3D4GA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
471
Chain Sequence
TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 144
structure length 471
sequence length 471
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA01
4DXBA 2GHBA 4YICA 1PB8A 1ZU0A 2ONRA 1GR2A 1F9BA 1FTLA 1LBCA 5JEIA 3Q26A 3IJOB 2F36A 2F78A 4NWCA 2PBWA 1MH3A 3VXCA 3TTRA 3U94A 2G93A 4Q0CA 2REJA 3IK6B 3K2DA 3KFMA 3OEKA 1ANFA 1DPPA 1SYHA 1B3HA 4JSOA 4P11A 3QYTA 1B1XA 1RYOA 1OQGA 5FTHA 3G3JA 3QXMA 2Y7IA 2H5YA 1MDP1 4GXAA 1H76A 5A5XA 4ND9A 3IOWA 4YZZA 1MDQA 3VXBA 3TTNA 4NF5A 2QS4A 4OHNA 1B5JA 4Z7EA 1FQEA 4LZ8A 1SI1A 4F29A 3CIJA 3SETA 1B4ZA 1MPCA 2O51A 3H3GA 4HW8A 3G3IA 1VFEA 4XKPA 1MS7A 1B3GA 1D9VA 1MQDA 3DP8A 4O3CA 1R1NA 1N3XA 1RYXA 3ILUB 4F2QA 3P7IA 1QUKA 1UQWA 1LAFE 1IZ1A 4ELPA 3LBSA 1LFIA 1NNPA 1SDXA 4TLMB 4YB7A 2XXIA 1O63A 3G3FA 2F5XA 3MBPA 4P0IA 3IL1B 4XXUA 4ZEBA 1H44A 2PT2A 2FNCA 4YKKA 2R6GE 1NMUA 4ZEKA 5AA4B 2VGQA 1AL3A 3KJ7A 3CSBA 3MVWA 4TLLB 3VE1B 3T9VA 4ZEIA 2HCAA 1NKXA 1XVXA 1RKMA 2ZMBA 4NTLA 4KCDA 1MQIA 5I2KA 1JEUA 4FEDA 4GL8A 1R9QA 1IIWA 2E0SA 1ZMGA 3ZKLA 1POY1 5KDTA 4E0WA 3FVGA 1EZOA 1JW1A 4F3SA 1JNFA 4U4XA 3TODA 2XX8A 3RY3A 4EF1A 2Y7KA 5CM6A 5I57B 1MM6A 3CG3A 4H8JA 2OCUA 4UA8A 2XXTA 3H6WA 4R9FA 4FATA 2I3WA 1B51A 4GRKA 2QS1A 3CFZA 3QIMA 1QW0A 4NF6A 3PUWE 2F7AA 2ONSA 4H5FA 4X1DA 1NH7A 4F19A 1B58A 5BUUA 4ISUA 3LSLA 2DE4A 3BFTA 2O6AA 3HPIA 3ZKKA 3EPEA 2XXPA 3H6TA 3ODBA 1BLFA 4RPNA 3K1NA 2A5TA 3B6QA 3G7WA 3KSXA 3QAXA 3PPQA 5BWJA 1LCTA 3V5AA 4L17A 4GL0A 3SEVA 3K01A 3PMVA 3TFLA 3ILTB 3UGWA 2V3TA 4AB5A 3C31A 3SEXA 4MFIA 2QMXA 4EUOA 1MY4A 4IY5A 1B46A 2RCBA 3LC8A 3N94A 1JVYA 2XXRA 1XC1A 3RN8A 1YPNA 1FCKA 3LSXA 2X7PA 4AQ4A 3EF7A 2I48A 5JK4A 3KBRA 5ITPA 3M3FA 4DE8A 4H5GA 3VDFA 1JW4A 1N7XA 4HTGA 1GTKA 5CMCA 4OWDA 3ONMA 1Y3NA 1JQFA 3C33A 2I4BA 5I58A 3CSGA 3PUVE 4MBPA 4GVOA 3TTLA 1OLCA 3TPAA 1N76A 4BLAA 5AA1A 3DP4A 3C34A 4JDFA 1ELJA 4C1UA 3FJMA 2I3VA 4P0GA 3EHTA 1LAHE 1TFAA 2XXUA 3MVYA 4F1YA 1URDA 3PMXA 1USYE 3T96B 1NH8A 1II5A 5I2KB 3FIRA 2AIXA 1YCJA 2Z8DA 1B7HA 2Q88A 4FECA 2RKMA 2P0SA 5ITOA 3JYRA 4HS7A 4R6YA 4BDNA 5KDTB 1AOVA 2H25A 3ZS6A 4NF8B 3W9WA 1QUJA 2O7IA 3FJGA 2XXYA 4DCYA 5HBCA 5I84A 1ZKBA 2E1SA 5FTIA 4U21A 3SEYA 1A55A 3W15C 1SBPA 3HHFA 2X26A 1Y9UA 3IOTA 3VFJA 4JWYA 1O64A 1LLSA 1QULA 2F8DA 4MH5A 4GXSB 5F7VA 1NNFA 1I6AA 3IB1A 1MM7A 1MXZA 4KFQA 4OERA 2FYIA 3S4UA 1SW2A 3NK3A 3I6VA 5H8QA 3QSLA 2D3IA 4MLVA 2HZKA 3IO6A 4NF6B 4DLDA 1B0HA 3FVNA 3KZGA 3HO7A 2QSXA 3OOAA 2H4IA 5CBRA 4FJPA 3CFXA 4OZ9A 3MQ9A 3TQLA 4XKNA 3C35A 2RC8A 2VD3A 3O2AA 3TCHA 4KYSA 2A5TB 3OSQA 3IO4A 5I2NB 1T0KA 4C1TA 1MQGA 4ELRA 3K6XA 1S50A 3TQWA 1DOTA 1UTHB 3TTKA 2UVHA 5EHSA 3K4UA 4Q8RA 2O69A 3FV1A 3E4RA 3MVZA 4YKPA 4F31B 1US5A 4RA1A 3TUSA 3K6VA 2V25A 4KQPA 2FA7A 1P1UA 1FQCA 1B5HA 3K6WA 5DTBA 2I4CA 2THIA 2WKYA 2UVIA 3SERA 3L6GA 4QFKA 1JETA 2IEEA 2Y84A 4XTCQ 5CC2A 4DDDA 5AA4A 3BKIB 2YPNA 3PV0E 4G2ZA 5ISUA 3RNNA 3IORA 5AA3A 1AMFA 4R2FA 4LQ2A 3I3VA 1MH4A 3OO9A 5H8NB 3USDA 4N13A 4POWA 4OEUA 2RCAA 4PP0A 4IO2A 2IA4A 1SVXB 1VSOA 2DP8A 4YB5A 3MAMA 4YMBA 4LZ7A 4Q5TA 1IXCA 4DZ1A 2D5WA 3CVGA 4BDRA 3UA8A 1H43A 5CBSA 3MC2A 1ZJLA 5CI5A 4F39A 3OEMA 3H06B 4F1VA 1BIYA 1EZPA 5TPAB 5I57A 1NNKA 4F3PA 4O3BA 4PE5B 1H3DA 3K0VA 1CB6A 1P1OA 1D3KA 1XT8A 5KCJB 2GHAA 2GRVA 3MZ9A 5H8QB 2H98A 5KZTA 2UYFA 1QJMA 1TXFA 3GZGA 3O6HA 4QFLA 3PPRA 2ALUA 4THIA 4ECFA 2DVCA 1LB8A 4NEDA 1AIVA 4HCYA 3KGCA 1FW0A 3FXRA 2DWJA 3IOUA 3PPPA 5B7DA 5I59B 2P2AA 4KI0E 4FORA 5DVJA 1N84A 2PMSA 1YTVA 4XIGQ 3HCQA 3F11A 3RTFB 1Z7NE 3C32A 1Q1KA 2CZLA 5LOMA 3UN6A 2DYXA 2P1SA 1B0LA 1AH5A 1MPBA 5K2YA 2F6PA 3T66A 2V3QA 1TFDA 1PDAA 2NXOA 2XXXA 4M4GA 1N3WA 2OZZA 4IO3A 1I6BA 5EHMA 3PUYE 1B05A 4NF4A 1A8FA 4WXJA 1WDNA 4G4PA 4GQOA 2F7CA 3A09A 5AE4A 4OESA 3N6UA 4UACA 2DSFA 3EHUA 4G8MA 1H45A 3UIFA 2A5SA 5H8FB 2DQVA 3FUZA 4KYDA 4F18A 1ATGA 2ONKE 3C9HA 4NF8A 1DTGA 5DVIA 1YAEA 2AYSA 3RUMA 3U92A 5ICQA 4LUBA 1OLAA 2F7BA 2DWIA 4F1UA 4QFPA 3FD3A 3K1PA 2B3BA 1L5TA 3FASA 1WODA 4H67A 1JVXA 1MRPA 2R9JA 1B52A 5AA2B 1VFDA 2UYEA 3VLWA 3KJTA 2ZXTA 4QHQA 4LONB 3IJXB 4XKQA 1MXYA 3SEWA 2REGA 4ZZAA 1SD3A 4IO4A 1WVJA 1IEJA 1UIVA 3QK6A 3JZJA 2M8CA 4ZECA 5I56B 4I8CA 1XOCA 4G77A 4OMBA 3C36A 4YKIA 4ZZEA 3G3HA 3U8QA 2KLFA 5I2NA 3OMBA 2F97A 3WAFA 3M8UA 1LAGE 2Q9TA 4G8HA 4KPTA 2Q2AA 1LB9A 3OO6A 4GFRA 1B6HA 1BP5A 1UTHA 3K1MA 4QSCA 3KG2A 3FXQA 3MWBA 1HSEA 2O1MA 4PFWA 1MY3A 4ELOA 3RT8A 4LQ5A 2AL4A 3TELA 3TMGA 4JBZA 1N7WA 3CG1A 5DEXB 3N5LA 3KSJA 1B9JA 1SW1A 3OELA 3ZSFA 3O6IA 3B6WA 4HCWA 2B65A 4GIZA 2HEUA 2ZNUA 4NF4B 3S9MC 5TU0A 1OVBA 1FTJA 3FGSA 1PB9A 3FJ7A 3V8XB 1B32A 3HV1A 2XX9A 2H9BA 4N07A 2OJTA 1LCFA 2ANJA 4OQOA 3KOTA 1A8EA 4E0XA 3PD8A 3PMWA 5H8NA 4MLQA 2V3UA 2DS9A 3DM0A 4DXUA 4I9DA 4ESWA 1P1WA 1URGA 3DP6A 1LGBC 3TTMA 3PPOA 1MY1A 3TZAA 3MVXA 1QKAA 2F35A 3RLFE 2X7QA 2ZNTA 1Z7ME 4F2OA 5TPAA 1MQJA 2QS2A 3S2VA 4LP2B 1DTZA 5FHOA 3U1OA 4KR5A 4GOTA 1MXUA 5L9MA 5KCJA 1B3FA 1FQDA 3IB2A 4JWOA 3KOSA 1PB7A 1Y3QA 2RC7A 3PGFA 3BBRA 3EHSA 4LA9A 1MXVA 2XD3A 