3D4GA

Zp-n domain of mammalian sperm receptor zp3 (crystal form ii)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
471
Chain Sequence
b'TEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 144
structure length 471
sequence length 471
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d4gA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3d4gA01
4NF4A 3MC2A 4R73A 3FJGA 1URSA 4OENA 1MPBA 1B4HA 3HPIA 3KSXA 3I6VA 1IIWA 4R2BA 4GRKA 4LZ8A 4KD5A 1PEBA 3EN3A 3LR1A 3SEXA 4BDQA 3VV5A 2NVUB 4F1UA 3O29A 4FJPA 2NOOA 4FORA 3O97A 3MZ1A 4XKRA 1UTBB 4G2ZA 5DVIA 5CBSA 3PGFA 3PPOA 1Y3PA 4YAHX 2UXAA 2B3BA 3B6TA 2DE3A 1M5EA 4DZ1A 4KR5A 4F3BA 2QJEA 3MP6A 3WAFA 5CMKA 1LB9A 4YKJA 3SEUA 4C1TA 1WDNA 1Y4TA 4F39A 5L8DA 3NK3A 4HTGA 1Z7ME 2I3WA 1QUJA 3EHSA 2PYYA 1MXVA 3I3VA 3VFJA 1RKMA 2RF1A 4F3GA 4YMBA 4OZ9A 5DVJA 1N04A 3DLNA 4YKPA 3GBBA 4TLMB 2P1SA 2H9BA 4M1VA 5FTHA 2HCAA 5ITPA 4I62A 3TCHA 3E4RA 2QL3A 4NF6A 4WKMA 4ISUA 5I58B 1IXCA 1MS7A 1FTMA 1JEVA 1B5IA 2DWAA 3LUYA 3QSLA 4NF5B 2ZMBA 3OMBA 3H7MA 2E0SA 4ZS9A 3MVWA 4FIMA 3QYTA 2QS3A 3E9XA 1URGA 3HHFA 5DYHA 3QAXA 2GHAA 5I59B 5I57B 2DQVA 4YU0A 3CSGA 1AH5A 4Z0IA 1B7UA 4KFQA 3TQWA 3D4CA 1B0HA 5CMMA 1DTGA 2LAOA 1IQ7A 1LLSA 4R74A 3KGCA 3FIRA 2DVCA 3MZ9A 5K2XA 3TTLA 4DDDA 1US5A 4NWCA 3RPWA 2O6AA 4LZ7A 4E0XA 2XXTA 5KCJA 1IUDA 1PB8A 3S9MC 3C32A 2DE2A 4H65A 2ALUA 3TYHA 3OO9A 3L6GA 5AA3A 3T9XB 3K4UA 2DP8A 4QSEA 4XKQA 2GRVA 4GXSB 2UVJA 3GXAA 1SW2A 2ABHA 1B3FA 3IO6A 5AA2A 1XVYA 1LGBC 5AE4A 4LZ5A 2RC9A 4ELRA 4H1XA 3TMGA 4OHNA 3G3KA 1B3GA 3ZS6A 2RINA 4HS7A 2R9JA 2D3IA 4G8HA 3T96B 2F78A 1H3DA 2F35A 4WEPA 3M3LA 3KG2A 5A5XA 3UN6A 1P1QA 4PFUA 3IJOB 3G3FA 3SKPA 4ECFA 1A7LA 5JTYB 1P1UA 4GVOA 3FJMA 3MW0A 1JETA 3B7DA 3VLUA 3TTNA 3A09A 2CZLA 4GIZA 1ZJLA 3CG1A 2XXYA 4QFKA 3IJXB 1MY3A 2F6GA 4F3SA 1JEUA 4JSDA 1II5A 4AB6A 4QF9A 3O6HA 4G4PA 4O3AA 1VFDA 2O51A 1L5TA 5IAIA 1UTHB 1B1HA 1LAGE 1MM6A 1I6QA 2Y84A 4F2OA 2XXVA 4F31B 3N5LA 3SESA 3JZJA 1GTKA 3ECRA 1ZLQA 3VVEA 5I56A 2XXUA 1MRPA 3QUJA 3CFXA 2VD2A 2Y7RA 1JVYA 4EQ9A 5H8HB 3P7IA 3K01A 1NH7A 1DOTA 4DLDA 3VXBA 3DP8A 3VDFA 3T9HB 3H06B 2Y7PA 4ELPA 1QUIA 2H98A 2I4BA 2DWJA 4IB2A 1B7ZA 4I9DA 4PQJA 2F7CA 4PFYA 2AYSA 4O3BA 1MY0A 4JWOA 3U92A 1SW4A 3A3CA 1Y4CA 4LUBA 2PT1A 1POY1 2I58A 1Y3NA 1OVTA 3LC8A 3C34A 2GH9A 4EDPA 5AA1A 3U1OA 4EQBA 2D21A 1ZBMA 4G68A 3UGWA 1OVBA 4IY6A 1B3HA 3BKIB 2V3QA 3RY3A 1M5BA 1R1NA 4LA9A 4LONB 2DS9A 2HFBA 2O1LA 2ZYNA 2Z8EA 2RCBA 4JWXA 2AL5A 3VXCA 5AA4A 4ZE8A 1B32A 2XD2A 2YLNA 3SDFA 5I84A 3PPPA 2H5YA 2B65A 3M8UA 3HN0A 2QMWA 3BBRA 5KDTB 1B4ZA 1Y1MA 1SW1A 4ZEFA 3B6WA 5CBRA 1Y3QA 4MFIA 1MDQA 2OLBA 4DXBA 4KYDA 1QKBA 4ESWA 3RTWB 4RYAA 3TCGA 2I49A 3IOWA 3DELB 4X1BA 5CRYA 1Q35A 4H5FA 2PBWA 1MXWA 2DE4A 4BDMA 3TTMA 3O66A 5H8QA 4NF8B 3ILTB 1R9LA 2HQ0A 4IGRA 2I6EA 2FA7A 2UVIA 3MP1A 2AIXA 3M3FA 4IO3A 3TELA 4OFOA 4BLAA 3NK4A 2DWIA 3SEVA 2A5TB 3CFLA 1R6ZA 5ISUA 3CFZA 4ELQA 1H44A 4OXVA 4RA1A 2O1MA 3IX1A 4FAJA 1XC1A 4E0WA 1D9VA 1B5HA 5EHMA 2ESNA 3W9WA 1BTJA 1VFEA 2VHAA 3S2VA 1B51A 4RPOA 4PFWA 4XIGQ 1OLAA 1B3LA 5I58A 3ZKKA 4RK9A 4R72A 1R9QA 5TPAB 3IOVA 1EZ9A 2RC8A 1MXZA 2QS2A 2DYXA 4KYSA 3FV2A 4KI0E 4ESXA 2AL4A 5I2KB 3MQ9A 2Z22A 5H8NA 3H3GA 4OVJA 4BDLA 3LSLA 1SQYA 4U23A 1ANFA 1BP5A 4U1ZA 2DWHA 3T66A 3IORA 3OEKA 4NEDA 5CMBA 5FHNA 1H76A 4EUOA 1ATGA 3FXRA 4JDFA 1IXIA 4U22A 1N0TA 3IK6B 4OERA 3O9PA 4GL0A 4PFTA 3PPRA 3DP4A 4P0IA 3IR1A 5F7VA 3PPQA 1J1NA 4DXCA 4R9FA 4N07A 5BUUA 4GD5A 3E3KA 3TUSA 3KJ7A 1ZKBA 4IO6A 1NNTA 4RK2A 4G77A 2ONSA 3H03A 1DTZA 2REJA 1MG1A 4H8IA 3SETA 3O2AA 1EZOA 3QK6A 3GLBA 2Z8DA 5BWJA 1B58A 2QMXA 3VLWA 3CVGA 3VLVA 2O68A 1XT8A 5DEXA 4FEBA 3PU5A 2F5XA 1OLCA 2ANJA 4U4SA 3PUXE 3W9VA 3K2DA 4YMAA 3Q28A 4JBZA 4DCXA 2XXRA 3FGSA 1MQDA 2H99A 1US4A 1FW0A 1MH3A 1MXXA 2FNCA 2HXWA 3KN3A 3SEWA 3HHGA 1BKAA 3KN8A 1SI0A 3PD9A 3G3JA 4KCDA 5B7DA 4U1OA 3W15C 4KQPA 1SYIA 4KYEA 1VE4A 3TEPA 3IAZA 2I4CA 2CMOA 1MPCA 1A54A 1B7HA 4G68C 4KPTA 4YICA 1IXHA 4OEVA 1OMPA 4POWA 5JEIA 3SERA 1IITA 1USYE 1MM7A 3THIA 1B52A 1UTHA 5K2YA 4R6HA 3R6UA 2PMSA 1AL3A 1IZ1A 4AB5A 4JB7A 1H45A 1LCTA 4Z7EA 