CIKB 1JCVA 1FGVL 4LP2B 4UTAA 2AF2A 1I3RA 1NSNL 4NUJB 4OJYA 3F7PC 2FRGP 2VRQA 3QP3A 2WYHA 3QWQB 4IKNA 5KBNC 3WXVL 5TQ0L 5K9OA 3DKHA 2XTJE 4GI8A 2NTFA 1WSST 3GHBL 5E6YA 4XOEA 1G1YA 3K8KA 4RVBA 1DR9A 4KXCA 3SCMB 5GGRA 5BO1L 1US5A 2JE8A 3O6LL 3UO8B 2MSPA 1W6LA 5MI0B 3SE6A 5K9QG 3V6OA 1I6BA 1PZ5B 1A14H 2BNUA 2J2ZA 3N43F 3TJPA 3L1OL 2WVTA 3QR1A 4Y4HD 1N0TA 2FLBT 2R9HD 3HNTH 5DJXA 4N6QA 3AU0A 1I3GL 3T6ZA 2BOBB 3HZKB 2BWQA 5C2UB 3FB7A 1WGOA 1WZ1L 3B2DC 5HYEA 2JCCF 1N10A 1WFJA 3MNVB 5T33H 2ENPA 2DQ6A 2VCOA 5JOPD 3AG3B 2OK2A 2BERA 2FWOB 1FNGA 1CXLA 1RUMH 1XGYH 2DMBA 3QNXB 1BW8A 2W80C 2QPEB 4K55A 3GSVA 4JFZH 4M3KB 1DQJB 3RT6B 3KPRE 4Q74A 3UPRA 4DUVA 2VZUA 1HQ4B 4X6DB 4K5LA 3NA9L 4PGCA 4HCRL 5CR8A 1F6AA 1HWGB 4K3JH 2ARJA 4EF3A 5CP3H 4FGMA 1QUIA 5DXWA 4YE4L 5EZJA 3WMQA 3LN5A 1K3ZA 1T1YB 2H47C 3TA3C 4BQ6A 4X4KA 1ZOXA 3BWZA 3LXUX 3L1OH 5CBRA 3WJLC 2WXPA 5HDBF 1OALA 4B0MB 4QRUA 2AQTA 3OKLB 4M6ML 4UOW0 4F37K 3VFNA 2A6DB 3K6NA 5JK4A 2X0UA 5TE7H 1NPJA 4LLMA 2ZYNA 1N3WA 4HEMA 4PG9B 2XXRA 2A3TA 5CWSB 2I5YL 3Q29A 2A83B 2OS7A 1AZZC 4JFVA 3X1BA 2JKJA 3VFNB 4ZFOB 4AGLA 4JFDD 4CSZA 1I85C 3MRNA 3QJSB 3ZSSA 4AIZA 5M94B 3BH8A 3WFZA 2XN0A 3HV1A 1MQKL 2XUWA 3IDGB 1MHEB 4H25B 1NV0A 2ZYHA 1QLEL 1DN0A 3MCYA 4Q2ZB 1K6QH 1TQVA 3D3VE 4J3OF 5CNHA 3FC8A 3ZL2A 2DXRA 2F5BH 1MXVA 1ZSDA 3P0YL 4U1LA 4XOAA 2HMID 2WV3A 1GIGH 3S3PA 5FB8A 1DL7L 2BIPA 2PPAA 4NUGL 5BQ7A 4QFLA 3OKNB 3C2SA 5F9WB 4A2EA 1XTLA 3K6SA 1OL0A 3D4CA 1LSTA 2E7CA 3FQ1A 1XI6A 2GHAA 4L3AA 2X70B 1WYJA 2Y5QA 4N91A 4L4TA 1UCBL 1P4IL 1C7TA 2Z8RA 2KT6A 3N94A 4GQZA 4HXVA 3AS2A 1WH0A 1Q1KA 1EHLH 1CBVH 3KW7A 1RSYA 1ET5A 1BKAA 2MCPH 1QSFE 2CO4A 5I75C 5DUPH 4N3TA 1GA2A 2I27N 1OW0A 3VO0A 1AMFA 4TSCL 4NPYA 3HW7A 5LN4A 5D2LA 4LCIH 1GZQB 2Y6SC 1H8SA 4LASL 4IDJL 5ID1B 4M1DL 4Z0IA 3P0YH 3R06B 4XN4A 1FC2D 4KZCA 4U3SB 4EI5A 1S7TB 2QS2A 3TEZA 3O6FA 2AQRA 2XACC 5F7DB 3G6JA 3WNMA 5LWYH 3ZYZA 4ZMXA 4AXWB 4KBPA 4K3DL 1BFVH 5JQHC 5DD6B 4IOSD 4U49A 1Y9UA 3UJJL 2VB5A 2WBDA 5JO5B 1ZA6A 1T83A 