3D4GA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
471
Chain Sequence
TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 144
structure length 471
sequence length 471
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA01
1ELJA 4ZEDA 4LZ7A 2V3QA 1GR2A 1JVYA 2DOJA 3LC8A 4KPTA 2OCUA 3HN0A 5DEXB 3M3LA 1LAGE 2QS1A 3CFZA 5IAIA 1B3HA 4IO6A 3S9NC 1WVJA 2X7QA 2XD2A 1YAEA 2GH9A 3IO6A 3OEMA 4OENA 3UK4A 1D3KA 3CRBA 2H99A 3K6VA 3OO7A 1EZPA 2F36A 4F1YA 2Z23A 4H8JA 1D9VA 1S7YA 2ONKE 4NWDA 4FAJA 2XX8A 3IR1A 1ZIUA 3R6UA 3SEUA 3SETA 2IA4A 1NH7A 3MVXA 4U1ZA 2XXWA 1F9BA 1B1XA 1NH8A 3LSLA 4JXIA 1HSJA 3A3CA 4LATA 2IEEA 4X48A 4RK9A 3S9EA 1Y9UA 3KOTA 1Y1ZA 1MY2A 1Y4CA 1DTGA 1A40A 3MVWA 4H67A 3RTWB 1URGA 1XHYA 4OYVA 3U92A 4R75A 1LAHE 2ONSA 1Y3PA 2R71A 3FZVA 4G68B 5AA3A 4DDDA 1XS5A 3BFTA 4P0IA 1N7WA 1UTBA 1NFTA 3JV9A 3C34A 2OK2A 2UYFA 4POWA 4RNSA 3HV1A 4X1DA 1UTBB 2Q8JA 1JETA 3K4UA 3C35A 3KSXA 1UIUA 2RCBA 2UVGA 1RKMA 1SI1A 3BFUA 3N26A 3C36A 4JSOA 4P0GA 4TOZA 4YKPA 5DTBA 1LAXA 3B7DA 4KYSA 3V8XB 1MQGA 1PBPA 4G4PA 1EU8A 1OLCA 4G8HA 4IO7A 3ZS6A 5AA4B 4K3FA 4YB5A 4OESA 1MY4A 3VLVA 5I58B 1YTVA 4ISUA 4TQUQ 3M8UA 3PGFA 3FXUA 4OEUA 1B7HA 3FASA 2I3VA 3UORA 1FQEA 1MDQA 3KFMA 1MXUA 2I4BA 5DT6A 4XKQA 2DS9A 3DLNA 5A5XB 1IXHA 4QF9A 3K01A 1XOCA 2DYXA 4RPNA 3KBRA 3ZSFA 4FE8A 4GWOA 4F29A 1NNKA 2ABHA 1DPPA 1MM6A 1B3FA 2PBWA 3IOVA 4QFOA 4ESXA 5BWJA 4PE5B 5CBRA 2AIXA 1H43A 4JWXA 4RK2A 5CMBA 1P1WA 3FVNA 4F18A 5DEXA 4OWDA 4EXKA 1JEUA 5CC2A 1P1OA 1B46A 1DSNA 1MG1A 2I49A 3OEKA 5FHNA 2P1SA 1B9JA 2OWSA 5L9SA 4XIGQ 4NF5B 4BDQA 3VDFA 3K02A 2VGQA 3CFLA 1FTKA 3AXFA 3Q27A 4JB7A 3RLFE 1XVXA 3TMGA 3TQLA 3W9WA 3KG2A 5B7DA 5I58A 3H6TA 3P7IA 4FECA 1B40A 1Y1MA 2H4IA 3DELB 3PV0E 5H8FB 4OQOA 3MC2A 1QKAA 2X7PA 4U1OA 3E4RA 3E13X 1D4NA 2Z8EA 2Y7WA 5KDTB 3SESA 2G93A 4OMBA 4DLDA 4ELOA 2F7CA 1LB8A 5EHSA 2O68A 3LSFB 2DWJA 1USYH 4C1TA 1FQDA 4UACA 3KJTA 4ECFA 3IJXB 1FQCA 4M4GA 3D4CA 2QPQA 3TTLA 1XC1A 3OSQA 3M3KA 3FXQA 4KCCA 4Q0CA 3W15C 3WAFA 4AB6A 2P2AA 1LFIA 1IXCA 3K1MA 5CMMA 1MM7A 4FEBA 2F8DA 3QUJA 4H1XA 3MVYA 2UVJA 4KYEA 4U2RA 3TCGA 4R2FA 3B6QA 1MPDA 3VFJA 1ZLQA 1B5JA 1FCKA 4WEPA 1VFEA 3HO7A 4OEVA 1AL3A 3R26A 3RQTA 1IXIA 2ZYMA 3CG3A 4Q5TA 5H8NA 3PUWE 1IXGA 3EF7A 1A8EA 3U72A 1MY3A 3FUZA 3S9LC 3H6UA 3T22A 1Z7ME 4DZ1A 1DPEA 1LBCA 3MZBA 3MVZA 3FATA 1JW1A 2XXQA 5TP9A 3TELA 1I6AA 1MRPA 2XXTA 3MJNA 1Q35A 4IO2A 1SW4A 2M8CA 3CI8A 1TXFA 2Z8FA 4QFNA 1P1NA 3KOSA 4YICA 5L9MA 3FJGA 3S4UA 4BLAA 1B1HA 4MLVA 4BDRA 1BP5A 1II5A 1MXWA 3SKPA 1R9QA 1B0HA 3FGSA 3IO4A 4HS7A 3R7XA 3RTFB 4AB5A 3CSGA 4MH5A 1LLSA 2VP1A 1GV8A 2A5TB 1BKAA 3PPOA 2QSXA 1NNTA 2BJJX 2P0SA 3S2VA 4XKNA 1H44A 5JTYB 1Y20A 4U4XA 4U22A 1QW0A 3CSBA 4YB7A 3WAEA 1FQAA 2ZNTA 3FVOA 1Q1KA 4EXLA 2QJEA 1FQBA 4NWCA 5F1QA 1J1NA 2REGA 1WDNA 4YU0A 3EHTA 5FTHA 4EF1A 4G8NA 2DWAA 3K6WA 5H8NB 5I56A 3QK6A 5H8QB 1MY1A 2QS4A 2FA7A 1B3EA 1QUKA 4NF8A 3Q25A 2NVUB 3KN7A 4GRKA 4OTEA 5I2NA 5ICTA 1SVXB 3BBRA 4I8CA 4RA1A 3TDJA 3TEPA 4FIMA 1SYIA 2O6AA 4N13A 5M2VA 1BIYA 4BDMA 2OBGA 5I57B 4TLMB 3W9VA 2XXUA 3K1PA 3TODA 4KQPA 1XVYA 3EN3A 2F7BA 2XX7A 3G3JA 1P1QA 4QRZA 1EZOA 1LCTA 4NF6A 2UVHA 3T9UA 2A5TA 2DXRA 2V25A 5B70A 2HEUA 4FATA 3E3KA 3Q28A 4ZEIA 1ZMGA 2A5SA 1KWHA 2AL5A 3H3GA 4R6YA 4R6KA 3G3HA 4ELPA 5L8DA 3N5LA 1BLFA 1B4ZA 1MPCA 2DVZA 3PMXA 1LB9A 4U21A 5CMCA 2DXYA 5KCJB 3K6XA 4C0RA 3SEYA 3VXBA 3CR9A 4FORA 3RY3A 4GL0A 2PVUA 3QXMA 1NNFA 4QSEA 2B3FA 1IQ7A 4LZ5A 4I1DA 3TKDA 3LR1A 2DWIA 1IEJA 4GXAA 3PMVA 4R9GA 5IKBA 1IITA 4H65A 1N04A 3LSXA 3OO6A 4P11A 3MP8A 3U1OA 3VVEA 5ELVA 5I59A 1LGBC 4F1VA 3OXNA 5TU0A 1R9LA 3MZ1A 3T9HB 3IB0A 4Q30B 2VD3A 4R6HA 4UA8A 2I58A 3C31A 3KZGA 1JQFA 5FTIA 2F97A 5HBCA 3ZKLA 1SQYA 3TUSA 4HTGA 5AE4A 1B51A 1HSEA 3ILTB 3K00A 3RT6B 3N6TA 1H76A 3IL1B 1A54A 1LBBA 2I3WA 2UVIA 1OMPA 3CG1A 1N76A 4IO5A 4QSCA 5F7VA 3TZAA 3QYTA 1B5HA 3N6UA 4RJZA 3IOUA 2VD2A 1M5FA 4OERA 1PB9A 3PUZE 3NK3A 3PPRA 3MP6A 2F7AA 1M5EA 4KI0E 4NTLA 5ITOA 2O7UA 1SI0A 1SW5A 3RPWA 1VR5A 4LVQA 2DQVA 3OOAA 3UGWA 5DYHA 3VLWA 2PT1A 3EHUA 3L6GA 4ZDMA 3PUYE 4EQ9A 5H8HB 3USDA 2V84A 3LSWA 4I62A 2ONRA 2RINA 5AA1A 4BDOA 3GZGA 3KGCA 4MLQA 2D21A 3I3VA 3CVGA 3KSJA 3O97A 3PPNA 3DP6A 3SEXA 3O9PA 3PMWA 3G7WA 4XKPA 2Y84A 1USYE 1MQHA 3VLUA 2F5XA 4WXJA 1I6QA 1VE4A 4YKJA 5EYFA 4G68C 4ND9A 2F78A 5H8FA 2XXHA 3OO9A 4DXBA 1Y4TA 1S9TA 1SD3A 4IB2A 1LCFA 1MH4A 3O28A 5LOMA 4IGTA 2ZYOA 1LFHA 1Y3QA 2PT2A 4G8MA 4BDNA 1CB6A 3DP4A 3H6VA 2ANJA 3RGYA 2HAVA 2XD3A 3KN8A 3F11A 4EF2A 1MXYA 1YCJA 2GFEA 4JBZA 1ZTYA 5A5XA 3CIJA 2XXYA 4F22A 1SYHA 1O63A 2H9BA 2ZNSA 3FXRA 3HSTA 4GVOA 4PFTA 2RKMA 3PD8A 4Z0IA 1MS7A 3VVFA 4EDPA 4F3BA 1N0TA 5TPAA 2HXWA 4AQ4A 3O2AA 3SDFA 2O69A 3HHFA 2D5WA 1SW2A 1B05A 3ILUB 3OMBA 4F31B 3D4GA 4HW8A 5HM4B 2NOOA 2DE4A 4QFPA 4HCWA 5DVFA 5AA2A 4DCYA 4LP2B 2Q9TA 4RYAA 4PFUA 1O64A 3JYRA 1NKXA 4ESWA 1R1NA 3MPKA 4IO4A 3RNNA 3DM0A 2YLNA 3FJ7A 1YPNA 3OSRA 4GIZA 3VV5A 1LFGA 2I4CA 2E0SA 1NNPA 1ZKBA 2H5YA 4DE8A 1MXZA 3B6TA 1DTZA 3O29A 5DVIA 4WKMA 4O3BA 4Z7EA 4XKRA 3T9XB 3TCFA 5K2XA 3TFLA 