1F9BA 3PMWA 3PUWE 1VSOA 5L9OA 2GFEA 5F1QA 5FHOA 3USDA 3Q26A 1N3XA 4DCYA 3KOSA 2XXPA 1LFGA 3FATA 2NUVA 3FVKA 1FTLA 3PUYE 5H8SA 4HCYA 1P1WA 4O3CA 3EF7A 1UQWA 3IO4A 2F36A 1D4NA 4GF8A 1PB7A 3MVZA 2QPQA 1ZIUA 3OD7A 3KEIA 2OBGA 3TDJA 1Y20A 1CB6A 4XTCQ 4EQ7A 3TFLA 4H5GA 2OWSA 4NF6B 4X1DA 5H8FA 1Z7NE 3ONMA 3CSBA 2A5SA 3RT6B 4IO5A 3QIMA 3QXMA 3K6VA 3WAEA 1N3WA 4R6KA 4U2RA 5KDTA 5HPQA 3LSFB 3VE1B 2OK2A 3ILUB 2W7YA 3CG3A 3FVNA 4ZE9A 1OIBA 4X48A 2UYEA 2PX1A 3DM0A 3PMVA 1MQIA 3RT8A 4ZZAA 2M8CA 3PD8A 4R9GA 1MY2A 1SD3A 1FCKA 4NF8A 2O7UA 2Z8FA 3R26A 2GHBA 4KHZE 1AOVA 2OCUA 1NNFA 3K6WA 4GXAA 2XXWA 4H67A 3JV9A 2IA4A 1DPPA 4ELOA 5HM4B 5TP9A 1SDXA 5ICQA 5AA2D 1TFDA 3O6IA 3KN7A 4R2FA 1SBPA 1LAXA 1FQCA 5KCJB 2A5TA 3CIJA 2B3FA 2I0CA 3QUFA 1GVCA 1FTKA 3N26A 3LSWA 2XXHA 2D5WA 3Q27A 1DSNA 4RNSA 1O7TA 3K1NA 2O69A 3TAJA 2X26A 3GZGA 2I3VA 4ZEIA 4NE4A 4XXUA 2HZLA 1HSJA 5CMCA 5ICTA 1N7WA 4YKIA 4FEDA 1GV8A 2HAUA 1LBBA 2XX8A 1B2HA 5A5XB 5I2NB 2THIA 4H6DA 1S7YA 3G3HA 2ZYMA 1QW0A 3OENA 3OO8A 3H6TA 2HEUA 5I2KA 1PC3A 4I1DA 4IO4A 3AXFA 4DXUA 2VP1A 1WVJA 5DVFA 2P0SA 1I6BA 3Q29A 1JVXA 1OQGA 3TTRA 3V8XB 3V83A 3TKDA 4UACA 1UTBA 2H4IA 4DIGA 5FHMA 1B0LA 4F19A 2Q8JA 4NWDA 2ZYKA 3EPEA 3PMXA 3OO6A 4Q30B 1BIYA 4MBPA 4RJZA 1FQFA 1N84A 2I0BA 3M3KA 3S9EA 1A40A 3FD3A 3RN8A 5L9MA 2RCAA 2VGQA 3U8QA 3RUMA 1NKXA 4GFRA 1XOCA 4BDOA 2G93A 4R75A 4EF2A 4OMBA 4FECA 4L17A 2OJTA 3VVDA 1P1OA 4OETA 4IGTA 2REGA 1RYOA 4Q5TA 3MZBA 3PUZE 1P99A 1UIUA 2IEEA 4ZEBA 4NTLA 2X7QA 5TU0A 1ELJA 4P0GA 4QHQA 3N94A 1AMFA 1RYXA 3FZVA 4MH5A 2RKMA 3OXNA 4OTEA 4Q0CA 4RPNA 1Y1ZA 1O64A 3UIFA 1N76A 1LFIA 2UYFA 3FVGA 2UVGA 4C1UA 1D9YA 1MXYA 1YTVA 4OEUA 4RY1A 4QFPA 4NF5A 2F6PA 1ZTYA 1B3EA 4FATA 1FQAA 3CI8A 3C4MA 5AA4B 1B6HA 1YAEA 3MUQA 4ZECA 3T9VA 2WKYA 1M5FA 3RTFB 2V84A 1MQJA 1NNKA 2QS1A 4ND9A 3HCQA 2F7BA 4FE8A 1A55A 1MQGA 3D4GA 1WODA 5I59A 5I57A 3V5AA 3L6HA 5FTIA 4ZEKA 1MQHA 1CE2A 2F34A 4OQOA 4PE5B 1YCJA 3LBSA 3OSRA 5JK4A 4IO7A 2ZNSA 2R71A 5H8QB 1JW1A 5IKBA 4TOZA 4TLLB 3MBPA 4AQ4A 3S9LC 2Y7KA 4LP2B 3V89B 3IB2A 3TCFA 3FUZA 1QJMA 3PUVE 4QRZA 3HO7A 2RC7A 4F22A 4WEDA 5EHSA 3C31A 4ZZEA 3K0VA 1UIVA 1DPEA 2ONRA 4GWOA 1LB8A 2V93A 3TPAA 2DXRA 3SEYA 1B46A 3E13X 4OYVA 5ITOA 1TWYA 4P11A 2XX7A 3CRBA 3UK4A 3G7WA 1SI1A 3LSXA 2Q2AA 1JW4A 2ZXTA 1LBCA 3UA8A 1NMUA 2G29A 3KZGA 1NH8A 3DP6A 1IEJA 3C36A 4K3FA 1A99A 2I48A 3K1MA 1SYHA 2PT2A 4WXJA 4YB6A 4QSDA 3C33A 1MY4A 3MPLA 2NWJA 5JTYA 4POXA 2QS4A 4NF4B 1D3KA 1LSTA 1FQBA 3VVFA 3MWBA 4ONYA 3JYRA 1EZPA 2FYIA 3BFTA 3GBAA 4YKKA 1O63A 4F18A 3CR9A 5H8NB 3FASA 2YJPA 4MLQA 3RNNA 3TTKA 3HV1A 2XD3A 1N7XA 2QRYA 2DVZA 2V25A 1VR5A 4OESA 4MF3A 4GLIA 4PETA 4F1VA 3O6GA 4JSOA 3U72A 1DMBA 1MDP1 1B1XA 2R6GE 3OOAA 3RQTA 2Q88A 3KFMA 1ZMGA 1S9TA 1M5CA 2F7AA 2ZNTA 2HAVA 1NL5A 3B6QA 5H8HA 3K02A 1JQFA 2Y7IA 3N6TA 2H25A 3OELA 1NFTA 3C35A 5EYFA 3FVOA 5CC2A 3EHTA 4IO2A 1I6AA 3MVYA 4XKNA 4OWDA 2Y7WA 3IB0A 3K1PA 4G8MA 3H6UA 1LAFE 3RGYA 4IY5A 4F2QA 1YPNA 1LCFA 5DEXB 2VOZA 3H6VA 3BFUA 1BLFA 3S4UA 1USYH 2OZZA 3O28A 4EXKA 2V3UA 1PB9A 4GL8A 3TQLA 3KBRA 3S9NC 3IB1A 3K6XA 3T22A 2BJJX 5I2NA 3G3IA 2XXQA 2XXIA 2VD3A 4LATA 4THIA 4QFOA 3IOUA 1I69A 2UVHA 4U21A 3R7XA 1AIVA 3Q25A 1IXGA 5L9SA 3RLFE 2F8DA 3FXQA 1T0KA 5DTBA 1POTA 5DT6A 1LAHE 3H4ZA 4RXLA 4BDNA 1A8EA 3TZAA 3T9UA 4QFNA 1SW5A 1QUKA 1A8FA 4I8CA 4OFJA 3U94A 3FXUA 1ZU0A 1EU8A 4H8JA 2KLFA 2DOJA 3MP8A 4UA8A 3TODA 2O7IA 2F97A 3T93B 4GQOA 1GGGA 2V3TA 2Q89A 1JW5A 5M2VA 1FQDA 3MVXA 1XVXA 2HZKA 2ZNUA 1FQEA 1FTOA 4YZZA 4ZDMA 4N13A 2DXYA 4PP0A 3KJTA 1B9JA 2YPNA 2ZYOA 4YB7A 4DE8A 5AA2B 3F11A 3EQ1A 3U93A 4BDRA 1QULA 4MLVA 3I5OA 5KZTA 3IOTA 2XX9A 4U4XA 2E1SA 4C0RA 4N6PA 4GOTA 1TT1A 1HSEA 2P2AA 1PBPA 2ONKE 1B40A 1B05A 1JNFA 4YB5A 3FV1A 4KCCA 5TPAA 4LVQA 1FTJA 1EH3A 1P1NA 4R6YA 4LQ5A 3K6UA 1SVXB 3A3UA 1URDA 4EF1A 3EHUA 2O84X 4F29A 5H8FB 3MPKA 4QFLA 1NNPA 1S50A 3ODBA 4X9TA 3PPNA 3KOTA 1XS5A 2XHDA 2DSFA 1OQHA 5CM6A 4JWYA 2Z23A 1LFHA 1H43A 4F1YA 1GR2A 3UORA 3H6WA 2XXXA 4Q8RA 4G8NA 4HCWA 1MY1A 2Q9TA 2NXOA 4M4GA 4OFLA 3N6UA 4F3PA 3UP9A 1QVSA 5J1DA 3MJNA 3ZSFA 5I56B 1Q1KA 4TQUQ 1XHYA 5B70A 3MAMA 5TP9B 4ZEDA 1KWHA 3ZKLA 1MPDA 5HBCA 1PBQA 3OSQA 4LQ2A 2PVUA 3IL1B 3KSJA 2Q2CA 5ELVA 3C9HA 4H0WA 1B5JA 3OEMA 4HW8A 4QSCA 2X7PA 1M5DA 1QKAA 4XKPA 2OWTA 5CI5A 3HSTA 1TXFA 1Y9UA 4EXLA 1PDAA 1MXUA 1MH4A 1HSLA 2QSXA 4JXIA 4G68B 5LOMA 3OO7A 3FJ7A 4NMYA 1TFAA 3PV0E 3K00A 3G3GA
