3D4GA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
471
Chain Sequence
TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 144
structure length 471
sequence length 471
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA01
2F7CA 2VP1A 2FYIA 4KR5A 1DSNA 2VD2A 1IXGA 1USYE 5H8FA 3SDFA 4GWOA 4NF8B 4F3GA 4YB7A 3Q25A 4H8IA 2QPQA 4GOTA 1I69A 1MQGA 4OHNA 3R6UA 4ZDMA 1II5A 4F39A 1A7LA 4FJPA 1B3LA 3H6TA 4JWOA 2I4BA 1D4NA 4KD5A 1UTBB 3O6GA 4WEPA 1D3KA 5DEXB 3T93B 1NL5A 4KQPA 4F19A 3H3GA 5EYFA 1FTMA 4F2QA 3IO4A 3GZGA 3C9HA 4FATA 3ECRA 3KSJA 5CM6A 3DP4A 3P7IA 3G3KA 4FECA 3K6VA 5I59A 2B3FA 4GRKA 3FXQA 2DOJA 2F35A 3CFXA 4WEDA 3I6VA 4LVQA 2HZLA 3TTLA 3S9NC 4R2BA 5DVJA 3VLVA 3KOSA 2GRVA 1P1UA 3N6UA 5H8HB 1PB8A 3N26A 4JWXA 1QUIA 3VVFA 2O69A 2F6PA 1B0HA 1YCJA 2D3IA 2UVIA 1FQDA 1OLAA 1RKMA 1FW0A 5ISUA 4H5FA 4FIMA 4DLDA 1AMFA 1TFAA 2UVJA 3OO7A 2F7AA 3TTNA 4KYEA 1ATGA 2DXRA 5BWJA 1N76A 2QMWA 3OO6A 4ZEIA 5DTBA 1I6QA 5K2XA 2O1LA 4ZZAA 4I62A 3K1PA 3ONMA 2O7IA 1H43A 1SDXA 3MVWA 4FEDA 3UA8A 3LSLA 4U23A 4N07A 3VXBA 3SEYA 1B2HA 4KPTA 4YKKA 3SERA 1MPCA 3HCQA 1B5HA 1URGA 1LFGA 4YZZA 1AL3A 1B3FA 1N7XA 4LA9A 3MP1A 2HXWA 3BKIB 1YPNA 1MPDA 1PDAA 4GLIA 3ILTB 1KWHA 4LATA 3C36A 3FIRA 4ZE9A 1MXZA 1S7YA 3H6WA 3BFTA 1LFIA 1B4HA 4X1BA 2DWIA 3O6IA 5DVIA 2V93A 5I56A 2QS1A 4XKRA 4YICA 5AA4B 4MLVA 3QSLA 1FQBA 4IO3A 4P0IA 3ZKLA 5TPAB 1IQ7A 3MZBA 1SBPA 1NKXA 3KBRA 4MBPA 3TTMA 1HSJA 1ZJLA 3U93A 3V83A 2O6AA 4QSDA 1GGGA 5L9MA 1USYH 3BBRA 4GQOA 3A3UA 4G8NA 1OQGA 2Y7WA 4GL8A 3AXFA 1EU8A 3R7XA 2I4CA 3FZVA 3B6QA 2ZNUA 4QFOA 2THIA 3FXUA 3O29A 1NNTA 5H8QB 2P0SA 1Y20A 3IL1B 3VLWA 3FASA 1MXUA 2QMXA 1ZBMA 2V3UA 4XKPA 1JETA 1PB7A 5ITPA 1B5IA 1ZTYA 5JTYB 2PVUA 2GHBA 4G68B 3IJXB 3TCFA 1TFDA 1B7ZA 2LAOA 1N7WA 2D21A 4GL0A 1SQYA 3MPLA 1B51A 2Q9TA 2RC9A 4ELOA 1H45A 1B1HA 5AE4A 1MQIA 2ZMBA 1AIVA 3H6VA 4K3FA 2DS9A 1PBPA 2OWSA 5H8NB 3H06B 3F11A 2NUVA 1SW1A 1PBQA 1JW5A 4H6DA 4O3CA 1N84A 3MP6A 3M3KA 2V25A 3K6UA 3V8XB 2RC8A 1B52A 1MH4A 5HPQA 4PFWA 2XHDA 3MP8A 1GVCA 3TUSA 3S9LC 2VOZA 5HBCA 4P0GA 4AQ4A 4RNSA 3ZS6A 3I5OA 4XXUA 4C1TA 4YKPA 2DQVA 1JVYA 3R26A 1B05A 3SEWA 4NF6A 3MC2A 2GFEA 1B0LA 1MY1A 2XD2A 4L17A 3VVDA 2FNCA 3C31A 5AA2A 4ECFA 3EN3A 1Y4CA 4ISUA 4QHQA 3FXRA 3K02A 4Z0IA 3K6XA 5JEIA 3CG1A 3ODBA 4YMBA 2ZYOA 3BFUA 4F1YA 1H76A 3VDFA 2UXAA 3S2VA 5KDTB 1NFTA 2DWJA 2ONKE 5I2KA 3O97A 1M5EA 1EZ9A 5I57A 3WAEA 4X1DA 4NWDA 1Y4TA 5IAIA 1ELJA 2GHAA 3RT6B 4PE5B 4ZEFA 3TMGA 3G3GA 3RGYA 3H6UA 3B6TA 5L9OA 2DE4A 2F97A 4AB6A 3E3KA 2Z8EA 4OTEA 3FUZA 5TP9B 1B3HA 1D9YA 5A5XA 1DPPA 1AOVA 3SEXA 4GXAA 4OMBA 4NF5B 1Y3QA 1MPBA 2F78A 2YLNA 2HFBA 1IEJA 2DYXA 3PUXE 2UYFA 4E0XA 2R6GE 1DPEA 3OELA 1LCFA 2RINA 3FJ7A 3U8QA 3PD9A 3U94A 5H8FB 3UK4A 3ZKKA 4G68C 2AL4A 4PETA 5B7DA 4R9FA 4Z7EA 5M2VA 2Z8DA 4F1UA 1LBCA 4OXVA 1UTHA 1ZLQA 2ZXTA 3KSXA 5CBSA 5LOMA 1B40A 1SI1A 4EQ9A 3GXAA 3PUWE 2ZYMA 5L9SA 5F1QA 4TLLB 4PFTA 5FTIA 3O6HA 4G8MA 3PPQA 4FEBA 2YPNA 1FQCA 3N6TA 3PMWA 1NH7A 4EQBA 4DCYA 3TPAA 2X7PA 2Y84A 3IAZA 4U1ZA 4IGTA 5IKBA 2REGA 1P1OA 1URDA 4XIGQ 5I84A 4EF1A 1MRPA 1VSOA 2ANJA 4ZEDA 3PMXA 4EDPA 3OOAA 4OENA 3VXCA 1BLFA 1Z7NE 4NMYA 5AA1A 3EHUA 3VFJA 5JK4A 2GH9A 3V89B 4ZEKA 5I59B 3S9EA 3CSBA 5B70A 5ELVA 3TDJA 2HAUA 4OQOA 4MLQA 4Q5TA 4QSEA 2O1MA 1GR2A 4YU0A 4EXLA 5I2NA 1LAHE 4OYVA 1XVXA 3OO9A 3D4GA 1B3GA 2I48A 3W9VA 5DT6A 1MY4A 3MPKA 4IY5A 3G3FA 1Y3NA 4RA1A 3T9XB 2Q2AA 3M3LA 1UIUA 2H25A 3KN3A 5FHOA 2XXUA 1M5BA 1P1WA 3RLFE 1MQDA 3RN8A 4OWDA 4BLAA 5DEXA 1QULA 2O84X 2I58A 3QUJA 2I3VA 1OVBA 1B58A 1NNKA 3KJ7A 3MAMA 3FV1A 1OQHA 2H4IA 1QJMA 4F1VA 3PPPA 3IB2A 3O66A 1P99A 3MQ9A 4RK9A 3FGSA 1S9TA 1A40A 4BDNA 3FJGA 4HCWA 3T9VA 1GV8A 1O7TA 5H8HA 1IUDA 2PX1A 2XXTA 2XX9A 3HO7A 1B7HA 3MJNA 4FAJA 3MVYA 2ONSA 4AB5A 3CFZA 1QKBA 4OFOA 3QIMA 1J1NA 2DWHA 3M3FA 4JSOA 2OCUA 2H98A 3LUYA 4NWCA 5DYHA 2XXRA 2ESNA 4R2FA 4QF9A 2E1SA 4QFPA 3CR9A 5I56B 1FQFA 3DP6A 1FTLA 4BDMA 1SVXB 4GF8A 4O3BA 4F22A 2OJTA 4C0RA 1A54A 2CZLA 3L6HA 2DVZA 4R73A 2RCBA 4N6PA 3A3CA 3G3JA 3T22A 2XXYA 4ESXA 4KFQA 2DXYA 2PYYA 5EHMA 4H67A 2V84A 4G8HA 1LLSA 1A8EA 1QVSA 1VFDA 3CG3A 3HPIA 2PMSA 3H7MA 3LSXA 2DSFA 1RYXA 3EPEA 3KEIA 3JYRA 3DP8A 3CI8A 2I0CA 4RY1A 1POTA 1XS5A 1Q35A 3FVKA 2R9JA 2REJA 4YMAA 1WVJA 2OK2A 1N0TA 2ABHA 1B4ZA 3IX1A 1FTKA 3QUFA 1DMBA 1PEBA 4TLMB 2NOOA 3T66A 4NTLA 1D9VA 5AA4A 3LSWA 4TQUQ 3PUYE 1SYIA 2HCAA 4U21A 1B7UA 3TZAA 4YKIA 4DXBA 3MW0A 5TPAA 4QRZA 1TXFA 3U1OA 2V3QA 1SW2A 1Y1MA 3KZGA 4JDFA 4LUBA 1PC3A 2OBGA 4PFYA 3KFMA 1TT1A 2NXOA 4E0WA 3O9PA 3PV0E 3SEUA 1MXXA 4ND9A 3RQTA 4DZ1A 4OEVA 4H65A 4IO7A 3W9WA 2DWAA 4F18A 1MXWA 1JQFA 3K2DA 1JEVA 4OFJA 3DELB 4Q30B 4KCCA 4U4XA 1FCKA 1FQAA 4EXKA 5KCJA 2YJPA 3FJMA 4NF6B 4I8CA 4OZ9A 1XT8A 2X7QA 5AA2B 5CRYA 2ALUA 3UIFA 2F8DA 2PT2A 3IJOB 3KOTA 1BTJA 4F2OA 4H5GA 2W7YA 3TAJA 3IOTA 2UYEA 1HSEA 4OERA 3EHSA 2P2AA 1B32A 2G93A 5I2KB 2R71A 3N94A 5I57B 1LB9A 3T9UA 3LBSA 4NF4B 1SW5A 1EZOA 3OENA 3VV5A 4HCYA 4BDLA 4ELPA 4ZS9A 2ZYKA 3QK6A 1MXVA 2HZKA 4WXJA 1FTJA 4JXIA 4QFNA 4F3PA 3KGCA 5I58A 4EF2A 3USDA 