3HCQA 5KDTA 5H8HA 5CI5A 2YPNA 4HCYA 2HQ0A 4ZEFA 1AOVA 3SEWA 1JW5A 2VOZA 2B65A 5FHMA 5H8SA 1GTKA 1R6ZA 1IZ1A 2F6PA 2I0CA 4WEDA 5J1DA 5TPAB 3OELA 4OHNA 3T93B 1H3DA 5FHOA 3TYHA 4R74A 4NF5A 3C32A 4KD5A 4EQBA 1UIVA 1B7UA 1JEVA 1Y3NA 2B3BA 2XXRA 4BDLA 2REJA 1JW4A 5JEIA 4YMBA 3FD3A 2QL3A 4C1UA 1AIVA 2PYYA 4NMYA 3GXAA 4H0WA 1L5TA 5L9OA 1MXVA 2HZLA 3Q29A 4YAHX 3T96B 4EUOA 1MXXA 2RC9A 1CE2A 1A99A 4N07A 2Q2CA 4O3CA 1ZBMA 4ELQA 5I2KA 1ZJLA 3MPLA 4KCDA 1MQDA 3O66A 3DP8A 4LZ8A 1A55A 1M5CA 2DE3A 2F6GA 2OZZA 4H5FA 4OFOA 3OO8A 3TTMA 3O6GA 2QMWA 4EQ7A 3IOWA 1MQIA 1PB8A 1N84A 1DOTA 2I48A 3IJOB 1B52A 3M3FA 2DWHA 4O3AA 4R2BA 4L17A 4F39A 4JDFA 3ODBA 4ZZAA 2CZLA 3H6WA 3FVGA 3UA8A 1B58A 1OVTA 1TT1A 4JWOA 1EZ9A 1N3XA 4PFWA 4Q8RA 2RF1A 2NXOA 3IAZA 1WODA 1Z7NE 5ICQA 3QAXA 4LQ2A 3K2DA 3T9VA 1ANFA 4IO3A 3UIFA 4OVJA 2CMOA 2OJTA 2OWTA 2ZNUA 3MW0A 5I84A 3GBAA 1OQGA 3IB2A 2UXAA 1QKBA 3KJ7A 4OZ9A 1OIBA 3ONMA 1MPBA 1QJMA 2ZXTA 1N3WA 3PPQA 2LAOA 3N94A 2QRYA 2VHAA 3L6HA 1OLAA 4POXA 1PEBA 1SBPA 2F35A 5K2YA 5AA2B 4XTCQ 4F2QA 4YZZA 2G29A 2Y7IA 4YKIA 4NF4A 2H25A 3H06B 1D9YA 2O7IA 3U8QA 4ZEBA 5EHMA 3ZKKA 4E0WA 1B7ZA 4ONYA 4ZECA 4KR5A 2FNCA 3MZ9A 4MBPA 4LONB 2O1MA 4LQ5A 1LSTA 4ZS9A 3LUYA 4ZEKA 2R9JA 2Y7KA 2O1LA 4LUBA 2O84X 4R72A 2H98A 1PB7A 4G2ZA 1B3LA 4U23A 4E0XA 1FTLA 3T66A 3NK4A 4H8IA 4GXSB 1N7XA 1FTMA 2RC8A 2W7YA 2GHBA 2V93A 1US5A 4RPOA 2QS3A 1UQWA 4F3GA 1OVBA 1TFDA 3TTKA 1UTHB 5CBSA 1I69A 2XXIA 2RC7A 4JSDA 3QSLA 4PFYA 4FEDA 1M5BA 1POY1 2E1SA 3A09A 1QULA 2DE2A 5BUUA 3SERA 4QHQA 4ZE9A 1PDAA 5ISUA 4R9FA 4GQOA 5AA2D 1QUIA 5TP9B 4QFKA 3IK6B 4OFLA 1OQHA 2HAUA 3IOTA 4YKKA 1BTJA 4KFQA 3TTRA 3GBBA 4H6DA 3V89B 1GVCA 1JVXA 5I57A 2R6GE 3G3KA 4IY5A 3OENA 1M5DA 3UP9A 2X26A 2HCAA 2Z8DA 3QUFA 3HHGA 1SW1A 2Q89A 2GRVA 2XXXA 2OLBA 1B32A 4NF8B 1A7LA 4RY1A 2F34A 3IX1A 3FV2A 2ALUA 4G77A 4NF6B 3B6WA 4GLIA 1A8FA 4NF4B 4NEDA 3TTNA 4GFRA 3FJMA 1ZU0A 1TWYA 5I56B 4JWYA 4M1VA 2I0BA 3KN3A 4PQJA 3EQ1A 3Q26A 1NL5A 1FW0A 3EHSA 5ITPA 3O6IA 1MDP1 4R73A 2QS2A 3VE1B 4RXLA 4YMAA 3S9MC 3V83A 4MF3A 3TCHA 3ECRA 5JTYA 3C9HA 1T0KA 2FYIA 2XX9A 4KYDA 3JZJA 3H7MA 3MP1A 4H5GA 3VVDA 2Z22A 3TQWA 4OETA 2DP8A 3V5AA 5HPQA 1B2HA 1IUDA 3G3IA 3MAMA 5H8QA 1P1UA 4GF8A 4N6PA 3U93A 4F3PA 2ZYKA 1MQJA 2XHDA 3EPEA 3RUMA 4F3SA 2Y7PA 1UTHA 3PUXE 3UN6A 4ZE8A 4F2OA 2XXVA 2KLFA 4I9DA 4LA9A 4PP0A 4OFJA 4GD5A 4FJPA 5KZTA 3C4MA 4F1UA 1VSOA 3GLBA 1FTOA 3MUQA 1FTJA 3BKIB 2Q2AA 3SEVA 4DCXA 1B5IA 1NMUA 1URSA 2THIA 3VXCA 3IB1A 4OXVA 3FIRA 3A3UA 2D3IA 1S50A 2V3TA 3H03A 3QIMA 5KCJA 4X9TA 4IY6A 2YJPA 3PUVE 5I2KB 1ATGA 1PBQA 4THIA 3TAJA 2RCAA 1GGGA 1TFAA 3G3FA 3I6VA 2PX1A 4QFLA 4PETA 5DVJA 5CM6A 4DXCA 1RYXA 2HFBA 1URDA 2O51A 3OD7A 5CMKA 1O7TA 5I59B 3MWBA 2V3UA 4TLLB 1DMBA 2PMSA 3LBSA 1POTA 3I5OA 1HSLA 2Y7RA 3KEIA 3MBPA 3U94A 1I6BA 2NUVA 2DVCA 3THIA 1B3GA 3RT8A 3FVKA 2HZKA 4F19A 4IGRA 1US4A 4YB6A 5I2NB 3H4ZA 3K0VA 1AH5A 2UYEA 3HPIA 2QMXA 3O6HA 3RN8A 4GL8A 3K6UA 1IIWA 2ESNA 4DXUA 1PC3A 2DSFA 4MFIA 5AA4A 1AMFA 1B0LA 1H45A 2Q88A 3MQ9A 3PD9A 3TPAA 2XXPA 3IORA 2I6EA 2ZMBA 3C33A 3CFXA 4ELRA 4XXUA 1FQFA 1B4HA 1VFDA 2ZYNA 1EH3A 2AYSA 1RYOA 3PPPA 4GOTA 4U4SA 1LAFE 4X1BA 1JNFA 2NWJA 1SDXA 3FV1A 1MY0A 1XT8A 2GHAA 1B6HA 1P99A 1QUJA 2WKYA 5CRYA 5JK4A 3G3GA 4G68A 2AL4A 4NE4A 3PU5A 1MH3A 1QVSA 3E9XA 4DIGA 4ZZEA 3K1NA 4KHZE 4QSDA
chains in the Genus database with same CATH superfamily
2BVTA 4GQ9H 2V3QA 2Z7YA 4ZMTA 5T1DH 4WZ9A 3S35L 3BVNA 1PDKA 4HEME 1IMAA 1B3HA 3N40F 4HSCX 3BT0A 2XD2A 1CXFA 3BFOA 4N2NA 1HHJB 2CLVB 1MJUL 2HLEB 2FATH 3EFDH 3LN5A 2Z64C 4YHIA 4JKKA 5EO1A 4F1YA 3MAWA 4KO5A 1T1XB 1DQJA 1WPCA 1GGIL 1MFBL 4OF7A 2Y1VA 1CVSC 3CDGA 4HUMB 5EV7A 2VJ0A 4LP4A 3LSLA 2F74A 4D9RD 32C2B 2ENPA 3Q48A 3EGSA 1R4XA 2EDWA 1HEHC 2VW6A 1IFGA 4K5LA 5D1ZI 2GIXA 3TO4D 3HZVB 9CGTA 3C35A 3LZLA 5DJ8A 2UVGA 3JUZA 3C36A 4X5QA 3L3OC 4JRXE 5HJ3B 3ETTA 3PE9A 5AVUB 4I3YA 1EGJL 1Q0XL 4TQUQ 3QIUB 1M05B 2O6EA 2PN5A 1MFDL 1UD3A 1YO4A 3B37A 4HXAH 1U8IB 1XSIA 3ARPA 3GSUA 4CDHA 4M5ZH 4YDLB 3OZ9L 1Y0LA 4WW1B 2EECA 2SEBB 3DLQR 5E2UL 1KA1A 3TT3H 4S1DC 2BVQB 2ZX9A 4HPYH 3CDFA 3VG0L 4J3UA 2FYVA 4N24A 4O51B 4AITA 4F57H 2WGXA 3IOVA 4I0PA 3LD8B 4J4PC 4F18A 1NLDL 3D09A 1H43A 3MQIA 3QMFA 5CMBA 1KLFA 3HMXL 5IFAL 3LKNB 3O4OB 2X1WL 4WGKA 2DH2A 5B8CC 1AOHA 4YHNA 1H15B 3ARDC 4JZNA 4R4BA 5JHMA 5CCHE 4QIRA 3WXWH 4M5YL 3CLEL 4OUUA 1A14H 5DI8B 2AHIA 2D4DA 5JLZA 4ZX5A 2QSCH 4ELOA 3REWB 4OVQA 2WTOA 3P9WB 2Y1YA 2CBMA 4PY7A 5HVGB 1XC1A 3OSQA 3OM3B 4OGAC 3QARA 3QG6A 3TJHD 4JM2F 2O93L 4B9YA 3W15C 4I18A 3OAYK 3CDYA 5CMMA 3GMNA 1K9YA 2F8DA 1U3HB 3O8XB 1JVKA 3FSOA 5LQBH 1AFVH 1MZZA 2XZQL 1Q94B 3IXTB 3WTUA 4RGNC 2H4EA 4TS6A 2PXYD 3L9YA 2C3XA 5EO1B 4EIBA 4S11A 3MZBA 1FC2D 4D0BA 3BZEB 3LQAH 2AJYL 1JZHA 1AXIB 3HUJE 4HISA 1MIEL 1SJHB 1MIML 1PDKB 2W0KA 2VN7A 4FCHA 2WKOA 4PYHA 4TYUA 1TXFA 2JMRA 2X4QA 2FGWH 1A6VH 4AQ8A 3FUFA 4WNJA 2XIDA 4AQAA 4CMHC 5EPMB 4OFYA 1B0HA 4Y9EA 3VXME 2O6FA 3RVTC 3DIFA 3QBTB 4G42B 5F6IB 2OM5A 5HBBA 3C6LC 2W8CA 1L9MA 5F7FA 1HCZA 4YSSA 3WNMA 2HA1A 3B2VL 3G9AB 2WNXA 