chains in the Genus database with same CATH superfamily
5JXAL 1UOVA 5DC0A 3N5AA 3KWWB 5HI4D 5KVDE 3LS4L 5C3IA 3MC2A 4MJIB 4ZOBA 4H8UA 2C9SA 4JPSA 4P4KC 1DCUA 2O61B 4BFKA 1G5AA 4ZI8A 1R5IB 1QI3A 4R90L 2CKBB 5IW3A 1WGOA 4U1MB 5KSAB 2ZSWB 1RP8A 2DKSA 2VC2H 1FAIH 3KBPA 4X6CE 3UDWC 3I6VA 4ZXBB 1XQ4A 5D2NA 3RJQB 4LOEA 1QFWH 5DU7A 4X5XB 4BQBA 3K72A 5ID1A 4GRKA 2H6OA 3WY1A 1PY4A 3LR1A 2DWEA 2WPGA 1PG7H 2CBTA 5JA8B 4PJCA 2XC8A 3PLYA 3HG3A 1C12B 1L9TA 3QIUD 4IIQA 2QVTA 1KDIA 1L7TH 2DH2A 3PL6A 3MNZB 4RNRA 5AOKA 4MA8L 5ERWB 5A7BA 1JK9A 1C08A 2EEFA 4FI6A 4X9BA 1Q72L 3O97A 1V7NH 2AXFB 3VXUB 5IROD 4XKRA 1AGEB 4HWEL 1JZIA 1A0QH 1JGVL 3AQDA 3OKNB 1Y6NR 5DSCA 4A2EA 1XD0A 1RUKH 4L3AA 4GS7C 2ZUWA 3B34A 3B2VH 1O7DE 3K0YA 1U8CA 1NCWL 3PGFA 3ABKB 3PPOA 5CZRA 3QDGE 1FYTE 3EOBB 4U1IA 5F9AC 2LTQC 3BFQG 2B3BA 4TSBL 4DZ1A 1U8JB 2CIKA 4M7LH 4UWQB 4F3BA 3ZKMC 4JX0A 1RZQA 3O6FD 4YKJA 1XWVA 5TE6H 5D6DC 2X09A 4UQDA 2QBWA 3MJ7A 4KX9A 1W0VB 5J13C 1RZIA 4PRID 1WDNA 2WLNA 3LZLA 5D72H 3RGVB 1S3KH 3DROB 5I1LB 1Y4TA 2XKUA 5GGRY 1CYGA 2H4EA 2IADB 3AT9A 4N3TA 1M2OA 4XN9A 5L8DA 2VDOL 4JDEB 2DKMA 4IBQA 2KUTA 4LHUA 5D1QB 1T1YA 4LLQA 3U6XS 4OH2A 3F7VA 3EHSA 4AT6B 1LP9A 4PWFA 4NQVA 2HTLC 4OZHF 2ZCHL 3VD5A 4K7FA 3Q0HA 3W5MA 2C4FT 4HUVB 1MXVA 5DEFA 3NFPA 3SYOA 4H45A 4DW2L 3WGUB 1F6AB 1WBYA 5FF6A 3SGEI 5IP4A 1RKMA 3FN9A 3QULA 4TQHA 2R69H 3LHPL 2Y9RT 4L4TD 4ZMYA 1AANA 5FGBA 3VFGH 3VXQA 4LASH 5HPOA 3AS0A 2XZAH 2C26A 1TZAA 4XVSH 3TURA 4YE0A 4DP9X 5DI8A 3RZCA 4YIQA 4TLMB 4MAYC 2H9BA 4GFXA 3DLQR 1IBFA 4FXKB 5FTHA 2CZIA 4YOKA 3QJRB 5I66A 4J3OH 3O11A 2IH8A 5ESVA 5INDB 1DVFA 2AKRB 1DJIA 4U05A 3SJVE 2ZUTA 3WI9A 4QOKE 2XA8L 4HQQH 2ZX8A 3FN0H 1GHFL 1LMKA 2R2HB 4R26L 3CH1B 1GYWA 2DYPA 4BZ1L 2H26A 3BC9A 4NF6A 3H7BA 2EDQA 2O5ZL 4ZPVA 3OF6A 3KBEA 5KYXA 4FQLH 1UQSA 3HE6A 2NR6A 1VHPA 2EXYD 5I58B 3FCGA 1IXCA 2JB5L 3APDA 1MS7A 1JXKA 1FTMA 2XPZA 3R1GL 4HXBH 2BFGA 2V4CA 4PTUB 2MH4A 3BKJH 3Q8CA 2NXYD 1SXNA 5CMAA 2DWAA 2Z7YA 1DCEA 1BX2A 4WSJA 5EU3A 1DBJL 1G6RA 2F61A 2IGLA 2KKQA 4F8PA 5C7XL 2PW1B 2X88A 4XMUA 4CNIB 2PCYA 2YZ1A 4BQ8A 3MVWA 4JFPA 3WMPA 4X4XA 2LFEA 5I8OH 4Z7OF 2NNAB 4FIMA 5FGCB 4L8DA 4E9RA 4WTQA 1XXDC 4LSRH 2D3LA 4B95C 3NN8A 3ZTDC 2W60A 3QYTA 1B0IA 4WHTA 3CDGA 1KB3A 2VMDA 3HPJB 4BFIB 5J57B 2V5MA 4UZUA 4Z7WB 2CHZA 3L3DB 3N9GH 2A38A 4NO5B 1KB5B 2ERJB 3RX5A 3HHFA 1WP6A 4R3SB 4JKKA 5BQ7A 2HFFB 3RFZB 3WAJA 1LEVA 5BNXD 4KKQA 1E42A 4CW1B 1WAEA 3QAXA 2NY2B 4JBSA 1ZOXA 4F9LA 4GQ9H 1SEQH 5I57B 4KO9A 4FP8L 1BIIB 4MCZA 1OZTG 2A0LD 3IFPB 5E7BA 5I1CH 4KRLB 3OLGA 4EUPG 5ITFA 4EKXA 1A4CA 3QDJD 2F8OA 3I6SA 4WNQB 1PZ5A 3KPMA 3EGDB 3N85H 4OZHA 1PU0A 1NL0L 3O0RH 4HZ1A 4X80H 5CMMA 5DGQA 4FG6C 4CUCA 5HBBA 1DTGA 1N7ML 1PKQA 2WM0A 4I3EA 1IQ7A 1MWAB 5GGTH 5BRPA 3L9RB 4X5PA 4IRZH 1JPSH 3OAUH 1RV6X 1NUGA 3CFMA 4FXGA 5F9OH 5EEXA 3MZ9A 2EADA 5LB1A 3ARED 4UB0H 4PRPE 4GP8B 4NWCA 3ZGIA 5DURB 3RPWA 4P5MA 3VGHA 5BVJB 3QIWD 3EGXB 4MBRA 2FATH 5DHMC 3EF4A 5KEZA 2QPUA 4H5SA 1E27A 2XXTA 1ES0B 1KPUA 1IQWH 1T83C 2GBAA 4HALA 2HSIA 1S7WB 3S9MC 2RMNA 5I8KH 4LOUD 2DE2A 1OAUL 1UACH 2Z35B 2ALUA 4H65A 3EJQA 2L5VA 2FVZA 4HHAA 1FGNL 1YUHB 3QDAA 4OR1A 4N8GA 4U6HA 4NBXB 3FAWA 2EDJA 3Q06A 5GRJL 3QUMA 1MCPL 4QUOA 3K4UA 4FEIA 2DP8A 1CFVL 4PWJA 1VFBB 4PCTA 1ILUA 1FCGA 2XG5A 3FSOA 1BECA 4XCEB 1ACCA 3TN0D 2FUTA 1MRCH 1OVZA 5AA2A 3SD5A 3FQYA 3ILPA 1UA6L 2RC9A 2X53A 4ELRA 4RSVA 1DJXA 2BCKA 3FDWA 4GRWE 4I3SH 1NUYA 3TMGA 3MYZA 2CO2A 3LKSB 3FUJA 4K7PX 4HIJB 4Q9QL 3CSYA 4AVJA 1Z5LA 3K4DA 3NCFB 4PYGA 4NDMA 2WYIA 1MVFA 4FMKA 4W9DC 2E8YA 2W9DH 3EADA 4KKCD 4MS8C 5J7CC 4J39A 2CZKA 2OTUA 1MF2L 1O7SA 1PKOA 3MGTA 3NIFB 4OGYL 2DZEA 2B4CH 1NFDB 3VA6A 4XCNB 3QW9A 2P80D 3T3PB 3GSXA 1I4FA 4QAWA 1JE6A 4FF9A 2G2NA 5E6IB 3VH8A 2QFPA 3IFNH 2AMGA 1NMBL 1GOGA 1N68A 4FFTA 2W38A 1CGSL 3IU4L 3WFEL 