1D4NA 1MY0A 2DOJA 4ESXA 3OD7A 3VLUA 4PETA 2RINA 5J1DA 5K2XA 2UXAA 5I59A 3BFUA 3GXAA 2OK2A 4H1XA 3HN0A 3TYHA 1IUDA 1HSLA 4IGRA 4X48A 3AXFA 3KN8A 3IX1A 3IOVA 5ICTA 3VVDA 4OEVA 4PQJA 3QUJA 5M2VA 4DXCA 4TOZA 1BKAA 2D21A 4YKJA 3OSRA 3E3KA 3A3UA 3MP8A 3OO8A 1P1QA 1A40A 2PX1A 4OXVA 4U2RA 1IXHA 3Q27A 3G3KA 1LBBA 2XXWA 3RPWA 1HSJA 2F6GA 2ZYOA 1B2HA 1XVYA 4IGTA 3MZ1A 4U23A 5CMBA 2O1LA 3VV5A 3O6GA 3E13X 4FEBA 3L6HA 1B3LA 3PPNA 4C0RA 2V93A 4IO5A 3MJNA 5H8FA 4R9GA 3THIA 2XXHA 2VHAA 2OBGA 4BDMA 3H6VA 3S9EA 3T9UA 5L9SA 1M5BA 3HSTA 2Z8EA 3M3KA 1MPDA 5L8DA 3IB0A 4QFOA 2AL5A 4JWXA 3FVKA 3M3LA 3SDFA 1MXWA 5AA2A 3MW0A 1ZIUA 1MXXA 1POTA 5L9OA 2HAUA 2BJJX 1QKBA 4H8IA 3PUZE 2I49A 2W7YA 4NMYA 1Y1ZA 3FXUA 5HM4B 4ZEFA 4U22A 4XKRA 4R6KA 4EQBA 4LZ5A 3IR1A 1US4A 5DYHA 1QVSA 4KCCA 5I56A 1N04A 4GWOA 2QRYA 1R9LA 3CRBA 4GF8A 3R6UA 4OFOA 3Q25A 4JSDA 1A54A 1FTKA 1Q35A 4IY6A 5H8HB 1ZLQA 3MUQA 1UTBB 1P1NA 4X9TA 1FTOA 4WEPA 3H7MA 1B1HA 4BDQA 1PC3A 1GVCA 3O9PA 4ZE8A 4KYEA 3FATA 1MG1A 1LSTA 3T9XB 3RT6B 3MPLA 2QJEA 5DEXA 3GBAA 5CRYA 4EXKA 3T93B 2ABHA 1Y1MA 2QL3A 1B7ZA 1OQHA 1SYIA 1Y20A 1M5EA 4R6HA 1B4HA 1IQ7A 1S7YA 1PBPA 5EYFA 4QSEA 1MY2A 3RGYA 3GBBA 1IXIA 2G29A 3SKPA 3O28A 5B70A 4G68C 4I62A 1SW4A 3OENA 3Q29A 2GH9A 4EXLA 3O29A 4TQUQ 3DELB 4LVQA 4EQ9A 2UVJA 2Q2CA 3UK4A 1IITA 1OIBA 4ZEDA 3IAZA 3RTWB 2O7UA 5JTYB 2Z23A 3KN3A 4KD5A 2RC9A 1SW5A 5ELVA 4RNSA 3O97A 3CI8A 2HZLA 3KN7A 5H8SA 3VVEA 4QF9A 2YLNA 4KHZE 3RQTA 2DXYA 2HFBA 1EH3A 3N26A 2PT1A 4U1OA 4NWDA 4AB6A 3PD9A 2ZNSA 3DLNA 4N6PA 4G68B 5DT6A 5TP9B 3O66A 4YAHX 1A7LA 4QSDA 2Y7PA 2HXWA 2V84A 3TEPA 4DCXA 2Y7RA 4DIGA 3EQ1A 3TAJA 4R2BA 4U1ZA 1OVTA 1XHYA 2ZYNA 4PFUA 1B3EA 2Q8JA 1ZTYA 4WEDA 1JW5A 4EF2A 1NL5A 4JXIA 1N0TA 1S9TA 2UVGA 2I0BA 3VLVA 4K3FA 1TT1A 1UIUA 3NK4A 3V89B 1B40A 4R74A 2O84X 2ZYKA 3LR1A 3S9LC 1EU8A 1M5DA 1NNTA 3U93A 3HHGA 5A5XB 4IO6A 1CE2A 4QRZA 3A3CA 2VD2A 4OVJA 5CMKA 5F1QA 1M5CA 3B7DA 4NF5B 4ONYA 1R6ZA 4JB7A 3T9HB 3SEUA 1SQYA 1D9YA 4I1DA 3PU5A 4FE8A 2VP1A 4R75A 1FQAA 4IB2A 1PEBA 1FQBA 4ZDMA 3H4ZA 5CMMA 4H6DA 2QMWA 4F3GA 3UORA 2Z8FA 2NOOA 4GLIA 3UP9A 3OXNA 4PFYA 2OWSA 4M1VA 4O3AA 2XHDA 4NE4A 3EN3A 2O68A 3U72A 2I6EA 4BDLA 2HAVA 2DE3A 2Z22A 3GLBA 4ELQA 3MPKA 1GV8A 3PUXE 1LFGA 1VR5A 3E9XA 3KEIA 1BTJA 3LSWA 1GGGA 1ZBMA 3FV2A 1I6QA 3H6UA 3T22A 3OO7A 3R26A 4BDOA 4FAJA 1IXGA 3LUYA 2Q89A 2CMOA 2YJPA 2HQ0A 2DVZA 3SESA 4U4SA 4YU0A 1OMPA 4ZE9A 3CR9A 1URSA 3QUFA 1P99A 4RJZA 3G3GA 2GFEA 3WAEA 3CFLA 5FHNA 4H0WA 4OENA 4X1BA 3C4MA 2DXRA 1EZ9A 4G8NA 1SI0A 3TKDA 3K6UA 1I69A 4POXA 2ZYMA 4FIMA 1B5IA 5IKBA 3B6TA 5DVFA 2NUVA 2XX7A 4RPOA 2XXQA 2DWAA 1VE4A 3TDJA 1DSNA 5H8HA 1NFTA 3TCGA 4MF3A 4R72A 5HPQA 1TWYA 4F3BA 1B7UA 1Y4TA 4IO7A 2I0CA 4ZS9A 1UTBA 2Y7WA 3D4CA 4OFLA 4RK9A 2NWJA 4EDPA 4GD5A 2QS3A 2H99A 2B3FA 4H65A 3K02A 1O7TA 2VOZA 3TCFA 2DWHA 3FZVA 3Q28A 3S9NC 1A99A 4QFNA 3W9VA 1FTMA 1XS5A 3R7XA 3D4GA 1USYH 1JEVA 3MP6A 2QPQA 4WKMA 2OWTA 2OLBA 2PYYA 2PVUA 4RXLA 1KWHA 3MP1A 4EQ7A 4Q30B 2XXVA 2R71A 4OYVA 2ESNA 3LSFB 5IAIA 4Z0IA 1FQFA 4F22A 2F34A 1QUIA 1Y4CA 4YMAA 3H03A 1M5FA 3K00A 1PBQA 5I58B 1DPEA 1MQHA 5JTYA 4RY1A 3I5OA 2LAOA 4LATA 3MZBA 1DMBA 1J1NA 5AA2D 2DE2A 3ECRA 5FHMA 2RF1A 1LAXA 4RYAA 1LFHA 1Y3PA 2I58A 3N6TA 4YB6A 4OFJA 4R73A 2NVUB 4G68A 4PFTA 5TP9A 3FVOA 4RK2A 3VVFA 4OTEA 2XD2A 3V83A 4OETA 3JV9A
chains in the Genus database with same CATH superfamily
3WFCL 1J10A 4AEIH 1MELA 2DQCL 2FJUB 3RJOA 1GZPB 4CRPA 3DV4A 2HX8A 2CLVA 4P4KC 3ZXAC 4KH2A 2FJSA 4XI5C 5CP7B 1INDH 3QT2A 3MR9B 3GHEL 2AXGB 4FFZL 2HVKA 2KLSA 3PUCA 4I3SH 5DK0B 1TZ8A 2IOMA 3L9RA 3MXVL 5KS9E 2F78A 3GSOB 3QEGH 2HLFD 2PBWA 1MH3A 2CO7B 4FKHA 4L4TA 1KEGL 2HFEA 2ZCLL 4FQHB 4RA0C 4ODXA 4HC1H 1NAKH 2XA8L 1ZAGA 4HXBH 4NC1C 5FIEA 4Q0CA 4HCIA 2WLLA 5I5JA 3IK6B 1M3JA 5CEYB 2D9CA 1AGCB 3HAEA 5ICZB 4CNIB 2Z8SA 3BZ4A 4D8PB 4RCAA 4ZMNA 1H15B 5T3ZH 3ISWA 1SYHA 1OT2A 4X6CB 1B3HA 2GK0B 3REVB 2IJ0C 4MXWL 4HIHA 3QYTA 4C57C 1WFNA 1QUPA 1F5WA 4AX3A 3O6ML 2VT0A 1OQGA 2IALB 4IIQA 5FTHA 1JPST 4KQ4L 1JD9A 2AXJA 4WU5A 4N8VA 1BMZA 2OTUB 4ODWA 4PM1A 3ULUD 1W8EA 3EH1A 4DEPB 2H5YA 1MDP1 1OANA 3G6JE 2GY5A 1H76A 2ZNXA 2VPNA 3L3JA 2FWSA 3DTUB 3AG2B 3TWCH 3QDJB 3IOWA 1IKOP 2SEBA 4PJDA 2E9IA 4JB9H 1NDTA 2V9RA 1QR1B 4MD4A 4QJ4B 3GUTA 4KVCH 1C5DB 4F7PA 3NPZB 1ZEAH 4LLMB 4WHDA 2NSQA 1NV2A 2ICWA 2WJ7A 2YQBA 4XC3L 1RURH 3K6DA 5JOPE 3CQFA 1BZ7B 4OHNA 2Y06L 3BVDB 2LLGA 3E1ZA 1M7IB 3GF8A 4KK8C 4XAWH 5GQBA 5I8EB 1DR9A 4FQLH 1NMCC 1NTDA 2LTQB 3T3PB 1XF2B 2O51A 2Z8RA 1AP2B 3K74B 3N1GC 4L23A 4XMPL 4ZUWA 2J20A 4QRTB 1SHMA 2JJSA 2H3NA 3HVDA 3VI4B 2EADA 1VGKA 5IV2B 1DVZA 3EGSA 3QDMB 2BVQA 1MQDA 1R5VA 3GUFA 3LKRA 4F7EB 4O3CA 2LU5A 1R1NA 1S9WA 3PV7A 5IQ7L 1N3XA 2VDMH 3KPLB 3HMXH 5FOJA 3HI1B 3FRPA 3VXMD 1W6LA 4YXHL 1NZRA 3RVWD 4PGNA 1QUKA 3E3QE 1UQWA 4OVQA 1C08B 1F02I 4WFHD 4ELPA 3LBSA 5DMJB 5F6IC 2G9HB 1UD2A 1NCIA 1LFIA 1NNPA 1SDXA 4GI8A 4KKQA 4QXDA 5KVDH 1JZ4A 5IHWA 4N2KA 3G3FA 4NM8L 5F3BB 5J1AB 1LDSA 4P0IA 5HHVH 5I2IA 1E4KA 2Z93A 4FZ8H 4ZEBA 1H44A 2H6UA 4LCUB 4WWKC 1GC1C 5I1KH 3IDGB 