2NY5C 1AH1A 2NOYA 2VWEC 2W0PA 1WZAA 1ETZB 2CPCA 1NGWB 3KPQA 5E51A 4AOFA 3K6WA 1D5BA 4PI2A 3ARVA 4PP2A 4HG4J 1KTCA 3VFVA 2QKSA 2R56H 3KN7A 2FEEI 5JMRA 3IJ9A 3K1DA 1I7ZB 3HS0A 2RTTA 4F33B 4G8GD 5FIEA 5J6HA 3KXFB 1AI1H 2DQEL 3X13A 3X3GH 4A6YL 3KPPA 2W59A 3S8FB 4QCIA 3CU1A 3T2OA 3VFRB 3G3JA 5LB1A 1QYGH 4Z5RA 1B90A 1CO1A 4G8FA 1QR4A 4WENB 3E3KA 1UKTA 4PY8J 1PG7L 3ELAT 3T0EB 2IANA 4GB9A 4FEIA 2OL3H 4KKNA 3N5LA 2ADGB 5E6IB 1J1XL 1LK3H 2W0LA 1F4XL 3OXRA 5E8PB 5F3BB 4UOJA 3ARFD 4GRWF 3TM6A 2YN5A 1A7QL 1NMCB 1T7ZA 3C5XA 3KPOA 4G6MH 3GMRB 3OG6B 3STZA 5IMKB 1J5OH 1YNKL 3HRPA 4M4RA 5EZOL 5CJQL 3ARRA 4NFCA 5D7IF 4LSSL 1SBBA 3VVEA 2HJLB 2BM3A 1ZK5A 2IANE 3JV4A 4HUUB 5KSUA 1IBHA 1JPEA 2Y7NA 3QUZB 5BOJA 1AP2A 3KPMA 8FABA 4Z7VF 4BQBA 1RJZA 4HWEH 1FVEB 4QUOA 4L0ZA 5L8LB 1B51A 1HSEA 3RT6B 3F7YA 4K3DH 3H9ZA 3OKOB 3CVHB 4RMQA 3WFDH 1VDGA 1OY3B 2VL5A 2VDNB 3GGWB 2K4AA 2VD2A 2Q0ZX 3SKOB 1BLIA 1DK4A 4NNXB 4K7FA 4TSBL 3I75A 5BRZD 4XCYB 4AUYA 4LKXB 3B5HA 4QO1B 2YEVB 5BMFL 2BJML 3VLWA 4N2GA 1CFNA 1KPVB 3KCPA 4LSQL 3PU7A 5D2NE 1OQXA 3RTQB 3QG6B 2CHDA 5EU7E 4MMXC 2FJFB 4KZEL 4M1GL 12E8H 4PJIA 1F4YL 4FTVD 4M7KH 5FCSH 3REWA 3O81A 3FQNA 5D2NC 1EHAA 4PBVC 2FQEA 3K2IA 3UGXA 5I15L 3D2TA 5AZUA 1EHLL 4C83B 4ONGH 1DQDL 1PFCA 3MZGB 4NDMA 5D1QC 1XD0A 4Z7VB 4LLMB 1UWEL 3L1FA 5EU6D 3P11L 5J8OA 2EABA 1MH4A 3QAQA 3UTSA 5T3ZD 3B8SA 4WV1B 2AANA 1LP9F 2OMXA 3TN0B 3CIJA 4TNFA 5K9JL 1HSBA 2WCSA 1SYHA 2ZNSA 5CGYD 4F22A 4PBXA 2ICCA 4MA3B 2XWVA 1KEGH 2C3GA 4A6YA 1SW2A 4HMEA 4Z8FH 1QSVA 4LGPB 4PGDB 5LDUA 1FL3A 4GRLA 1Y0LB 2XZQH 4WW1A 2ZXAA 4WKZB 1YEHL 2ETWA 2J6WA 1T0NB 4LEEA 3A6OA 5TF0A 4Y19A 2GTWA 5JIHA 1W0YT 2MCPL 1FPGA 3HNVL 4UV7H 3TJEH 2R1YA 3AS0A 4ABUA 5KAQF 1MXZA 4DE8A 1BD2B 3O29A 5FO8A 5MEND 5LDZA 4CDGC 4K3HA 5K2XA 4X7FC 2W9EL 4AZ8A 1RUAL 2YLKA 3LXUX 4HFWA 2CKNA 4FABL 2YD3A 1XR9A 1XL6A 4X4ZA 5IBUB 1GTKA 5KBKA 2W65B 4PM1A 1S9XB 3NT0A 5FHOA 1JXGA 1SJEB 3DARA 3MNWB 4P3DB 3IU4H 4BZ2H 1JZDC 4NF5A 4DP4X 5AZ2L 3B9KD 4QRTA 3WFBH 5F72S 4PJ9D 3L95B 2P1YA 3MUY1 1TUPA 2ZE0A 1MFEH 2D3LA 4LVNC 3EGDB 4E68A 3FFCD 1UXSB 3TS8A 5KYWA 2CGRL 4EUPA 4LDLB 4QHPA 1RERA 3V4PH 5K5YA 1C9SA 5HYJE 2Q2CA 5I15H 1DQLH 2FWOB 3C5JB 4AMKL 4DGYL 4AW4A 5E08H 2CPUA 4DP5X 5ET7A 4WUUB 1S7TA 1T7VA 3O3AA 3U9WA 5DJCA 1LMKA 3JYBA 5B4MD 3OMZA 2HWZH 5A5LA 3TA4D 1B58A 4S1SH 1IKOP 1TCRA 4FFZH 4Q8RA 2PO6C 5EOTB 1MFDH 5DMGC 5CBEA 4Z7NF 2RF1A 2K8QA 4ADIA 1RU9L 2Z8VC 4LQ2A 5ICQA 2HMIC 1NGXA 3HS9A 3ECWA 2AAVA 4TUOB 2OJTA 3T3ME 3ONMA 1H9DA 4P46D 3MOBL 2EXYC 4GWUA 5CD5D 1OM3L 3STLA 3HBGA 5GRWA 3PDOA 3QNZB 4OH2A 4J6RL 4UM9D 4L0YA 5IB5B 1P6FA 4FC3E 1Q9WA 4IHOB 5AZEL 4ELMF 4LFHD 1FGVH 4XHJD 1U33A 3M1BA 3ZKKA 4HIIB 1A7OH 5DUBA 1KYUA 5IVOA 4CILA 4MBOA 4ZFZB 5GGSB 4JFQB 1CGSH 4YR6B 1PGRB 3TU6A 1RHFA 3D25A 1I3UA 3U1SH 2CJSA 1HOEA 2K7QA 4IBTA 3RWJB 5GGTH 2NTFA 5L88H 4R72A 3VJ6A 1EHKB 4N0CC 3STBA 5FYJU 3GBEA 3MV9B 5A6IA 5I19L 4G6AC 4X6CE 1CNQA 4RPOA 1HJCA 2LU3A 1GYUA 2NY4D 1EAPA 1Z7JA 4OB5H 3QUYD 3WSQH 4GYBA 3IGLA 1CFTB 1GC1H 2EEFA 2J88H 1QPXA 5F0PB 3SDXB 4B5ZA 4XXWC 5AG9A 2OYPA 1PDAA 3QG7L 1HINH 4OGXL 3JT0A 2F1AA 3TTRA 3V89B 3N6YA 4AMWA 4RGNB 4IY5A 1C1EH 1HEZA 4XH2A 1M5DA 3MV11 5ADOH 3DX8B 2PR4H 2WXNA 3ZT7A 1IMCA 2FAUA 4G80A 4P4RA 1CYWA 3PHSA 4HFUH 4F5CA 4F58H 3P2BA 5AAWC 4YLCA 2B5IB 1ZU0A 1TWYA 5BRQA 3PABB 2Y24A 2CU9A 2EXWD 4PJAE 4TL5A 1GY2A 5D1XC 4Z78A 4GSDL 1KTDA 2IOOA 4LCVA 4XN4A 4RXLA 5CMAA 3TCHA 5DJYB 4DP1X 3ECRA 5AOLA 3PJSB 2Z22A 4RSYA 1B2HA 3BUDA 5JPNB 2NYYC 1E90A 2OXGB 4DI4B 2XHDA 4U1HB 1K4CB 2RH0A 2YPLA 3QO1A 4WFFE 3UTZA 2OJEA 1IAOA 5EFIA 4XMTA 1RV6X 4G3YH 1WH0A 2Z9TA 4KVPA 5BVPL 1ZV5A 3DO7B 1AHMA 2Q20A 1BBJB 2F19L 3AITA 3N42F 1BEXA 4K8RH 4E5XG 1JZJA 4QXUL 1B0RA 4AK1A 1GGGA 3G3FA 1IBZA 1W72L 3UC2A 3GS7A 2YEQA 3S0PA 4DTGH 2V3UA 5CMAB 1ZA3A 2QKIB 4MX6A 2AV7A 1LEVA 4PJDE 3RPIB 4EOWH 4NZFA 2V7NA 2Y2WA 5T3ZH 4XXDA 1KJMA 5I2NB 1DE4B 3H7BA 5F3HB 4DFHA 5AG8A 2OR7A 5KJ7E 2UYEA 1EH9A 2LV4A 3RN8A 1T1ZB 3ORJA 2EO1A 1JCKA 3HUJF 5B7EA 5FYJL 1OHZA 4MD0A 1HHKA 3QIWA 1WT5C 3M7OA 4Z0BL 3CFXA 5DQ9B 4PMFA 1DCUA 1JIBA 4KGJA 4D2NA 5IESH 1RYOA 4U4SA 1OIOA 4JO3L 5DZJA 5C07B 3WYRA 4N20A 1RJLA 3W38A 1CC3A 1UOVA 5E03A 1MUJB 2X6UA 3EYFA 4Y5YB 4H2AA 3LEXB 4AIEA 3PU5A 4LSUL 1HE8A 4ETQB 2ENSA 1CK0H 4XI5D 1ELJA 4ZEDA 1XGZA 3SDDC 1LGVA 1Y07A 5DEXB 1VFBA 4QRFA 3VGAB 1LAGE 1MHEB 1KJVB 2F7OA 2J5LC 4F8TA 5GZND 1BOYA 2IC2A 5DRWA 3TT3L 1G0IA 3MV8A 5E2UH 1I31A 1K8DB 1NMBH 3QUHA 4GAFB 4UQ3A 4ELMB 1XZ0B 3D2UB 3T9WA 4Z7OB 3K6DA 4NJ9H 5ABZA 3GJFB 3UC0H 2IWGA 1N7MH 3M1BB 5C08D 3SQRA 2X4RA 2P5EE 1VIWA 4ZFOL 5HHNA 4N2OA 3A3CA 2ZJSL 1H3WM 3DROB 4MB5A 5CCKL 1CDIA 2WBKA 3D52A 2QMKA 3EFFA 1UQSA 5AKSA 3ZT6A 2R71A 1YNLH 1OCZB 2X0WA 1YNTF 4P0IA 3CZGA 5AYQA 4C56D 2OV0A 4JFEB 5GSVB 1MCPH 5KS9F 3NRQA 3LKOB 4TNWK 3ZE1E 3V52L 3HRZC 1GHFL 1V10A 4J7RA 1RKRA 4LCWE 3BYTA 4EN2A 1MCEA 2HPOA 3P77B 5EU7C 1MQGA 3MJ6A 1ZDSA 1X9QA 4ZS6D 3CFJA 1UVQA 1OLCA 3HFFA 4LKXA 4U31A 1AD9A 3FU6A 2HT3D 4OEUA 1GGIH 1MFBH 1S3KH 2ZOLB 5H4YA 2A3TA 4MJIE 3B3IA 1MXUA 4N90E 3L7FA 