3M3LA 3N0AA 5A5XA 5A2CA 4PFUA 4EUPH 1AI1H 3QUYD 3H42L 4K3DH 2NXZC 1UZ6F 3MRCA 4NM4H 1ORQA 5F7AA 1D6VH 3PWPA 4HP5A 3UPCA 5GGQL 1O9ZA 4ZMVA 1WBXB 2I5YL 1LBYA 5L7XL 1CLVA 4NHCL 2GTZA 4UOQA 2XBTA 4L8CB 3ARDC 1I9JL 1XL6A 3CFCL 5K93A 3C5ZC 2R2CA 4MX7A 2EDFA 1E6JL 2K7PA 5B38G 3B7DA 3PUCA 1N2RB 3ARWA 3CVHL 1UTDA 2AEWA 4HIHA 5CHNB 4EXPX 2FE0A 2BNRE 4OW6A 2D0FA 3EJSA 4G8EB 3ARFC 1RPKA 3ULUC 5L6YL 2CZLA 3B2PA 2VLJA 4HUUA 1KCRL 1P5VA 3BDBA 2BVYA 1KBPA 1R3KA 3O4LB 2CR3A 3RYMA 1X5XA 4WFFE 4L1HA 1C9SA 5AOZA 3I2CH 5JA9A 1SVCP 4Q9BA 3EGSB 5DEGB 1ZTXH 1QAWA 2EH7L 4HEPA 1QSFB 2HXAA 3MLVH 3UTTD 1F4YH 1JTOA 1RLBA 1UCTA 3O6ML 3UAJA 4BDVB 4QFKA 5FFGA 1WFOA 4J4PD 1A02N 1L5GB 3VW3H 4G3YL 2J6EH 4HKZB 4ABUA 5JHAA 5F6HI 4QBAA 3FUIA 4JSDA 2G30A 1HEZB 2KQNA 4X0KA 1RZ8A 3DBXB 1II5A 4QPEA 4OV5B 1IMDA 2NY4B 2YLHA 3BCDA 3QXVA 5HGHB 1VFDA 4O3AA 2GJ6B 3TEWA 4GX3A 1FBFA 4EI5D 1XGYL 4NM8H 3CFEA 4F33A 2MQCA 1CWVA 4F24A 3VRIB 1BXXA 1ML0A 3OMIB 4OD2B 3LN9A 5DDHB 4LMQE 1FGVL 3VRJA 4HUWB 2H6UA 3AXHA 4OLUH 1OPGH 5ADOL 1ZLQA 1J5CA 5I56A 1UCBL 2NY3B 3FBPA 3E6FB 1MRPA 1JERA 1PYWA 4G7VH 1XDTT 3MKGA 4UMGA 3JV5A 4MNGB 3JBG7 2XA3A 2R0ZH 4NBYB 3DX8B 3DXAB 4KY1H 5SWQB 4JAMB 3BAEH 5A3IC 1DOTA 3QPKA 3G6JB 1OGAA 5HJGA 2XBZA 2QZQA 2BWIA 3MRPA 5BUGA 5D1ZI 3TM6A 4MRCA 4UT7H 1D5XB 3VXBA 1B0GB 3GXFA 2OMWA 1HILB 4F7EB 1BEYL 2IEPA 2AXHA 3BGMB 3TBWB 4YSEA 2V17L 2WAHA 4C83B 1A6ZB 3C08L 1IGYA 4JVDA 2YUVA 3MOAH 2WYPA 2FJSA 1R3JA 2PW2B 2FD6H 1GPOH 3K2UH 3WNLA 5M7QA 1BF8A 1ANUA 5DMKB 2YRBA 3NGBC 2UZIH 4XP5H 5FECA 5EIIB 5LG1A 1FL3B 4A2GA 2XG4B 4XOAA 5T3XD 2I4BA 1XCWA 4BM7A 2VDKH 4FLSA 1A65A 1FO0B 2CGZA 2F5BL 3TO2B 4ZFOL 1MPAL 1KT2A 2V0AA 2FWUA 3KXFE 5FFLA 5JHLA 4XXDB 3GF8A 4LPCA 3TPUB 1A7OL 5FOBB 3H7LA 1AO7B 1XGZA 4DT2A 5C1MB 3MI6A 4QY8A 4AITA 1RHHA 4G5ZH 2BNQE 4E5XA 5FCUH 5L4JA 3LC8A 3PP3H 3EH4B 4EDPA 1Y18A 1F18A 1OLLA 2VOTA 4LVHB 4Q6IC 4FL4C 2JF1A 3QUKB 1L7IL 2BIQA 3IVKB 5CGMA 1UVQB 4NNXB 1K4CA 4IY6A 1RJYB 3ZN6A 3L6FA 1WFUA 2O5NA 1RULL 4GW5A 1CTMA 1NM4A 4K71B 4UT9H 1CU4H 3DSFH 4TSAH 1KIPB 4HIXH 1I85C 3S4SB 5T3JA 1VAHA 1VGEL 2XQYA 1LO3L 5HHOA 4M6MH 3EO9L 1A6VH 4KK6D 4RRPG 2IBZY 4LBAA 3ZKSD 2N0KA 2Z8EA 1LM8V 4JRYA 4CBZA 4K5OA 1OWRM 2Z31C 2RCBA 4JWXA 1KJMA 4S11A 1XMEB 2JJSC 5DHVH 4ZJ9A 2XV6B 3WD5H 1BAGA 3S3DB 3BYYA 5EMYA 4N26A 3FKUS 2DJ4A 1KCKA 5A2JH 2F54E 2E27L 1XGTA 1NIAA 3QQ9D 1YMHB 2YPVA 2OK0L 2H5YA 1GZHA 3IFOA 1J05A 5E08H 3HN0A 3CPLA 3IETA 4JO2L 3BBRA 1I3UA 4NENA 1S7QB 2F18A 5IKCA 5LXGH 4JFXB 1B4ZA 5KDTB 4PJBB 1Y1MA 1SW1A 4MIJA 1TZHA 3TIEB 3ETBJ 3V6BR 4OFPA 5IOPA 4MFIA 1E9QA 4DEUA 4OFYD 3VFUA 1NCNA 2GJZB 4JFDD 4TNGA 4O4YL 1JNLH 2OLBA 4JCWA 2R4SL 3DARA 3ZO0A 1NMAL 1MCRA 4ESWA 1QKBA 4WO4A 4I0KA 4NZJA 1W72B 3FH7A 3FCUB 2VXTH 5F3HB 5D2LE 3P2TA 4DPRA 2I49A 2Q8BL 4WU7A 5E8OB 3BPCA 2DQCH 1DVSA 1DUYA 1RDXA 2OM5A 2OMXB 2ZX7A 4LMQI 5DUJA 1NUXA 3RTQC 2OMVA 4OJAA 4BDMA 5FA4B 2ZT9C 2A83B 2VM3A 3GLDA 2IAMA 2ZNWA 4LVNB 1P9MC 4NNYB 3M1BB 4PJ9B 3O66A 1QWUA 5BXFA 2PFYA 2NSMA 4NF8B 4KX7A 3OLIA 1SY6A 3KYAA 1JZJA 3UFIA 1R9LA 4PJ5E 2VDMH 4KROD 2IQ9L 2J88H 5ITBL 4HAFA 2W81C 3MCG1 1NMCB 4IGRA 1PLAA 2FA7A 2HVKA 1P84J 3I02B 4M56A 4UQIM 3VGFA 4ZMQA 1JG9A 1YXIA 1FPGA 4KI5E 3MP1A 4LLVB 1FVEB 1I8AA 3MLUH 4HK3N 4N5EC 2LFGA 1NOLA 2GSIA 4PLOB 1DBBL 4N8VG 4DN4H 5TGBB 5AOLA 5HI5C 4GI9A 5J89A 2I26N 4G6ML 3OGOE 4NQDB 1UADC 5D2NE 2YEQA 4V1DE 4BLAA 4MLIA 4AYEC 3RNQA 3SE8L 3CFLA 1HZHL 1SXCA 2FECI 2N1KA 2VUOA 5EZOL 4F8NA 5I73C 1LE9B 4P5TD 4AL8C 4X6DB 5IQ9A 3FCSB 4PJCE 3ARVA 3MC0A 1OM3L 2VABB 1N59B 1U8KB 3MRIB 4I18A 4TYUA 5T3XL 5ISUA 4Z7VB 1A9BB 4ALAL 2XA5A 3TBTB 5IZZA 1XT5A 1MJ7L 3MREB 1T1XB 2H6PB 4PM1A 4N2OA 3AM8A 3MLPA 2K6ZA 4B7IA 1UWGH 1BAFH 1IO4C 4PJ8A 2XN9A 1FC1A 4KXDA 1YEIL 3CBJB 5HYIA 4HUXB 4M29A 3ISYA 5K9JL 3QCVH 1ZPLA 5A6MA 2CJ3A 2W59A 5J6GA 1VFEA 3FXBA 4FS0A 4MHFA 2AJXL 1TETH 3ZHFA 4OQ1A 1HI6A 4Z0XB 3CZLA 5DQ9A 3DUHA 5E95B 2A9ML 3TFKC 1MWOA 4AYSA 2ETWA 3FL7A 1A1OB 2GPZA 2V5YA 4OLXL 1RU9H 5HYQA 3VFMA 3RB7A 4FBPA 2DTSA 1DBKH 4RH4A 1OLAA 1B3LA 3FO2A 4NZ8A 1YVLA 2FJFB 3L1OL 2I7OA 4KZ0A 4F7CB 3VA2C 4KXZI 5E2JA 4BBWA 4YLCA 