5E8EA 2H1XA 4RLDA 4ZODA 1TLKA 3SJVD 3V4UH 3TBWB 2FNCA 1NCTA 4RA3A 5AKSA 3O41A 4I1PA 5E9DA 4ZEKA 4PJFA 1ED3B 1OPOA 3E78A 5EIIB 1NLDL 3VYPA 3TU6A 2VXQH 5I6PA 2ZUWA 3CVDA 3QRBA 3CK0H 4H0GA 2NMSA 4HWBA 4NIYE 2KMWA 3UEZA 1NM4A 4N86A 4BDVB 4FNTA 1ZLVK 3ATAA 4NZ8A 3BHBB 3G6AB 1TETL 4WK0B 4AJYV 4FG6C 4DAGH 4WNJA 4WU7B 5MEND 4AYDC 4U3SA 3PWUA 2E7LA 2J44A 1IEHA 3GYYA 2EIMB 4JO4L 1NKXA 2HCAA 3WTSA 3PGFH 5KUMA 5GS0H 5F1KC 4LESA 5A2IH 1JFQH 3GMMA 4ZQKB 5GZOD 1F13A 1ADWA 1J88A 2R1XA 1AQKH 2BFVL 3VFRB 2ZMBA 4IYKA 4FHJA 2YFOA 2DJUA 4KCDA 4DKAA 3HR5B 2G60L 4GL8A 5GGSB 2A6KB 4Q9CA 3TL5A 3FSOA 4NZJA 3MFFA 1ZMGA 1QEWA 1POY1 2VB5A 1RP9A 3APDA 4KJQC 5E6YA 1CVSC 4RGMC 1WTGT 4OU3A 4OZIA 1TTFA 3ZL2A 2HN7A 4FTVB 1NCBL 3QZNA 3RIFF 4DH2A 1AANA 2ZKMX 3C12A 3ES6A 3DC0A 4JDEB 1F4WL 5DUML 2OMZA 2QT6A 1JNFA 5D2LB 4XAKE 4U4XA 5KVGL 4F5CE 5FW7A 4LBAA 4Y19D 4XNUL 5DQ9B 3BC9A 4ESKA 1E2VA 4H7VA 1XH3A 3LHPH 5GGTA 3WFEH 3TODA 1W8NA 3UEQA 3JVGA 3IE4A 3ESMA 5F1SA 3NCWA 2EJ1A 4CVUA 4S0SD 3EKCA 4R84A 1EA9C 1NCAL 2Y7KA 2O61A 2B1AH 1ZANH 1WAAF 4LHUA 2J6WA 4RGOL 3WXVL 1HEZA 2EDNA 4OF8A 1NANH 1F1GA 2H3KA 1AGFA 1MM6A 4UTBL 5ET7A 5KVEH 1OAXH 3H6WA 1FCGA 5E2JA 4R9FA 5HPMA 3GXPA 2UZIH 1EEZA 1Q9LA 4PTUA 1WAEA 3TO4B 4DSYA 4FATA 2VZVA 2KERA 2VLKD 2FO4B 2F3DA 2CRMA 3CFKB 3MODH 4FKKA 1PPIA 5F7MC 2MCPL 3QIMA 1VEOA 1YY9D 1QW0A 4NF6A 4FQXD 1UGKA 5B39A 4X1DA 2AJUL 1K4CA 4P07A 4F19A 3RL1B 4FQCL 4P2AA 3ATEA 4U3HA 1NCJA 5GXBB 3BZ4B 4AV4A 4PJIE 1DYZA 4ETQA 2BRRH 1FFRA 1X7QA 3BZFA 4QDGA 5B3NA 2YGVA 3QHTC 5FYLE 5IGXL 2Y7QA 2W1NA 2A9DA 2FSDA 4OZHB 1SVZA 4Q9QH 4UOW0 4LNRA 2F15A 4AKOA 1S8DA 2K1MA 4Q6IA 2R8SL 3ZYJA 1JK9A 2WO2B 3T0AA 3WKYA 2XXPA 4PRNB 4YSAA 3QPXL 1A25A 4CU8A 2KQNA 5EUOA 4WU5B 4JANA 5DGQA 4HK3J 3K1NA 2GUYA 4EN2A 2HRLA 3AREC 1AQHA 2CIIB 3R0NA 4GRWB 3W2DH 3PWPA 4P5KB 1MQ8A 4U6VH 1KJ3H 4LLWB 4Z1PA 4Y2DB 2E0PA 4KHTL 4HPOL 1T66D 4MQ7B 1Q0YL 3QSKB 2QVTA 4PJDB 4ABQA 1N0XH 1DVFC 5HDBF 1X5YA 5BW7C 4L17A 3FB7A 4QEGA 3QFDA 4MD4B 1T22B 1KGWA 1OF2B 1JV5A 1X5FA 4G1EB 4F7PB 4GL0A 1MXGA 4K5OA 3T0EB 1NGZB 4HJEA 1YECH 2UWEA 2P4AB 4HULB 4B9PA 2Y69B 4O3AA 3QFJD 3TFLA 2GB2A 2CHXA 3BWSA 3N44B 4NXKA 2ZXEB 3ZMNA 3N2JA 1OK0A 5BOPA 2V3TA 2IANE 5CSZB 4AB5A 4XMTA 3C31A 4GEJA 3SEXA 4MFIA 3ZGIA 5EFIB 2QMXA 4GJTB 4JRXA 4HMEA 1MY4A 1B46A 1UJ3C 3AUVA 3PWLB 3V6FB 3LC8A 3QH3A 1PYWA 2PCYA 1WAAE 3UDWC 3HMWH 5CILH 3L3OA 3QI9A 1YPNA 2WLHA 2VXSH 1R5VB 3LKRB 3LKPB 1RK0A 1H3TA 2NY5H 5DUBB 1UACL 2ED6A 4CADB 4L1BA 1CBVH 1BZDA 1XF5B 4X4YA 1PZUB 2F19H 3HG5A 1YVLA 3FRPB 3EBIA 3HS9A 3UYRL 2LGNA 3FSAA 3JWDL 4LEBA 2I48A 4I5BB 3QPKA 5JUEL 3RIAK 1KLUB 1AXSA 3ULVC 5DHYA 4LU5H 2Z4QA 5E1IA 5IFHH 2CD0A 5DO8A 1EGJH 3PLYA 1GPOH 1FORL 1U92A 4ZRGA 4OWDA 5D2NA 1Y3NA 4XGZA 3FCTA 4OI8A 3C33A 2I4BA 3NTCL 3CX5J 3BQUB 3OTTA 3SDDB 3I02A 1TUPA 3BX7C 4GQPH 1HNFA 3PUVE 5EBMB 1U8HB 4PRHE 3TTLA 2X4UA 3D8MA 1AR1D 4N0UE 1FZOB 1J8HA 1AD9A 3ARFD 1MRCH 1CXKA 4XBPA 4ZOEA 4Q7DA 1HS6A 3BCFA 3DP4A 5D7EA 5AZ2L 1WZ1L 1ZIBA 2FL5B 1D2OA 1GSMA 1A6WL 1WCBA 3DETD 1MJUH 3QNYA 5D7KE 1TFAA 4U3SB 3PWUB 4DGVL 3B8BA 3IJYB 3FO2A 5BRQA 4YSCA 3C5SA 4J23A 4YAQA 1GOFA 5LG1A 5FYLH 1VJSA 4R5TA 4Y4KA 1G6RA 2A74C 2RFXA 3NCCB 4P23D 2F7IA 3GMMB 4YR6A 1GSKA 3HAEH 1USYE 2HA1A 2Z0BA 5AL8A 1R3LB 3EHBD 4RAUA 2PCPA 1G7IA 2P5WD 1FFPB 2YEZB 1TTRA 2JXMA 3MFFB 3TN0D 5DQDH 2G2PA 3JYRA 4A6YL 4DK5A 4YWGH 3VA2C 4DQOL 4ZMWA 4J28A 1UD8A 1MWOA 4NN6C 1RUKL 3T0WA 2CUMA 2UV3A 4OCXL 4L3ED 1F58H 2X40A 2VC2H 1NINA 3MRDA 1FV1A 3IRPX 4LCYA 3GINA 1A55A 5I73C 4NQTA 1YUKB 1AKJD 4XN9A 3F64A 4RZCB 3KPSD 3QIUB 1CDHA 5F3HA 3H9ZA 2F9BT 2WXRA 1BVNP 2YD6A 3ALPA 4DK3A 1PG7H 1TQSA 1H6TA 4YOKA 3MLVH 2F8DA 1AE6H 5BMFH 2YUXA 1U8NA 4YHPB 4GXSB 2C3XA 3MRJB 1FDLL 3EUUA 1TR7A 3IDIB 1WVZA 3K1DA 1CGSH 5DRXB 3L2LA 1HEZB 4R96A 3IB1A 2XWCA 3WAKA 1MXZA 5GRWA 1A9BA 5FO7B 2VMFA 3SPIA 2CJ3A 4E41B 5B4MC 4ICXA 4N26A 2FYIA 1CQKA 5AVVB 4LQ1A 2XQYK 3WJLC 2DQFB 1CDBA 1BFOA 1HOEA 2VLJD 4LSQL 5H8QA 2D3IA 4L5FH 2HZKA 2VISA 5K39A 5D1XA 1AI1L 4NF6B 5B39B 5LLIC 1E65A 1K4CB 5T1DH 5K9JL 4PB0H 2QZ5A 2EZ0D 4P5TC 3QJQB 2GCYA 2GUOA 3KZGA 4GMSL 1S9XA 4PGDB 4YXKH 1OCCB 2IAMD 3MNZA 2IGLA 4QNPF 3FT3A 3QXVA 4Z76A 3K0WA 1LO0H 4JFOA 2OSLA 3U1SL 2Y36H 1N76A 1X5KA 1ZE3H 2A1WH 2YO3A 2ZOTA 3IS0X 3KGTA 3KW8A 4N0FB 4XT1C 2ZJSL 4Q6IB 2E76C 3NSXA 4R2GC 4BD4A 4P46C 3FRUA 1QRNA 4FYSA 3FAXA 4PJGB 3O2AA 3MRFA 4X4XA 5EUOB 3TCHA 5D7SL 1ORQB 1WBZB 1ESOA 2YAHA 1BX2B 3OV6A 1RHHB 3EBAA 5FHAL 1RV6X 1MCPH 4JFYB 4DVBA 3IO4A 1X5MA 3FBPA 3MZGB 1KIPA 5KJRL 3CZUB 3N43F 4O51B 3C5JA 5TK2A 1XL4A 3WEXB 5HBBA 2V2TB 3GSRA 3QDGE 5ILTL 3FU8A 4NKIL 4HWBH 4OM0L 4QHNA 4AMKL 1MQGA 3D06A 3FC8A 3DX7A 1UADC 3RVTD 4W6XB 4EOWH 5EV7A 2P8LB 5I24A 5IHUL 3EJSA 3LMJL 3K6XA 3GS7A 5I30L 5ICYA 1DOTA 1NKRA 2R0KH 3MV8A 1FNGB 1UTHB 3ZW3A 2ICEC 3TTKA 1EUUA 4RSYA 3ETSA 2Y5LA 4JHZA 1JHLH 3HW7A 4MAYD 5LWYH 4MB3A 3FV1A 1J0HA 5JNYB 2H0EA 2CR0A 1DDHB 3QEQD 1AWBA 1YUHB 3MVZA 3VMNA 4F31B 5DEFA 2ISDA 5FF6A 1PYWB 3L5HA 1US5A 3HNVL 4KK5C 5EA0H 3TUSA 4XBMA 3K6VA 3RFZA 2V25A 2L4OA 3CFCH 4K8RC 