1W0VA 4D7BA 3DTUB 4YSRA 4UQ3B 3DUUB 3GI9H 4PJEE 1Q1JH 2B08A 3MCLL 3FK3A 4KQ4L 1BAFH 3GKZA 1YYML 4X6BB 1NAMH 4N2HA 1NNKA 2DQJL 2VO5A 1JDDA 2VOTA 3D18A 5KYWB 4L4VA 4Q6IB 4BIKA 3F5WB 1V3JA 2AERT 2CCWA 3GSWA 4N9GB 4R5TA 2BSBA 2CDFB 4MAYB 2XC8A 3K02A 3GJEA 2UX6A 4PS7A 3QHZH 4HHWA 1D5XA 1XR9B 4O2CA 5E8PA 3PPEA 4AS5A 3AREB 4AZ8B 2C26A 3BP6A 5L4FA 1D4NA 1E5YA 4Y4HD 3VGHA 3SESA 1DQKA 2DTSA 1TQBB 1OW0C 2EIZB 1QVOB 2X4TB 2QV4A 4KROB 1N6UA 4UABA 2YRPA 1BEYH 1DR9A 3CSTA 2V8LA 4QTIH 4OAWA 1CE1L 2DMBA 3VRJB 5DC0A 3C2AH 1JPTH 5C7XH 3IDYB 2A6DB 1MM7A 3DVGA 2WD0A 3LUZA 1LJMA 2GBUA 3ZE0E 4FYRA 5JTWA 1AQHA 2HKHH 3MMEA 2TRYA 4W93A 4RFNB 1SEBA 3EHBC 2ROXA 3L2LA 3SBRA 4IMKA 3WFZA 1E6JL 2F0CA 5I1AB 4P5MB 4NEHB 1NC2D 2DQCH 2FT8A 3BKCH 4YXLL 3QIUD 4OZFA 1D3CA 3FULA 3FKUS 3NZHL 3G5XB 3S34H 1A8JH 2OMWB 2VN4A 2GY5A 3MJNA 4YZFE 3R19A 4ZOBA 2EEDA 1P1NA 1O6VA 5IFJA 1I8IA 2ZX7A 3CVIH 4NP9A 4Z7WA 1XH0A 1HXYA 3L5XL 3OV6A 1KEML 1TU2B 4JFYA 1MREL 2F68X 2XYBA 1V3LA 2IVFC 4AM0A 3I2CL 3PJSA 4F7TB 4M56A 1DCLA 5TE7H 2BCKB 3B2XA 3BZEA 3CSBA 4YB7A 4EXLA 5FK9A 1I7UB 3FVOA 4JFUA 4UI2A 4UILL 4XNUL 3LRLA 2H5UA 5EUOB 3MLPA 1RHHB 3FTGA 1SDDA 2D0FA 3RIKA 3PGCA 4UUJB 1Q94A 3IXTA 5C7XL 5FOBA 3EOAB 4GKSB 4M61B 4C4UA 4L8CB 4FZ8H 1XGYH 1JPGB 1WV7T 2NNAB 3UBXA 4AJWA 5KW9H 4BFOA 2VO8A 4HG4K 4OTEA 1UWGL 4PLKD 4UNUA 3E3QC 3SEPA 1FG2A 3N3EA 3ESUF 4FIMA 5FYJH 2DQIL 4ETYA 3FF8A 5A2IH 5I57B 4P99A 1T7WA 1PU0A 1KTKE 5CD3A 1XVYA 3H6JA 3QPQC 3GSNL 1FSKB 2V8MA 8FABB 4NF6A 4LLQA 1OZUA 4PJ8B 3UYRL 1NC4A 1RZQA 2DXRA 1E50A 3TO4C 4FGMA 3JZ7A 2ZUVA 5TE6H 3N06B 1Q9LB 2PKDA 4JX0A 2ZNXA 2P7TA 2Z35A 4ZMNA 2WM0A 2OMVA 1AD0A 4L3CA 3ULUL 1QD0A 1MPCA 4XO3A 2VN3A 3NCBB 2N59A 1ZVNA 1VPOL 4JHAL 5IMKA 3P0GB 2B3FA 3FTYA 1P69B 4JZNB 4TQEH 5AEAA 5EUOF 4QY8B 1TZHB 5KS9A 3LKSB 3QQDB 4IGBC 3ZU8A 2WPGA 1A4CA 1BDYA 2CZIA 5IQMA 5SWQA 1LGBC 3QR2A 1IBYA 5TU0A 4WVRA 2VN5A 3U9UB 4XNUH 1ZJAA 3G6JF 1X7TA 2FD6H 2J5WA 1ZT4A 1E0OB 2ZUQB 4ALAL 5FTIA 4I85A 3V10A 4UT7H 1HYSD 2XY1A 3FFDA 4XP1L 2CJTA 3NJLA 4KDTA 3LSOB 5F9OL 1YEKL 4KJPC 4PJ5A 1MREH 3TZAA 4RGNE 3RL1A 3PWNB 1YN7A 4JQXA 5IGXL 4LK4A 5CXPA 3RB5A 4NQSB 5KYUA 1SW5A 3RPWA 4MD4A 1UXWA 3UGWA 3QI9C 4GKNB 1ZHBA 2P80A 3VD7A 2PT1A 3EHUA 4EQ9A 4BH8B 1RFDH 3V0AC 3B50A 1HIML 1H0DA 3BYYA 3AREA 1ZTMA 3RQ3A 5B3JF 4GO6B 3SPVA 2ZJSH 4DKFL 2OMZB 3DDFA 1KFAL 3TASA 4LVEA 2OMTB 4ZXBC 4XKPA 2KZBA 3HBPA 1XCTB 2QVRA 3VLUA 2QKIC 1JRHL 4L5FE 3RIFF 2X6VA 4N1EA 1AQKL 4P5KA 5F1SA 5DFAA 1NMBL 2JF1A 4QYOA 4U0RB 2RR3A 2MPAH 1W72B 1A4JB 3QUMA 4P2QA 4PJHB 4KKZA 2HAVA 2JJSC 3F6JA 3OAUL 1YCJA 4JBZA 3EJYC 2AK4A 3SDAC 3MNWA 4IJ3C 4P3DA 4M6NL 3ZVVA 4PFTA 1QFUL 2LFGA 4OZGA 1YMMD 2VZSA 3J07A 4NN3A 4WFFD 4WWKA 4J28A 1YN6B 1R5VB 1BF2A 1E5AA 5AVSB 2H1XA 3FN0L 5ID1A 4PREB 4GT0A 2Q9TA 3VACA 4KPHH 1NKXA 4BSVB 4Z3IA 3DM0A 5L8JB 5AZEH 2I7SA 3SE4C 2ISDA 3WI9A 4AEEA 1NNPA 3VVWA 3CBJB 1KCSL 1HL8A 4WJ5A 5FPIA 3LV0A 2APWA 5KDTA 2E0PA 5D2NA 4KK9D 1Q1JL 1DQML 1AOVA 4MD4B 2XWKA 1V7ML 4M9PA 5DD6B 3S36H 3QWRD 2J25A 1ML0A 1QTSA 5CEZD 5LUMA 1F45A 1EIBA 4G61A 2VXSH 3SGKC 4ENEC 3OKMA 3A0OA 4PJ7E 4XBGB 1UIVA 3G5ZA 1KBBA 2HWZL 5JO5A 1I1AD 4ZW7A 3K2MC 5T1LB 1JW4A 1B6UA 2D3JA 3HI1B 3LIZL 1XH1A 1RL1A 5KSAD 3D2UD 4AH2B 4YAQA 4ZNCD 4NMYA 1ZT4B 1IAKB 1A0QH 3NMEA 3KEHA 4Y4KD 3GHPA 5D7JB 2Y7OA 4OZ4B 3CE1A 5ILTL 3LKPA 3F12B 4JB9H 1CE2A 1PY9A 5SWQB 1MVFA 1O6SB 1JERA 4UNTA 1SPDA 2VDLH 4F7EA 3TJPA 4H88L 4OJEH 4F9PA 3TTMA 3MFFA 1E65A 1QEWB 1X5AA 4MXQD 1OAUL 5E99H 5IFHL 1U58B 1SVCP 5F93C 5GIRB 3WJMB 2ZAHA 4R2BA 2D7MA 4MDJA 3QUML 4JDFA 1FQ9C 1N6QL 2CZLA 2Y3AA 3P4OB 3M1CA 3JWNE 2JJVA 1KTBA 3JV6B 2DDQH 4U6HB 3SDCD 1MJJB 3ESMA 1G94A 4U7MA 2CKBB 1QHOA 1E28A 3CFQA 3BSGA 1WHPA 2O5XL 1J8RA 3T3PE 1A5FH 3UIFA 4OVJA 3VXTB 3PWPB 3HJ0A 3BEVB 5ANMB 5D1QE 2D31A 4O2FA 1K8IB 1MWAL 1JV5A 3S37L 4POXA 3NSYA 1XB3A 2VDML 5IQ9B 3TA3A 4L8SB 2VDOB 1ECYA 3SYPA 2NDFA 3KYMA 2QT6A 1NUZA 4LLUA 5MENB 3NVQA 2VMEA 3AS2A 4XVJL 4DVBA 5LDSA 5ISZE 4RBPK 1MPAL 2HJLA 4RFOL 5MEOB 2E7BA 2FK9A 5DEGB 1U8CA 2BSRB 5T3ZE 4MYPA 2G3ZA 3FTZA 3DYPA 1RH8A 5CLYA 4E0XA 3EOBA 2IH8A 3R0NA 2XOTA 2C1OA 2DL2A 2P8MB 2W7YA 2YFOA 1X5MA 2GSGA 3ABMB 3D0LB 1JXFA 2GT9A 4N2LA 5E56A 3BXNA 5ENWB 4E9YA 1FZJA 4UCFA 5E6SB 5IFJB 2WN3A 1P1ZA 3BIKA 3MRBB 3FCSB 3P11H 5DZOA 4DUWA 5GSRB 2ADIB 3GSXA 5F7UA 1F97A 2A4ZA 3Q8AA 1AGCA 3H9SD 3PWPE 2D4FA 3BWAB 2Y7QA 1HNGA 3MLRH 4YSDA 1T03H 4HCRH 2K1MA 3FFCB 4RFNC 4XNYL 5IZ7A 1HZKA 2RMNA 4I9WE 3E9TA 2E7MA 1PIGA 4PV9B 3MMEB 1SW1A 1HL4A 4ERSH 1IO4C 5CLXA 1LD9B 5EHSA 4G80B 2ZOOA 3LX9A 1ONQB 3QS3A 4DZBA 1T4KA 2DQFA 4GFRA 1NGWA 4I2XE 1CLOH 4JWYA 2ED6A 4JO5A 3UZVA 4RWYL 4XAWL 2VLJA 4O02H 2OK0L 4PJEA 3DHMA 4C54A 4TNVK 4R73A 3BHBA 1T1YA 3ZZLA 1U8JB 3IJYB 4KXAA 4HWUA 3ZQXA 4HIPA 2AXFA 5I8CB 1A9EB 1XF2B 1P1UA 4MJJA 1MQJA 4AQAB 3CFMA 1AMXA 1Q38A 3K71A 5KYXA 1SUJA 3F58H 4PP0A 3MRPA 4OF3A 3WNOA 5J0BA 3L5JA 5SWSD 1HKLH 3O3DB 1YRKA 4XMPL 2JLPA 4F1UA 3GLBA 3LS5H 1RZ7L 2WINA 1FTJA 4XBPA 3PQYE 5AAMA 2EC9T 5EOCL 3FIRA 3A3UA 4LO9A 4HFUL 3G3LA 1U4FA 5CJQH 5E6UB 1H3XA 5J06A 