3BH8A 1R9QA 1G0DA 2MOQA 3ALPA 3NJNA 1EZ9A 4KH9A 2QS2A 2CEXA 2Y7MA 3KH4A 4IKNA 3BGAA 1JYVA 1DE4A 2W8CA 3ZGHA 4KY2A 5KAQF 3C75A 3DV4B 3WLWD 3LKOA 2F5AL 5GSRA 3HFML 3QHTC 1INPA 4WY7L 1C5BH 1XR8B 3QXAA 2Z22A 3U1QA 3U0PB 1T7XA 5DJYA 4FQIH 3KZ8A 4O94A 5EIVA 5EFIA 1TEGA 4M5YL 4OZIF 4OVJA 4K23L 2VR7A 4PY8J 1D9QA 3DGCR 3MRBA 1BQHA 2CGYA 2HJLB 3MGOB 4NQTA 5EG6C 3ZTNL 1BP5A 4U1ZA 1BZ9B 2VUKA 1OB1A 3OXRA 2O6EA 3Q2VA 4JFWA 4TL4A 4TUKL 3VD7A 3IORA 4O7MA 3MLYH 3TT1L 3OEKA 2P5WE 1SMAA 4U1HB 3QISA 3SDDD 1FL5B 5CMBA 4FQHB 2EIMB 5I1AA 1ZD6A 2GVYA 2XX0A 3GEWB 2VQ1A 3HC3H 3OWRA 3U7WL 1NA8A 4EUOA 3TF7C 5HGBB 3BP5B 3KPLA 4JE0A 3NJMA 2EIDA 4JW3A 1YECH 4KOBA 2VISA 4FEMA 3IGFA 1WYJA 2OTWB 3CJJA 2BNQD 4OZGE 3IK6B 4GJTB 2DM4A 3I6LE 3GSRA 4Y19A 2OR9L 2HXRA 1D5BB 4HWUA 1J88A 4S2SB 1R34A 1TQCC 4G6KL 8FABA 5LUMA 2WAQA 5DJZA 5T3ZH 3AGVA 4P0IA 4WO0A 1BCIA 5HJ3A 3NZHH 4IKLA 2BSBA 2P4AB 1ZT1B 3NIDB 2WN3A 4PY7B 4DXCA 3SDXB 4GD5A 1MAMH 1MFBH 3E3KA 1ETB1 4TNVF 3TUSA 4YHZH 1M6OB 2CLRB 3WTTA 3FIRA 4GXFA 4GEJA 1ZKBA 2WUBL 5IBLD 2HAZA 3ESUF 2EE2A 5E0QA 1MN4A 4FCHA 1I3GL 2R7EA 1II4E 3M8OH 4QTHA 5HGAA 1K5NB 2ONSA 2J1YA 1GOHA 1KEGH 3WIFA 4HIQA 1J7VR 5C6PB 2FO4A 1LO5A 2REJA 3GSNA 4D2NA 4WV1B 4UYPA 3TYFB 1WFNA 1U8MA 3GRBA 1AHMA 3MRGA 3SETA 4ESKA 3MRKA 3HI1A 4RGNE 4UV4H 4DH2A 2XWZA 2MPVA 3MV8A 1B2WL 1YUKB 2Z91A 2NLJA 3QK6A 4PREB 1UUNA 1C16A 5IQNA 1JK8B 2VDNB 1JPTH 2Z93B 4GQPH 1GJIA 5BWJA 1S9WB 4Q4EA 1BG1A 1P2CB 2A9DA 3V4PH 2QMXA 1RIUH 4UZSA 4CGUB 3VLVA 2Y24A 2RCSL 2O68A 3AWFA 3G08A 12E8H 1ZLEA 2WUCH 1UATA 2R59A 3DIFA 4X8JA 3EG9A 4OZHE 2YZ8A 2CKBL 3T1FA 3WO4B 4P2RD 1OLCA 4HH9A 2SEBA 4U4SA 4F58H 2YFNA 3G04B 1PKQE 1HWWA 1IBGH 2GT9A 3BH9B 5L0QB 4NFBA 2Q3XA 5J9PA 5DHYA 3IAGC 1NKRA 4WGWB 2VITB 4P46B 1PCSA 1OTTD 2H99A 1ILSA 3U1SH 5KS9F 1FFQA 4ERSL 1PJWA 3WHXA 2OL3A 2X4SB 1IEBB 2BH0A 1E28B 3R19A 1OM9A 8PAZA 2OS7A 1BBJA 2MRYA 4HGKC 1F42A 4NPYA 3GMOA 4JVUA 3WFHB 2JQZA 2VXVH 1TJXA 3SY0B 1PQZB 3CQQA 1YSOA 4XOCA 4L4VA 3EYUL 1QTYT 3WE6A 4ZSOE 5E56A 1BD2E 2XRAL 5C0IA 4IRSC 1NLBL 4Z3TA 2ZSVB 4XCCH 2UY6A 5B7DA 4R7DA 2AQ3A 3W15C 3RWGB 4LRNH 4PP1D 1RCYA 5AVUB 3FUDA 4P23B 5LN4A 3NQKA 5ES4B 4KYEA 4U1LA 1VE4A 1E5AA 5KSBE 3UACA 3PL6D 4GKSA 5I6NA 4YWGH 3H6AA 4OD3H 5MENA 2P44B 3Q43A 4OLYL 3ZHDA 4UIMB 2V3DA 1F58L 4NT6A 4EIGB 2F3DA 3KWUA 2MQGA 5EU6A 1CL7H 5DD0H 4OBSA 2KPWA 1A54A 1FJ1B 4O02A 2A74B 1XB3A 4WF7A 4G68C 2IOIA 4N4YB 4MA7H 2W88A 4OEVA 3DK0A 4NQXA 1AFVH 1ZIAA 3QCTH 4JM4L 1J0KA 1KXTA 5T1KB 3CN4A 3QG6A 1OMPA 4LIQH 3QR2A 4LPUA 4Z7OE 4POWA 4LEXL 1M05B 1NPUA 1R5WB 4MZIA 5E8EA 4KKZA 5J6HB 1Q94B 1YPZA 3W9DA 3IKCB 3WJJC 4B9KC 5I6XC 4NN3A 1IITA 2Q6WA 4X04A 3OSVA 2W0FA 3QZNA 3VXSB 1HXKA 1A14H 1TMQA 3RKPA 3MNDA 5AB9A 5DD6A 2E6QA 3P4NA 2IQAB 3THIA 5C8JB 1NDMB 3P77B 4QT5A 1MHCA 2VPOA 4HJ0C 2C7FA 5I16B 2R56L 3PWPE 3DHJA 2LLLA 3CZUB 1SLWA 1CXKA 4KTDH 1CLZH 1PZ3A 2X4UA 5LGKA 1JHTB 5ISZA 4NIKB 2CUIA 4LHUD 2ICEB 3GUFA 1MVUA 3F7QA 3W5NA 4APQC 1H45A 4JB7A 3BKML 1YEHH 2OMBA 2WQRA 4KPHH 4YAQB 1JPEA 2QELA 2WQWA 3NZ8B 4Z7NB 5GRYA 4Z7EA 1MDAA 4JFZL 5IIEB 3GFUA 1WHOA 3HB3C 1DBAH 4HUKB 5G55A 3W9EB 4D0BB 5I8CB 4M8QB 5IB5B 1NC2B 4N8CH 1INEL 4LNVA 5HI4C 2DQDL 4TQIA 5FHAL 5KS9A 2DQ6A 1XBRA 1TNNA 3NABL 4H8PA 1JXFA 3JZYA 3U46A 1UGKA 3BZEA 32C2B 5BV7B 5F3BA 2VLJE 4PJEB 3U0WL 3NTCL 2E5EA 2RFXA 3VFTB 4D0CA 3RZCD 3FVKA 4BE5A 2N7AA 2YJQA 3RIAK 2WINA 2NY6B 3GGWB 5LDZA 3QIWB 1G9EA 1LBXA 3LQMA 4R97C 4TVPH 1DVFD 4PBDA 1DVYA 5K9OB 3PUYE 5H8SA 1F90H 4WFGE 4L1SA 2PP8A 4A2MA 1DSYA 3EW3B 3S96A 3OJ2C 4G9DA 1L3WA 4H8HA 4P49A 1T5WA 4Q14A 4WEBH 2O5XH 2DYPD 3EF7A 4X6CB 5E6UB 1CG9B 1WDAA 3ZHNA 1JHKH 3KYOA 3RP1A 1U6AH 3OF6D 3QIUC 4IBZA 1PB7A 3HE6D 2NR6D 3ESOA 1HSBA 1TJHL 3ZQ9A 4DZ8A 5F97E 5IROC 3V6FA 4FJYA 4OZ4A 3PIQA 3GKWH 2VL5A 1T1WB 2BJIA 1IM3A 4XX1E 3KEIA 5E99L 4GMSH 1HCYA 2OBGA 4JCMA 3S5LG 2W65A 2QSTA 1KB5L 4HKBB 1NJ9B 1DZBA 1F4WH 1RK1A 2QPSA 3LV3B 4ZQTA 2LU7A 1GS6X 3QUZA 4H20L 1IBHA 3FCTA 4WV1C 3RWFA 4XTCQ 4BWUA 3TFLA 4EQ7A 2AQ1A 3HMXA 3VQ1C 4L8CA 3C6LA 4E9SA 2Q3AA 2ZXDA 4JMNA 2XXFA 1IC4H 4X1DA 2R1XB 1OGAE 5DD3L 1S9XA 3O6FC 2FL5A 2EUWA 1HAWA 