1MY3A 4I9DA 4BDRA 2Q88A 2QRYA 3FVNA 1R1NA 5KZTA 3FVOA 4DXCA 1Y9UA 2IA4A 3CSGA 1B1XA 3EHTA 2BJJX 2DE2A 1B5JA 1CB6A 4KYSA 4RXLA 3TQWA 3DLNA 1JEUA 3FD3A 2RKMA 4MF3A 4N13A 4BDQA 3LR1A 2XXPA 2PBWA 4Q0CA 4OEUA 2XXIA 5EHSA 4M1VA 2QS4A 4PQJA 1LB8A 1UTHB 2QSXA 4QSCA 3TEPA 3PUVE 4R6KA 3OD7A 3LSFB 2KLFA 3FV2A 3HV1A 2XX8A 1NH8A 4IY6A 4UACA 2IEEA 4FE8A 2H99A 1POY1 3Q27A 4YKJA 1QUKA 2Z23A 3GBBA 1XC1A 3OSQA 1EH3A 3TYHA 3PPRA 1R9QA 1MQJA 3G7WA 2E0SA 3I3VA 1JVXA 3B7DA 3PU5A 3HHGA 3TFLA 5BUUA 4NF5A 4ZZEA 4G4PA 3O28A 3VLUA 2Q2CA 4O3AA 2A5TA 3E4RA 4LONB 3K4UA 2QL3A 2M8CA 4F29A 3N5LA 2F34A 1IXCA 5CI5A 3OO8A 1T0KA 2A5SA 4RK2A 1ZIUA 1LCTA 4NEDA 1H44A 3NK3A 1NNFA 3QAXA 3CVGA 1XVYA 2Q8JA 3K0VA 4U2RA 4DCXA 5I2NB 2VGQA 3IK6B 3NK4A 1MM7A 3OEMA 4X48A 3IOUA 3PPOA 3SKPA 1YAEA 1IITA 1Z7ME 2HQ0A 4H1XA 4EQ7A 3RTWB 4RJZA 4XKNA 4NE4A 3KJTA 3UORA 2OWTA 4H8JA 1US5A 4NF8A 4MH5A 1MY0A 1R9LA 2B65A 1QUJA 3T9HB 3HHFA 1UIVA 1O64A 1FTOA 3Q26A 1QW0A 2QJEA 1B3EA 2D5WA 4RPOA 4YAHX 4M4GA 3RNNA 4POWA 3Q29A 3RY3A 4OESA 4GFRA 1CE2A 4DE8A 2F5XA 2Y7RA 3ZSFA 3MUQA 2H5YA 3FATA 1SYHA 2Q89A 1UTBA 5AA2D 3K1MA 3EF7A 1LAFE 1VR5A 4QFLA 3HN0A 1H3DA 5ITOA 3TELA 2Y7PA 4LQ2A 2XXWA 4TOZA 4JBZA 2UVHA 1S50A 3IO6A 5CC2A 4POXA 4THIA 1DTZA 2B3BA 3JV9A 2FA7A 1LFHA 5CMMA 2RC7A 2Z8FA 4R6HA 5L8DA 1OVTA 1WODA 1VE4A 3TCHA 1MQHA 2Y7KA 4U22A 4OFLA 1R6ZA 4ZEBA 2O68A 1VFEA 1QKAA 2XX7A 1US4A 3SETA 4IO4A 1EZPA 3C32A 3IB1A 3IORA 1MS7A 1Y1ZA 3CFLA 1TWYA 4F31B 3IB0A 4DDDA 1ANFA 3CRBA 3PGFA 1URSA 2OLBA 3D4CA 2V3TA 5DVFA 1OMPA 3Q28A 4WKMA 4HS7A 1JW4A 1DTGA 2X26A 4R74A 3UGWA 4U4SA 2HEUA 4GVOA 1SW4A 4GXSB 1NNPA 4F3BA 1I6BA 1OLCA 4KYDA 4MFIA 5ICQA 2F36A 4X9TA 1IXHA 1MDP1 2UVGA 3H4ZA 1PB9A 2ZNSA 3VE1B 2OZZA 1HSLA 2O51A 3UP9A 4JB7A 5AA3A 2F6GA 4QFKA 1MM6A 4R75A 2XXXA 2DP8A 3HSTA 1LAGE 4C1UA 4IGRA 5K2YA 3UN6A 2I3WA 2H9BA 3MZ1A 4FORA 3M8UA 4EUOA 2ZYNA 1B6HA 1M5CA 3OSRA 3S9MC 3U92A 1L5TA 1LGBC 3MVZA 4RYAA 4XKQA 1UQWA 5FTHA 1Q1KA 3A09A 1SD3A 4GD5A 3OXNA 3TKDA 3JZJA 5CBRA 3IR1A 1IIWA 1BIYA 3RTFB 2F7BA 3IOWA 4ELQA 1F9BA 3ILUB 1A8FA 1MXYA 3QXMA 5KCJB 2CMOA 2HAVA 3S4UA 5H8SA 3MWBA 4KCDA 3W15C 4YB6A 3L6GA 4LQ5A 3RPWA 3QYTA 2XXHA 1OIBA 5FHMA 1B46A 5H8QA 2ONRA 1LSTA 2RF1A 4RPNA 2XXQA 3V5AA 4Q8RA 1P1NA 3G3IA 4GIZA 5CMKA 1ZKBA 1IXIA 3C33A 3SEVA 4G77A 5JTYA 3E13X 3OEKA 3MZ9A 2P1SA 1B9JA 3EQ1A 4G68A 1NMUA 4P11A 2AL5A 2I49A 2NVUB 4OETA 1WDNA 2WKYA 1MG1A 2XXVA 1LBBA 3TTRA 2XD3A 4R6YA 3DM0A 1M5DA 3O2AA 3RUMA 2O7UA 3PMVA 4KI0E 1Y3PA 1XHYA 1IZ1A 3K00A 3T96B 1N3XA 3RT8A 5F7VA 5I58B 3K6WA 3OMBA 4R72A 2Z22A 5H8NA 4U1OA 2DVCA 4I1DA 1N04A 4YB5A 1YTVA 3KG2A 1MDQA 1P1QA 2VD3A 3FVGA 2DE3A 5ICTA 5HM4B 3WAFA 3PUZE 4ZE8A 4PP0A 5J1DA 3CIJA 5A5XB 3E9XA 4ESWA 2I6EA 4ELRA 3PPNA 3U72A 3THIA 2Y7IA 2AYSA 1N3WA 4IO5A 2G29A 3VVEA 3IOVA 4JSDA 5TU0A 1JNFA 3MBPA 3KN7A 3TODA 4LZ5A 1ZU0A 1AH5A 1BP5A 3LC8A 4DXUA 3K01A 4NF4A 4PFUA 4G2ZA 3H03A 4LZ7A 5CMCA 4H0WA 4ONYA 5FHNA 1ZMGA 2ZNTA 1FQEA 3TCGA 5KDTA 4LZ8A 1A55A 4HW8A 3PD8A 4LP2B 1LAXA 2NWJA 3GLBA 2QS3A 4F3SA 1JW1A 1M5FA 3G3HA 1DOTA 2VHAA 1SI0A 1XOCA 4HTGA 2A5TB 4OVJA 4ZECA 3C34A 5CMBA 4KHZE 3K1NA 3MVXA 1O63A 4IO6A 4BDOA 4R9GA 3TTKA 4DIGA 3SESA 4JWYA 1BKAA 5TP9A 3B6WA 2RCAA 3C4MA 3KN8A 2AIXA 4UA8A 4XTCQ 1I6AA 3GBAA 1RYOA 2PT1A 2QS2A 2I0BA 4IO2A 4IB2A 1MH3A 1A99A 3C35A 3TQLA 1GTKA 1MY2A
chains in the Genus database with same CATH superfamily
4GAFB 2EXYD 3PNRB 4U6XB 1J0ZA 2V4LA 3OGCB 5I30L 3I6LE 2WW8A 3L4YA 4G8GE 4JPIA 2A74C 3TTSA 3H7BB 1FPKA 3BIAX 3H9HB 4PJCF 1BVKA 4ZW3A 5IP4A 4QIRA 4P5RA 2GHZA 3SDCC 3SDFA 4N68A 2B9AA 1T20B 4I9XA 4EN2A 4QXUH 1A4JB 3WY2A 4PJGB 3TYFB 1TITA 3B9KB 1EAQA 4PF8A 4BUQA 3RZCA 4NF8B 2BVTA 4UINH 3FQ1A 4F37F 4F3GA 3V7AG 3SOTA 1IE4A 3V5KB 4NN7B 4XPFL 1P5UA 1PIFA 3B50A 4H8IA 3LKNA 5C2UB 1IE5A 2XZQH 4NHBA 3V7MA 1B88A 1HQ4B 3N40P 2RIKA 4TSBL 3VXUD 4UM9D 2QV4A 5EU6B 5B39A 5D7JC 3LXCA 5AW1B 3ZMRA 1H6UA 4G7YH 3VFOA 4JY5H 3FO9A 1HYRC 1KB5H 4ZUSA 3BGMA 4JM2A 1I69A 1MQGA 3NJGA 4F7MB 1T5XA 4MMXC 1YY8B 2YK1H 3WFBL 4KKRA 4U49A 1L7TL 1RUAH 2BK8A 3ZE2F 3UABA 4ZDMA 2F5BL 2UZXB 4GQZA 3ZDWA 4I2XA 4GI8A 2LLGA 2VDNL 3U25A 2Y0SA 3F65A 1KLFA 4NLHA 3DUSB 1KFGA 2GIYA 2N0KA 3OF6A 4X4ZA 1FHNA 2ED9A 3GM8A 2I4BA 4MDRA 2R0WH 1GKEA 3UZEA 4KD5A 1X9RA 1P6WA 2ESVD 2V5RA 5B3NA 3GRWH 2AAAA 4O02L 2HFGH 2YUXA 4FQ1L 5JZ7D 3O6GA 2X6AA 2DI8A 1D3KA 1ZTXE 5DEXB 3T93B 3TBCA 4HS6B 4LLUB 1BQRA 1JGEB 2VTFA 3CFJA 4NQDA 3ZT7A 3H3GA 3LEVL 5EYFA 1U36A 2GBTA 1ID5I 5I74B 3NCJL 5C0CE 1FV1A 4RRPG 4F2QA 5EOCH 1L9PA 4X04A 4YHZH 4NZRL 1FH5L 5E6YA 1MKFA 5SV4A 5ESYA 4ODXA 3IPEA 1VA9A 2JLLA 2I7OA 2XJLA 5CM6A 3DP4A 3P7IA 3GI9L 2V9RA 3QUZC 3BYTA 2LVEA 2QMJA 4KOCA 4OKVB 1USQA 3OO6A 3MLVL 5HGGS 2CRMA 3EO1A 4L4TE 2K3TA 4GH7B 4LT7A 4AM0B 4QNPE 2CUAA 2B3FA 5I59A 3EW3B 4RMWA 4X83A 3P11L 3BEVA 4LP5A 1BV8A 3WE1A 1O6SB 2EYTA 3OL2A 1UD4A 1AP2B 3W2DL 1NLBL 1JIBA 1SYVB 2PXYB 5DVLA 3KOSA 3T4AC 3FAWA 3QIWD 3FTUA 1EPFA 3JTSA 1MAML 4F57H 5GZOD 1P1UA 5H8HB 1E42A 1BGXH 3UPAA 3N26A 5ICZB 5IG7A 3VVFA 2BHUA 1L0XA 2G75B 3F05A 5J8OA 2R56H 4WI3A 