4G9FD 2BP8B 4NPJA 4THIA 2YSTA 5A7BA 2OSYA 5FHAL 1JG9A 4FQLL 5IJKA 4BH7A 4N6RA 1NIBA 4OD1H 4CUCA 5EBLA 4YBLB 3ECQA 4HZLA 1E5UI 4KJPD 4N15A 3QG7H 3GZKA 3VFUB 4WI9A 2IAND 5AYUL 4JFDE 3GDBA 3U2SA 4LPUA 3STLB 1J8HA 5INCB 1WFJA 4UM9B 1PPIA 2WP3O 2W94A 3L3JA 3MJ7A 1GSMA 4YSTA 2CNYA 2Q88A 3NSJA 4PCDA 4PG9A 1CE6A 1BFVL 1L7TH 2WWNA 2AW2A 2IQ9L 3I02A 4G7SB 2JKWA 5J9PB 3QFJE 4F20A 4ZFFB 2D03H 2Q76A 1MWAH 5CJXC 5JK4A 3O3AB 4GWSA 4NHBA 2X9WA 4WU7B 3BWUF 2I9TA 3PQYB 5GS2H 3FL7A 2IBGA 2AQ1A 2XRAL 5D7SL 1NUGA 5HM4B 1BXUA 3CX5K 5I17A 4QXWA 4PJ9A 2X1OA 3WKQA 2DDQL 3GSNA 2VT5A 3X1BA 1OV8A 4GBXB 2X7QA 1HZHL 1J0KA 1IQWL 1KBGH 4I8DA 4J6IA 3FB8A 2G30A 3O6KH 2VQTA 4PLOB 2SEBA 3IS0X 2HRPL 3RAJL 5ES4B 1EHNA 1ZK9A 4QRPA 3UAJC 3IR1A 4N0UB 4GEIA 2XWJB 2XZAL 3MYJA 2WXPA 5DYFA 3QYCA 4LLVA 1JXJA 4JXIA 2IEEA 4RA0C 2Q7YA 1BPVA 2EE9A 3GJFK 4JCWA 4ZYKA 4OLVL 2I25N 5CSGA 2EZ0D 5DD5L 3MLRL 2EYTB 1PEWA 4ZUVB 4DP0X 1EEYA 2J8UE 3FO2A 4ZPTA 3L4CA 3KDMB 4AIZB 4X1DA 5I6KA 1MCWM 2BW5A 3BFUA 1R24A 1QFPA 4YQXH 1JL8A 4P0GA 3OAZH 2A77H 2GVYA 4I3RH 3ZL2A 5ADPH 5AW5B 4ADGA 1PBPA 1NFAA 2BHUA 5KOVC 1FNGA 4GSXA 1YTVA 3PGFA 4HE1A 3UDWC 1U95A 4RETB 2HFEB 4NI3A 3DUSA 2OMXB 2WXFA 1ZLDA 2J12B 4ES8A 5KW9L 4FQJH 3P1VA 3SKJH 3ILQC 4U1LB 4CNIA 3J8F7 3KBRA 1RD6A 3ZZSA 1HILA 1SY6A 2WBJC 3RWCB 1KXHA 4Y5XA 5CEZL 1CU4H 2VLRB 3TESA 4LIQH 4WEBH 2CO3A 4XVSH 5HGAA 4DGUA 5IROD 1AWBA 4JO4H 1LE9A 4QNPF 1WA0X 3PQYA 3R7RA 3WKNA 3P4MB 1KSRA 1HHHA 3RILA 4L1HA 5JOPE 4BD4A 3D08A 1TZIA 3BWSA 4LDCA 5A3IC 5EFIB 1AKJB 5J56B 3LH2H 3LNDA 3GDCA 4ELDA 1U8OB 4Z7IA 3MO1B 43C9B 4Z3TA 2B4CH 1Y18A 4HALA 3MR9A 5HHQB 3PWJA 4WJG3 3MNZA 3AXIA 4YXLH 5I30H 1XO8A 4J12A 3RFZC 1H9VA 2YXWA 3TNNB 4QT5B 4PJ7B 2BVEA 3LKRA 2NY1C 2ITFA 5FLVA 3O0RH 2Q7YB 3SBWA 1T04B 1AIZA 2ZZVA 2NYZA 3ZTDC 4H1XA 3MVYA 4P9KA 3KHOA 3L9EA 4KYEA 3IFOA 4JPKL 3WE1A 2O5NA 1P7QA 2LAAA 3FS9A 5GZOA 3IPEA 1JPTL 2AQRA 2H8PB 2B0SL 5H8NA 3L9BA 2QR0B 1I4FA 3LY6A 4X4KA 5FEBA 2XV3A 1MJ7L 3DSFH 5DEFA 1N18A 5L4JA 1UB6A 4H7VA 1EX0A 5EN3A 1AKPA 5HPOA 3UTSE 5J11C 5I59A 2W38A 4H26B 1IFRA 3QJFB 5HD8C 4PWEA 4YICA 2X9XA 2IV8A 3FB7A 3QDHA 4N2FA 2AJYH 3SOBL 1UATA 2WC7A 4BE5A 4DN4H 3U65A 4NAJA 1XSKA 1CWVA 2DQDH 1EZVX 2QQNL 4PCYA 4V2BA 1CFBA 4XNQA 4XNMB 5C6TH 3PTYA 4R90L 5G55A 1U3NA 5INDB 1UZ6F 5K9QG 3D0VB 3UAJD 4BSWB 1H44A 1CDUA 4OIBA 2LFEA 3BX7C 1FQAA 2ZNTA 4X5WA 4APQD 3QNXA 4MA8H 1MLCB 4BK8A 3HS0B 3PPSA 1AGBB 3TTSA 1KYAA 4OZGF 4UQDA 4LPTA 2X2JA 4LCWD 4J3BA 2IH3B 4EI5D 5IHHA 1WVZA 3THMH 2TRHA 1F6LL 1PLAA 2H3XC 4PV9A 5IW1A 4GRKA 3QIBD 2WIMA 4WW2F 4LCUB 3LRSB 4W9GC 2PCRA 4QKXB 3KPTA 3EG9A 2Q3XA 1WBYB 1FNLA 2DOCA 4AUUA 3DJRA 4HD5A 1MJ7H 3A24A 4EDXA 1LCTA 3U0TB 1JYXA 3PXLA 3DIFB 4KX7A 5TJWK 1FJ6A 4AC4A 2H2SD 2LU5A 2HX7A 3NCWA 4Z1PA 3F3HA 3VWKB 3SO5A 5ESAB 2EKSA 4MXQC 5FB8B 4H8VA 3HG3A 3AUWB 3L48A 4XBPB 1SEQH 4KNSA 4GAYA 3O9WB 3IM1A 3OKEA 5DR5H 4KKCD 3BZDA 4JFWA 3TKDA 2FL5A 3E6FA 3E2HB 3I6GB 3NA9L 3QFJD 3R06A 4G5AA 2RACA 4PGCA 4WV1C 2WXQA 3QUXD 4ZUSB 1KEMH 1OVZA 5GS2D 3WS3B 5JQ6H 3OXNA 1DBBH 1IAIM 4S0SD 4EI5B 4UBDC 5A2JH 1D5MA 3VXQA 1SLUA 3ZHLA 2PO6B 5FF6B 2HVBA 5DVNA 4F2FA 4JZOA 3VA2C 3EZ8A 1YUHA 1HHIB 1O9WA 2BWIA 2EE6A 1X7SA 3AQDA 1YEKH 4NIYE 4YLQT 4YHKL 3U7WL 2BIHA 1LEGB 3SHSA 4AJ0A 4KITB 2GBTA 5ITOA 1KB5A 3MRMB 3Q3GA 1EUTA 5FKAB 3CXFA 2YD8A 4UYQA 4YFLI 4IIQA 4ZK8A 3N85H 4BBWA 1LM8V 4EN3B 4XPAL 4NO0D 5F1IA 3BIGA 3FFCA 4KVNL 4K73A 2ONRA 2B1OA 3W39B 2H3KA 3VSUA 1I1CA 1R5IB 3X1FA 4JO3H 1KACB 1CBVH 3WNIA 3HAEA 3B2UD 1SXSA 5C8JA 5F7YC 5I0DA 4Z7NB 4YBLC 5T1MA 1F41A 1U8HB 3MRIB 2QQKL 4F7EB 3SZKC 2NCEA 1CLZL 1NDGB 3FNKA 4HH8A 3ULUH 4HXVA 3C5ZA 1K9TA 1VGKA 2ESVA 4PRHB 4IB2A 2ALAA 3MLZL 1P5UC 3AY4C 5ADPL 2ZYOA 1CB6A 2ANJA 3D3VE 5JO5B 2XD3A 4UT9H 3TN0A 3BQUA 3HZ3A 4HIXH 3GSUB 2FVNA 4Z0IA 4ZO7A 5IHLB 1O9VA 1J8HD 2ZYHA 1ZT7A 3GHBL 2OSXA 1S7QA 4I1RA 5JHBA 1KXQA 1TNMA 2MHAA 2OMYA 4FFWC 4XGZB 5FA4B 3FT3B 1FL5A 2NY4B 1Y1UA 3FU7A 4KTDH 3P54A 3B6SB 4HCWA 5DQJB 1IC5H 4OI9A 4MX7A 2NQCA 2WQVA 2BP3A 2FX9H 3J27A 4FJZA 4IKKA 1UXMA 2E6QA 5CGYC 3RKDC 4DETA 5F24A 3QHFH 4U1NA 2E0SA 5EUKB 2AXHA 3BO8B 4RAHA 2V9QA 2YS4A 1NBCA 3QPKA 3EDJA 3W9DB 1FZMA 5L2KB 3SKNA 1F4WL 1LDSA 1BBDH 4YHKH 2EDYA 4HJTA 4XRCB 4U6HA 1ZE3C 3NSDA 4QO1A 3SEWA 1JW5A 4PP1C 4ZOAA 5JPNC 1PAZA 2FCBA 4BWWA 2PWDA 3BEWB 4G7YH 4J27A 4QRQB 2Q8AH 3DV6B 3BWUC 4BDLA 1S9VA 2XXRA 2P43B 5IJKC 1YJDC 1FVEA 2D03L 2Q2EB 5AWNH 8PAZA 5A2FA 4L2YA 3LOWA 4NO0B 2V7HB 3EADA 3HZMB 5IVXA 3QXTA 4NQCB 3T96B 3BVNB 3D30A 4TLSA 4AVKA 1BG1A 1KBVA 3IF1A 4FL4B 4G6JH 4Z9KB 1PG7X 4HGMA 4TTDC 5ECJE 3ARDD 4TNVF 4N07A 3G08A 2P5WA 1MQDA 1FDLH 1QRNA 3PL6A 4H5FA 2GFBA 4JKMA 4HXBH 4LSVH 3LH2L 4QHUA 2O61A 3AQXA 2KPNA 4IHBA 4N22A 2WTRB 5SX5K 4F39A 4WEMB 4YXKL 5C0GA 3T4YA 1PS3A 1JGEB 4KJQC 4WNQA 3TH2T 2ADGA 1U3YA 4K94L 5DFWH 1WODA 2E9IA 1NM9A 5D5MB 3C87A 3BD5A 4YNYA 3VLVA 3K74B 2OS7A 4XCNB 3BZ4B 1KNOA 4OD2A 2VHAA 1NJ9B 1KGXA 1CGSL 1PEBA 2KR0A 1VF5C 3FTWA 3ZTJH 3QB7C 3MRDA 4OLUH 5JORA 2E75C 1I8KB 3OB0K 4S10A 2G29A 1HN1A 4TVPD 2H25A 2O7IA 1XF4A 4X0KA 5AVZB 