1MCEA 3QDGB 1FYTB 1Z7NE 5I1JL 1CJYA 1QEWB 5GS2H 2HP4A 1IGJB 1QSEA 3CSBA 4YL9A 1VFOA 2EECA 3UBXI 3MLSH 4HBCH 3MRMB 1TTRA 5I0XA 5HY9A 4YSOA 3X3FH 3UEQA 3QIMA 3CC5A 3KHQA 2DQHH 1FIGL 4M00A 4OZFG 1N3WA 1UZ6E 2OW6A 3WO4C 4M93C 4MQ7B 2L7UA 5DFWH 4XAKD 3LIZH 1RK0A 3WL9B 2CHNA 2E7MA 1JDDA 5EV7A 3SBPA 4GBXB 3RJOA 4NKOA 4ZX6A 4LCYB 3MLWH 4YHKL 4ZUWA 3V52L 3LSFB 1JSYA 2JB6B 3QJQB 4AWJC 4K8RH 3UZEC 2CK0L 2IXQB 2YIHA 3CDFA 1AKPA 2IH3A 3FVNA 3QZWG 4C4KT 3FRPB 4ZE9A 1VCBC 3TCFA 3SHSA 4X48A 3QI9B 2PX1A 1JP4A 3KJ4B 15C8L 1NUZA 2E7LA 1U3HA 1RIHL 4FNQA 3SQRA 5C3TA 2HN7B 3PD8A 1A6UL 2V3EA 5I5MA 2G2PA 3X11A 3BP7A 1IZKA 3GIZL 1YYML 4FFYL 4W4NA 5IF0B 5A43C 1SD3A 2GHZA 1ZHLA 4XN4A 2MCAA 5JXAH 2ZAIA 2QKIA 1KLUB 3IFLL 2FX7H 4UYQA 4XNMB 5HDQH 2Z8FA 1CD1A 3R26A 3U0TA 3BT2L 1G7MA 1PTZA 5HHOE 3PG2A 2WLIB 4MJ4A 4X98A 3ROLA 4JRYE 1KCUL 4OJCA 1HKLH 1SGKA 4L8BB 5AOIA 5DMIH 3SJVB 3IGUA 3VXNA 1K9TA 4YXHL 2EXYC 4QOKB 3EFOB 4YPJA 2OCUA 1AZRA 3GIVB 4H67A 4ZUTA 2XXWA 4ZOCA 5DZOA 1F13A 2ZOWA 1NEZB 2JCCA 2IA4A 1CLOL 4LDLB 1A9EB 5D9SA 4E9WA 5HM4B 1JAEA 2NXYC 2A74C 4WDIB 4NAQA 4GW4B 3BWUC 1CICA 2AEQL 3E1F1 4GXUM 3BDYH 2ITDA 1SDXA 3F5WA 1JPGA 1V3LA 5BW7A 2WVUA 5AA2D 3O6IA 3KN7A 4WFHD 3ZDYF 1UKSA 3ZUCA 4BUQA 1IMAA 3QK0A 1LAXA 2D3JA 2ZXGA 2KERA 2FO8A 1S8DA 2AHIA 4R96A 3CIJA 4B3VA 1UM6L 4GAGL 3UTSA 3MLZL 3TZVB 1M7XA 4FZ8L 5ESYA 4ZUUB 4HWEH 3X14A 1B4LA 3WFCH 4PB0L 1QW8A 1OEZW 1NICA 4H2CA 3II3A 1DEEB 3FQXB 5AAMA 1Z2KA 1DQIA 4XRCB 1DFXA 4ES8A 1RZJC 3CG8A 3AY2A 4LE8A 4K7PY 4OZFH 4C54A 3LSWA 5DTFA 4G1EA 1AHWA 1L6PA 2XXHA 1H5BA 1NCDL 4LCWA 4BFGA 1BHGA 2B1AL 4J1UB 4QYOA 2HFGH 1S9KC 2P45B 4WI0A 4OJFL 3ZMNA 4YQXL 1MUJA 2D3NA 4M1CD 2O69A 3X1EA 1G4MA 3QFDB 1MCSA 4JJOA 2EDOA 4IDLA 2A0LC 4XWOD 3SDCA 1KPVA 1LD9A 3APMA 4QTIL 1NH6A 4LVEA 5IHUL 2A2QT 4P8QA 1YNTB 3TIDB 4NE4A 4JO4L 5CMCA 2OMYA 3RX9A 2BOCA 4YKIA 1ZPUA 2LVCA 2HRPL 5DWPA 3NSYA 5G5DB 3CHGA 1RSYA 4NOBA 2BERA 5IFAL 3EJRA 2DQMA 5F7FA 5HYSG 2OV0A 1KTLA 4NSKA 1QZNA 4WCYL 2WQXA 3FSAA 3JWOC 2P52A 1UD3A 3TC9A 3AREC 2FRGP 3L5WA 4R4BA 4ADGA 4AIZA 1LBBA 2XX8A 1Q9KB 1EO8L 3OPZL 1A6AB 1R1CA 5KVGE 3O8XB 4CVUA 3LHAA 3QIWC 1I1AA 2THIA 2VLJD 1S7YA 3L17A 1N12A 2YGVA 2ADYA 1JPFB 1L6XA 4JN2A 1GGCL 3OENA 1OCCB 4KDVA 4LXFA 5KANG 4PRPB 2X6AA 5FYLE 3QNYB 4I1NB 4LOUC 4NO2B 3KPOA 4KITB 4NJ9L 3UAJD 1F8TL 4MAGA 4WFGD 1L3NA 4PW4A 2W94A 4EOWH 2VRKA 2VO8A 2WBXA 4HIIA 4WEMB 2X4OA 4X5WA 3N44B 1W91A 3BLPX 4DXUA 4FI7A 1U8NA 1NV2A 2NZIA 4JZJC 1I6BA 1J0IA 3GMMA 4O9HL 1OQGA 3ARBA 4KNSA 1ZLWH 3TTRA 2CBMA 1GTFA 1KC5L 3TN0C 3L1GA 1PLGL 3ARQA 4HW6A 4CU8A 3MSTA 1CGXA 4RFEB 4BZ1H 2O5ZH 4HIEA 3N40P 3GS4A 1UTBA 3OL2A 3B5HA 3KDMA 4RAVB 4CDHA 4ETYA 4DIGA 4I4WA 3BESR 4LU5L 5D1ZB 2JB5H 3I6KB 2VZOA 4MMZC 2LW3A 4CU6A 2X70A 3R1GH 3HHMA 4HWNA 2X1PA 1G7QB 2PXYD 3KBZA 4KKCC 3REWB 1M71B 4LARL 3EPEA 4GRWB 4ZMNA 1D5IL 2C9QA 2ZCLH 1AQKL 4PRDB 4UINL 2ZXWB 2G0KA 5C7XH 1X6NA 1BJ8A 2E7CA 1U4EA 1FO0L 3OGCA 1OGAD 3FOLA 2ENQA 4U3SA 5JUEL 3WIIH 2BCMA 4OLVH 1JI2A 1JGDA 3QJTB 1CURA 2X2IA 4CRPA 3SGJA 5TK2A 5F7BA 5CKAA 5L9MA 3QUYC 4XEQA 1A6TB 4J27A 2X2YA 5KSUA 4QXVA 2DQIH 5BO0D 1YMME 3EYOA 2J7LA 4JG1H 5TE7L 3Q44A 3GJEA 3QUXB 5JHBA 4YBLB 1G87A 1Y07A 3MUZ1 1QUPA 2G93A 1YZ0A 2B59B 5IY5B 2GAZB 4MB3A 3QDMD 4NC0B 3O9WB 2ATPB 5AENA 4OMBA 1TIUA 3LSOA 4BHUA 3HI6L 1BW8A 2J5LC 2CIIB 5EBMA 1I53A 2HMID 2REGA 3STZA 3GPEA 4NO3B 2XIBA 2WO2B 4Q5TA 1J9SA 4JFEE 1SLVA 3S35X 5D7LE 4KVPA 4B6ZA 4MLSA 3BQUA 4MKMA 3B5GA 2BNRB 4G80B 3TCLA 5I71C 4KNUA 5IGAA 1GZPB 2OLDA 4HS6A 4OGXH 2VR6A 4KRNA 4ZPTA 1SJEB 5DJCB 3U30B 3NSDA 5TU0A 4LFHD 1CYWA 4LEOA 4QHLB 5DJ0B 3NH7L 4DTGL 5LLIC 1ELJA 4W9HC 1BFOB 1FNSH 2XWEA 2ZD0A 1KFAH 2IDTA 1IGTA 3FZVA 4MH5A 1G9MC 1WZLA 5FDWA 5JPMC 2ED7A 4O00A 3T0XA 2OR7A 2XFXA 5K39B 3P73A 4GAAA 4JRYD 4OUUB 4MMXC 3V0WL 4OTEA 1C1EL 4E2OA 1NCIA 2GK0B 4XE5B 3NVQA 3PJNA 3EOYG 3P9MB 3DGDA 4IOSD 5E5MA 5EIQA 2GUYA 4EI5C 1O64A 3UIFA 4OLWH 1W72L 1FP5A 2D8KA 2BSEA 4OJDH 3G9VA 1SNRA 4TLTA 1OAUH 3N0PB 4RLDA 4XPFL 3VFWB 4AEEA 2FX9L 2J44A 4BWTA 4ODWA 3MV9D 3TNNA 3FVGA 1A47A 1DQLL 3NEXA 4F9PC 1WH0A 2ATAA 2EIEA 1D9YA 1U3YA 