5MENA 1HYSD 1CTNA 1XTLA 1Y18B 2K8QA 1S9XB 3AWGA 2H45A 3D3VD 3MO1A 4MJ5A 2WVVB 4Z18A 2HPTA 1PD1A 4YSUA 2WLZA 1RKMA 1M7IA 4BIKA 4PJ8D 3WE6B 1OZTG 2D8KA 3C6LB 4S10A 2ZYHA 3EBHA 3MRFA 5EOQL 5I24A 2NLJA 2Y2TA 2ZOKA 4OGXL 3ZDZF 3HNVL 1NGYB 3FRPG 2V7HB 3U4BH 3O4OB 5MEOA 4GSDH 4LNRA 2DMKA 2IPKA 2X4OA 2FUTA 4OI8A 1CDIA 2ZSVB 2VZ1A 4KYEA 3I9AA 3QWNA 1NUDA 3OAZH 4H8HA 1U6AH 3KWVA 5E8EB 1FSAA 1N76A 1QSZA 3ILQD 1L9SA 1I6QA 2A9BA 5DTBA 2FIEA 4YSPA 2E7BA 3N9GL 3FH7A 2HG5A 4QNPF 4DTGL 3NZSA 4RESB 1T1ZB 2OJZH 4ZZAA 2OTWA 4BZYA 1J10A 3CVIL 4IOSA 2XQBL 2AJSL 2KDGA 1ROWA 4PRBA 2YXMA 3U7WH 1LDSA 2D7TL 4Y19D 3DX4A 3GEFA 4O7MA 1YUKB 1CD8A 1ZHNA 5GGTL 2BNUB 2Z1KA 4ALAH 2WLKA 3ZZQA 4PLNC 3S2AA 5ES4B 2BP8A 3FT0A 3G5XA 4Y5VA 1QTPA 3MXVL 3VGAC 4A2EA 5IF0A 2ZWNA 3BPLC 3I74A 4FJYA 2VJ8A 2BW5A 3LSLA 2WANA 4U23A 3SGDI 5J11B 2ZXAA 4J3OF 2B2XH 5SWZE 2F54E 5E6RB 5AKSA 1M6OB 4K55A 1TU2A 3QFDB 4X6BB 3UAFA 3WELA 4WI2A 1FYTE 4EVNB 1OF0A 3KXFB 5DS1A 3T5WA 1BEYH 2AEPH 2Q8AL 1F90L 1MFMA 1JK8B 4FQJL 4ERSH 1B2HA 1D5BB 2VDPB 4G3YL 4XX5A 4Q9BA 4W6XB 1MPCA 1RSYA 1RHHB 3EF4A 3QFJE 4P2OB 1URGA 5I1KH 1J1XL 2WXPA 3QUML 1LFGA 4LPUA 3C60D 2D7MA 3L3IB 3QORC 2WIIB 4D0DB 2AEIT 2BY1A 3QZWB 2ZYIA 1BG1A 2APXA 1B3FA 3VFVA 4KKCD 5J56B 3MP1A 3FU7B 4JQVA 5IVXB 3QS2A 3BKIB 2WTRB 4Y2NA 3WUWB 5B1JC 5CP7B 2X2HA 4L9LC 4B9KC 3O41A 5KYYB 5E2VL 4Y88A 3B2DC 4V1DB 2VO5A 3PWLB 3IGFA 4XRCB 1Q0YL 1UKSA 3OC5A 5D6CA 3TS8A 3QG7H 5GGVY 3ILTB 1KN2H 3PNWB 4LATA 4N0RA 3HG4A 1TYJA 4X7FC 4DUXA 4Y4FD 3FIRA 4ZE9A 2MJWA 2QSVA 4WV1C 3DVGA 3EDEA 1ET7A 3CFKB 1NL0L 2FTAA 1CL7L 4TSCL 2XN2A 3VWKB 4OGYL 4OV6F 1S9VB 2Z7WA 25C8H 3CFNA 3TEWA 4LBEB 1KB9J 1HKLH 2YD5A 2PMZA 2V93A 1Q1JH 3MODL 4WUKL 4KVCH 5I56A 1A14L 2V2WA 5I1LB 3LNIA 1QUNA 5LBVA 4Z7OB 5I8OH 4Z7WE 3D87B 1JN6B 2CK2A 4P9KA 5EO0B 3MDJA 4YXHH 1LO3L 1CTOA 1NAML 2P24A 4X5WA 2FJGB 4R2GC 2DJMA 4C83A 2VYRE 5T1JA 3CDZA 2Y6SC 4PWJA 2RCSH 3ZKLA 3EGDB 1R3IH 1MCSA 1XSOA 3MRCB 4BFOA 1KZ8A 2A83B 4WEEA 3VGHA 1SBPA 1DBKH 2APVA 1NMCB 1YY9D 2I5YL 3JWDC 4KQ0A 1L7IL 3UZQA 1RZKL 2A6KB 3L48A 4LEEA 1C08B 1Z5YD 2D0FA 4MXWH 5C0BE 2LHAA 2EH8H 4DGVL 4F9LA 4QJ5B 3O8XA 2OPCA 1PZBA 4KJWD 1D9KC 1WP6A 4WTZA 4U31A 5I76A 3U36A 3GMRA 2JIXA 4XP6H 5EFIA 1KJ2H 1T6WA 3V83A 5F6IC 2O6AA 3QDGD 3D34A 3QDMA 3BGFC 1FFQA 3K2UH 4O2FB 2WWMD 3VGFA 5C7XL 1MNNA 4FNUA 3AW5A 1ND0B 4I4WB 4N1CA 5DC4B 3V5HB 3KL5A 5E2WL 3CFCL 4LCVA 4OR1A 4G8NA 1MXDA 3A67H 3BSGA 4W70A 4CNIB 2Y7WA 3VXUB 4UM9B 5C70A 5HVWA 4L0ZA 3SE4A 4YOKA 1EU8A 1E9QB 4XO5A 5HHNB 2Q2LA 4YPGB 3WHXA 4ANWA 4Q9RL 2THIA 5FEBA 2F58L 4LLVA 4JCWA 2DQFB 1IBFA 4JHAH 3X1FA 1RQ5A 2EZ0D 2PWGA 3GS0A 3UTSE 3ZHLA 3L7FA 2A4EA 2F19H 4PRIA 4X6EA 4Z7WF 1QR4A 4LCYB 1H3VA 1M3IA 3BKMH 4XMKL 1NNTA 1U8LA 3R4RA 1Y20A 4OCXL 4JNXA 1KYOJ 1NGXA 3VLWA 3WFCL 1HH9A 1R3HA 2AK4D 4QY8B 1KA1A 4EN3D 3LQAL 3KHQA 4N1HB 2QMXA 3KYKH 4LSVH 1JS4A 2EVIA 2V3UA 5CEZH 5IB5A 4X4ME 1BFTA 1JETA 1CC3A 2R29A 3BQVA 4RFEA 4U1LA 5FK9A 3SGDH 5F7KC 5AVXB 1QI5A 3TJHC 4OFDA 3ZKMD 4DW2L 2PVUA 1AQDB 3MVSA 4L48A 5KAQF 3E2HB 4WW2C 1S7UA 1NUXA 4AEEA 3C75A 4ZJ9A 5FYKL 4DETA 5DJAA 1MFAL 1X5GA 4Q97A 4HJSA 2LAOA 1BAFH 3CVHL 1VEOA 5D7IB 3IBEA 2VN7A 2AXFB 3T6QC 1F4YH 1DANU 2OMBA 4BSVB 3ZKNC 1YEFH 4G6JH 4R26L 4NYLB 4LCCC 1P4UA 2DW5A 3O11B 1CK0L 1NPJA 4HCRH 3VH8A 2RC9A 2JKXA 4CU6A 1KC5L 1G4MA 5F1NA 2OL3B 2WNXA 4WNQA 3G7TA 3K6IA 4JE0A 5KBNC 2GITA 1MI5A 4PV8A 4YL4A 3DOHA 1U42A 1CDBA 2FO4B 2X7LB 4D0CB 1DVSA 1KNOB 1J11A 1GS6X 1OGAA 4N8UA 3H6VA 4QHNB 5EWIH 3D4YA 3UYPB 4K3FA 4G9FE 4DZ8B 1N6QH 4TSAL 4GYBA 4XHQA 4GUQA 2GTWB 3SDYL 2NUVA 4Q52A 3HR6A 1NWOA 3ARFA 4Y2LA 3I6SA 4DGUA 3V7AE 2DMBA 4ELDA 1FPFA 1N84A 4JFYB 1PSKH 4MAUH 4YHIB 2GPZA 2VITB 4I3RL 4BCXA 3LIZL 2J56A 2DM7A 2IALA 2JB5L 3DECA 5DD3H 1ZT7B 1HZKA 1FPDA 3K6UA 3HJEA 3N1QC 5FOJA 4G72B 1XH2A 3LNGA 3KLSA 1RZJH 1MW2A 4HYTB 3FTSA 4KZEH 2A38A 2IAND 2VXVL 4M1DL 3FCGA 1J8HE 4KAQH 4AEHH 3Q6GL 3O6FC 1IO4C 3D50A 3QULB 4E9TA 3FUDA 5E1AB 3JWOC 1C5BL 3S9LC 1LO4H 2Z8WC 4OZFG 2WWKT 5E4IA 1FGNL 1TVDA 5ETUB 1JOIA 1TVHB 2QGEA 1IAOB 4RNSA 1HN1A 1CN4A 1RURL 1RDZA 3SYAA 3W38A 1Q9LB 3OAWA 2FIRT 5HGHA 4PV1C 4BZ1L 2DQVA 1KPUB 4PP1D 3HZYA 4WY7L 4N0CD 1JZFA 3DYMA 2IH3A 1NM9A 3HZ3A 3NRFA 1TQSA 4MAYC 5KS9B 2ADJA 2CIIA 1KEGL 1JVYA 4JR9H 3IK2A 5LAXA 4YZFE 3QK0A 3KPSD 2A74A 2HRPL 5JXED 2K3HA 4HJGA 4WQOA 2YRZA 3SDCA 1B90A 3V52H 1RFDH 4EMZA 1RH8A 5FFGA 4P4RB 1PG7X 4GO8A 4N0UB 2PYED 3MRIB 6FABL 1MW0A 1D5XB 1E5ZA 3T2NH 3VRLF 3UMTA 3E8UL 4MS6A 4ECFA 4Y19B 3VX0A 3HC2A 4BDVB 3ZKND 3H56A 2AS5M 4ISUA 5DJXB 2D73A 2XWBB 3EFDL 3FXRA 2K78A 3VA2C 4KGJA 3ZE0B 3P1VA 2ZUVA 3WD5H 2AJXL 3VXQA 5BRPA 1Y6MR 1PZSA 3PGCB 4F1YA 1W72B 2PTTA 3UC2A 2F9BT 5EEZA 2N1TE 2EKJA 1MJ7H 4CJ0A 4RGNB 4DUVA 1EEYB 3LAFA 1E6JL 4TN9A 1NV1A 1CF8H 1E28B 3JVFC 2V5MA 4MMXA 3GBML 2ZF9A 2OMVA 3G5WA 3GS7A 2VAJA 2VQ1B 3ME0A 3MR9B 4GP8B 4C4KT 4F2MB 4WHYG 4YGVA 2QVVA 1KBWA 3UOAB 2HXAA 2J6EL 2YD8A 3LH8A 2GSMB 2YSSA 3NZHL 4PREB 1A4AA 3M1BB 3WAEA 2J1ZA 1UM6L 1I1AD 3I75A 1JWUB 2CKBH 2GCYA 5IAIA 4P2QA 1FZKB 3RVTD 4K3DL 1I31A 4KY2A 