3OPZH 2F7QA 3ESOA 1DFXA 3TEYA 3D08A 2UVEA 3D3VB 1B5IA 2GTQA 1WC7A 3LQMA 2BNRA 5K59F 4ZUWB 2OMXB 3RIKA 5JOFB 4XXUA 4PRAA 2JKRM 3AUVA 2R56H 4DZ8B 3RY5A 2F54A 3SDXB 1FNLA 3GPEA 4G5ZH 3QIBD 4U7MA 1UXSB 5I3SA 1TJIH 4UOQA 5F7BA 3CLEH 1CFVL 2X4UB 3ARUA 3WIHL 2G93A 1E3FA 3TBYB 4J4PA 3U4EA 4RGMC 4AM0A 4IU3A 1Q35A 3WAFA 5DT6A 3TUSA 4WEBL 5HDQH 4JY6A 2BINA 2QELA 3DX6B 1P1ZB 2JI3A 3FCSB 4OZHA 4PW9A 3H3PL 4QTIL 5CILH 4YPGB 5AW2B 5GISL 2NT0A 3KLHC 1NUNB 4BDRA 4DI4B 2XPYA 5LNDA 5FFOA 4EZKA 2CZKA 3E3QC 2J20A 3TX4A 5B8CB 1TZGH 4XC3H 5JXEA 1N8OE 4FQIH 4MD0B 2RKMA 4IU3B 4RGNB 4UQ3A 4CN4A 1J1PL 3QAXA 1IVLA 3QJHA 4AEHL 2ZXEB 3ES6B 3SBPA 4DQOL 1EZSA 2V2TB 3TONA 2B8OT 5F6IB 3ZDYB 5CJQL 4UACA 1HXMA 3OKYA 4OD1L 1QUPA 3RFZB 4Z8FH 1SN0A 1WIPA 2OCUA 4A66A 4G5ZL 3IPBA 1BEYL 2BNQE 4OZHF 3A67H 2ONKE 2J1WA 3L16A 4WTZG 1A6WH 1QSFB 3EFOA 4JBSA 3BEVB 4V1DD 3ZKSD 5EULV 1MZZA 3RPWA 1CTOA 4N3UA 5KS9E 2CSPA 1KN2L 4PU2A 2KLTA 1N3NB 3PAUA 3NJFA 2X6AA 2F5BL 1U41A 4K5PA 4UILL 4DE8A 5L9SA 2FSEA 4NZUL 4X5WB 4RMQA 3UBFA 3AG1B 2Q9OA 2F61A 3ECQA 3LVTA 4HYTB 3ABGA 5CKGA 3V6ZB 1E9QA 3QZPA 2DQTL 2H26A 4OLWL 5EF0A 3VWJA 3VD1A 3TEUA 3O3DB 3VE0B 3AQYA 4P2QA 4XWGL 3O6KH 4KZDL 3OQRA 2XWZA 3GMOB 5C92A 4DP5X 4OLYL 4HV8A 1BIIA 1JZHA 1KGXA 4H40A 3HN0A 2PXYC 4LLDB 5A2BA 2IDUA 4ZDHB 1S7RA 4Z5RB 5FK9A 1S9YA 3QNYA 4HT1L 1EGJA 4RMUA 5DS2A 4PWKA 1WBXA 4EMZA 5HPOA 5K1JA 2A73B 2WY3B 3TURA 1FE8L 5D7LA 3MJNA 3QDGB 3P2BA 2HJLB 4QRRB 4F24A 1CICB 2VLKE 4IOFD 5EEZA 3KPMB 1EEYB 4PWHA 4HULB 3U1OA 1FBIL 1IGIL 3D9AL 4YGVA 3RWJA 2HFGH 5DWUH 3SDXE 5HYQA 1P6AB 4FMFA 3NJKA 1QG3A 4J3OC 2WO2B 4QRPE 5HVFB 1AIVA 1I31A 4XX1E 5DS8A 3BI9X 3QZNA 4V33A 4B9PA 2P48B 4R7XA 5C97A 1ACYH 2JMRA 5F1NB 1L6PA 5AL0A 1BM3L 4N0YH 5IT2L 1FNAA 2QVKA 1W0YT 4XP6L 5HYSG 4F2QA 2OXHB 3KS0H 5DJCB 3S37H 3RRQA 2O1AA 4Y4HC 4C56B 1ZWIA 2ED8A 4MS8C 2VIRA 5CBEA 4RLDA 3OAYK 4TSBL 1ZBMA 3U36B 1DBKH 3BPOC 3MC2A 3HG1E 3O6KL 2F9BT 3OO6A 4YHKH 3PWVA 4KWUA 4N5UA 4WHYG 5KS9B 3U6RB 5GGTL 3VCLA 2BVTA 3MV8A 3ZGIA 4YB7A 