2CSPA 3M17B 4YXHL 3X17A 1KFGA 1B7ZA 2APTA 2XY2A 3ULSB 4MBPA 1MAJA 1JPSL 4HKZA 3SB3A 3DX9A 4ZS9A 4LUBA 1FYTD 5FF6A 5JDSA 4B7IA 4WRLA 4A66A 3BUYA 2NNRA 4K7PH 3NSCA 3VCLB 2XTJE 3HE7C 3O4LD 3LEVH 3WS3A 5GGVY 1J5HA 4OFKA 4JKPL 5IBTH 3ZL4L 2QS3A 5KVFL 4RAVA 4TXVB 2B4MA 4PFYA 3QSLA 3DMMA 2V2TB 5FUCE 1FPTH 2OMTA 1Q0YH 5BOZG 4Y1TA 1SJHA 5JNYA 4E5XB 4G7RB 1QUIA 4RX4D 1H5BB 1TTGA 4LCWB 4YE0A 4DGYH 5C0IA 4D0BB 3S88H 3RUGF 5E08L 4NPYB 2IFFL 5I66A 3U4KA 3C6LD 3OQ3B 5CP7A 3X1NA 2X26A 3ULSA 4MSWA 5D7IE 2FRGP 2GHZA 4KV5E 1KBGL 1HQ4A 1UXLA 5BS0D 1XGPB 1T0MA 2X4PA 4Y8AA 2R0WL 4P9HH 3PWNA 4POUB 5E7FA 2K45A 2LABA 2OW7A 2ROYA 1GTNA 2PYEA 4TMPA 5EU6E 5F7HA 3EQ1A 3MOAL 5D7SH 4X98B 3C60D 4LCUA 3FU8A 4GG6E 5IVZB 3IJEB 4L9LA 1MQKH 3C9HA 5B22A 4KYDA 2XX9A 2A1WL 1BG9A 3JZJA 5KANI 3TQWA 4OETA 4WSJA 2DWXA 3U9UA 2FEEL 4NNYA 5JA9A 3BD3A 4GF8A 1ITCA 1KLGB 3MX0B 4HEPG 4K55A 3TEUA 1ZTXL 1UTHA 1T5WA 1FVDB 4O5LH 4UV7L 5KS9B 4N0YH 1BIIB 4AUJA 3BKYH 5KZTA 4XPBH 3MLUH 3FHAA 2GJZB 1VSOA 1QTYT 3SDDA 5IOKA 3ALPA 3BAXA 1URSA 3ZLQC 3CWGA 3VGAC 4DPRA 4H8WL 1FNFA 4Z7UF 3CBKB 2MNJB 2YAQA 1BM7A 4CW1A 5KN5B 2Z92B 2MTAA 1WWWX 3HG1D 2P52A 3FUKA 2BVPB 5IM7A 5GS3A 3WHE0 1U8PA 1E6OL 4LBEA 4M03A 3L2MA 4U4IA 4FQLH 5FGBA 4WU5B 5DJXA 1S9VB 4JE0A 3NP3A 1YMMB 3H4ZA 1NDMA 2DEXX 3LS4L 1FZOA 1RVFH 1C7TA 5C07E 2Z3FA 5I82A 3GMMB 2YSSA 4FNLL 5F88A 2M83A 2YPKA 3DTXA 4YBHA 3IDYC 4MCMA 2P8PA 1Z3RA 3DVFA 4QD2E 4AE0A 1SDDB 3DX7B 4OLVH 3PD9A 1JFHA 2XXPA 3QZMA 1FPJA 4YE4L 4FYTA 1QQDB 3PJNA 2AYSA 1KGIA 5JXEA 2CUIA 4OIFA 3X14A 3BPOC 4U49A 4APQA 4ISVA 4G43A 5JQHC 4AGLA 1IBBA 3Q1EA 5HHQA 4QHLA 1NCWL 1XMEB 3NOIA 2H26A 3WAKA 1S7XB 1USZA 5TDOA 4FA7B 2WQ8A 3MBWB 4WI0B 5KSBE 1FUNA 1JVYA 3GS4A 5KVGE 2ZWYA 4AYSA 5ITBL 3AW5A 3PUUA 5IAIA 1WVJA 3BUYB 4Y4HA 2DJUA 4QRUB 1JK8A 3U36B 4LCCA 3V7AE 3VFNA 4GOSA 3DPDA 3H9SB 3TO4A 4GRLC 3UBXI 3NA4A 4NRZA 2COVD 3G5WA 3MBXL 4R3SA 1BD2D 1T03L 3LPGA 2PUQT 3QJHA 1IMHC 1RVFL 3A67H 3JTBA 1C08B 4FLOA 3LS4H 1UWYA 3OTTA 5HYJB 4BDVB 3SPJA 1A1OA 1G1OA 5C0JA 3MVWA 1G1KA 1EMTH 1GH7A 1A7QH 3P9LB 4N0FA 1B3IA 1OAQH 1OTUC 4Y7MA 2XVBA 3AT0A 4X9BA 5DJ0A 1RZJL 1E8ZA 1TQBC 2VUOA 2H47C 2UV3A 1AIFB 4TOZA 3MOQA 4YHZL 2XA3A 3AGVA 2VDKB 3QZPA 1RUAH 1SF5A 3V95A 2QDWA 4PJ8C 4XX1G 3OJ2C 3F8UB 1JD9A 2H6PA 1I8LA 3VTAA 3ZDXB 1EAQA 2ZG2A 4OM0L 4BA8A 5KBLA 2WXOA 3T09A 1B7HA 4ILDA 4MNPA 3ATBA 2VM3A 5HHOD 1MDAA 2A4EA 3FO9B 1XF1A 4Y0GA 1KOAA 5E1GA 4QTFA 2WVUA 2HJFB 3CC1A 4L4TB 5C0DA 1TJHL 2H2PD 1KJVA 3BLBA 1E2VA 2AIXA 1XF3B 4G5ZH 2W9DL 1EDHA 5DEXA 3QNYB 5E6ID 3W0WE 2P1SA 5I76A 5HDBF 1VZGA 3VDFA 1IM9B 1OE1A 5TTRA 2YGNA 4OA4A 2R9HD 4ZX4A 3RLFE 2V2XB 1IGIH 3H6TA 1YJDH 4X6CB 2XETA 2UXVA 4U1SA 1XR8B 4I48B 4OQTA 4DGIL 5C09A 4ALAH 2Y5TB 1MIMH 4YK4B 4DLDA 1A6WH 2K3TA 3C9NA 4TN9A 2C7UB 2NSQA 4C1TA 2A2QT 2XZCH 3UJJH 5EZIH 3X1EA 4ECFA 3B7UX 4G9DB 4S1RH 4KK8C 4E0RA 1P4UA 5DCCA 4PG9B 1M2OA 4CADB 2X1PA 4KCCA 1YPZA 4TQEL 5I1HH 3V0WH 3BGFC 3KJ6H 5HYQB 2BJMH 2JI1A 3ZYIA 2YGVA 1AQMA 2PYED 1JHTB 2XFXA 2W0FB 4K7PL 4KH2A 3HO7A 3GJFA 1AL3A 1GYVA 4OD3H 1IM9D 2R83A 2A74B 1J8HB 5FECB 5F1OB 3CZLA 2NZ9C 4X4YA 3TO4B 4YSEA 1Z7ME 1LBCA 2XQYG 3L3IB 4AV4A 1JK8B 2J8UB 2I26N 2QELA 1GSKA 4JFFE 3KXFD 4URTB 3ZW3A 4BE6A 1F2QA 4BKSC 2DQIH 1A1MA 3KLQA 3I6KB 3LZQA 1Y6NR 2Z8FA 4D9LL 2ED9A 2ZKHH 3C5ZB 3IMTA 4BLAA 1DANU 4D7PA 4QOKE 4G8IB 1FV1B 2P8LB 5FUOH 2H0FA 1NCTA 2OXGA 2NQDA 4RAUA 1XHYA 2FJHB 2X3CA 4V1DD 2ATPA 2B59A 3S4SB 1RJLB 2EUXA 1M71B 4MAGA 3JXAA 3HNVH 3TJEL 1I82A 1QLEB 5DEFB 1JHKH 2O5ZL 2ZUQC 2FJGB 1QFUH 4C8XA 5F1QA 1ZXQA 4XP6H 3QIWB 4LQFL 4N6QA 5FYKL 5FTHA 2CJUH 2R69L 4TULH 3ZOAA 3F7LA 3HZKB 4OQTL 3K6SB 3CZFB 4Z8FL 4NF8A 2A1WH 3UTQA 3RGBA 3ROJA 3RNQA 2IQAB 3BZ5A 4NWUL 1DEEA 3T0WA 4WY7L 3ZDZF 2O5XH 2A99A 2FX7L 1JI1A 1CTOA 1K2DA 3QI9B 1KY6A 2XXUA 2EDXA 1NAKH 2AEPL 1T4KB 2ZTBA 1NFIB 2EUWA 2XX7A 3QRGH 4LSTL 3K72B 4F92B 1OANA 2V25A 4DKFH 1FIEA 2X4SA 3Q28A 2G0LA 3O11B 4PJXA 1Q90A 5L8DA 3FT4B 5B1JC 1DQDH 2HB0A 1IARB 1ES0A 4FULA 4YDJB 5ABDE 1E4HA 2QQLH 1I8LC 2YJQA 4TV3A 3TNMB 5BZDB 4P5TD 4PF6A 3VXBA 3D06A 4HK3N 5DD0H 5IEKB 1S7SA 4OF6A 3NQIA 2H9GA 1U3HD 2YQBA 4WCYL 4JFVA 4GAGL 5FUCC 4NQDA 1EAJA 4XP4L 3BGAA 1G5GA 1LE9B 2A73B 3WY1A 5J3HC 1S9KC 3NFNB 5ELVA 2KDGA 4NUMA 1R9LA 3CCHA 3MZ1A 1WWAX 3CZJA 4IJ3B 4U3HA 2JNZA 3EOBB 1E4XH 2VXQH 1IKNA 2FX9L 3HPJB 3H42H 4EI6A 1SQYA 3EFDL 4B3EA 4X98A 1SHWA 4JRWA 5EU3A 1ZLEA 3CG1A 4CADA 1C8PA 2GJ6B 2MKWA 2ICWJ 4CU6A 2KDYA 4OU3A 4M43L 1D6VL 3MP6A 3ARGB 4HS6B 2GKIA 4EKXA 1FORL 2Y3NA 2V9TA 2E59A 4Z0XA 5IQNA 5TE4H 2AMGA 3USDA 4UOW0 1DFXA 3FQ4A 4NOBA 3I3EA 3NH7L 4PC9A 4BDOA 1ETB1 1NMAL 3V6OE 4KKRA 4ZUVA 5IK3B 2J1WA 3SGJC 3V4VH 1VRSA 3PPNA 1I1YA 4G8EB 1QP1A 1KB9K 3OGCA 4HWBA 3W3BA 1T89C 2QPFA 4MNQB 2JJTA 2NXYB 2XXHA 1AS8A 1R34A 2WXRA 3OO9A 5BUAA 1UWGH 1PG7H 3MYJB 4KGLA 1OKEA 4NKMB 4N0UA 2IGFH 4X9YA 3QWNA 3MNVA 4X7CC 2OJZL 3B9EA 2L3BA 3V52H 5A5XA 3ZN6A 4YVNA 1O63A 2ZCZA 4NKOA 3HSTA 2P9RA 2YKKA 4FNQA 4L3EE 4PAFA 4EDPA 4ZS7H 2VAAB 1SOKA 1PSKH 3RFZA 3SDFA 2O69A 4JAMA 2HKFL 3MV7A 2YHGA 4R97C 1I8KA 