5EU3A 3IJSB 2XC8A 2YD8A 2YPLA 1XCXA 1FQCA 5FYKH 1K3ZA 4J8RB 1B5HA 2X70B 2XBZA 3K2IA 4HSQA 1SJEA 4XN1A 3T8VA 1KBGL 5I6XC 3RTQC 5DTBA 3KPQA 2OZ4L 2CHWA 4L8SC 4PR5A 4AITA 4WI5A 2VDNL 1FPBA 5FGSA 3CVHL 5B7EA 1MW1A 2WKYA 3L1OL 4OR1A 1AXSB 4E9VA 2FEEL 3MRCA 3JTTB 5DD3L 4LB8A 5DHYB 5E8DH 3RAJH 2KBGA 3B2UC 4FQPA 4LBEA 3EZ8A 1NICA 4XVSH 2Y84A 4NHCH 1I9JL 4AQAB 5GGTH 4CDHA 3VXUA 3RJDA 2HRPH 3NRPA 2YXWA 1RUAH 2H0JA 3QNXA 4RX4D 4GMTH 4AGMA 4QNPE 1A64A 3WSQH 2XN1A 2FEEI 1ETZB 1NBZB 1IBBA 4OLYH 3SBPA 5JIQA 2HRHA 2JVUA 4OZGA 4A7GA 2WO3B 3HRZB 1YN6A 3J27A 2D0GA 3BPNC 3KR3H 3KS0J 1MUJB 1O9WA 3OQRA 3QC6X 4G8FB 4LVNB 5ISZD 1SJHA 2VM9A 1Z9LA 5IEKA 3FAWA 2JK5A 5IZ3A 4DNLA 1NKOA 3BOVA 4JFDE 2BSBA 4LQ2A 3RLSA 3FONB 5DUPH 3FFCA 2HTLC 3Q8AA 3BRDA 3ENEA 3OO9A 3L6FA 5EHFA 1IILE 1HT6A 2A3TA 4IRJC 5F9OL 3D39B 3PAYA 2VDQL 5EU4B 3T6XA 2FGZA 3RWGB 4N90E 1G6RB 2RFXB 3HBZA 3BIAX 1FNSL 4ODHH 4JPWL 3Q8FA 4PJ9B 4WKZB 1MFBL 43C9B 1NV7A 4JO8A 4M93B 4PP0A 4S0HA 3WKQA 4PIBA 2YR3A 3VI3B 1KGUA 2FQGA 3FT4B 3OG4B 3V5KB 4FA8A 1NGYB 1SVXB 3VWKA 3VRLE 4TQPA 2JXMB 1CXFA 1SHSA 5CMAA 2M2DA 4MCYA 1KYOK 2Q76B 4PVLA 3V52H 4B9CA 3B2PA 2YJQA 4LZ7A 1IXCA 4DZ1A 4UV7H 4HPYL 5CEZL 1QNZH 2AJZB 4IK6A 2O72A 3T65B 3QNZA 4XP5L 3UA8A 2X4NA 3HN3A 3MRDB 3WV0A 1ZJLA 1S7TA 2MEJB 3LV0A 3LVTA 3BH9A 2GY7B 1Z66A 4OJYA 1BIYA 1NMAL 3R7RA 1NC4A 4FC3E 5E23A 1LVEA 1IC5L 1Q0XH 4NUQA 1EZPA 2PXYD 5HYQB 1JPTL 3RX9A 3OLDA 5IM7B 2FWUA 1JGDA 3FUIA 1SJVA 2PWDA 5DHMC 4ORGA 4F7CA 5IIEB 3WXWH 1HEHC 4GH7B 2ZX9A 1S4IA 4PFEA 4XPGH 1IMDA 3KYNA 1P1OA 4LDCA 2X12A 3NSYA 1JDDA 3L16A 3TA3C 1I9EA 4OSUH 4IR8A 1FZKB 4GFTB 1D3KA 1WZAA 3BSGA 4PJ7F 4XCCL 1A9BB 1WT5C 3AQDA 4JS7A 2OXHA 4K7FA 1XSKA 4EVNA 4EI5A 3QUXB 3II2A 1SJXA 1OAKH 5EUKB 1HX0A 4TMPA 2GRVA 1U3HC 1GYAA 5H8QB 5KBNC 2D8KA 2M1KA 3HPLB 5ITBH 1QBBA 4OLUH 2QADC 1BJ1H 5B7FA 5IKCB 1ZVHA 1UWGL 4Z78A 4M5YL 2NY0B 5AVTB 1TXFA 2QDWA 3RWFB 2IADB 1HFUA 1EX0A 1MHHA 1PQZA 3L5XL 1M2VA 4Y1AA 4ZO7A 4EZMA 4WHYH 4MD0A 5IVXE 1OGAD 4PGCA 5AFAA 2DVCA 1FYTD 4QRRD 2FGWH 4HIPA 3STLA 2RR3A 4MAZA 4PU2A 3FT3B 4JKKA 4M61A 2OSLB 3WKNA 5DD0L 2IDQA 4NP9A 3CGTA 2V0AA 4E9TA 4TTGA 4DCQA 4NB7A 1CI5A 4Z7UB 3N85L 2QPUA 4P2QD 1FW0A 3FXRA 2Q8BL 3IOUA 1TJGH 3BWUF 3QRGH 3QULB 1CXIA 3W82A 1NIAA 4GRLB 2H26A 5HTSA 3V9EA 4A2HA 1MCFA 3QA3B 5I59B 1U91A 4HEPA 3U6RA 2P2AA 5DJDA 3BGFC 3KBFA 3MRBA 4WHTA 4XCYB 2VLMD 3G3LA 2ZG2A 4DVBB 5DSCA 4MMXC 2Q8AL 5I15H 2DQEH 3TBYB 4JFEE 4G61A 3EG9A 2VDLB 1RHFA 3AAZA 4K3GA 4HIIA 5IB3A 4MZ3A 3EH2A 5F1NA 3VSQA 4XIGQ 2X41A 5J13C 1J1OL 4O00A 3F11A 3LS4H 3RTFB 4LP4A 1UYWL 4MA8L 5LVEA 3ZPDA 1NEPA 1I7ZA 1PAZA 2OMUA 3EFDH 4TS6A 4MDRA 3G6DL 5ERWA 3M17A 1G0IA 2CO6B 3MV8B 1KJ2A 4X7EC 5D1QA 2OX5B 1AH5A 1URLA 5EF2A 3IMBA 4Z7WB 5F7NC 4UA8A 1A7QH 4F7TB 4HUNB 5CFAA 2Q2EB 4XWOD 1I4FA 1NGXA 3L2NA 3X11B 5IWLC 4ZXBD 5SX4I 2A83B 4B7IA 3TZVC 4RQQA 3QORC 5I0XA 3HZVA 1TFDA 1S9YB 3KPRD 4ICWA 3A4DA 4MYWB 3G5YB 3MRHA 3ZE2B 5BZWA 5KN5A 4DFHA 4CJ0A 2BH0A 4O5LL 2OZZA 4NQDE 1G7MA 1AL3A 3KPQB 5D70H 4XXCA 3THML 1JPFA 1MFVA 4PWKA 3ET9F 2EDLA 3GBMH 3MBXL 2K9FB 5C7XL 5DMYA 4F2MA 1ZGLP 5FX3A 1UQSA 4NF4A 3FHAA 3Q9PA 2X3AA 2XPYA 4WXJA 4CSZA 4OCNC 1SFHA 1ICTA 1C5BL 4UDUA 3VXUB 1JMXA 4Z7NF 1THAA 1N4XL 5FM8A 4IBTA 4X6EA 4RGNE 4U4IA 1HAUA 4ISVA 5HXMA 2F7CA 3UTPD 2F54D 1MVUA 3A09A 4ZUSB 3IEAA 1TF4A 5CN1A 4OESA 5F71A 4JY4B 1UG9A 5E9AA 4OZGB 3H9SA 3QJOA 4L4VD 5HHPA 4UACA 1CDGA 3TS8A 3LKQB 4B96A 1DO6A 3QUZC 1BQHG 1XDTT 4JZJA 5IEKB 3K71B 3WTUA 2CKBA 5GZNA 4EI6B 3MA9H 1CFQA 2HP4A 4GO6B 2PYED 1H45A 3AB0B 5KZCB 1EDHA 3HE7D 3L08A 3L6FB 2W60A 4OFPA 4EEEA 3W5NA 1TKWB 3ELQA 4TRPL 5EC1A 1RJYB 3RKDD 4HJGA 3VACA 3KWXA 1EZSA 1M4KA 3QW9A 3IJ9A 7FABH 5F9WC 1ATGA 4A38A 5C0BA 3WY3A 3KYKH 1EBAA 5BVPL 1DSYA 2EVJA 1JJUA 2B39A 4BZYA 3SO3C 5IFJB 1TQBC 3HKZA 3SQOL 3U2SA 3ARTA 1LK2B 1H3WM 5E8OB 3RUMA 2K45A 4MCYB 1S5HA 4ZMXA 1BAGA 1U8OB 3HB3D 3HG1D 1YLBB 3ECQA 3X3FH 4LCWE 4PJCE 4DVRH 5A2KH 5ICQA 2AK4D 4POYA 1OLAA 2WCGA 5EEUA 4Y5VB 4F1UA 4K0OA 3VQMA 5JHDA 1DO5A 2X4NB 5D5MA 4M6MH 3T08A 4MJID 3IGLA 1UVQA 5DEGA 3HI6H 4FI8A 4NWTH 4P9HH 4HIXH 3FD3A 2NY6D 2XLLA 3Q43A 4G71B 3K1PA 5TH2A 5I0DA 4Z7IA 4CAGA 1JVXA 4YDIL 3UAJC 1MRPA 3W0WB 4JRYA 4KNUA 2R9JA 4HUWA 4PCYA 1VFDA 1TOXA 2DQTH 4ORGB 5CZVL 3CHGA 1TNMA 3VLWA 3RGVD 1FBGA 5I1HH 5F89B 1I1AB 4KXDA 3UTTE 4HEMA 4XWGL 1UCBH 2ZXTA 1IGIL 3NCJL 4LONB 3ZUNC 4DQAA 2DAVA 2C9RA 2C1OA 4NAJA 4H8WL 3IJXB 1FL5A 4O2EA 4U7SA 3SEWA 4Z3JA 1N64H 3BUDA 3CFBA 5KBPA 1DVSA 1P84K 5DJ2A 5KYUA 3K8LA 5I3SA 5FLUA 5BS0E 1G9NL 1JS4A 3MBWB 3P4MA 5GRJH 2Y7IA 4NKMA 3LN4A 3BH8A 3SCMB 3VXRB 3LEXA 5JIKA 3P77A 3CFEB 4XVJH 5FA3B 2M8CA 1AC6A 2GJPA 5T1LA 2UYLB 5I56B 2VJXA 4MD0B 5ACLA 4I8CA 5ADOL 4PGCB 5DHXB 1HZHL 1VZGA 2F7QA 3SQBB 1IARB 5E6RB 4FG4A 4CUCA 2RH0A 3K8MA 1ZHKA 4N1CA 1E4WH 1RK1A 4N6QA 4FEIA 4OMBA 3DIFB 1C9SA 3R7QA 5IR1A 5I28A 4JFFE 4YKIA 3PQYE 2N1TE 1E6JL 3F00A 1FBHA 3RUGF 4BINA 4K3EL 5HHOE 1SDDB 4FFYH 4G80B 4MJ2A 4P2OC 1NI9A 4LLAA 2WTRB 4FJ6A 4EKXA 3P11H 4ZYKA 1Q1PA 4X4ZA 3CZNA 5JQHC 3M8UA 1FJ1A 2WWOA 3HC4L 