3FW6A 1IEBB 2YMOA 4I9WD 4UANA 5DMYA 5CJ8A 1G7MB 3BWZA 4WTXA 4TVPH 5CO1A 3O6FD 1FJ6A 4JJHA 4YZFF 3KPRA 2M83A 1DLHA 3D25A 3WNJA 3TURA 3TT3H 3SSGA 3B6TA 4QXTB 1YLBB 2DQUL 3RPLB 4ZBJA 3V4VB 3WIIL 1X5ZA 2F97A 1QHQA 4NM8H 2Z8EA 1I7RB 3KBFA 5E9DA 4KJPD 2UY6B 5EO9A 1KBGH 1MCEA 5LDSA 3HNSL 3RA7H 4IOIA 2RFXA 2W80C 4BFRA 5CLXA 3H9SE 3GXMA 5EC1B 1RI8A 2WBKA 1T2QH 5HD8C 3BRDA 1DQLL 3SEXA 4K8RH 4Y4FB 1RJLB 4KX7A 4HUWA 3QUZA 4OF0A 3VXOA 1I7UB 3FO0H 2Y7NA 4NQ8A 3PWPE 1D5ZA 4B96A 4BFIA 4RSYA 3DX7A 4PC9A 5GGSY 3EYFA 3QIBC 3ZIYA 2F78A 2YLNA 4WUUD 2XY2A 1L9NA 1IEJA 3ZRCC 4CSSA 3Q2CA 2C4FU 3IU3A 1A2YA 1PQZA 3FQUB 3SGJC 3PUXE 3C5XA 3QPQC 5IT2L 4JRFA 4N8PA 4E0XA 4DVRL 3T4AA 5JTWA 3PQYE 4U2YA 2R6GE 4K94C 4JHWL 4DKEH 1LCFA 2RINA 4HUUA 2VERN 5LWYH 1RZQA 1AG0A 2F61A 2W0FA 2XVKA 4E42B 5IFHH 2BIOA 2JLPA 2VUYA 3INUL 1IJNA 3ZKKA 2H2PC 1IL1A 3TCTA 3PHAA 1UYWL 1IBDA 5AOLA 4MNQD 2QHRL 1SPDA 1F3DJ 1GS8A 1XAUA 3DSNA 1K8IA 1YEWA 2NX5A 1S9WA 2SODB 3MLZH 4J8RB 2AJVL 4Z7EA 5HDBB 3T8XB 4HP5A 4F1UA 3EXJA 5H37A 3STLA 2Y24A 4ZTEA 2ZXTA 3BVTA 5LOMA 4GBXD 3N50A 5E95B 1L9OA 5JIQA 5CEXA 1CLCA 2APTA 1B40A 4EQ9A 2F3DA 4RGMC 4O5LL 4OCSH 1SXAA 3BT0A 3IDMB 3QDJD 1G6VK 3OWRA 4M5TA 3ZTNL 3U2SB 3TPUB 3RI5F 2JQAA 2NXYD 1HXMA 5EBWA 4XNXL 1G7PB 2QSCL 4IJTA 1TETH 1GOHA 3GBNL 2FO1A 4OZIB 1WFMA 4PRPD 2E74C 4WRLA 2F7IA 2WP3T 2X28A 2CZHA 4ZUTB 4NUGH 5H2BB 4ZRGA 2M2DA 3ISWA 1SJMA 5LNGA 5SX4I 2L0DA 2EO1A 4WU7A 4DP5X 3PMWA 2IBZX 1IAIL 3IDYB 1NH7A 3ABKB 4X8CA 1YNTF 5IZ1A 5DCCA 4MX7B 4UV4H 3U30C 1HHIB 5B1KA 3ZGIA 5ISZE 5D72H 3ULSB 5E2TH 5DJ6A 2AABH 3LOWA 2Y84A 4FQLL 1NC2D 4Q6IC 4HWBL 4IGTA 1M9WA 3W0WA 4HJEA 5IKBA 2REGA 5C9JA 3ZMEA 4HUVB 4P3CH 1CTMA 1VZGA 1X3DA 4KROD 2JJVA 1WGVA 3AFLA 3Q2VA 1URDA 2BC4B 4LSUL 1NV2A 1EIBA 1NCOA 2AKRA 3EKIA 4X6CE 1ASOA 1EANA 4X8JB 2GJ6D 5JDJA 1T03H 2R8SL 1C8QA 1KV3A 4H44C 4WEMB 1LBWA 4EF1A 4X5XB 1FPTL 2ARJB 3BAYA 3DGCR 1QGXA 1IKFL 2OQJA 4QRPE 3PMXA 1RZGB 1PS3A 1R3JA 4JO4L 4U1GC 1KN4H 2ENSA 3JYCA 4WK0B 1TZAA 2AXHA 2Z0BA 4QHMA 4LSQL 2JJTC 2MTPA 3GTVA 2WZPD 2HHMA 4HBCH 2OSLA 4KKAD 4KVPA 1KY7A 4FBPA 4FFZL 4OLZH 1F8TL 2WOBA 3MV8A 4P3DB 4UT6A 3N42B 3I2CL 2GH9A 2XKNB 4ZEKA 1FVEA 4ZTOL 3V89B 1QA9A 1W0WB 4XNQA 3NSXA 4P5KB 4JFUA 2EEFA 1KIUB 5HI3C 3CSBA 1OSPL 5B70A 3F04A 4H88L 3MUY1 5IOKA 3AT0A 1FG2B 3SJVE 4MLQA 4S2SB 3KGUA 3AGVA 4MZ2A 1BBJB 1QP1A 2C9RA 5B1JA 3OX8B 3HN8A 4L9LA 5J6GA 2N3JA 4XPTL 2Y69B 3RIFF 5A43C 4YU0A 1IGTA 2H3XC 5C08D 4A04A 4F7EB 3O4LE 1RL1A 2X4PB 5I2NA 5J6HA 2DN7A 3CWGA 3QXAB 5J6SA 4FQXC 4OYVA 3P4LA 1TENA 4QHUA 4HG4K 2P44B 1A0QH 2VDOH 4KO9A 4WV1A 1S7VA 4XN5A 4IR8A 3POHA 3RIAF 5CUSL 1SN0A 1JCKA 3EGSA 4X98A 2BRRH 1BQHG 2ICWJ 4P59H 4P9HC 3C8DA 4G9DB 4AEFA 4E9XA 2B4CL 5F7DB 3ERXA 3NN8A 3SKJH 4JQIL 4L4VD 4I1RA 4X6CF 1MN4A 4OZHF 2FHFA 4FGMA 1F4XL 1JERA 4ACTA 4W6WB 3WLWD 4I0PD 4QAWA 3V0AC 3CAFA 4IQHA 3T9XB 2CWRA 2ZUWA 3KBHE 3LZOA 4F7PB 3MYJB 4UMGA 1I7ZB 5E5MB 2Q3ZA 3M3LA 4GEJA 3I6LD 2VM4A 1JXGA 4G8GD 3WS6C 2H25A 3KN3A 1CE1L 4QYAA 2EDDA 4TYUA 2ALWA 1TFPA 1M5BA 1WC7B 3AZUA 1DL7L 3BVNA 3VXPA 1IMHC 4UV7L 3TLRA 3GRGA 1XGUB 2CH8A 3KPSB 4M7JH 2WQXA 1WCBB 1XF4A 4YDKH 4QD2E 3M07A 3DIDA 1ZHBA 2X3BA 1D9KA 4FADA 3IDJB 1MW3A 2FWOA 4JRYB 3QUKA 3CMOH 2PYEB 1H6EA 1HAUA 1ET8A 1K9ZA 4YHLH 2YPLD 3RL1B 3LX9A 3KPPB 4YBHA 1HHGA 1WZAA 3HN5A 1LO5B 4KZCA 1T7XA 4ENZA 2CLVA 4B9CA 1SJHB 1LBXA 3CSPA 4UQ2B 1WTGT 5JO5A 4MMYA 4IBWA 3FB5B 1OQHA 2H4IA 1R9FA 1VGEH 2VC2H 4UMSA 1PKQA 2P42B 3NA9H 3GSQA 5I23A 5CNHA 1KT2A 5SX4H 2BVPA 4AT6A 1YEEH 2AJUL 3RPIB 3T4YA 3TT1L 4WJ5B 1GHFH 4OIIL 1Y07A 4GMTH 2D03L 3O66A 1PYWA 4X7SH 5DURD 4YX2H 1P99A 3AG3B 2XSKA 4M62H 2A77L 5CGYC 2GKIA 3G5ZA 4PD4K 2BIIA 2BY2A 3IJYA 1WITA 3BYYA 3ULUL 5CN1A 1A40A 1DJHA 1QEWA 1T0PB 5JIPA 3QMFA 1XZ0B 4HCWA 1GV8A 2GJRA 5F96H 1IUDA 2R59A 5ADOL 1ZEAL 1I1AB 1YYMH 4O9HH 4AJWA 4YDJB 5IB4B 3ZHKA 1ZGLM 3IFCA 2XX9A 1GCYA 1I8LC 3HO7A 1B7HA 5IROA 5KSAC 4FQCH 4MQ7A 5CZXD 1A9EA 2WX9A 2ONSA 5FYKE 3AC0A 3QAZC 3MRQB 4OF3A 5C0CD 1R19A 3CFZA 1QKBA 5I75B 4F7CB 2ISDA 3QIMA 4JCMA 3IFOB 4OIFA 2H1LM 4B5EA 2DWHA 4LVHB 3EJPA 4JSOA 5HHQA 2WKOA 4IU2A 4QHKJ 3P30H 1P4BL 1X6NA 3LUYA 2DKSA 2V37A 4IHBA 5DYHA 2NY2B 4R2FA 2OCJA 4PI2A 1UURA 1BWWA 5HYJB 4L4TD 4LCCA 4KTYA 4LDCA 4Y1AE 3S4SB 4EUPA 2EDQA 3RWCB 1QZ1A 3BLPX 4GKZA 4HJJL 1CU4L 2IDSA 3ETTA 3BD5A 3FHQA 2OJEB 4X0NA 3RURA 1FTLA 4NP4H 3S97C 2LAGB 3FQTA 4HMCA 3VD7A 2K6ZA 2ZNWA 3AQYA 4B9IA 3KJ6H 4GF8A 3JV4B 4WUUB 3EYQD 3EYUL 4UT9L 3B9KC 3SQOH 5IR1B 4KI0E 1MRFH 4EIZC 5ILTH 4F22A 5BZZA 4L1DA 2OJTA 2W92A 4BK4A 3QYMA 4J7RA 4WNSA 4I5BB 4YVUA 5CFHA 3PWNA 3W1ZA 3TNMA 4L8BB 5D5ME 5EZIH 1JPFB 2DVZA 4LOFA 4PEEA 4X0KB 3WENA 5E9AA 2ADIB 4OTXL 3LKQB 4MNPA 1RHFA 3MBWB 2XZAH 1KTDA 2HN7A 5AWNL 4IHOA 3O45A 4J3OD 3F12B 2P45B 3HG1E 1BA9A 5T33H 2VSMB 1G87A 3PGDB 1HHJB 3A3CA 1K8DA 3UL4A 3G3JA 1MAJA 1S7SA 4WCYL 3T22A 2YOCA 4ETQA 3REWB 1UJ3B 5E0QA 1U8IB 1ZLVK 4MNQB 4ZW5A 1JNLH 1XZWA 1OK0A 2KDYA 4A38A 1CBVH 4UOW0 1U2HA 1J1PL 1SVBA 4H67A 1C1EH 4FEMA 1N64L 2VLKE 1NBVL 2V84A 4G8HA 3HS0A 2IOIA 1LLSA 3RX7A 4GBXB 