1HZLA 5AVRB 4QHKI 1W8EA 5DURB 4JNXA 4MNGB 3VG0H 2AITA 2ZKMX 3PGFL 3OKMB 3US1A 2AJXL 2LLGA 3NIDE 3TCXA 5JW4Q 4ESWA 3QQXA 4A63A 4RZKA 3OSRA 3VWJD 2Q76B 3MNZB 1KBWA 4JFEE 1IAII 3SZ6A 3NBNA 2J8UF 4LHUB 3FMGH 1CDHA 2R29H 3ESNA 3ZR6A 1ZVSB 4XPTL 4XX1E 1IMFA 2B16A 1OAYH 2YPNA 2UY6B 1MCKA 4WJ5B 5C09D 3JWOC 1MI5A 1NCDH 2ZXEB 1NV3A 3MJ7B 3HKFA 2XWRA 3HCVB 4D9QD 3HC3L 4WEDA 1UA6L 3C60A 1SEQL 4OHNA 4YHYB 2XJLA 5CEYA 1BMGA 2VDLB 1EBAA 3P30L 2RCSH 3WLWD 1JEVA 4OI8A 4K7PX 4AC2A 5FM5O 5IP4A 4PV8A 1RZPA 1RP9A 4N2EA 3E6HA 4YMBA 1C08A 1D2PA 4WWKB 2QL3A 2MQ0A 5HHPB 2B9AA 4MNCA 3ATDA 4LLMA 1OEZW 2EACA 4NKIH 2OSLB 2VZUA 4TQIA 4Z0BH 3ZKSD 4EUOA 2X4OA 4O3CA 1NEZG 6PAZA 4W9ZA 2OPCA 1ZJLA 3WKYA 4KCDA 3ZT5A 3HOGA 2D7OA 3FQWB 4MS8C 4DKEH 3TIEB 5JPMB 3SBQA 3CQQA 3EDKA 3GBML 4IGBD 1KPRA 2W65A 2PMZA 4G8AC 3BH8B 5CINL 4XNBA 3O41A 2KI6A 4GRWH 3AU1A 1CGVA 1MCOL 3BD4A 2IF7A 4GO9A 2E47A 4HUWA 1UOKA 2RB8A 4N8CL 5CILH 4FQQA 1NBVH 2VE6A 3EYVA 1XCTA 4ZDHB 3BVTA 3BW9B 3FFOA 3GI8H 1UD4A 3EYSL 4OGAD 2Y5KA 1FYTA 3V6ZA 1FPIA 4N9OB 1KCVL 2UXAA 2OYKA 3PPQA 1G6RB 1PCSA 1XDTT 5ISZB 1N3WA 2QRYA 3CIAA 3CXHK 1JRHI 1DJXA 2F19H 2JKLA 3P9MB 1FBGA 1HCYA 3FPXA 2O4EA 3IWUA 3I3BA 4MCOA 2QHRL 3B7TA 1EJOH 1HESA 1T21B 2YPKB 2J6EL 3DTXB 3MV01 1BECA 4F5CE 2Y7IA 2QHLA 1SQ2N 1GS7A 2HT4C 1S5IH 1R75A 2Y2YA 1ETJA 2G75B 5A16B 4I0KA 1MNUL 3TIDA 1YLBB 3MZ9A 2VDQB 2WXGA 4TUJB 4ZEKA 4HIJB 2VQ1A 2O1LA 3I50L 1PB7A 5EC2B 4U6YB 5DD0L 2YRLA 1FBEA 3VTMA 3ATAA 1S7RB 4BHUI 1NEPA 4PRHA 2JV6A 2Z91B 3M1OA 4JQIH 2DWYA 1I3VA 3KYKL 3BKCL 1FZJB 3TEXA 3H3PH 3QQDA 4Y16D 3UPAA 5DHVH 3EYUL 5I1CH 3RFRA 2I9TB 5E00A 1YNTA 1CUOA 1MEXL 5ISUA 3Q6GL 1EJFA 4KXDA 5IHZA 1OQHA 2BSRA 3U9PL 2AQPA 1J0IA 1OSPH 3IMUA 5I0YA 1RZ8B 2FX7H 2JFCA 1CFNB 1KPVA 1CE1H 1GC1L 1YEWA 4M1CD 3OJDB 4NX0A 1B0GA 2MQ3A 4GJTB 3W5NA 2KLRA 4GXUM 2F34A 3IX1A 4G77A 4NF6B 1UT2A 1LILA 3IDMB 1T21A 2Y06L 3FJMA 1XIWD 4MDIA 1CG9A 3C5ZC 3TA3B 3TBTB 4Y7OC 3VMNA 5EA0H 1NAMB 3IMWA 2D0HA 4JO1L 1JV5B 3VFUA 1F11A 4L37A 3QZWA 2MJWA 2OTWA 1MH5A 3GWJA 4Y1AE 1T0KA 4GI6A 2AV1B 4YH6A 3CX5J 3V5AA 3BZFA 3TWYA 2N0MA 4N6PA 2VZ3A 4G6FD 4FQQB 1LK2A 5EYGA 4QXTA 5E2TH 2E7DA 2B3RA 5E8DL 5AKTA 1EXGA 1YY9D 1DBAH 3P4OA 3QIWC 1A8ZA 2VH5H 2OAAA 4OFJA 1HTYA 1MCSA 1QFWL 4B9PA 2E8ZA 1CD1B 4PJ9C 1HU8A 4DHLA 3VXSD 1OTSD 5C6TL 4NJAH 3VXCA 5T33L 5DRXB 1NCBL 1BAFL 3C8KB 4KROD 3ARGD 3MCLH 3DOSB 4KQ4H 1YEJH 2VXTL 2XFGB 4AEHH 2A9NH 2L4OA 2HXAA 2EIDA 5HYSB 4UWQB 1RYXA 4PRNB 4YOKA 1DN2A 4NQXA 4TLLB 2WLMA 3CVCA 3UDWA 4L37B 1HSLA 4PWGA 2HSIA 2ZSWA 3QFDB 4Q2ZB 3RT8A 1IMBA 3MN8A 5EBMA 3AG1B 1XMWA 2EQDA 1DSFH 5GS0H 4IGRA 1CYXA 1E4KA 3MA9L 4F9LA 2HFFB 3KW7A 3UJJL 3O6HA 4LEXL 1IIWA 4OFDA 4OKVA 1PJ9A 1F3DJ 4ZSOA 5EG6C 1FBHA 1UM4L 2HRLA 5DD3H 3TT1L 5LHDA 2E9WA 3EBIA 1MLCA 3T3PF 4HWNA 1DUYA 1ZOXA 2FZ3A 4JG1H 3QNXB 2HLFD 2PPEA 3CJJA 1URZA 3NIGF 3BLKA 1JNFA 4GI8A 3FSVA 4AYBA 2O61B 3FCSA 4LPVA 1MH3A 5DEJA 2WXLA 4GSDH 2ZP0T 2QFLA 1ACCA 5KBMA 1DO5A 3BCDA 1L0QA 1RY7B 2WZ5A 1YN6A 4B9ZA 4XMXA 4Y5VA 2R39A 2Y6TE 4KY2A 2LGNA 5FHBH 2LT9A 3UTTA 3EBHA 3CN4A 4JG5A 4U6YA 2XI9A 2NY0C 2VLLB 4U1MB 3SODB 3ZKMD 3IO6A 3OEMA 1K4DB 4M62H 1D3KA 4PJHE 4R3SB 1MCFA 4U6XA 5JDJA 5C0BA 2F5AL 1A02N 3L9RA 2L5VA 1U41A 2C3VB 5BRZE 2G75A 2H8PA 4PJ7F 3P73A 2YWYA 1OTUD 3MJ8B 5E2WH 5GGSY 1HINL 2YA1A 2V7HA 4U1ZA 4KRMB 4NUGH 2NXYD 4NZDA 4FQJL 1PZDA 3UP6A 1MY2A 1IGCH 4H67A 4L8SA 2DIJA 2JSFA 3W9DA 3FZVA 4IU3B 1EUUA 3ILPA 1WZ1L 2OK2A 3BW9A 3GINA 1T6WA 1EMTL 5CCJA 1X5JA 1UHVA 1IBGH 3ILDA 3GIVB 4HWZB 1NPNA 3ARFB 4I9XA 3B6SA 4BM7A 3KE0A 3GHEH 4DGWC 2F18A 3MU3A 2XX1A 4M1CC 2XICA 2CD0A 2XPGA 2FBJH 5DHMC 2MCG1 3UEZA 3ARGA 1G7MB 4W9EC 2R23B 2EIMB 4DTGL 1FQEA 4YHNB 3OKKB 1KWKA 4LGRB 5DRNB 5I1HL 2Z1PA 2WBDA 5GRVK 2EDJA 3SBWC 1O6SA 4ODSH 3E9UA 4MJHA 3RWHA 1G43A 4FE8A 2ITCB 1QSEE 3Q8EA 2MHAB 5FA4A 5PCYA 1U8KA 2D7NA 4CNIB 4YSAA 2QVUA 3RWEB 2VDPB 4HS3A 4L3FA 1NDGA 2X1XR 4EI5C 1UEMA 4CBZA 4PRAA 4XIGQ 4UNVA 3HC4H 5H8DA 1NIAA 4K9EL 2H9GB 3MNDA 1U95B 3OZKA 4MJIA 4FNSA 1Z3GL 2NY3C 4E36A 3KG2A 1MKFA 2HG0A 3ZSSA 1D7DA 2PCXA 2OW6A 3VQMA 3CDZA 3FOLA 4TRPH 2XBZA 5KDTB 4ZTEA 3MPCA 3QHTC 5IB4A 2F7CA 4ZUUB 4E41D 4EN3A 2O68A 1JOIA 1KY7A 1EXHA 3HS0C 1G7QA 1MDTA 4WWKC 2HFFA 3IJXB 3BUBA 4GIAA 4OR1A 5FYLE 5GRYA 3O6FC 2WUBH 2ZUUA 4U05A 4LRNL 3W39A 1G9EA 3TTLA 3BJLA 5T8IA 4Q0CA 4XOEA 1PX8A 4HKBB 5J1AB 3IMSA 5GZOD 1IXCA 3PDDA 1AY1H 5T5FA 3KG5A 3U25A 1B2WL 1YEFH 1YEIL 5E2VH 3W11C 3HZKA 4OEVA 3R26A 5AOZA 1DE4A 5C0AD 6FABH 2WYIA 4ABQA 2ZG1A 2IADB 2ZYMA 1P2CB 3OHXB 3ISYA 1C16A 3UCRA 3S9LC 1ZA6A 2LAGB 1E43A 4NPYA 5I66B 4GXVL 4JY6A 4M8QA 3VWKC 4XVJH 3SJVD 5TP9A 3O9WA 2OJ1A 2Y22A 2VDOL 3MLUL 2GTQA 3N40P 1SN2A 2LLNA 5DUJA 1A9BB 4O5LL 4RAUB 4N2IA 4PGCB 4ZUSA 5FKPB 3W5MA 3PY9A 4L0PB 3DV4B 5FA3B 3S3DB 1QGXA 1JVOA 4TVSa 4QF1A 4TUUA 4JPQA 2X40A 4D9RE 2NY4C 3HG1A 3HN8A 3O2VL 1U2CA 4GAYB 2DWEA 5TQ0H 4AS4A 1S4IA 3OR6A 1R46A 2OQJA 4HK0A 1PMYA 4XMKL 4XN8A 3B2VH 2M8XA 3GIZH 3GXIA 2X4UB 5K9JH 3AADB 1CL7L 3EHTA 1JYVA 4UQ9A 4F8QA 4HOWA 4GAJH 4I88A 2VR3A 4LQ1A 1LP9A 3LD8C 3QUYB 