4X0KB 1JUFA 1RIUH 2IMMA 1I8MA 3NEXA 1PLGL 3T0XA 4WW2A 2BERA 4XO5A 2V9QA 1RUPH 5DSCB 2Q2LA 2B59B 4G8HA 1VDGA 2A4ZA 2EDXA 4NQVB 3ZTNL 2RJMA 4PRDA 1P53A 2I24N 2UZPA 4WTXA 2PW2A 2WINA 3P9WB 5K5YA 3D09A 5I8CB 1TCRA 3EADA 1B6HA 1ZLEA 1HHHA 1NLBL 2QL1A 1P4IH 1XGPA 3KG2A 3TNMB 1AGDB 1A6VH 2OCFD 4GKZA 1MFCH 3PWJA 4U6XB 3US9A 4CN1A 3MWBA 1T6WA 4PFWA 4JLRA 4PJEA 2CHDA 4S1RH 4OT1H 4OZFA 3RT8A 4L9LA 4LQ5A 4MB4A 4MX7A 2LAAA 3B9DA 4P2RB 4U05A 3UACA 2XDHA 3SYQA 3M17B 3W38A 2AL4A 2BNRE 2E6JA 5D1QB 3TELA 2B2XL 3NZHL 1LO2H 5IJKC 5GSVB 3AWEA 3NCMA 3SKNB 5DEXB 1JE6A 1CNQA 4NC2B 3LEVH 4JZNB 1A3QA 1IC7H 3MREB 4PJXF 2D4FA 1OXYA 4RQQB 4EIZC 4CW1A 5KYYA 5HDLA 1N6QL 4FZEH 4WF7A 1UWFA 3O6IA 3MRHB 2E6PA 3QHFH 4N0RA 1FZMA 4LASL 5BZWB 3F7VA 3TVMA 5J12B 5I8KL 1JVLA 4ZS7L 3B6WA 1G7MB 4BXSV 4M9PA 1Y1UA 4MHHI 2WBWB 1MFEL 5CLTA 4OY9A 1JWSA 2DMKA 3ML9A 1NGPL 4G9FA 3B43A 1IFRA 1RZ7L 4F2MB 5LGHL 3GI8H 4LFHG 3NAAL 4NF4B 5KVFL 1BXAA 2FTAA 4L0ZA 3FUMA 4LFHD 4KVPA 3ILPB 4J4PA 3TC9A 1D5MB 4PH8A 1FTJA 4N1EA 4X6DA 4DO5A 1CLYH 3H2QA 4X6EB 1UT9A 1PB9A 5AALA 4AL8H 5HDQL 3FJ7A 5LDZA 2C3VB 2EKSB 4IU2A 4TUUA 3PP4H 2EVHA 3U7YH 3VG9B 4EBQH 4RIRA 1ONQB 2H9BA 4N07A 3MLYL 2OJTA 1LCFA 5ICUA 3QUMA 5IK3B 3KOTA 4MMYB 2GJ6D 2KLRA 2ZKWA 3V2AR 1CQYA 1F1AA 4FI7A 3RUGE 1EHLH 12E8H 2IWGA 5CEZD 1VESA 5H8NA 1ZPUA 5KUKA 4MLQA 3QUYD 3C6LA 4GX6A 3NJMA 4MHFA 3QR1A 5CZRA 3E8VA 1HYRC 4XPFH 2YWYA 1DBAL 3ERXA 1NV1A 3DM0A 1ZT4A 3J7HA 2ESVA 3MCLL 2F53E 3LKNB 3QJHA 3DX6A 3GBEA 2DMHA 3IMRA 1OZUA 2GHWB 5DQJB 3QS3A 4BCYA 5CIPA 1X6NA 3KVDD 3NN8B 4ESWA 3V4PA 4MSWB 1KCRL 4YL4A 4YDVA 5ESQA 4PJAE 1O6VA 1LGBC 4QRPB 5CD5C 3C6SA 3U2SB 3PPOA 1T0OA 5H4YA 3R1GH 4JVWA 4U3XA 5T3XL 3S4SA 3KJ6H 3ZDZB 1QKAA 3TYGL 4F7KA 1U3YA 4LLVB 2XN2A 3HE6B 4LRNH 2EIBA 4IHBA 4K23L 1N5AB 4R4NC 3V5DA 4MKTA 5DMKA 1E9QA 4OLXH 3CDZA 3GEWB 3P30H 5L2KD 3MTRA 5JHDB 4LL4A 2BNQB 2G0LA 1DBBH 1XSOA 1UD3A 2DD8H 3LZFL 4TLTA 5D5MB 5DJZA 3CTTA 3IJEA 4MWFA 1R33A 3APMA 5B1JC 2ZOKB 4WEBH 5DUJA 1YNKH 2H9GB 3DJ9A 5IROA 2HHMA 3KLAA 4FG0A 4HLZG 3DJTA 1H8SA 3L9YA 2ZWYA 1OP4A 1AVAA 3IVKA 3RNKB 2MWCA 1URIA 2KQZA 3PL6B 2MTPA 4JRYB 1IT9H 3LVEA 3UMNA 4PJHF 2CGZA 3KXFD 2JB6A 3L95B 4I1NB 3OZ9L 2BS9A 5BCAA 3IGAB 1PZAA 3MZTA 4L3FA 4BFKA 3IB2A 1KJ2H 1LO4L 1RI8A 3PABA 4AT6A 5BV7L 3FTGB 5TF1L 2OM5A 4I8DA 5IY5B 2EICA 3A6CH 4GT0A 2ZUTA 3DDFA 2QLYA 1EFXD 3CFBB 1CB4A 1ZHBB 3UAAA 1H19A 3VWJD 1YEWA 2V7NB 1OSPL 2FJGA 4WY7L 1QABA 1UH3A 1PKQB 2FD6H 4HHGA 4LA9A 3A6BH 4JJ5A 1M71B 4BFEA 1IKFL 3WFHA 2XD3A 5SWSB 2WTPA 4V1DD 4YBHA 3HS8A 1F86A 1C7SA 3QDHA 3TWYA 3IU3B 4ESXA 3F7KA 4QHMB 3VLUA 3CNKA 2RINA 5IJVB 2WSDA 1YG9A 4LNVA 4N0CD 5DD1H 2LW3A 2X9ZA 2Y7OA 5KSVA 3Q5TA 4Y7OC 3BFUA 2CCVA 3VAEA 3FB8B 3C9NB 1QW9A 5F9JA 2QQNL 1AOHA 2CKNA 2B9BA 2PO6A 4EDXA 5ET8A 1WICA 4PRPE 5EMYA 3VJ6A 3NIDB 4IGRA 5CJ8A 4GYBA 3MLRH 5JW4M 3B9VA 5E2UL 1FJ1B 3KN8A 5C9KA 2Z0UA 2X7LB 4X6FA 3VO0A 5IHHA 1IBGH 4WW2B 3IOVA 5I5IA 1G6VK 3O6LL 2B4CH 4MDIB 3VVDA 4PRIB 5I74C 4F91B 2DEYX 3UO1H 1NAML 5I23A 5B8CC 2E75C 1BVKA 2EC9U 4OEVA 1J8SA 2AEQL 1KXTA 5MP6H 1CU4L 4Y16A 1G0HA 4B9ZA 5T1KD 4QUOA 1ULVA 1I8KA 2CKBH 3KPOB 1ZVNA 4MNQA 4QRAA 4JHAL 1R5IB 2VW4A 3BPCA 4XNQB 4YKJA 4J3OG 4PJEB 2A6DB 4OZFB 4L9LB 1TVHB 2H0PA 3MUJA 3SDXF 1V10A 5SV3A 1INDL 1Y0LA 4GIPD 1OOAA 2H1PH 2DLEA 1UA6H 3AXLA 2YLHA 5I1LB 2BSED 3NA9L 1YMME 2EYTB 3QJZA 1UASA 2Q74A 1EMTL 4XPTH 4HK3N 1KTJA 3FQXA 2P24A 3TIEB 1J1PL 1JPGA 1P1QA 4HC1L 4FHBD 1A40A 3WUWG 1P5UB 3KYMB 2L7EA 2VMDA 3LUZA 3KHOA 3V0VA 3ZTJG 3RL2A 4G7YH 4FABH 4Y88A 1M57B 3F7VB 3KLLA 1UWYA 2I69A 2ZWLT 1P6WA 2NPLX 3I6KA 4IW4C 1KZYA 2D4DA 3ARBD 3KW7A 5T3ZL 3S5LA 2I7OA 5HYJA 5JHLL 1LJMA 3MBEC 2ZKXA 5IMLA 1XVYA 2GABA 4XVUD 2XSKA 4K71C 1M3IA 3NJGA 4L37B 3DPBB 3GJFA 3NYKA 2E8ZA 1JZEA 1LP9F 3KNBA 4KK6D 4XX5A 3MV7B 3O6GA 3WAJA 4BH7A 5DS8A 4OKDA 4OJFH 3CSYA 3S37X 2G2NA 3JWNH 2XTSA 4HJTA 2I7SA 4IU2B 5FFOA 2O5YH 3AWFA 3TCLA 3ARUA 3PPNA 5TQ2H 1KCSH 2XTJB 2AEPH 2NW2B 1XGQB 4YHMH 1D5BA 1A21A 2YQ2A 3RY5A 4DW2H 4HV8B 4X6CF 1RZFL 4LKXB 3QUMB 4IO5A 1JZGA 1NFDE 1VB9A 4DT2A 3KWUA 4Q9RL 5H8FA 4WWKD 1UM4L 4I3GA 2IDFA 5E4EC 5FO8A 2OBGA 4QXUL 3V6ZB 3H6VA 1MH5A 1RURL 5F88A 2ADGB 2IOIA 4JCMA 1JHTB 2ERJB 2F08A 5F7FA 3AU1B 1A8ZA 2ESVB 2XRAL 4I0PB 4K8RL 5E5MB 3T4AA 2H32B 2Q7NA 3DX6B 3E38A 1M5BA 3HSTA 3MNMA 4YZWA 1EIBA 3WOVA 3M3KA 2C7FA 1GZHC 5KSBE 5IW1A 3VQ1C 3CH1B 1KG0B 2N0KA 1B88A 2NY1B 4JPKH 1HSAB 5DR5H 4AM0B 1JZ7A 2VDML 3RTLA 4U1GB 3HMXL 4WJ5A 4X8RA 4G5AA 2YPVA 3MC0A 3V5DB 4J3UA 3TEZA 4N2OA 3MV9A 1ZTXE 3T3PF 2GTWA 2NT1A 3BAEL 1H8OA 3LH9A 4EMZA 1QHQA 4JWXA 5DJZB 4ZUVA 3VI4F 1SZNA 2OYKA 3SDFA 4JVUA 1MXWA 3E6FA 2VW7A 4AVKA 1CIDA 3LN5A 3BP4B 4JVIA 2P5EA 2A73B 1FSKB 4JHWL 1POTA 3KLAB 1SLUA 5L9OA 3ZL1A 3V7AG 1QKBA 5I1KL 4Y4HC 4Y5XB 4UZSA 5IB4B 4NMYA 1Y1ZA 4QHUB 5F7KC 3IDXL 3FYIB 1TTUA 4NWUH 2X28A 2YBGA 4P9MH 1PDKA 4HH9A 3EO0B 3T2QA 2AJSH 5HM4B 4NT6A 2LU4A 3OR7A 4U22A 3ZSTA 1P9MC 3ECUA 4XNYH 2VXQL 1NPNA 3CK0L 4KTDL 3GM0A 3GSVB 2L7UA 1DLFL 3DMMB 2KC0A 2IWFA 1S3RA 2G4GA 2NR6A 3GRWA 1UA3A 2B1HH 5DJXB 4DAGL 