3VXSE 4PWKA 2EDWA 3HPIA 4GG8A 4KJQC 1FLTX 3V2AR 4NO3B 1NJ9B 3PJSB 4JM0A 3H2QA 1RYXA 3QDJB 1HS6A 1IKNC 2MWCA 2IBGA 3KEIA 1S4IA 2BVOA 5DQDH 5DTFB 3QVAA 3RY5A 2NXYB 4ZMNA 1SMDA 5BV7L 2VDML 4JFOA 5GGVH 1CJYA 4PRPB 3CI8A 5D2NB 5DUJA 1EAJA 2I0CA 3OPZL 4KKLC 1POTA 2R1WB 5I74C 4MJIE 1NBYA 4IGBC 4BUGA 2E75C 1VACB 3H53A 1OGTB 3A21A 2DB8A 5ANME 2I60H 3IJSA 3FVKA 5EUOB 1DQQB 2OMXB 5D5MF 3NSFA 1JZ8A 1H15A 1FNSH 2FLRT 2REJA 1MY5A 1TCRA 1JPTH 1Q0XH 5I5RA 2LW3A 3N41B 4OD3L 5F7FA 1N0TA 1TNMA 3AU0A 4ZXBC 5SWZD 2F54D 5CGMA 1JP4A 2YOAA 1FTKA 4YSTA 1FYTD 4X5RA 3KM1A 3S36X 2VOTA 1G7QB 4UBDD 3G6AB 4TLMB 3MAWA 4KQ3H 5D96B 1HCFX 5ACZB 2GJ6B 1EMTL 3CUPB 4D0BB 5IMLB 1VKXA 4PRHE 4XWGL 4AYGA 5AA4A 2PXYC 5IV2B 4I40A 2B15A 4TQUQ 3PL6B 1OB0A 2O30A 1J8RA 3ARGC 1O7DE 3QFJD 1OP9A 5TFSH 4IS6A 4O4YL 1A6VL 3TBBA 4YKIA 4QJ4B 1P7KB 4EDXA 2ITFA 3V0IA 3B9AA 1MPAH 2ZZXA 4AEIH 2XN9A 3ET9F 1KIRA 2EYSB 3X1BA 1Y1MA 2I9LA 4JDFA 4LUBA 1PC3A 4XVTL 5LXGH 4Z3GA 3WFDH 3NFPA 4WDIA 4IW4C 4NQCA 5FWRA 3WAKA 2OBGA 2BS8A 3K6NA 4PFYA 2C1PA 3LPGA 4Z3IA 1OTSD 3LRLA 1QLEB 5JHDE 3KFMA 3KPOA 1ZS8A 3ZPDA 4AGLA 5HDQL 2ZUYA 1MFEH 1DN0B 4OUUA 2HWZH 3ELAT 3L3GB 1OSEA 5EZLA 5JDSB 5C08B 1AYRA 1G6RH 2XWIA 3LKPA 1D5IH 3HS9A 3BO8B 4L5FH 3IKCB 1BLNB 1PCSA 3GIVA 4PUBL 4XPBH 4C58B 1MXXA 4YBLB 4L3AA 2XWZA 5TDPA 4JJ5B 3BWAB 4CGTA 4TQEL 5BRZE 3O3EA 2WKGA 3QCTL 2EDFA 1U3ZA 4BCZA 5CCGE 4IO7A 3W9WA 2XXKA 1CLZL 4WWPA 2DWDB 2ZUQB 5FKAA 4PBWD 2WBJD 3QZBA 3ZE2B 5J1SC 3QIBA 4YDVB 5D2LE 4HLEA 4L4VB 2UZYB 5HBBA 3N6YA 3Q2NA 1JQFA 3QHZL 3IPFA 4XVJH 3AXLA 4JFDA 1XT5A 1TJGL 2RALA 4H1LH 4IGBD 5FYLL 3P2BA 4JRXD 4OD1H 5TF1L 1BQKA 1XH3A 3DX8B 3R18A 4HF5H 2ERJB 4I0PB 3SGJA 3V6FA 4MA3B 4ZQKA 4J2XA 4ZFFB 2QELA 4HOWA 1IC7H 2GBAA 4G8GB 1CFTB 5FW6A 1JWMA 1PG7H 3PPEA 2AXGB 3CDGA 4R96B 5C0BD 2H5UA 4P56A 2EDMA 1F18A 1GY1A 3LPWA 1ILUA 1ASPA 3NJXA 5EDSA 5C07A 1BXAA 5D1ZA 3PTYA 1EDQA 3H1ZA 4ZPVB 1G7IB 3VD0A 4OZ9A 1XT8A 4R7XA 3QEGL 1JRHI 1V3MA 2G4GA 3PIQA 5AA2B 1H6FA 5CRYA 4Z7NF 4JKPL 4OM0H 1RZ8A 5BQDA 3R8QA 4ZMWA 2XNAA 4DQOH 1IMDA 5H35A 3KOTA 5ICYB 5AVRB 4F1ZA 4H5GA 2CUHA 4MKTA 2A9DA 4TXVB 3X1NA 3VFPA 4DP2X 4I87A 2W7YA 3KL3A 3QNZA 5DQ9B 2YPLB 2NNAA 3GSXB 3OKEB 1NFKA 1OAXL 5GHWL 2NR6C 4XP9L 3CFQA 2HAZA 1AZZC 2Y36L 3T77B 3BP7B 1HDMA 5IHWA 4LP8A 5EF1A 2ICEB 1E4XL 4MA7L 4I3SL 5H37H 3UTSD 4D94A 2W60B 4GRMB 4W1TA 1JYNA 1IGFH 3Q6FA 1QLFA 2X6BA 2F8VA 1DSYA 4UT7L 4EPSA 1AR2A 1FLRH 2CO4A 2OSWA 2IADA 4IMKA 5D2LF 2W95A 5EBLB 1N5YL 5I2KB 4PJFB 5MEPA 4HAFA 4N6RB 1OK8A 4JGNA 4ZUWB 2A0LC 3II1A 4P2RD 3GSVB 1DBMH 3EYOA 1A1NB 3CFEB 1N68A 4YBQD 4FYTA 2BOBB 4NQVB 5DVMA 3HB3D 4WTQA 4W4NA 4XP4H 5DYOA 1AI1H 3GRBA 3VWKC 4ZS9A 3ATDA 4FG6D 4Q6IA 4ZMZA 3FYEB 1U8OA 1FZMB 4FP8H 5DHVB 1Y0LB 3LS5H 4FOMA 4NS0A 1J1OL 4ZNEA 1UM5H 1EA9C 4WXJA 3DHUA 4PLKD 3PLYA 2SEBA 4QFNA 5EQAA 3OKKA 4F3PA 3ZDZB 3KGCA 1IZJA 1DE4B 3BSZH 2IAMD 3DOIA 3PABB 2APWA 2V9TA 1UT9A 4HDIB 3WTYA 2FO8A 2HLEB 2P46B 3F7VB 1UT1A 2IV8A 2VDQH 5DVKA 1CFQB 2HTLC 1DBJL 3KEDA 3KS0H 5AD0A 5DEGA 2QRYA 3SE8L 1JDDA 1NBZB 4TF4A 1DFBL 5KYUB 1SLUA 3RVVC 5GS0D 2Q8BL 2Y1AA 2BZCA 2ZWLT 2PCFA 1M42A 4NCC2 4C4UA 5JIDA 4L3EA 4HKZB 3U4EB 5LTCA 4G9FD 1T21A 2DQTH 1C5CH 3N40F 4DXCA 1Y9UA 5E4AA 3EHTA 3NSYA 3PDOB 3GLAA 3PF2A 2BJJX 3QEQE 2NDFA 2L3BA 1U8QB 4GXVH 3P9LA 4BFBD 2CRZA 4G7YL 1B5JA 4RXLA 4JY5L 4UT6H 3EXLA 4IMLB 2FATL 3Q06A 2JK5B 1AH1A 1DO6A 3QXWA 1ONQA 4EDWH 4MJOA 2WGNB 4KMQA 4MF3A 1INQA 5CILH 1KJ3L 2YK1L 2YA2A 2BNRE 3CZGA 4N13A 3D2UB 1J8HD 1N2RA 5GJSL 2BIMA 1TJXA 3C12A 5F3BB 3OG6B 1DFXA 1DDTA 1LNUB 4FQXA 2Y7MA 1SF5A 1XB3A 1NFDE 2AK1L 4KH9A 3RG1C 3V6OC 2ZAHA 4E41A 1MFDL 1AZUA 1UZGA 5A2LH 3R7QA 2XXIA 2D3LA 2R27A 5EHSA 3D85B 4CMMA 4NQXA 5JIIA 4HPYL 2VRAA 1AD0A 1RU9L 2Y7LA 2YIHA 3D9AH 4FQ2H 3VSQA 1FNEB 3WMPA 5IM7A 2QSXA 5HY9A 4B3EA 2R0WL 4HFUL 3TEPA 3KM2A 3PU7A 3JSSA 1MF2H 4YC2B 2FHYA 1DUYA 2V3DA 3VFSA 5HI5D 4AXWA 3FN0H 3HJ0A 4P49A 1FGVL 3EOTH 2IH1A 2DTMH 4PJXE 1BD2D 4A6YA 1XBRA 2E46A 2CGRH 5L8JB 3F6LA 3VB9A 2B5IC 1QFUH 1P2CB 1D7DA 5BO1H 2XX8A 1CPUA 3V8CA 5AKTA 1JRHH 4U05A 4R5VA 4XO4A 4WWID 6TAAA 4IY6A 4UACA 1CICB 4NNPH 3FCTA 2W9EH 4YHZL 1FP5A 1FBCA 1JXFA 3E2HC 4FE8A 2QSQA 15C8L 2QPFA 3Q27A 5ESAB 3MRRA 1RPUA 3BT2H 5KYXB 2Z23A 3BAWA 3I9IA 3ZL4H 2Z7UA 2GVYA 2J57A 2ZF8A 1Q9DA 4RAUA 3ZUCA 3GWJA 4GG6A 5EZPA 1EH3A 1ZLUH 3EHBD 1KCRL 5MI0C 3QWOB 4FFTA 2JJWA 5GJTL 5K1JA 3UGEA 1A7BA 4NZDA 4PRAA 3B7DA 4LSPH 4EBQH 3PU5A 3CFDB 4DHLA 3FUFA 4G8FB 3C2AH 2XWCA 5BUUA 1NFDF 4AC2A 3MV11 4JY6A 3WKPA 3MRBB 1WWWX 4FN0A 2JELL 1IJ9A 2MHAB 3GINA 2H6PB 4GRLA 3V0VA 1LD9A 3K0YA 2O93L 3NA4A 1H8SA 1FYTB 4MSWA 3VLUA 4OGAC 1MWAB 2R56L 3ULUE 5I28A 3AS0A 3EDFA 5I1EH 3K4UA 4ZDHB 1R5VB 4XCNA 4F1SA 2M8CA 4C4BA 1H0DB 1LEVA 5E99H 1ZXQA 5LGHH 3C87A 4BH8A 1A8JH 1XGPB 2ICES 3MROB 1X5IA 4YSEA 3ABLB 2F34A 1T0KA 2Y23A 3S35L 4RK2A 3QJSB 4DP4X 2D31A 1ZIUA 1KEML 5SWQB 2Z91B 3BQUA 1YQ2A 1BCIA 1F4WL 1MY7A 1I8LA 2KZWA 2KI6A 4HHWA 4UUJA 5FO7A 3NCYP 1R24A 4GSDL 4HKJA 5KSAA 3NK3A 1BIIB 1NNFA 2FBOJ 1RMFH 2BCKA 3EH5B 4RMRA 2WLLB 3LZPA 1IGYB 3H9SD 