2XWTA 4F8LA 2UVGA 1S7SB 4GSXA 1NCGA 3WEXB 3RDTB 3RL2B 3WE1A 3OAZK 4OEUA 4IGBB 3I84A 4NF5A 2DJUA 1CFVH 1M3IA 5E00B 1VADA 1VACB 4NYLA 5FHBL 2F6PA 3D18B 4FTVA 1ZTYA 2N1TE 2EEAA 2IDQA 4X7EC 1X5GA 4D9LH 3MBXL 1IC5L 2DQJL 2VLRA 2IV8A 3FU3A 4JVWA 4B0MB 3AFLA 4IHBA 1WVZA 4GMTH 2B39A 1PFCA 4U31A 2E6PA 1VIWA 2AC0A 3NFSL 4ZECA 5BRZD 3C2AL 1BBDL 5B8CA 2FBJL 2KLTA 5TF1L 1M5FA 4JJHA 1E4KC 1NNKA 4M43H 3FTYA 5CWSB 5F9JB 1GL4B 5DS8B 2F7BA 2NSXA 3CHRA 2IAMD 1JTPA 1BFSA 1BMGA 3MKKA 1HHKA 3CFQA 3SKUD 1WODA 4OIIL 3N41B 3FF8A 4NOFA 4QRAA 4QXUL 5H94B 2B7DT 1GMIA 4DO5A 5FTIA 4OZIE 4HJ1A 2H32H 2YXMA 4YMPA 5C97A 3JUZA 3L1EA 3IE9A 4ALAC 3WFEH 4R72A 3FU7A 1CGSH 5FYKE 4PRNA 1NGXA 3Q5TA 1O5PA 4LLWA 4YXKL 3UG4A 3D30A 3O2WL 3COOA 3H42H 1U91A 3IPFA 4QJ3B 5FEBA 1MQHA 3UTQB 3U65A 5CEXB 1UM4H 4LDOB 5AAWA 1NCOA 2O6DA 1DANU 2F34A 1MRFL 4OQOA 4PE5B 2WVSA 4LLUA 1K6QH 3KXFB 3PHSA 1UT1A 3SDYL 1GW6A 3KEHA 5JK4A 3GM0A 4XZ4A 5JDSB 1YNKH 3QNZA 4IO7A 4L4VE 4W1TA 5AALA 2ZNSA 3CFCH 5B1JC 2HHMA 1HN1A 1MHPH 2LLGA 4Y2DD 3SKNA 4AYFA 1WLHA 2FNBA 4ZDHB 2CCVA 5CLWA 2EEDA 2DLGA 5ELIA 3P3TA 4A63A 2BNQB 3K8KA 4TOZA 2V2XB 2VLME 2Y1ZA 3OG6B 4NRZA 3ZT5A 1G84A 1R3IH 4FLRA 5L6YH 3BUQA 5GGSA 4KK6C 3U25A 2EABA 4GWXA 4HMEA 3UYOD 1B9KA 5JW4R 1TQSA 3HAEG 5B22A 1KCRH 1KCWA 5MENE 3QEQD 5KW9L 1FZKB 4F22A 3B3IA 5GRVL 1J1OL 1T80A 2KZ1B 4XZUA 2XN9D 3QQ9C 4YHYC 1T3FB 1OW0A 5HJDA 4N8YA 3P30L 4F91B 2XWXA 1FPFA 1XCTB 3FRUA 2MOVA 5BZDB 1ETZB 3AXLA 4GWOA 3NCCB 3UADA 4GW1B 1U42A 4AUYA 5C0DA 1LO4H 2F54B 1A5FL 2R69A 4HS8H 2X0WA 3LKNB 4BCYA 4RQQB 4JE4B 3ECVA 3LDBC 2WMPA 1XGYH 4OGZA 4OVVA 1YEGH 4P11A 2B3RA 2XX7A 3J27A 5T8IA 1QEXA 1GGYA 5DRWB 1SPIA 5AB1A 3NCEB 2JKXA 3LSXA 3P0VH 1FGVH 1K8IA 3VU1A 2WK2A 4BA8A 1J0ZA 1LEIA 1H9VA 1CFNA 1NMUA 1NCCL 5CZXD 1NH8A 1DN0B 3AS2A 2WTOA 4RVBA 1P7KB 2BP0A 3H4HA 3T2NL 2ZKYA 5D2LB 1JD7A 3OMZA 1BXUA 4E0RA 3VI3E 3C36A 4YHPB 1FFOA 4MDIB 1JMZA 5GGSY 4WWOA 5EN3A 2R1WB 1GMEA 4RFNC 4RMBA 3JYCA 3UEZA 3K1MA 1NGWA 3UZVB 4KROC 4TS6A 4ZG1A 4YB6A 1UZGA 4PR5A 1I8MB 1ONQA 3EYFB 1R3LA 1BEYH 3PPSA 4KTYA 1JRHL 3CLEL 4AQ1C 5KS9E 1TSRA 4PJ5B 1QG3A 3V9FA 1MZYA 1ZWIB 3QH3A 3VFOB 4POXA 1FUNA 3BAWA 4MJ2A 1YRKA 1WTGT 3IF1A 2ZKXA 2FGWL 3D69A 4YPGA 1FQBA 5F88B 1DVZA 1RURL 2CHXA 3OZ9L 3ATBA 2YD3A 3K2MC 3L3GB 5JPNB 4BQ6A 2NUTA 1B2YA 1MPAH 1X5MA 3MWBA 3O3BA 3R0MA 4EDXB 1AYOA 4OF0A 4P5TC 1L9OA 4HT1H 5KJ7E 3BFTA 4Y19D 4IEFA 1O63A 5H8NB 1JVOA 3G5XA 2E4TA 2ADFH 3HAEH 3LKPB 4V1DB 5AQ0A 2HLFD 2YJPA 1IX2A 2CDFA 2W91A 5GGRB 3TTKA 1NCUA 2NX5A 3RI5K 4PJCB 4HE0A 1L7IH 3ZO9A 1PZBA 4KU1A 1I3RA 2DVZA 1NIEA 4IIQB 2XVKA 3V0FA 2LU3A 1RULH 1E4XH 2YBRA 4PETA 3ME0A 4PGJA 5FXCH 3U72A 1CE6B 2OYKA 4A2LA 2VDNL 1HC1A 1LO3H 2AV1B 5DSCB 1LK2B 1UD8A 2PN5A 3QO0A 5E9DA 5B7EA 3IDXH 1T89C 4IRZA 4BH8A 1N26A 4HD5A 2DQTL 4AE1A 1SFHA 3K6NA 2X40A 5IR1B 1MY5A 4BK4A 1TLKA 2QVIA 4P1LA 4YDKL 2BIMA 4QCIB 4ZTOL 2H1LM 3ZL4H 1NL5A 4QXGL 3MV8D 4U3HA 4ZOEA 5JW4N 4PFRA 1OAKL 2WWKO 5H8HA 4J2QA 1KLGB 5A6IA 4BK8A 1I7RB 1WIUA 4IMKA 3T4AA 1NV6A 3PAZA 4O4YH 2NTFA 2ZYSA 1UA7A 3BEWB 4PS4H 1SMOA 4EIBA 1F3JB 3WLWC 1ET5A 4G43A 4HFWB 1QLEL 2Y7OA 1NAMB 5J5EA 2AJYL 5E5LA 1EXUB 2NRDA 4MD5A 1XI6A 2OMUB 2A9BA 1IAKA 4NQVB 3HZVB 1QQDA 3VUAA 1ITCA 1Z0MA 1VJSA 3DJSA 3CQPA 3NFPB 4A68A 2BRRL 4AW7A 4HE2A 5TDOA 4KFZC 5FF6B 1KJVA 2PCFA 1BXAA 3SDDC 3SYCA 3PRZA 5KSVA 3FTWA 3QULB 1DQKA 5DZLA 3CDYA 1NGZA 5CAYB 4NX1A 2P7TA 1YEFH 5J3HD 3NSXA 2IQ9H 3MACH 1FNEA 4G8MA 1FBGA 5ITBH 4JANB 4JFFA 2P5WB 1W8OA 4OLEA 1MNUL 1CXEA 2C1OA 1ADQL 3N43B 5BCAA 4F2QA 4N1CA 4J3SA 4PJXF 2DOCA 4K07A 4L4VD 2VOZA 5JR1H 2ALAA 2UYLA 1G4RA 4KXCA 3N3EA 4PU2A 3BO8A 1Y6KR 5JIHA 1YQVL 3UDWA 3ZDWA 3EO0B 1OALA 2YMTA 1WAAF 4OZGB 2EILB 5DMJB 3GSQA 2AEPL 4NP4H 4X9IA 4NAMA 3HPLB 2X42A 1NV7A 4ATWA 2H26B 3KDPB 1KTRL 1LWJA 3GBEA 4L1TA 2UXFA 4EUPA 5KYXB 1AXTL 1PB9A 1UQSB 2HKHL 3QAQA 4WUUA 2HPTA 4FQXB 4UT6H 2V9RA 3TYGL 4ZUSA 5IBLC 1RZFH 1ZSDA 3GRWA 3K6XA 1OM3H 5EU6D 5I2NA 1W8NA 4KZEH 2XXQA 2Z8WC 3OKMA 5ANHA 5DZAA 3GNMH 1BX2B 1IAIM 2FLRT 2VD3A 1INDL 3O6LL 3NG5A 4XNYH 1QASA 2PCXA 5EOCJ 5AW9B 4DGIL 4ORGA 4QFOA 3MCKB 4GUOA 3QFJE 