4KJYB 5C9JA 4KCCA 1W80A 4KTEH 1SOQA 3WHXA 4FNLH 5D6DA 5E6IA 3PGFL 3RY6A 1IQDA 3EJZC 2MTAA 3FCSA 3HUJB 4LEOB 4OD3H 5EBWA 3BIBX 4LSPH 2QRYA 1R9LA 4OCMC 1AQKL 2HG5A 4LP8A 4LSUL 3NCEB 4QRSA 3FHEA 3H9HB 1U8PB 3AQZA 3CFQA 5DJ6A 1SYSA 3SDCD 4BQBA 1S7QA 3TBSB 3Q25A 4JSDA 1A54A 5I76A 3DOSB 1FO0A 1M6UA 2XIDA 1FTKA 1P1VA 2BY0A 1AD0A 1H5BC 2AMUA 4PIRF 2R83A 5CP3H 1DEDA 3QDJE 3DO7B 1Q8MA 4MHHG 3S36H 5EU5B 2Y7MA 3VFPA 4EDXB 2NT0A 4RWHA 3FJTA 2NXZC 4WTWA 3SKOA 4HS8H 2NX5B 4X9TA 2C9VA 4PS4H 2NXYD 1CFTB 4I48B 1V27A 2ICCA 4LPWA 3UPRA 2YEVB 3DVNB 3WGUB 2NLJB 2CH8A 2WYZA 4NNPL 4DPBX 1B1HA 1UURA 1I3UA 4XHJD 3WHE1 4AK1A 1PC3A 1GVCA 4MD5A 1MW0A 1INEL 2QMJA 3FATA 1ZVSA 1MG1A 2IGFH 4KYEA 4MZRA 3LV3B 4P8QA 4X42A 4YHOH 3T3PE 5C07D 1DL7L 1F45A 1VACB 3UADA 2QJEA 3ARED 1YEKL 3SO5A 3WTYA 3RPIB 3VI4E 2PYFB 4MJ6B 2W81C 5CRYA 3SE4A 4HU8A 1DVFD 3NFSH 4EXKA 3T0BA 2ZD0A 3MNDA 1KEML 3QDME 1JI1A 1O6SA 1OAXL 4GW4B 4KV5F 5FCSH 2QL3A 3QYCA 5IMMB 5CIPH 5JZ7C 4DP2X 2CR6A 3V4PH 3FT1A 2PMZA 1Y20A 2QFRA 4GXVH 1TZOA 2NZ9C 4ODSL 5CFHA 1IBFA 3B56A 1H3PH 3IB4A 4LARH 1YEFH 2JV6A 5C08D 5HYSB 4BELD 2AGJH 3VD3A 2NY4C 2P24B 2NY2D 3QZOA 3VA6A 1WIOA 1XBRA 5EYFA 2WWMD 4QSEA 3EGXA 4NO3A 4BM7A 2YKLH 4OCYL 1G87A 4XN5A 1NA8A 2VMJA 2ZWKA 5CCJA 1Y7VA 3PHSA 2BVPA 5JIDA 3ABKB 3IDNB 1XCTB 2Z92A 4N9GA 1FPTH 3GBBA 5GGRA 2G29A 2GIXA 3HC3H 4MA1C 4XMKL 2LU7A 1CT8A 4LHJB 2ZSWA 3ZOAA 4RDQF 2W0FA 4I62A 4JNXA 1G5AA 3LQMA 4LRIC 1SW4A 3INUL 3GQFA 3OENA 3BDXA 3O3DB 4KZ0A 3GXMA 2E4TA 3DXAD 4OQTA 3ZKXC 5FXCH 5JORB 1JG9A 5B1BB 4YDKL 3EJRA 4QTIL 5GGSY 3N1MC 3W2DL 2I60L 5T3XD 2DQUL 2WXLA 3OR6A 4OF5A 4DI4B 3FOMA 4LVQA 1ID2A 2NQ3A 1N0XL 3H2WA 4WGKA 3I75B 3NJKA 4TQ8A 2QVUA 3M6DA 3WN5A 4DEUA 1A7PH 4GBXC 3IXAA 4YK4C 4FP8H 4IRSD 4OZ4A 1G1OA 4TVPH 1ASPA 1XBDA 4IS6A 4N25A 4MTMA 4H0HB 4HQQL 1HXYB 1M7DA 2JF1A 5BVJB 5ANMA 4DETA 3KN3A 1T0MB 1FBFA 1DVTA 1SW5A 4F8LA 4GUPB 5HVHC 3BE1H 3SODB 4AZ8A 3SJVA 4ZFOB 5AEAA 3MLSL 4GRWF 5BO1H 5LG6A 4U1HA 4LOUD 4PAFA 2QFLA 5F7AA 2O5ZL 4NAMA 4PJDF 2IDCA 4KHZE 4QF9A 3RQTA 4S1SH 1OV8A 4FTVE 2BXYA 3LRSA 4Q58C 3UTOA 3ZIYA 4PRBA 3HMWL 1XEUA 5HYFA 5I0ZA 5IJCC 4TL4A 5JQIB 4OVRA 3FUJA 2HFBA 5E5LA 2X4TB 2N3JA 5D2LE 2QELA 2VRQA 5MENA 2NY5L 2A77H 2BHFA 3DX1A 3MLWH 3MRGA 3U4EB 3WL9A 2FH6A 1LEIB 4NWDA 1VSCA 3QJFA 4AB6A 1DBJL 3AACA 1IEAA 1GS7A 1FF5A 3CAFA 3N44F 2MSPA 3G5WA 3OXRA 3TJHD 5GZOA 4FYTA 3MV9B 4FQ2H 5D7LA 3PIQB 5FOBB 4H1LB 5CUSL 3DLNA 5IB5B 4G68B 5I6NA 5DT6A 4FYQA 1TO4A 1D7BA 3E6FB 4L48A 5D8JH 2AZUA 5AQ0A 3LN5B 2P5EB 2VZSA 3NP3A 4MJHA 2Y7PA 3MROB 1N9PA 3HJEA 2HXWA 2E5EA 1G9HA 1PS3A 4FJYA 1SYVA 1KIQB 3II3A 4UT9L 4YFEA 2V84A 1PG7W 1QLEH 3S8WA 1XR9A 4CJ1A 1G7QB 3PF2A 1J86A 3PGDB 4JGMA 1PDKB 4BKTC 4F37K 4R2BA 3TAJA 3C5XA 4ZMLA 2VLLB 3DK0A 3S34H 3CN4A 1OVTA 3HZYB 2CBOA 3OR7B 4MA3B 4N87A 1MI5A 4TNFA 1J0IA 1AO7E 3QJVB 4Y19A 1XMWA 2MHAA 3UG5A 4ES8A 4PF8A 5AVSB 4J8QA 4BUQA 2FHYA 2UXFA 4G8GE 2DEWX 1MJUL 3FQUA 4OF7A 4WEDA 3H1ZA 1Y07A 4DKDC 1QSVA 3Q2LA 4O2CA 1HHJA 4OLVH 3Q8CA 5FYLL 2MNUA 2NQCA 2ZX7A 4OZHE 1LEGA 3S3DB 1CL7H 3P40A 1S9TA 3AM8A 3AFLA 4HUVA 2FCBA 4JPIB 3QQ4A 3VLVA 2PTTB 4OIAA 5E00B 2HG5B 1KWKA 3N1FC 5J9PB 5B4MD 4PCTA 3E79A 3CZSA 4PJBB 1SYSB 1TZGL 4TULH 3R0MA 2QSVA 2N7AA 4F7MA 5JIIA 1TT1A 1UIUA 3DVFA 4OVUA 4N2HA 4A39A 1FO0B 2PR4L 4Y4FC 3EW3B 4RGMB 1B2YA 1FE8H 2VLKA 4JG1L 4KRNA 1NBVH 2O5NA 4GRWE 5DQDL 3GJFH 4YWGL 2RBLA 4P5TD 2WUCL 3CFIC 2EO7A 3D08A 4FQXA 3VFPB 3F05A 4AYEC 3MSPA 2VE6A 4DP9X 2QV2A 3EYSL 1IM9A 1FNLA 1F58L 1BF8A 1YNLL 1QSED 2BSSB 2AK1H 3GIZL 1UB5B 3QIBC 4IO6A 3LOWA 4WW1B 3T0EE 3UPRB 3GMNB 4FFVC 3F58H 4QRFA 2VD2A 2YA2A 1MCEA 3BP6A 5CHNA 1XI6A 1BZQK 4V33A 5AB2A 4UM9B 2BSTB 2FJHB 5DMIH 2E3VA 1ITCA 5T3ZD 1M5CA 3MJWA 1PG7L 4FXKC 4XBGA 3L3GB 3MLVL 3ECWA 5BMFL 4EXPX 3OAZH 1OGPA 4OZIF 3BZ5A 4DZBA 1HJBC 2J25A 2E7CA 3NEOA 5DC9B 5JO5A 1SQYA 1HL8A 1OP3H 2LFEA 4OJCA 1DBML 4I1DA 3TBVA 2VP1A 2KLTA 1U95A 4Z0XB 3O4OC 9CGTA 1QBML 4HS6A 2YJLA 4QOKA 5JPMA 4NJAH 1DQQA 5CMMA 2JI3A 2ZOUA 5D7HA 1AKPA 4P99A 4G6AD 1IMHC 3OZKA 1EXUB 1YN7A 2BHYA 3QFJA 1KPRA 4H13C 4XCEB 1EERB 2YPVH 1ITBB 4U1SA 3VDBA 5D7IA 3ESVF 3FB5B 4XNBA 4YXKL 1NUFA 4RAVA 1IO4C 4P3DB 3UORA 2WQWA 2Z8FA 3REWA 3QG6B 1U3ZA 1ZJAA 4MCMA 4XRCB 4XNZC 2ZX6A 2FIXA 4BZ1L 4D0CA 5EOCL 4M1VA 1DZ0A 2ALAA 1PD1A 2W0FB 4Q52A 2ADJA 4AC4A 2VABB 5EORH 4O2FB 1CF8H 5EZLA 3L54A 4R26H 3RTQD 4Y0GA 4Z6AT 3VXNB 5JQ6H 3NJXA 4L0YA 2O68A 5CM1A 2AEIT 2I6EA 1ANUA 3HLAB 1Q9WA 5B3JE 2BOBB 4BDLA 1T0NB 3VXMB 4I4WB 5HI5C 4J7RA 5CJBA 3OR6B 4M7LH 4N6RA 4OVVA 4YX2H 1IAKA 1TJHL 2VDKL 4FYRA 1KB5A 1LFGA 1J1XH 2OK0H 3OC5A 4XPAL 1MNUL 1BW8A 3GRWH 1WA0X 2A7BA 1IIKA 3HS0C 5IJBC 4EOWL 4PJGF 4NAPA 2B4MA 1V55B 1SQ2N 5EUOF 1QEXA 3KAAA 2GI0A 1UM5L 2YXFA 3WENA 4MVBC 4AZ8B 3Q8BA 1ZBMA 3NDYE 1YEDB 3RWEA 3GMLA 3O2WH 3ARFA 3H6UA 3PUUA 5FO9A 1WD9A 5LWYL 2AZAA 2PKDA 1H8LA 1L5GA 3EYOA 3I9GL 1IXGA 4HWZB 2DI7A 1FPJA 1N8ZB 2JWYA 5BO0D 2CMOA 1E3ZA 4J3BA 5EA0L 4FERA 4LHQB 1L9OA 1G43A 2APFA 4GQZA 5DJYA 1MPAH 4QTFA 2N1KA 3MNWB 1UOLA 1MWAB 3JV4B 2DH3A 2CCLA 5FYKL 1FLRH 1T1YA 