4DO5A 1U6AL 1CLOH 3FTGA 1XX9C 4R4NC 1NIEA 2DQGH 5C71A 3UIYA 1LHZA 5KVEL 4WWKD 5CZRA 4N87A 4YO0B 1JGLH 5CN3A 3W5MA 1I85C 2C3VB 1S5HB 3KLAB 1OVZA 3BN9C 1JDCA 1BOYA 2BSBA 1U30A 2X1XR 3BUDA 3IU4L 3PWPD 4O58H 1I8MB 3PPOA 3SKPA 4U6XA 3ZKQD 5D7KE 3L4VA 3BZDA 3VG9C 2N7AA 3OGCA 2HQ0A 3M8OL 4YAQA 4M7LL 2XTJE 4TOYL 1U91A 3HC0B 3H7BA 5FW7A 2Y3NA 1AS7A 1KBKA 2PPEA 3P77B 4JFEE 4TNWF 3CV5A 5E6UB 4GINA 1T20A 2WBJB 1A4JA 1AJ7H 3UORA 3DO3A 4YH6A 4PJGA 3SCMD 3TX4A 3ULUF 2IFFH 3TYFA 1N10A 3B9KA 2W94A 3PQYD 3VFUB 4NF8A 2DMGA 1GA2A 4P9ML 2DJ4A 4PJIE 3R1GL 3LVEA 1YEKL 2LQRA 4JRXB 1ETB1 2G5BA 3V5KA 4NAQA 5IY5B 4YLQT 2HFTA 4HWZB 1MJ8L 1TR7A 1QUJA 5SWSE 1PLCA 1HNFA 3TIEB 4HIPA 1HQ4A 4KK6D 5E8NB 3FTYA 3T0XA 2TRHA 1BEYL 2AEPL 1YEDB 3RHWK 5EU6A 3Q26A 1QW0A 4NAMA 2NQ3A 1B3EA 1UCBH 1CB4A 4F7MA 1YY8A 4YAHX 1SBSL 4M4GA 1ZSDA 1WCQA 4JFFA 4HWEL 4H8VA 4YSQA 4PG9B 4C57C 5GSRB 4Z78B 2UZXA 4PJBE 3Q29A 2CO6B 4UILH 3IJ7A 2AI0H 1U3JA 1S7QB 1OP3K 1GC1H 2Q87A 4IDJH 4OESA 4GFRA 2ZXBA 1FWXA 5D4QA 4YUEH 5AW7B 4Z5RB 4MTMA 4DE8A 3UIZA 1HCYA 3OAYK 4PF6A 2ITDB 1WEJH 4W9FC 5IJBC 3DUSA 3MUGB 4JZOA 2LLLA 3FN9A 2HRGA 4Q6YA 5D1ZI 3RX8A 2Y7RA 4W9EC 3MUQA 3B5TA 3HMXL 4WW1B 5DFVD 2H5YA 3C6EA 4GI6A 1HI6A 1KN2L 1FO0H 1IKNA 3D69B 2EDOA 1FPJA 3DNKA 3ILDA 3AS3A 3K1MA 4XB7A 4IK7A 1D7FA 2DDKA 5EA0L 5ESQB 4HS6A 4LLUA 5FHAH 1JGEA 3RWGB 5I1CH 2EO9A 2NY1C 2WVSA 25C8L 4KMTL 2WO3B 3D4ZA 5C7ZA 5DRXA 3NFSH 4PJIF 3HN0A 4M5YH 4P2RB 3T65B 1SEBA 4JHVA 4H0HB 5I8OL 4CW1B 4IEFB 5CGBA 3HB3B 1BXVA 4WTWA 1FZOB 4NBXB 3DIVA 2QADC 3NJLA 4OKVA 2EQDA 1AWBA 1SJEB 4KUZH 2O6CA 1WVZA 2VUKA 4ZXBA 3BUPA 5IFAH 4GEIA 5AW3B 5IQ7L 4AM0A 2IG2L 2OCCB 5H94B 5CJ5A 4QRPD 1OE3A 4W9KC 4CSZA 2YBGA 1CFVL 1YZ0A 3WN5C 1O6SA 1FNGB 1AXTL 1TLMA 4WHTA 4S0SD 1AP2A 4M6AA 5E7FA 2EH8L 4ZO7A 1SYVA 1QR1B 2IAMB 2PXYA 4PR5B 3WIFB 1ZGLB 4R6HA 2ZXWB 1WZKA 3V0EA 3ARGA 2KC0A 3ARUA 5L8DA 1FA4A 3V4UH 1OVTA 4QHPA 2WY3B 2JI2A 2R0KH 4XP6L 4B9YA 1KJ2L 2X5PA 2Y7KA 4ODHL 3KPMB 2G75A 2NTSP 3EJZC 4W81A 4U22A 1RUKH 1VGKB 3WDJA 4OFLA 4KO7A 5HI4D 4NO0D 1CR9H 1W8OA 3SJVD 1Y18A 2NYZA 4BKSC 4G9FB 1S9XA 2WGXA 4LRIC 1I4FA 5F7WC 4F2FA 5JHLA 5MHSE 3FO2B 3T1FB 4HC1H 1BHGA 4FFYA 1TQBC 3LKOB 2YLKA 4NO2B 3G9AB 1EZLA 3O4LD 1I8KA 3C6LA 1MNUL 1FZJB 2DYPD 5EF0A 3FQXB 5A40E 3HLAA 5I16B 4TVSa 3O2WL 1NGYA 4PJHA 2V7HA 1CZ8L 2NY7L 3G08B 1SUHA 3GSRB 4LLAA 3G5YB 3IXTB 4LDEB 4YLCA 1DJWA 3BKML 3OAYH 2ZSVA 3GQFA 4KKPA 5GRJH 1NDMB 4P23C 1MS7A 2Q86B 3N85H 3QGVA 5E8EA 4AH2B 2XN1A 4U3SB 4AV5A 4DCQA 4UNTA 4LSVL 3LXAA 3DRQB 3PPSA 1ANFA 1M7DB 2GI0A 5LBGA 1BZ7B 3TN0B 3VMOA 3BEWB 1T1ZA 3D4CA 5FYLE 1HJBC 4RNRB 1CQYA 1DBBH 3U82B 3VO0A 1P1VA 2HX9A 2AQQA 4Z0XA 2VZSA 4R0LC 2B3RA 4HS7A 4WU5A 3II3A 3MLRL 4Y4HC 4LXFA 3QI9C 3VGBA 2J71A 3K81A 4N2FA 1QW8A 2BNUA 2K6YA 2K7PA 3ZZSA 5DSCB 4U4SA 3P69A 2HEUA 1BD2B 2BHYA 2VXSH 4F5CE 1ETZA 3QWQB 1SW4A 3VSUA 4A2MA 2AJZB 4ETYA 1BAFL 1J9CT 2R69L 3BKJL 1KTJA 3HAEH 5C9KA 3FMGH 4F3BA 5DUBB 2P52A 1I6BA 4P47A 3D0VB 5LGKA 2D7OA 1GGIL 4JO2L 4X6BA 4X9TA 4EVNA 4LARH 2G4EA 1K3ZA 4XN1A 3AB0B 3U1SH 1JK8A 2EDLA 3EHBB 4Q74A 1GMEA 3WOVA 2AQ3A 5F9WB 5K59F 4TNVF 4XNUL 3S36H 1G7LB 2O51A 3FU5A 5B7FA 3TBWB 3F00A 4EQ2A 3UP9A 1JTPA 1RHHA 1WJ3A 2NR6A 3MV9E 4LL9A 3W9DB 1ZRUA 1LK2B 3ABZA 4BD4A 3EDJA 5IQOA 3DX0A 2F6GA 3EJZD 3L3IA 2WIIA 3U6RB 2B9BA 2V0AA 3LY6A 3QZWA 4D0DA 5LO7A 5DD3L 1KCKA 3EOAA 4GO6B 4OLYL 2G2PA 3C5ZB 3SDDD 2DJSA 4GWYA 1H6TA 5IVXA 1UZ8B 2NY6B 4LSRH 5F1SA 2WTRA 5CP7A 5IMKB 4YPJA 5KYYA 3LUZA 3HCVA 3E6FA 4V1DA 7PAZA 4N8VA 5IESL 1MFBH 4XRCA 6PCYA 1LO4L 2BSED 3JWNC 3Q8BA 5DMGC 2PPFA 2R4SL 3E3QC 5J89A 3CK0H 4P06A 4XNYH 1B6HA 3CFKA 4E9SA 2F6AA 1M5CA 1QSFA 5FYKD 2P4AB 3VWKA 3BPNC 1S9VA 5L4IA 2Q8MA 1IBYA 3FBPA 1U95B 4LBEA 2EIZB 4HAGA 1I9IL 4AUYA 4M3KB 1OAJA 3B7SA 2QPDB 3K74B 2HX7A 1L5TA 4R90H 4ONHA 1T3FA 2VISB 3GYYA 3MVZA 3KVQA 5I1LA 1D5RA 4W9ZA 2VR9A 2H47C 1DQMH 2CGYA 3HRPA 1JN6A 4OCYH 1MQ8A 2N4IA 4K7PY 1RIVH 4XPAL 1KPVB 3DTXB 1P7HL 1UOWA 4YE0A 4CADB 1Q1KA 5IBLC 2ZKYA 1DQDH 4Y1AD 4QTHB 3ARXA 3VXRA 3JTTB 3NJMA 3W82A 2FJGA 5T5FA 4FZEH 3CVBA 3LEYH 3H0TA 5FCSH 3OXNA 3H7LA 1T7ZA 3MCG1 2GK2A 2FWSA 3PWPB 3ZKSD 5DMKB 2A83A 3A4EA 5EIIB 3T2NL 1QRNE 5T1DH 2X6UA 1E8XA 1I3UA 2A6KA 2XXGA 4C8XA 5FV1L 1C08A 4L9DA 2VDLB 4MDJA 4Z7QE 3DXAE 3UC0H 2VDRH 1E5YA 4O94A 12E8H 1YNTB 3HC4L 4OM1H 5JW4N 5FHBH 3SCMB 4R6UA 4NFBA 3IFAA 1MCWW 3QXMA 4ILDA 4O2FA 4X42A 3S4UA 5BS0E 1CLYH 4XCCH 4PG2A 4O51B 3HG1D 3G6DH 3HG0A 4FTDA 4I4WA 4HPOH 4PJEE 3V5HA 4BH7B 2HKFH 4P5SA 4KCDA 1D6EB 4UQAA 4AK1A 4JO1H 1IVLA 5CBAB 5DHEA 4CNIA 3VXUA 2BVUA 3V6OA 2EDYA 1E9QA 2EIDA 3LSOB 5CJQL 4YPGA 5HHNA 5HGDB 3ZKXC 4ZAKD 2J8OA 2GY7B 1UQSB 2YLHA 5A2JH 5C8JB 5F3HB 4KFMA 3IVKB 1ZVYA 1BLIA 4LCYA 2FL5B 3BWUF 2H26A 3FHEA 5AL0A 4TVPL 3MLUL 4ZX6A 1NOFA 5BZDB 3G6JB 3SKOB 1DQJB 1C7TA 1JTTA 4N20A 3AMKA 2XWXA 2CQVA 2DQ6A 4OBRA 4YL9A 5E9NA 3DIFB 4ONFH 1YEHL 4NM8L 1G84A 3GGWB 1JHLH 1MCNA 1HWHB 3K8LA 5JXAH 3BX7C 5A3IC 1NDGB 1AQDA 4GSXA 1AR1D 1R5IB 1T2QL 4U4BA 4Z7QF 3E13X 1A3LL 4XHJC 5AAWC 4KXAA 1Z0MA 5EU5A 2P1SA 1R5WA 4K8RL 