4RGNE 1N67A 5DO2C 3N44B 2BOLA 3EYQD 1JVLA 4OFQA 5DK2A 2EXTA 1TVBA 3HE6C 3Q05A 3U36A 3RPIA 1MEXL 5DFVD 5H8SA 1JS4A 4CN1A 3BWAB 4Z18A 1BD2E 4OD3H 3ARFA 4NLHA 2PYFB 3SGDI 1NCBL 3NRQA 2EDQA 4B3VA 1JZ2A 3HUJA 3KPLA 1F8TH 4X6CF 1GGUA 3LNDA 3L3DB 4OLEA 1JNFA 3GKZA 1EDYA 1NCDH 3QEQA 1J1XL 1RK0A 4HC1A 1ZT4A 5EIQA 4IRZL 5AOZA 1L5GB 1JPFB 1YQVH 1EVUA 1LFGA 2JFCA 1DSFL 4E41E 5C0DB 1QKBA 1AL3A 1UH3A 1FFTB 2P5EB 4Z6AT 5JMRA 1SW5A 2X0VA 4IYKA 3HZ3A 2C3GA 4HUUB 1AHWB 3ARBC 4JDVA 1J1PH 1RZJL 4GIOA 1DBKL 1F6FB 1K4CB 5IBUB 1ZK5A 3EOTH 1PX4A 4H2CA 4ZAKB 5LDZA 3MBXH 4FEMA 4GNKB 4DQOH 3TN0D 1SJHA 1NIBA 1W72B 1XQ4A 2W9EL 4IIQB 4N5ED 3OKNA 5IB1B 1B4ZA 1SHWA 1MW1A 4JFPA 1R0AL 3HFFA 3EJZD 4BZ2L 3ZRCC 1OPOA 3VB9A 4Z8FL 2D03L 1NFAA 3EKCA 3JTSA 4QWWC 5ALCH 5DQJB 2NY4D 5KYYB 1FBPA 2O4EA 3CVDA 1H8OA 1QBAA 2MQ0A 3H03A 1HEHC 4UNVA 3NH7L 3PUCA 4XNYH 1OAZH 4CRPA 3KEIA 3VFTB 4DLDA 5TDOB 3F7VA 3MNZB 1NNFA 4M00A 1QPPA 3LZNA 4H5SB 1GGCH 1XV8A 1BAWA 3PWPE 5I6XC 4FIMA 3CFBB 5CMCA 1MCJA 5DTFB 1FFNB 1L9PA 3I9GH 3RGHA 3H6WA 3EJJX 3MJ9H 1BYNA 1IGCH 3BVVA 5F7EH 2VE6B 3M1BB 1OOAA 3RHWK 1FNEB 4G8AC 2JJSA 2FECI 4X98A 2VQ4A 4Y19A 1U8PB 3FSAA 4B6ZA 4EAEA 1MFDH 4KZDH 3JWOC 5JHAA 3O3UN 3SGJA 2JIXD 3L3GB 2C4FU 4C56D 2XWJB 5C0CE 1CT8A 3CIQA 3R26A 2N59A 4TVSa 1B3JA 1MLBA 3CXHJ 1YYML 4U1GC 4OCWH 1ZEAH 4XX1G 3MBPA 1U8HB 4X8GA 4A67A 4ODHH 4B60A 1IO4C 4TYUA 4UV4H 4UT7L 3C6SA 2H8PB 3U2IA 5EBWA 1P7QD 1IGIH 3KJ6H 3DO4A 2WMPA 2Y6SD 1URLA 3TYHA 4BDOA 3KVPA 4HUVA 2V93A 5D6DC 3GO1L 5GRYA 3S96A 4PTUA 4BSWB 1FJ6A 2AJUL 4GUCA 2WBJB 1AO7A 5JPNA 4W6XB 2NZ9D 1DOTA 3UYPB 1PPIA 2HPOA 2EUXA 5TPWH 2H6PB 3FQNA 1F1DA 5FV2A 3VXUA 3LJ3A 4N9GA 1I82A 5EG6C 5D1QE 3T3PF 3KVDD 4KK6D 3CMOH 4PBQA 3TNNA 5ALBL 5IMLA 3QYMA 1JSYA 1Q9LA 4Y4KB 1X4YA 3CG3A 2KUTA 4RGND 4XPHH 5IHWA 5FHNA 1E27B 1ZVNA 4MJHA 3NN8B 4JCLA 3HRZC 3V5AA 3SY6A 5ITFA 3AXIA 1LVEA 1O9ZA 4K7PY 4I3RL 4UV4L 1EIBA 1D5ZA 3QJQB 5IMKA 2O1MA 1M3JA 3DIFA 3EUDA 3OR7A 2QKIA 3DDGA 3ZT7A 5SX4I 4G6FD 4LVHC 5IB2B 3QI9C 2P9RA