5CNHA 4EN3C 4YU0A 3L3HB 1E5ZA 1WGOA 1IEAB 1RUQH 4RISH 3CR9A 5IB2B 4XE5B 4ZE9A 1NV6A 4GW5B 3L4XA 1MCWM 5TE7H 1M6OB 1K2DB 3AGWA 2XQYG 3RAJL 2X4SA 1URSA 3QUFA 3UBXI 2FVNA 1FIGH 1NV5A 1P99A 5D7JD 3G3GA 4XVSL 4RJZA 2QEJA 5E7BA 4AKQA 5JW4Q 4H0WA 2P5WA 1WZMA 3TN0A 8FABA 2JKSA 1Z2KA 1BD2D 5JIMA 3LNDA 5GRVL 3JQOB 4FFZA 3UYPA 1XR9B 2WAQA 1M2OA 4JFPA 4R3SA 1I69A 4E41E 3WSQL 4POXA 1YMHA 4FIMA 1I9IH 2WVVA 3F6IA 4OLYL 3GJEB 3QZWB 5JXEC 3NZSA 4GPVA 2XWEA 4QRUA 4L3EA 3TH4T 3TPUB 2YIHA 1JWUA 1T20A 5FM4A 4XB8A 3U46A 3L3DA 4UDTA 1AKJA 5DJ0B 4MNHA 1OB0A 2QKIC 4RPOA 2CBPA 3C8KA 3KPSA 3MUHL 2F74A 3GHBL 3D0VA 2OFQA 2CZIA 4BWTA 2A74B 1VFBB 1EJOH 3WKPA 2LR4A 2YC1A 5JOPD 1ZGLA 2EYRB 2VSDA 1QSFD 2W94A 1I1YA 2BS71 2CAKA 5ADPL 1QWUA 4PV8A 1X5XA 1DLHB 3QCUL 2EDYA 3VVFA 1NFTA 2MRYA 3QQ4B 4WJKB 4LPVA 3CSFA 2YD2A 5HI3C 4MF3A 4R72A 4PG2A 2AF2A 2AI0L 1TWYA 1B7UA 4PJGE 2I0CA 2UY6A 1YYCA 3GMQA 2Y2TA 3I6GB 1VADA 2R2BA 3D4CA 4P4RB 5JDSA 4ZMPA 3AQXA 3GKWL 2VLJA 1JVKA 1A3RH 2ZZWA 1CD9B 4EDPA 5T33H 4BXVA 4ZOBA 2H99A 4OQTH 3GO1L 1OE2A 1MIML 1QNZL 1QLFA 2J21A 3FDWA 3FTSA 3K02A 2Y6TE 1CYXA 3FO0H 1CXHA 4A55A 3GB7B 3F65A 2J8HA 4H20H 4OGAD 4PB9L 4M62H 1NOAA 2IAMA 4JFSA 1BCIA 2R4RH 4HIJB 1BM3H 1Z9NA 4PSPA 3VI3F 1FTMA 1GYWA 4JRWA 4TM9A 5G2NA 1XS5A 3IU4L 3LPPA 3OVUB 3D4GA 3FZUC 3R7XA 5J56B 2OMTA 3F7QA 1WLHA 1ZVYA 1QX1A 2RCSL 4UIMA 1Y18A 1J0YA 2V9UA 3WXWL 4DZBB 1JF5A 2JKIS 5EU6D 2EYSB 3SPJA 5KW9L 1ZS8B 3BQVA 4X8JA 3F12A 1AJ7L 3PJSA 2OLBA 4OSUL 5IMOB 1E7VA 1FHGA 3EYUL 2PYYA 1DQVA 3EO9H 4QXTB 2PVUA 4RXLA 4JFZH 1NOLA 3CFJB 1QUNB 1U95B 1UB6B 4G9DB 4ONGH 2Q6WA 5EYGA 4IM8A 1S7WB 1VA9A 1IAIH 5IESH 1I1FB 2APXA 5ITBL 4H8PA 4PLKD 4OLUL 1DEEB 3S88L 3D2UB 3VD5A 2NUTA 4Z0IA 4M1GH 4APXA 4UUJA 5IT2L 4POZD 4Z3TA 3KZ8A 4F9LC 3DA0A 4UILL 2OP4L 4GRMB 4DO6A 5HHNA 1MCCA 5JA9A 1X7TA 5F3FA 4MAYA 4NZTL 3RWJA 3TEWA 3GJFK 3Q48A 1TU2A 3WTWA 3ZO0A 4WO4C 2BVEA 1QBLL 3ARWA 2MOQA 1BZ9B 3QEQA 3GLAA 4U1IA 1QVOB 2NYYC 4JG0H 5AUMB 5AAMC 1TJGL 2R7EB 4NCC2 5AOZA 4A67A 1A1OA 4FQIH 3VE0A 4PI0A 4BRJA 4HVBA 3VFVA 4XAKD 5I15L 4RY1A 4YPGB 2WBJD 1JTPA 4XBEH 3PNWA 3H6JA 4P56A 3D39E 2AJVL 1P5VB 1U8LA 3GSNB 5IQLA 1X6LA 3ETBF 3B7SA 4HBQA 3KLHC 1YEEH 3DURA 5GS0C 4LPUA 3MZBA 4LATA 1A47A 4NZDA 4HMCA 2ZCHH 4Z7UF 2X3CA 3H7LA 4YFLF 3VB9A 3WTTA 1DMBA 1OP3K 3LS4L 3CU1A 3RB7A 4RX4A 1JP5A 2ICEB 1U8MB 2Y5TB 3EFDL 3O6FD 1D5IH 3VI3E 2OW7A 1NOFA 3FBQA 4ENEC 2JKJA 4GP8B 2BCKB 2VN7A 3RWEB 1AR1B 3GMLB 3U4KA 5I1GL 3D3VB 2WCSA 1A7QL 2BNUB 5EF3A 2B4LA 4ANUA 3T9XB 1IGJA 5ISZA 1KIUB 4OCWH 3GM8A 4GO9A 4L0PB 1IKNA 4LCVA 1Y6NR 3BDYL 5K59F 4YB6A 4DEPC 1LM8V 3M88A 4KUCF 4KZEL 2NVUB 2YARA 5F7DA 3K72B 4GAFB 2ZX8A 4QHKJ 4ZNEA 3ZIMA 4BKLB 4B3VA 1ROCA 4P23B 5D70L 5TDNB 4L4TD 3GTNA 4Z23A 1UZ8B 1ZA3A 2Z34A 1NL0H 1H6EA 2DWYA 3DTXA 3FQTA 5FYLD 4GWSA 2X4SB 2BDNL 3EHBB 4YICA 5KYXA 1UOWA 1AR2A 1M1XB 5EO1A 1ZU0A 1BYPA 5DZJA 1NC2D 1ZXQA 3TURA 2P5WB 4X4MA 4DGIH 2FSEA 2ITFA 8FABB 1F9BA 1L9PA 1QYGL 1LBCA 1HHIB 4UTBA 2XV0A 3B7TA 5JEIA 4HKJB 4NENA 5EBGA 5EWIH 3ZE2F 1EAPA 2AQ1A 3P4NA 3UC0H 2LTQC 4JFPB 3TEXA 3IJOB 2X6AA 5A7BA 2F36A 4XCNA 1MQKL 43CAA 3LZLA 1SLWA 3BVNB 3TJEL 1EUTA 3GIVA 3N9GL 1BV8A 1UT1A 4A7TA 3DIVA 3VFGH 2DIAA 1HHGB 4O7MA 1SN0A 1F2XK 3UERA 2J6EL 4FA6A 4UDTB 1H3UA 2IBZY 2REJA 1TJIL 4Q0XH 1W0WB 3UAJD 1U8CB 5KBKA 4ONFL 1KENH 4IRJB 1B4JL 2PXYA 4NO5B 1ANFA 2NOYA 3OEKA 4HZLA 2Q3XA 1DPPA 5CR1A 1INQA 1YNTA 4YE0A 1WRFA 4IBVA 1FBEA 4JDTH 4M9OA 3IFPA 1GA2A 2VN5A 1UOKA 1FH5H 1B1XA 4R0LA 4UQIM 3UIYA 5IOPB 2DLHA 4FEMA 1PJ9A 5B38G 2IAND 2CO2A 2IH3B 3ZQWA 4Z7UE 3KYKL 4OZGF 3E0GA 1SXSA 4A7GF 3ARPA 4IGBB 4GO8A 2E7HA 3G3JA 4GKOA 4JN2A 1N6VA 4LIQH 3RVUD 4M3JA 4Z5RA 1MIEL 3GK8L 5TE4H 2WXJA 4HSCX 1L6XA 1SPIA 4ND9A 4RMSA 1MNNA 2R69L 3PAZA 1DN0B 4YZZA 2VRAA 4MNGA 2JLPA 5SWZB 3QJSB 3C60D 4KKNA 4ZSOB 3L5IA 4NKDB 4HKXB 3Q44A 4AW7A 4DVRL 1RPUA 1D9QA 1MDQA 2X4PA 1WISA 3V5HA 1UD4A 1KMGA 2C9UA 1QLFB 3LDBB 3TTNA 4NF5A 4TF4A 2QS4A 5H2BA 5K59E 2FX7H 1AQ8A 4K7PL 4FJZA 1OGAA 5T5NG 1VGEL 1FYTA 3HI6L 4IDLA 4QRRA 1IAMA 3IMTA 2WQAA 1ZV2A 3IJHB 4OAWA 2B8OT 2J7LA 3O11A 1KB5H 4I87A 4OIIH 4NX0A 3V6OA 1QFOA 1I85A 4PC9A 4PAKA 2ADFL 1S9KC 1B4ZA 4P2QA 1N59A 3A24A 3H3GA 3Q8EA 2GSGB 4OV5B 4XVTH 4Z7WE 5E08H 5I1HL 4PRHD 3KDMA 1G7JB 4XKPA 1UCBL 4EZLA 1H9DA 4N20A 1D9VA 1B0RA 1JMZA 4U49A 5KANI 3MJ7B 1D9KA 3I84A 1PTZA 4R4BA 4KPHH 5JPNB 3AC0A 3NBNA 1RYXA 2Q8MA 4HF5H 3ILUB 2W07B 4GXUN 4F2QA 1RZ8B 3UTZA 1MHCB 2QADB 4GG8A 1ET8A 1SOKA 4PY7B 4WTZG 2XV2A 5MEOA 5D7KD 4F9PC 1LAFE 1YXIA 4PWGA 1DBKH 1TTAA 3RGBA 1NV4A 4F39A 4ZTPL 3RX5A 5TQ0L 3MRRA 3OMNB 1C12B 4ELDA 4XVJL 3IBOA 4G42B 1CS6A 1B0WA 1D2PA 4M5SA 3NCBB 1A9EB 2EIJB 3H3PL 2VDPH 4FQQA 4MB5A 4M7JL 3NA4A 3VGFA 1FBDA 1QFHA 5CEXB 1NBYB 3MRMA 4HJJL 3E80A 4MAYB 3RWJB 4C55A 3WFCH 2E56A 1TT6A 4OGYL 1CLVA 4NDMA 3QEQB 2AV1A 2VKXA 5FK9B 4ZXBA 1KA0A 3O2VL 2OWZA 4NX1A 1SM3L 4YKKA 3TV8A 1KYOJ 4YLBA 3FQYA 4FFYL 2VGQA 4CKQA 4FFZH 3P11L 2WBDA 5EQ9A 3CSBA 3HI5L 3QZPA 2N7SA 1SXAA 2Z31B 4MMXB 3MVWA 1RIUL 1A6TB 1RUPL 1R9FA 3RHWK 1G1CA 3VE1B 3TO4C 4JN1H 