3K0YA 5D7LA 3GBNH 1XVSA 5ETUA 4UQBA 4FTVB 4O02L 1KYOK 3RVUC 3O4OC 4RWYH 4EN3C 5M2VA 2AXJA 2ZZUT 5FDWB 3ZDYB 1HWGB 5JHLA 1EZOA 2WB1A 3IMRA 3C2SA 4H44C 4Z7OF 1KCWA 3DRQA 3KGSA 4HHAB 4XE0A 1LDPH 3V4UH 1NFDE 1AGFA 5DO2D 5IJVA 4JANA 5KVEE 4JKPH 3TBBA 1BLFA 1LB9A 4U21A 3GRWH 4OKDA 5KJRH 4FMKA 1QPKA 3WENA 1Z9OA 4GG8A 4K9EC 1R1CA 3QFJA 4BSWA 3RY3A 5E5RB 5IV2B 2D3NA 1UZGA 1T2QH 1ROWA 2I7OA 2A9NL 2V3FA 3GMQA 4W9FC 3MRJB 3LR1A 3MTXA 4P8QA 5DQDL 1EAPB 5IMOA 4MAUH 2R29A 4J3SA 4F1VA 1OT2A 2CA4A 3IB0A 2PR9A 1NL0H 1BVKA 4PFBA 4R6HA 1TEFA 2I85A 2NQ3A 1B88A 3NG5A 4JR9L 4OCRH 4X6BA 5EU4B 2H41A 4KKCC 3ZZQA 5CD3B 1FJ1A 1XGUA 3VNYA 4AT6B 3N6TA 4GWYA 2I3WA 2V5TA 2QR0A 3D9AL 4P0DA 5E1QA 4Z3JA 1C7SA 2OCJA 1A9VA 3TBSA 4GBWA 1BJ1H 3PPRA 4HIIA 4K5NA 3RZCC 1VR5A 3U79A 4LVQA 1EYIA 4AQ1B 1WRFA 1ZGLA 3NTCH 2W60A 2RQEA 1VA9A 5MHSD 1D5IL 3ZUCA 2VQ4A 4H0LC 4KO6A 3B9KB 5HHVH 1VZIA 3I3VA 1UASA 3Q1SL 4K8RD 4X42A 4BUGA 5BV7C 1J11A 4CC0A 3DP6A 2WYTA 4ALAC 4MX7B 4WGVB 1Y6MR 4ZMZA 3VYNA 1L9SA 4LIQE 1XBDA 5KSAA 1HXYB 5AENA 4XC1L 4OZHA 3ZBMA 4M9OA 4N8VG 1MOEA 1F02I 2X4OB 1F0LA 1SLWA 2YFNA 4EVNA 1RLWA 3QJHB 3HE7B 2X2IA 1J05B 4KK5C 2G9HA 1P6AB 4EF2A 2KLSA 1NWOA 3MFGB 3C09C 3Q43A 2GFEA 3KYKH 5BS0B 3NRFA 5HGAB 4FL4C 2XXYA 4NZTH 4P2QE 5DD1L 1VFAB 5LN8A 3MLVL 3VVFA 4FKKA 3DDGA 3FQ2A 2ICES 4MMYB 1IUZA 3D4GA 3FO1A 2VLRE 5M95B 4FERA 3BUQA 4M3HA 5DVFA 4YPJA 5AA2A 2BERA 3UIZA 3CGTA 1A65A 3V0DA 5I5IA 5DRZB 1T83A 3W2DL 3MPKA 3POHA 4G43B 5FFOA 1EJOL 2J6EH 3L17A 2I32A 2YKLL 5ICUA 5DK2A 1GS8A 1BJ1J 4N3UA 5E4AA 3HCQA 4WHCA 3FHEA 4LCIH 2AKRA 4HCYA 3Q0HA 1KCVH 3VFOA 1UGKA 1NUDA 3DX1A 4E41A 4EN3D 2F6PA 1AFVL 1FZOB 4KI5D 3TBSB 1UT9A 1X9RA 3DK2A 2A0LD 3ULVF 2DWDA 3AS3A 1MCOH 4J8QA 1E4XI 2CDGA 2CGZA 3VFTA 4I1PA 1T4WA 3MLZH 3BVWA 4GQPH 4FX5A 4G6FB 1QRND 3PL6D 2A7BA 3ZQ9A 5GGRB 3RX5A 4CSSA 1FFQA 1WZ1H 1G7LB 1LK3L 2BNRA 3OKDA 4DPAX 5I2KA 5AL0A 4ZW6A 1RIVH 3EDEA 1P7KB 2OZZA 2ADYA 4JGMA 2G9HB 3DOHA 1Q8MA 4I77H 4BZ1L 4MMXB 2A4CA 3FBKA 4FZ8L 4MZRA 2WTPA 4L17A 2R9HC 5GISH 1TT1A 3PWLB 1FDLL 4OZHB 4LN5A 3OLEA 4JANB 2EP6A 5CSZB 5D2NB 4ABWA 1H6UA 4M6OH 5JPNA 4DUXA 3Q6GH 2CIIB 1PNDA 2OLDA 4YDIH 2VPOA 3GLAA 5D1QB 3QISA 2R56L 1AQ8A 1E8XA 4OZ9A 4HEPA 5AWNL 1SYVA 4F57L 2EIJB 1F18A 3L6HA 1OLAA 1CE6B 3RTQA 1FO0A 1QHQA 2PYEE 4XPTH 5EU6A 5I1LA 4K3JH 4JQIL 3X2QB 2N1TE 3DK0A 2DBJA 5L4IA 3HPJA 5ABAA 1C8QA 2EVIA 1XGPA 2IPUG 1E7UA 2NY3B 4N6RB 1Q0XH 1HI6B 3ABKB 2R0ZL 4NAPA 1UZ8B 4ELMA 1YMHA 5EZLB 4PHZA 3AFLA 3RWGB 5KSBA 3H9SA 1FBCA 4HT1H 2WZAA 3T8MA 2EEAA 5I2IA 1EBPA 5EU4A 1W72A 1KUMA 1LE5A 1J9RA 5IMLB 4QLWA 2Y6SD 3S3PA 5F7DB 1RUKH 3SE9L 1US5A 5EIIG 4OCSL 1UQWA 2Y2TA 1KGCD 2B77A 1I9IH 2COQA 2WZ0A 4A7VA 5GS0L 43CAB 5IUCA 1IGML 2ICWB 3MSTA 1EWHA 5DS2A 1M2VB 3NFSH 2IXQB 3V2AR 5J5EA 4OFLA 2XXGA 1IIIA 4QJ3B 5EEYA 1A3LL 4MD0B 3HLAA 3OENA 5SX4I 1TR7A 1DEEB 3IGAA 3HHGA 3EFOA 2UXFA 3ZRCC 5I5MA 1EANA 4H2CA 4PJHF 1NEUA 3BMVA 3KCWA 4W81A 2MNUA 1YN7B 2UZIH 3QCUH 4BELD 5GRJH 3CSYA 1ANUA 1OAXH 1NEZB 1A6ZB 2ZOTA 1CI5A 2E27L 4X8XA 1FW0A 3L5HA 3OLDA 1L0YA 1BZ9A 1WP6A 3KVQA 4MWFB 2FYIA 4PJCE 3SGJA 4EDWL 3MRBA 1W16A 3QPQD 3E78A 2P45B 4XEQA 2UVFA 3SQOL 3Q9PA 1JYNA 2H2PC 3H42L 1TLKA 1J9TA 4KXBA 2H1PH 4PLJD 5EBGA 3LIZA 3DBXA 2DYPB 4WUUE 4YLBA 3HC3H 1TMQA 3BPCB 1WBZA 4IEFA 2YPLD 5GSRA 4FHKA 3BKIB 4WFGD 4LL4A 2CZHA 2YJLA 3V5DA 2VSMB 3V4VB 1S50A 3IPFA 4DGVH 4CC1A 4C56A 6PCYA 5D1XA 2JQZA 1RJYA 2DAVA 5EZJA 5T5NG 4L5FL 3AG2B 4N2CA 5JIIA 2O51A 4WDIB 1O7TA 3KPLA 1AE6L 1JI2A 4UT9A 5MP6L 3KEIA 2PWFA 3L95A 5GS1B 2YUVA 5JW5A 4PR5B 4WI7A 2WBBA 5IQ9A 3RG1C 3SYCA 2EDFA 3GFUA 1BVNT 2HZKA 4RZCB 3OKKA 3ZDYE 4YB6A 2Z0UA 3NAAH 3HPLB 4LLYB 4WFEE 4I89A 1GZPB 3PRZA 3KYNA 3C08H 4F27A 2K4WA 3EYOB 3PGCB 2B4CL 4UUJA 3CPUA 3B43A 4JRYD 4NO5A 5E5UB 4XB8A 1NFDB 5D9SA 1CDYA 3ZGHA 4EPSA 1AANA 4X6CA 1R24B 1BD2A 3QR0A 1GW6A 1R5WB 4EF3A 2NWJA 4U1NB 3T3MB 1PKQB 2A74C 1P84J 1EHXA 2GHAA 3WIFA 1IIKA 3R7QA 3G3GA 1YG9A 1AO7A 5DHXB 4KVCL 1T89A 2DLFL 3CU7A 1EEQA 1MNNA 3PP4L 1QUNB 3PFQA 1FL3B 5EEWA 4PWIA 3EOTH 1XF3A 2P28B 4AYID 4A6YB 4JVDA 2QGBA 3RVXD 4KOCA 1S7QB 3G5XA 1WEJH 1U58A 2GH9A 1QWHA 3RZCB 4X6DA 3D69A 3K6VA 3CZNA 1PLGL 5T1DL 2BY1A 2VZVA 3ZDXE 5I1AA 1AVAA 2OKMA 3FO9A 5C0BB 3D48R 2XV2A 3QEUB 4Q7DA 5EULV 3RVWC 1OAJA 5L6YL 1QZNA 1XF4B 2IA4A 4I0PB 4H1LA 1VHPA 4Z7VA 2F1BA 1VGKB 1VEMA 3G9VA 5SWSB 4LATA 3EGXA 5DQDH 4ZJ9A 3S9EA 4LE8A 4AX3A 1JGUL 4ENZA 5HDLA 2CGYA 4YQXL 1O7DC 4NB7A 1WT5A 4DDDA 2H0JA 4H20L 1GKEA 4WHTA 2YXVA 4YK4C 2RGSA 5E6YA 4YNYB 1R0AH 3DSFL 3LHPH 3HI6L 4IIZA 5I6XC 2ARWA 4YKPA 3S5YA 4K9JA 5EUOE 3JTSB 1GY1A 4MAZA 4WCYH 1JGEA 4XXWA 4ANUA 5AA4B 4B27A 1MG3C 3O4LE 5EORH 4L18A 4OESA 4UDUA 1X5IA 3KYOB 1Q1PA 5DD1H 4N17A 5INCA 1S7TB 4IU3A 3OHMB 5E9NA 4OGZA 3WJJC 3Q8BA 3QVAA 4WUUD 5DYOB 5DO8A 3A3YB 3G08B 4DH2A 4WW2B 1V8HA 1WAPA 3MREA 4PVLA 1QNZH 2D7TH 3NPSB 3QUMB 2KLTA 4JLRA 1FPEA 3DO3A 3WJLC 1J1PL 5F1NA 1CI3M 2J1YA 2B14A 1I1AC 4PE5B 1CF8H 4IKNA 4XC1H 3RVVC 3SPCA 2NRDA 3HHMA 1FP5A 3DUUA 3GIZL 4E9LA 2RFXA 3MBWA 3MJ9L 1XEUA 1CXHA 4LEOA 4LL1A 4KKLD