4A6YH 5I75C 2DD8L 4P11A 1HL4A 4Z0BH 2GTZA 2OMZB 2ZP8A 1A47A 2I49A 3LDBB 1OAZH 4DI4B 3MOQA 2RA1A 2WKYA 1ZV9A 4HAKA 1LE5A 3LD8B 5D7IA 2AXFA 2W5PA 2DDQL 4XBPB 4B27A 2NXZD 1JYXA 3CFBB 5B39G 4H2AA 4NQEE 4PJEF 4MNHB 3SO5A 3U6XS 2OWZA 2PO6B 2XA8L 3O11A 2ZJSL 5D7LB 2OL3A 3DPBA 2X44D 5AUMB 5AW8B 2YZ1A 5IW6B 4KTGA 5DA0B 1IZ1A 3K00A 4YDNA 3T0JA 4PRHD 2ENJA 2FO4A 2C9XA 2X7LA 2Z31B 4OZHB 1N3XA 3K6WA 3RT8A 4Y7OC 4QI3A 4FL4B 5L2KB 2OSYA 3OMBA 4DZ8A 3FPYA 4LHQB 2GTWA 4HFWB 1RZFL 4N9GA 4UNIA 3QUMB 4HZAA 2X4UB 4P04A 5KVDH 4HIEB 1PY4A 3TNNA 4JFYA 3L4UA 3DV4B 4YHIA 2FEEI 2VITA 5TQ2H 2ZX8A 1N04A 3FOMB 5J9PB 3C9NA 3MLZL 3MRLB 1PNCA 2WQRA 2J8UE 4I85A 1UOLA 4LQFL 4JREB 2DKUA 1MDQA 2FHBA 1WV7T 1P9MA 1B3IA 5KVGL 2VD3A 1U3HD 3GDBA 3QULA 5JQ6L 5E1AA 1KCWA 5JLZB 4OLEA 1PAMA 4GX4A 1KCVH 5DZVA 4ZE8A 4V33A 3SKMA 4OCSL 4A2HA 2WPGA 3QRLA 5CIPH 5ETUA 5C09E 1TVHA 4R4BB 5J1DA 1UXSB 3PJNA 5FFLA 3VD4A 3O4LB 4K15A 3D0AA 4DIXA 4YWGH 1FORH 3E9XA 2JJUA 4LNVA 1Q9LA 2Y5LA 5KEZA 2Y25A 3M6DA 4ELMF 4ESWA 1IGJB 2YEQA 2W9DH 2WUCH 1I85A 1OSZB 5BRZD 3AG4B 4ELRA 1WZ1L 4JX0A 4PB9H 4UTBA 4YE4L 5DJZB 2Y7IA 3NJJA 1BOGB 5KS9A 4UV4L 3VVEA 1TJHH 3SE3C 4IOFD 1AGEB 1DQIA 2DF3A 5E08H 4KRPB 4DOHE 4X5QA 4EKXA 5E2TL 3BSHA 4FZ8H 1TSHA 1BBDH 5CHNA 1DJYA 1NAMB 3AACA 3PWVB 1BP5A 3LC8A 4APQD 4PP2B 2HT4D 4G70B 2DWYA 4GI9A 4J1UB 1D5XA 3K01A 5A2IH 3MRKB 2XETA 4NF4A 2P49B 5TE4H 5DJXA 3RZWA 3TL5A 2XWBA 1OCZB 4PJDE 4NZTL 1QSEE 4NWUH 5CMCA 3UZVB 3E6HA 3VFGH 5T8IA 1PZDA 4I3YA 2FD6L 4HXAH 3RAJL 1KN4L 1RD6A 2OMTB 1Q9OB 1W72A 3PGCA 4GQPH 1ZMGA 3KCWA 4XFEA 1T1WB 4KNUA 4LMQE 1VFMA 2VR6A 4TKWA 3QJFA 5HHME 5D96C 4GQ9H 3UEQA 3WSQH 4M61A 2EADA 3MGTB 4XOEA 3UH8A 1A55A 4NCDA 3MR9A 4F2MA 4N2EA 2GTQA 3GLBA 5L0QC 4PREA 2BH0A 35C8L 2KLTA 1WLHA 3CC5A 4MWFB 4F8PA 1QBMH 1JWUA 4RSVA 2JH2A 1A3RL 3ECWA 1DOTA 1T89C 4DUWA 3OMZA 5IJDC 3O81A 2HTKC 1VF5C 3OSVA 3BUYA 2ZCKH 3VFMB 5JW4R 4QWWD 2V5TA 5ABAA 4MGXA 1NMAL 1MJUL 3KLHC 4PAIA 1E6OL 2QBWA 1OT1A 4OVJA 3CXHK 4QXTA 2ZCLL 2LVCA 1A0QL 1OD7A 2VDOL 4ZS6C 3V4VA 5KN5A 4IBYA 4B60A 3C34A 4NZFA 3K1NA 3F58L 3MVXA 2VXUH 3ILPB 3MPCA 4G42B 2X0VA 2R15A 3HNTL 3S3CB 1I7RA 4P59L 4JFHE 1SQMA 4BDOA 3X3FL 4JWYA 1G5AA 3OKLB 3SKJL 5K9QG 3AREC 1Q0EA 1W16A 2F7RA 4PVMA 3VI4E 1YJDH 1QFWL 1YCSA 2JF1A 3FDWA 4PJDF 3KN8A 3CSFA 4ZSOB 1JPSL 4Y4FA 2HRLA 3N91A 1RJLA 5T3ZL 1QNZH 3JZYA 3NOIA 5I66A 2WBXA 4R7NA 5FECB 1I7UA 1MCBA 4W6YB 3ARDC 3PDDA 3CZFB 5FCUL 1GSMA 3U79A 1OGSA 4N85A 3GBAA 4UABA 3L6FB 4MMZB 3FUJA 4PM1A 2FEDC 2ZOOA 3MLSH 2M1KA 4LHJB 4IRJC 1WS8A 1TG8A 1E9OB 5DZ9A 3U1QA 1A99A 3P0YL 3C35A 3TQLA 3CZSA 4K2UH 2WWKO 3O3DB 3WN5A 4P4KD 2BZDA 3FQUA 4L05A 4ICXA 1XGTA 2VXTH 4U3HA 4GAYB 4Y1AB 3HZVB 1AD9B 3TPKA 1DSNA 4F8OA 2P5EE 4MJ2A 1FPGA 3ROJA 2CKBB 3GSOB 3FQRA 1IXGA 5FM5M 1IFHH 4WIQA 4YHLL 5CP3A 2NTFB 2D7PA 4E42A 4LVOB 4FMVA 1KTRL 4N2AA 3QEQD 1FE8H 4FERA 2FECI 4S1DC 4WFFE 4GWOA 1KUMA 4NNYB 3CFTA 4LRIA 4OFQA 2VN3A 1BEXA 4WI0B 1MCPH 3UAEA 2BSDA 2P7TB 3VXMD 1WZLA 4J8RA 1E40A 1XIWB 3QUXD 2JJSC 3T8XA 5D5MB 2K7QA 2F5AH 3QO0B 4N28A 1ET5A 3QJRB 1GHFL 3CN0A 4HIHA 2D7QA 3E9UA 4H5SA 4PGBB 4YX2L 1GZQB 1OF2A 3NGBC 4M62L 1YN6B 1OTTC 2ZE0A 3FSAA 4FFYH 4LCIH 4LIQH 4P0DA 2D7NA 1XGYH 3IDMA 1NCTA 3HE6D 3UBFA 5IWLA 3U2SA 4P23A 3TPUA 3LRKA 3L4WA 3PFUA 2MCPH 3RVUC 3FHAA 3RWDB 4F91B 1SGKA 1ZHLB 3R6UA 1G7PA 1IQWH 3ZHNA 1FTAA 1J5OL 4RMVA 4OZIA 5C0RL 3UO1L 4Y2DD 1DCEA 1ZA6B 4NGUA 2P5WE 1A7LA 4FQCL 4Z1PA 1BMWA 5B4MD 2XHNA 3NH7L 1ETA1 3RTQC 4MX7A 2NY4C 1HHIA 3TYGH 4BKLB 4C4KO 4Y4HA 5BVPH 3ARED 1I1YB 1OAQL 2V5SA 4JWOA 2R29L 1D4NA 1B6DA 4RAVB 3ATFA 3SE6A 1H9DA 1V3KA 4M7LT 3KGRA 1F42A 4HUVA 4G6MH 5KJRH 4ODSL 3AY2A 4JM4L 4QKXB 1OAUL 3RNQB 3EIFA 4WTZG 5JQIB 3NAAH 3Q43A 5JIKA 5A7BA 4KQPA 4U3XA 2X6VA 4F19A 4U7SA 4RLDA 2BCMA 3IN2A 2ZYRA 4X8JA 1FTMA 3GZPA 5C0AE 3GM0A 1IT9H 3SPVB 4H45A 5J13B 4X5XA 1YPZE 2ARJA 2YMXH 3QZMA 5ANMB 3BWSA 3GZQA 2XRAL 5DEFA 3QUYD 2QZQA 1RZGA 4NP4L 4Z7UE 4ZTPH 5J12C 1H8NA 3ES6B 4GWUA 4JG0L 5DEJA 3UP1A 5ESVB 3FQWB 3KJ6L 2ZXDA 2BMKB 2NXZB 1SUJA 2BHZA 4Q56A 4RDQG 3G3KA 2ZWZA 4IBVA 3WEBA 4P3DA 5JPNC 5J1AB 5DS2A 2XKNA 3E1F1 1U3NA 2NNXA 3F2LA 2BOCA 1CG9B 1ACYH 2DQJL 4P5KA 1OD9A 2DTSA 1KIUA 5I8KH 3V0GA 3ULUD 3FS9A 4GKNA 5BMFH 3ULVC 2DOJA 2VJ0A 3KAAA 3Q01A 1EAPB 4JFTA 4PRHB 4WEDA 3I6VA 4LVQA 3ARVA 3FOLB 4R2BA 5DVJA 3VLVA 3S9NC 5B22A 2CDFB 3BZ5A 4NAPA 2I69A 2F15A 1BBJA 2GRVA 5E8PB 3OX8A 3P3SA 1PB8A 4JWXA 3O6LL 1HINL 2GQHA 2RB8A 3U7YH 2O69A 4F7EA 1CURA 4HX1B 4J3VA 4NQUA 5E8OB 3T6ZA 3OHMB 4FE9A 1CBVL 4NPJA 1PG7W 5BV7C 4MKMA 1HL5A 1IQDA 1WA2X 1OLAA 4BE6A 1DK4A 5GISH 3FT2A 3RX9A 2XXFA 4F2EA 1B4LA 3L1GA 4MB4A 1LBVA 2L7JA 5EU7C 4TULH 1U3HB 2F53B 3DOSA 4I18B 4QTFA 5F9OL 1J9QA 4G9DA 4YDMA 1SRDA 4Z7NB 1OTUC 5F7DA 2B20A 4K9EL 4QRFA 5FYJL 4MJIA 3VI3B 5CJOL 4QJ3B 4KK8C 3OKNB 3DUHA 1F4AA 5TDNB 5DQDL 1YYCA 2PWFA 3TTNA 3DUUA 3V5DB 4Z7UF 2X4QB 1QASA 3II2A 4OJFL 3APFA 5D7KD 3RTQD 2ZCZA 3CX5K 4P8QA 3MYJA 4RISL 3T0VA 5E5MA 3VH8G 4F7PA 1ATGA 4DP0X 5GGVL 1BPVA 5BWJA 3MLXH 1QEXA 3DGDA 3LB6C 2H9GB 2EEXA 2XTJD 3Q5TA 4XGZB 