5FYKD 2ZCLH 2HJKA 1A65A 3KC0A 5DK3A 1R1CA 3Q2CA 5DWUL 1TIUA 3LRKA 2XA8H 1GGBL 4AYFB 5J13B 1GGTA 3KPNB 1L0PA 5E4OA 1LD9A 5E1GA 5J8OA 3CHPA 1SXZA 3NIFB 3D0AA 1AIFA 1A6VL 4DP1X 2LVEA 4C47A 1MQIA 5I2KA 4FEDA 3VYOA 4LKCB 3DGCR 4S1RL 1Q0EA 2IH1B 3ZJAA 1JXKA 2GC4C 2PCFA 2F54A 3OX8A 4MXWH 2QLVB 4F3FA 2QFPA 4OIFA 2OYMA 5KSUA 3ZKLA 2NNCA 3O6MH 3KLSA 4K73A 4YSRA 4A6YA 1E27A 3QG7L 4G7QB 3CX5K 5KDTA 5ET5A 5DHDA 2OQJA 4YVNA 1DJWA 5CJXC 3LEVL 3X12B 4KQ4H 1HH9A 4L4VA 5FYJH 3RGHA 5DURD 1IC7L 1PLBA 4B9JA 2WXPA 2OMVA 1P7HL 4WI9A 1S7SA 1CMOA 3QXAA 4ALAC 1AMYA 1HHKB 2VZOA 3UGUA 2DQHH 2PYEA 2EVIA 2J8UA 4GG6A 3Q9QA 1QKZH 4N2FA 4Y2DC 2Z35A 4YNYA 1JZIA 1H3GA 1XHHA 2VQ4A 3GBLA 4DP5X 2H2PC 2J4WL 3ZZ1A 1ZA3B 5C0RL 4G83A 4L8BA 1GKOA 3RY3A 4MB1A 3W0WE 1ID5I 2H6PB 3CN2A 2CJUL 3T0EC 2Y06H 2WYKA 4A7QA 2WIIA 4R4ND 3BIKA 3FULA 5I57B 1E28A 4YL9A 1NCUA 3IFLL 3CG3A 5LAXB 4FNRA 4NENB 4XMPH 4AL8L 2YOAA 2OCUA 2DMCA 2P46B 1A7OL 1EAPB 2XXTA 3PP4L 3HG1A 4W9DC 2VR3A 3U7YL 4EBQL 4GRKA 2AK4A 2QS1A 4YHLH 3KC1A 1SGKA 4IOSD 2DLGA 3PWVA 2JJSC 1ML0A 4LK4A 3QQ3B 3RG1C 1A6PA 4QPEA 1N5YL 4LPXA 4MJIA 3PUWE 32C2B 3QQ9C 4H5FA 1N7MH 2W0LA 1WWAX 1K5NB 2ICWJ 5IQ7H 1NH7A 3VXRE 2ATPB 1IGFL 3ZL4H 1MDAA 5EQAA 5GS1A 1UOVA 3CFTA 1WFIA 2YKKA 2JJTA 4A1RA 4E36A 4MNCA 2FRGP 2KL6A 3IFPB 3U0PB 2I9TB 5J89A 3L2MA 5DZPA 3RGVA 2VDOH 2C7UA 4NM8H 1ZE3C 1JCVA 5CKAA 2EUXA 3GSWA 1JSYA 1BLFA 3MJ6A 4GAJH 4ETYA 2PCRA 4BUHA 4N8UA 4C4UA 5AENA 3B6QA 3PDGA 3BQUC 3SDDC 3KMDA 5D9SB 3CFMA 2ZUQB 2FO8A 3KJ6L 3G7WA 3K46A 4NQCB 3D1MC 3PPQA 5BWJA 1NLDH 1LEKB 2P48B 1CGVA 4OLXL 4BFIA 2QPEB 3P30L 1F6LL 2X4PB 4FE9A 4A63A 4LF3B 2N0MA 1KTCA 4UF7C 1CICB 2UZXA 5EPMA 3RWCA 2YBRA 4XP1L 3EKIA 1DBBL 2DD8L 1KTDB 4MLIA 5H2BB 1TETH 5KBMA 2H6OA 4NO0D 2ZAGA 1TZHB 1U93A 5F0JB 3ZHKA 3K01A 1YNKL 2HX7A 3FOLB 1IAIM 4JO4H 3UCQA 4A2EA 4N6DA 2Y2WA 1ORSA 1MCLA 3MMEB 1TEGA 4QGYA 2E7LC 4P2RE 1TO5A 4LSVL 3UGWA 4QMEA 1U2HA 1X7SA 4ZMQA 4P2QB 2BFVH 5IZ1A 5IZZA 2WY3B 4XOBA 2G60H 3WJJA 4IY5A 4PAIA 3KDMB 2PF6A 4GIOA 2XXRA 2OV0A 3CCHB 5ELIA 4ZPVB 5A40E 1U8QB 5D5MF 1FCKA 4PGZA 4I0CC 2V2WA 3UPAA 3SE6A 3EOAA 3VFTA 3A6CL 1LQBC 3FUDA 4CVZB 2DLFH 5J16A 4JFDD 1ND0B 1NCBH 2OZ4A 2X7PA 1WZKA 2KT6A 3KYOB 4GG8B 3EF7A 4UU9A 5MEOB 1W0VA 2HKHL 4D9LL 3F7LA 1MREH 3DV6A 4K7PX 3KBRA 3M3FA 3VDFA 2C9XA 1TYJA 4I7ZC 3A6BL 4JM2D 4H0IA 4ZS6C 1BF5A 4N90D 2KDYA 1R0AH 5E0QA 1UKSA 2FATL 2WLIA 1GH7A 4WENB 2FBRA 1CN4A 1ZDSA 5EZJA 3WLWC 5I5MA 1U58A 4LOVA 4Z95H 5T1MB 3MRMB 3O9WB 3QIUC 2XPGA 4P3CL 1O5DT 4F37F 2DZEA 3CSGA 5DD1L 1QFUL 3NSCA 1NCAH 3JVGC 4Y4KD 5CD3A 1JGIA 1OLCA 4GVOA 4MBPA 2EEDA 4PJ8D 4U1NA 3EFFA 4AJVA 4H5SA 2BC4B 4P2OB 1A8JH 2EAEA 3WXVH 5AVQB 4NFBA 1WG3A 2J12B 4AUYA 4ZMVA 3C34A 3ALWA 3FU3A 3KPRB 3I3BA 3JUZA 4UTBH 3C09B 4JDFA 4C1UA 1JN6B 3AT8A 3MBED 5BRZA 4ZX3A 1MFDL 2X0VA 1XB8A 5FW6A 2YLKA 3B7UX 2MCPH 5D96C 5E99H 2HJKB 2P1YA 1BSIA 1Q9OB 2E7DA 1FGVL 4G6KH 3UO1L 2AJUH 5D72H 3BWAB 4QT5A 2COQA 5MP6L 4FQCH 1URDA 1LD9B 3UL4A 3TX4A 3PMXA 5L2JA 2CKBL 1EXHA 3TFKC 4F15B 1DCLA 2PTVA 1II5A 5I2KB 1G1KA 2I5YH 5DVLA 4XR8C 4YDNA 4X7DC 1YCJA 1RZJH 4UT6L 3FIRA 5IGXH 5HDBB 3TASA 1DUYA 3NIDF 4G7VL 5H37H 4LO9A 4QRPE 3SE3A 1B3JA 2RKMA 2A9NH 4RSVA 2W8CA 2P0SA 5ITOA 2R8SH 3ZDZE 2H1PL 4WW2F 5IUSA 1S7RA 2GJJA 4BDNA 4B9IA 2H25A 5KDTB 4R7DA 4Q6IC 4OD1L 1A1NB 3W9WA 4M8RA 4L4VB 1R3KA 5MEPB 1QUJA 2O7IA 2ZG1A 2EP6A 3K6OA 1PW3A 4F57H 4N2MA 3WJMB 1JNHB 3QUYA 1P84J 1KOAA 1EZVY 2ITCB 1ZKBA 3AS0A 3Q06A 4U21A 1M05B 5FTIA 1BQHB 2BNQE 3MTXA 1MCJA 3ILQC 2XXGA 4KHTH 2V2XB 1RSFA 1AS7A 2WZAA 3HE7B 3PNRB 4HPOH 5HHQB 3OJDA 4PJEF 4FABL 4GG6B 3M46A 4F92B 5KG9A 3HHFA 2Z35B 5CSGA 2X26A 3VFJA 2HUHA 5IGAA 3CZGA 2VR6A 1WBXA 2EUWA 3LXUX 4GNKB 2F5AH 2FDBP 2YD0A 3LKOA 4AQ1A 4KTYA 3M1CA 1DP0A 1QULA 4MH5A 3N42B 2YD3A 1S5IH 5F7VA 3BFWA 4S1DD 5I6OA 1O6TA 4WI4A 4V2BA 1OALA 4XO9A 2GAZB 3ARGD 4D0DA 4DUWA 5L4JA 1KTLA 5DC0A 2MCG1 2R23A 4BSJA 3O3AA 4OJFL 3R18A 4KQ0A 4OERA 2IWKA 2WMPA 2WOBA 3HB3B 2YXVA 2O5YL 2UY7B 3S4UA 1SW2A 2AK4B 4JFQA 4YHML 3NK3A 1YJDH 3FTVA 1HWHB 3WDHA 5F7EL 3I6VA 4NP4H 3M1BB 3QE5A 4JFED 4U1JB 4XMLL 1DJHA 1CWVA 3ABLB 4L29A 1PKQE 4Y4HD 5C0CA 1QA9B 5DW8A 1UACH 3QCTH 1RJLA 4YJZL 4IHOA 4HHAA 5SWSE 3P9MA 3CDCA 1KV3A 4TSBH 1F6AB 4I3EA 3P9LB 3GGWA 3HO7A 3UYRH 2D2OA 2VJ8A 3TT3L 2H4IA 5JUEH 4M1DL 4Y5YB 3V7MA 2CLRA 4UOZA 4Q74A 1KDIA 4NFDA 2V5RA 3KXFA 5MI0B 5I1CL 3C35A 4BA0A 2RC8A 1FORH 5DC2A 3KLKA 2VD3A 1OAJA 2GW5A 5IHZB 2ROXA 3NTCH 1ZV5A 4NJ9H 5KWYC 3COOA 4Q2ZB 1ZHLB 6FABL 5D2NC 3U9UA 1BJ1J 1XF1A 2V8MA 1MFMA 2ITEA 3FFDB 3RX7A 3LNGA 4JPKL 3D9AH 2OA9A 1YY8A 2BXZA 2MJWA 3RQ3A 2JQMA 3MNVA 4X99B 3VWJA 5JHBA 5DJAA 4P4KA 4KMTH 1A3ZA 3M1OA 1BVOA 4C1TA 3HRZC 1WZ1H 4PRIE 5DFAA 3R8BB 4BFIB 2P7TA 1J8KA 4NQDD 4V1DA 7PAZA 3KL3A 4X6BB 1OTTC 3OB0K 3TF4A 1T2JA 4C4KT 4DGVH 1YEIL 2DEXX 3TQWA 5DLMH 2JJKA 2L5VA 3CH8A 5DI8B 4AIXA 3L3KA 2CPCA 4WV1B 1JGLL 2AXHA 1E6OL 3UBGA 2A6JA 5EHSA 4HWUA 3L4CA 4RGND 4ADIA 4Q8RA 4OCSH 1AZUA 1JDCA 3TYFA 3E4RA 5F7BA 2YSSB 3SGDI 1FN4B 4BFNA 4YKPA 3GSUA 2QSQA 1PZ3A 4RA1A 3VMOA 5GRXG 1RZKH