3ETSA 4ZEIA 3RPKA 5K2XA 1RIHL 4XB8A 1CICC 1EDYA 3S8FB 3QYCA 2O1LA 1N59B 1WC7A 4N2MA 2I60L 3OBAA 4ZMXA 1TVBB 2GIXA 1A5FH 4N2DA 5DO8A 4EI5C 1MW1A 4M8QB 4HLJA 1XGUA 4Y1TA 2WBWB 4YVNA 3KPSA 2OI9B 4UQEA 5T5FH 2JB6B 2XXMB 3QQ9C 5JXEA 5LJYH 1WCBA 2O7IA 1XF2B 1XTMA 1L0YA 3IDJA 4OVPA 2VN4A 4G5ZH 3MCLL 3HBZA 5GRYA 4JRYA 4APQB 2WP3O 1E3FA 4MQSB 2ARWA 1CBJA 5F7HA 3KPPA 1N7ML 3FT3B 1NAKH 3AXHA 3SPCA 2CLRB 4HV8B 1LO5A 4IBZA 1ZVNA 2YD1A 5DR5H 1HFUA 1SJHA 4HJIA 4UQ2A 3NQIA 5BZWB 2XBTA 3FB5A 4EIUA 4G82A 5TFSL 4N07A 1MCQA 3WKML 5B8CC 3VXBA 3EADA 5CD3B 2WVTA 5D1QB 2G3NA 5JHDA 4I2XE 4BFFA 4TVPE 4XN9A 2BIPA 1DO5A 4PB0L 5D9SB 2R0LL 2PWDA 3GHPA 2VR5A 4KPTA 3BFQG 1ZA3B 3BVVA 5LXGL 2VZUA 3WFDL 5AOMA 1XZ0A 2QVKA 3O2DA 3U2IA 3ZE1F 3FQ4A 4XVSL 1JZ7A 5IB1B 3RYMA 3WNIA 1C16B 3F7LA 5HHVL 5IB4A 2E86A 4LCUB 1AL3A 5J16A 1N7XA 3LRGA 2ENPA 4APXA 4TL4A 1V5JA 4CN1A 2E7LC 1BVOA 5DW8A 2HWZL 2HXWA 4OJAA 4K9JA 3IRCA 1EBPA 4NQDE 3FT1A 4L5FL 3KYOB 5DYFA 5GGQH 2JCWA 2Q76B 3D7PA 4KV5E 5K39B 4DQAA 3MRQA 5AAWA 3U0PB 1BZ8A 1CIUA 2DRUA 4F7CA 4XVUC 3IFOA 3U48A 1PDAA 1E5AA 5FYKU 1GRWA 1B0WA 3W37A 1JHTA 1QBLL 1ACXA 1F41A 2C7UB 3BFTA 1LFIA 3H6WA 2Z92A 3FTZA 4FXKB 3WMSA 4EQ3A 3K6DA 3LNEA 5HYJA 3SODB 1BQHB 4FLRA 4XVJL 5IW1B 4D3CH 2PP8A 5DVIA 4BK5C 3KYNB 3DSFH 1A66A 1B0GB 4HF5L 2VC2B 2OJEA 2ORBL 3BLKA 1BFVH 5E23A 5BQ7B 3JV4A 3MHZA 4N86A 2VGLM 1JI2A 1I3RB 2DLEA 4XOBA 3SDXA 1FQBA 2OL3H 2AQ1A 4BWWA 4IO3A 4E9VA 1R6VA 3PXLA 4P0IA 4I5BA 5KSBF 2EYRA 3K6OA 4ISVB 3KBRA 5MENE 1JPFA 4P5TD 5KVGE 1WFJA 5AYTA 4OZGF 2G2RA 4QCIA 2ADIA 1O7VA 2MEJB 3E80A 3LKQA 3MBWA 1MCOL 1FDLH 2HT3D 3FZUD 3A4AA 3F12A 1JZ3A 5DT6A 3PGDA 3HI5H 1HHJA 2GSIB 3HPJB 1UH4A 1S2EA 3BDXA 3QEQB 5CM1A 4XO9A 1RIUL 3U93A 4HXBL 4KV5F 1UJ3A 4QSDA 1EJ8A 1U8IA 1CT8A 3HMWH 4B50A 4YIQB 2H2SD 3VXMB 1USYH 2WXHA 3QUXB 4CU8A 1FLRL 4HCIA 1D7CA 2QJDA 4FTVB 4A7UA 4DKFL 1NFDB 1X4ZA 3AXFA 4GBXA 4GL8A 2TSBA 4ODTH 2I4CA 2QTVA 1MCIA 3FZVA 2CUIA 2GYSA 3MU3A 3TH2T 5EIVA 1N0LB 3MBXL 3Q9QA 3TO4D 2XVBA 3ZR6A 1NJ9A 2CGZA 1MHPL 3PJSA 5AVQB 4NUJA 1WD8A 3HE6B 3FXUA 3QDJA 1E2ZA 4H40A 5FYLD 5ALCL 5DTFA 3SE3A 5F1OB 4XP4L 3RGHA 1ADWA 2KLSA 2P0SA 4XMPH 5ID1B 2E9GA 3HRZC 4PRPA 5D2NA 1LMKA 4UTBH 3Q3GB 2V17L 4Y2DB 4CL7A 4FP8L 5ADPH 1X7SA 3MFFA 2OZ4H 2W0PA 3F7KA 5EZJB 3OAUL 4AKQA 2ROYA 2WYHA 2IJ0C 3LS5L 3RUGB 1VACA 1OE1A 1HEZB 1UM5L 2O1AA 1CGSL 4DEPB 5EUOA 2OMXA 3VD9A 1PB7A 4NB7A 3BD3A 3SZPA 5ITPA 1FNAA 3T09A 3JYBA 5I73B 1EFXA 5JTYB 1A6UL 5LCVA 1AACA 4ZMVA 4MDIB 2FBJH 3A6OA 3MRNB 2CJSA 1E8WA 3CH8A 2D2CC 1AS6A 3MA9H 3WGVB 4QRRA 5E2JA 2A1WL 1KENH 2QEJA 3B56A 3QBTB 4K7PH 1TFDA 3LN9A 2XOTA 3H4FA 1B7ZA 1G7QA 1O5DT 5H37G 3ZY7A 5J0BA 2Z64C 5ACZA 3QHTC 2GJ6A 3CUPA 1ED3B 2KQNA 5DUML 3PRZA 4D0BA 5IMLA 3MREA 1KB9K 3QUGA 1RK0B 3DLQR 1W72H 1E65A 3PL6A 3QUYB 4MCOA 4U1JB 2Q9TA 3MV9D 1QQDB 2Y5QA 3B9DA 3QHFH 2PCPB 1P7KA 1B1HA 4GXVL 2WSDA 4UF7C 2WZPA 4ANVA 4UT6L 5JIHA 3SBQA 3UYRL 3HE7D 4DZBB 3GNMH 1T5WB 3CZKA 2DKMA 3ARSA 4JVIA 1T89A 4EDWL 1H3PL 2EYSA 4HISA 5DMIL 3JVGC 1GCFA 2DS9A 3VFTB 2BP3A 1PBPA 5H8NB 3H06B 5KZCD 5C0ND 5IBUG 3F11A 4ZMPA 4X5PA 1TQVA 1SW1A 4PAFA 5J1TC 2YXFA 1JW5A 1M56B 1OHZA 4FYQA 4NKMB 3B34A 2FWUA 2DIAA 3WO4C 2YXVA 4EJ1C 4BZ2A 3IF1B 2Y5TA 1DN0A 1JPGA 3L3GA 3ZX1A 1U8CB 2J5LB 2V9UA 1SDYA 5C08A 3D9AL 1FPBA 5T3ZE 5DQJB 2C26A 3QR0A 5DHXB 3BO8A 3IKCA 1BLNA 4DERA 1KPRB 1MF2L 1XDTT 2XHDA 4M6NL 4JJ5A 3FN0L 4XNAA 43CAA 5LBSA 5DGQA 5HBCA 2ZX9A 4P0GA 3ARDA 5D70H 3FU6A 3EO0A 4KZ0A 3TN0C 4XXUA 2V2TB 4C1TA 4K3HA 1QFUL 5AW5B 2C9QA 4LGRB 5EMYA 1MFCH 4YDVA 2VWEC 2E7HA 4L4VA 2UZYA 2ENYA 5E5UB 4DGYH 1IARB 2W9EL 4HGKC 4NI3A 3UTTB 5I6LA 1L5GA 1SVZA 5EN2B 3DX8A 3OJDB 3CSTA 2XQYA 1YECL 3B43A 2BP0B 4MA3A 4FKKA 4N2GA 1J9TA 3RP1A 5CCJA 5DLMH 4ZFFA 5LKNA 1YNKH 4KH2A 1XBDA 4WO4C 3O9WD 3F3HA 3GMNB 2J20A 1CFTA 4Q4IA 2B59B 3FB7A 4R96A 1B05A 3DXAD 5F9DC 1ZLEA 3JWDL 2Q7YA 2GFEA 2WZAA 1NEZB 1XGQA 5H4YA 4ZPVA 1MY1A 2EEAA 4L17A 3DHPA 2FNCA 4XAKE 3C2AL 4KZDL 5AA2A 4MCMA 1CGXA 3CLFH 2PW1B 3QDME 3RDTD 2IH8A 4PJIB 4CUCA 3LZNA 2X4SB 2VZVA 3AB0C 2P8PB 3EN3A 1X9QA 1UWEH 4I7ZC 3GJFB 5BS0D 1D2OA 5IHUH 4P2AA 5C2BH 5ICYA 1CDUA 2BW4A 4TPRH 2C9AA 2OV0A 2JJSA 3SBRA 1L9MA 2G0LA 2YPLA 1TKWB 3OKEA 1S7WB 1T66D 2Z4TA 2XIIA 2O6EA 1G6RB 2XJKA 3BFUA 2YFOA 1HL8A 3NIDB 4N2BA 5I1EL 4E0RA 1L9TA 3T77A 5AG8A 3BP7A 3K8KA 4GWXA 2J1YA 4HEPA 4FI8A 2ICEA 2VW7A 4JB9H 2W88A 4PRIE 3NTCL 2W60A 4QRQB 5LGHL 1FPIA 3K4AA 2K4AA 2DWJA 5I18H 3ECQA 1RJYB 2NY6C 1F11A 5EBLA 3D33A 2UWEE 3ESMA 4PJFA 5I2KA 4M7ZB 2YS4A 3H4HA 1Q1PA 1E30A 2MCMA 2KQMA 4XTRC 4NWDA 4ZUWA 2VDKL 1BAGA 4H1LB 3GSVA 2VMJA 3GB7B 1RMFL 1XVSA 4M5ZH 1A1NA 2J1XA 3CFEA 1ELJA 2WUBH 1Q94B 1SDAB 1U92B 3LRSB 3VNYA 2BOBA 3EAKA 4ALAC 4DVBB 1HWGB 3BFOA 3EYSH 1CLOL 1DANT 2BJML 2ZUUA 2DQGL 4K7FB 2VRQA 2C9PA 4PGCB 2VDMB 4POZC 4EAEA 3NP3A 3GTTA 5CZVH 3H6UA 2EDRA 4QHLB 4CSPA 3MOAH 4PFIA 3L95B 5DHVA 1XH1A 1EAOA 1CGUA 2NUPB 3VFNB 4AB6A 3CZJA 1XXFC 4OQ1A 5T1KB 1V7NL 3CHSA 2LE9A 2CKNA 3K72A 1JUFB 4HIJB 1YAZA 3FUZA 2FRGP 5F93C 5A5XA 2DQIL 4KDTC 5FB8B 3BKCH 4GAJL 1DE4A