4A6YL 1JZDC 1UD4A 4OI7A 1I69A 3I3BA 4G5AA 4JFPB 4X4XB 1QO3A 1ZT4A 1E3ZA 3DGGA 4AK1A 3FO0L 3R7XA 4OF6A 1IXGA 4HXAL 4LCWE 4MXWL 5MHSE 3C5SB 1IBZA 2AGJL 2CDEA 2W60B 4XF5A 1KN4H 4PW3A 2VDQB 4RGNB 1UJ3B 1WZ1H 4R84A 3O2DA 3MNWA 4HJTA 1G94A 5D6DA 2BXZA 3FMGH 3PWVA 5BV7L 1E8YA 1DJWA 4BKTC 2X3AA 1ED3A 2J6EA 3IJ8A 3BVNA 3R18A 3L1OH 4UAOC 4DKFL 1SDAB 4RXLA 1M4KA 5ISZD 3SGKC 1A8EA 1BZDA 4NFCA 1EZVX 3T9UA 3O3EB 1FNGB 2H3KA 1Z7JA 2W07B 3MLTA 5LAXA 3CK0H 1SW5A 5K1JA 4JHBA 3TA3A 5ITFB 5KVFE 2DWXA 4B9CA 1OTTC 3V5HB 1NC4B 3KPMB 4I8CA 4OZHB 2EXSA 3WNJA 1YEJH 4OFJA 3RVWD 2ZOTA 1ZU0A 3GXNA 1CB4A 2DM7A 2FIKA 4DJMA 3HFMH 4H8JA 2WLLA 2AZUA 3Q2LA 2CJSA 2DOJA 1NV4A 4FXGB 3VWJB 3TODA 1ZE3C 2EDKA 1JTTA 2EDTA 2V7NB 3HC4L 3OX8A 3QR0A 4JZNA 2FJGA 4M5YH 1F1DA 1T7VA 1U8IA 2BVUA 1MCBA 1XGUB 5ID0A 1VZIA 3T93B 5D2NC 4P2QE 3T8XB 4KI1A 1O6VA 2H3NA 4F2FA 1DO6A 5IUSA 1A4JA 4PJXA 1RSFA 1E27B 4BWWA 5BS0D 4NIYE 2V3TA 1XSKA 1D5RA 3MQIA 4A7SA 1PLBA 5IJKA 2NY5C 1XO8A 4PP1C 4M1DL 4I88A 1XVXA 1WAAA 4ZSOB 3MVXA 1CFTB 1FTOA 2M2DA 1BD2B 5ABDE 2L3BA 4G6JH 3PL6C 5LG6A 5FV2A 3B2UD 4G6FB 2XN0A 2OSXA 4U6HB 4YHLL 3C9NA 4Y5VB 2OR9H 3BYTA 4U0RB 2DXYA 3L16A 2A99A 3PNWB 2DI8A 3QNFA 3QO1B 4MNQA 4UUJA 2X4PA 1W16A 3GSUA 4WHDA 1TZGL 1IM3D 5KSBB 1F56A 3ZDYE 2XG5B 4NZUL 4MNHA 3D0VB 3DJ9A 2YARA 5AA2B 3POHA 4P2AA 4XNUL 3RIAF 1VCAA 1K8DB 2EVHA 3UBXB 5DFTA 3EQ1A 5ICUA 3O45B 3B7UX 4ORZC 5JQIB 4DP8X 3M88A 4M4PA 1F11B 3SKJL 1TU2A 2A4CA 5FKPB 5CEZD 2WUBH 3C6LD 3DBSA 4NO0A 3CSYB 3GK8H 3MR9A 2A6KA 4NDMB 1TTGA 3U7YL 3W0WD 2XKNA 2E1SA 4GOTA 2PWHA 4XOBA 3LD8C 4OM0L 3D39A 1FFPA 4Z7OB 3PHQA 1QSED 2OTUB 5GGVL 2ONKE 1B40A 4Y5XA 3FO9A 3E3QC 5AVQB 1B05A 4YFLI 1I4FB 3M1CA 4UT9A 3WS3A 1JNFA 2B14A 3GHBL 1AVAA 3FV1A 4KCCA 5I76A 3D2UB 3WIHL 2FWLB 3M1OA 4O02L 2BRQA 4D7BA 2G9HB 1EH3A 1HJCA 1B2WH 2P8MB 3I9AA 3VNYA 3AMLA 4LVOC 1QBML 3LNDA 4TLUA 3X2QB 1ORQB 4LDEB 4F7MA 3PWPB 3OQRA 3EXLA 5EZJB 3UTZB 1WWWX 2HUEA 4EF1A 1IARB 2WBWB 3DHMA 4IJ3B 2K6WA 4PF8A 3PGCA 3MPKA 2GTZB 4XNZC 1E4JA 1ZHKB 2RCSH 1YHPA 4OU3A 1HL8A 3S48A 1O6SA 5JIIA 3T0VA 3CSFA 5FGBC 5KBDA 2PF6A 5F0MB 4DQOL 4MX7B 2Y1AA 3GUTB 1YCSA 2CKBH 4QXTA 1YJDC 2AITA 3UTPD 2YD2A 1U3HD 1PEWA 1QRNA 2YR3A 3RZCC 3VU2A 2A6JA 2VKWA 5JW3L 4GSQA 5LJYH 3KW8A 2R0LL 2ZAHA 3ULUF 3KOTA 3CIAA 5CUSL 5E7FA 2JKWA 2QHRL 3JTTA 4J8RB 4X99B 4BFRA 2Q76B 5DO8A 3TS8A 1DVFC 4HUUB 3LQAC 1XS5A 3HE7D 3FJTA 4C4UA 1FPKA 2DSFA 4Z7IA 1M7DA 4D9QE 1EMTL 4N24A 4R2GB 4LKXB 3FPYA 2CKNA 2WP3O 1N5AA 2BZDA 2YK1L 4PGZA 3HE6C 2NR6C 4AM0A 4OFDA 4ZFFA 2FIXA 4N68A 2Z23A 4KUCD 1RUPH 1AD0A 4FQ1L 4PP2A 5ICYA 4F1YA 3FXIC 1ZS8B 4X0KB 1RZ8B 3RIFK 1W8EA 1E2VA 3UORA 3L8QA 2I32A 4PGNA 2AI0L 4POUB 3O4OB 1NLBH 4P99A 5DJXA 3RG1C 4PVBA 4Q8RA 4QHUA 1CICD 1ZVNA 4H2AA 2Q9TA 2Y1YA 1TO5A 3R0NA 3V4UH 4F3FA 3BOVA 2ORBL 3CFEB 1DDHB 4IHOB 5IK3A 2ENSA 4JB9H 3N6UA 4F3PA 3VX0A 2AXGB 4FTVE 5EEWA 3JWNC 2F8IA 3UTSD 4D3CL 1QVSA 4PIRF 4TUOA 3C5JA 3GXMA 2WGNB 4LESA 4PDDA 2VLRE 5I56B 3KYNB 3DO3A 4JRXA 3HC2A 1PYWB 5C0CA 1QOKA 1Z66A 4QHMA 3LV0A 2EDWA 2VZ3A 1NIBA 25C8L 3BEVA 1NCHA 2ZG3A 3LZPA 4JFYA 1OGSA 4DAGL 4MJJA 4MD4A 3WFZA 2VN5A 4HHWA 4KZCA 5CSGA 3MRDA 1IQDB 1NKOA 3MAMA 1FZOB 1YDPB 3V4VA 3LN5A 3OHXB 1FRGL 2HT4D 5C86A 1EVTC 1TKWA 4QKXB 4F9LC 1P5UB 1EEZA 2ZPKH 2Z8SA 3AG3B 3UAEA 2R29A 3SDCD 5SWZE 1FVCB 3I9GL 3AGWA 5DQJB 4FDWA 1QD0A 3MRJA 3HG4A 4LQ2A 5SV3A 4XBPA 5CEZL 2GJJA 1K2DA 4GAJL 1CGYA 5FECB 3SCMD 1N67A 2PVUA 3CFJB 1J8HE 2Q2CA 1Q9OB 1FSKC 1BSIA 1GVIA 3QQ3A 4N9GA 4PEEA 2JJTA 2R56H 3OEMA 1FPTL 1TPXC 4HW8A 4FXGC 1D3CA 1L9QA 4G8FB 1OT1A 4Z78A 3ARDA 4UBDD 4BE6A 4ZX5A 3C5ZA 4TUUA 1KCSH 3IJ9A 1QR1B 3BAYA 2ZWKA 1ZEAL 2D4FA 4AX3A 1Y9UA 2P3VA 3FQ4A 4JY5L 4QY8B 5D7JD 3N06B 4BFOA 5C2BL 5DJDB 5FX3A 4AQZA 4NKMA 3KCWA 4FMFA 3VXPA 4MD0A 1MH4A 4WWID 1AMYA 5FHAH 4NGHL 1MIEL 4X4YB 4DKEH 3NABH 3S98A 4JXIA 4NN6C 3C2SA 3ZDXF 2OCFD 3I3EA 4HISA 5LOMA 3OO7A 3FJ7A 4NMYA 1E7UA 7FABL 4PMEA 3BWAA 4DVBA 4LF3B 1MIML 3MBWA 2X1WL 2NY0D 3BPNB 2VR8A 3BMVA 5CJQH 5TDPA 1P6FA 1WITA 5HHOB 2ZF9A 3PFQA 4Y8AA 4NQCA 2NY1B 2E0PA 4NF4A 3D52A 3ARBD 3X1GA 3PQYD 5CP3H 4W70A 3S5YA 2F53E 1CIDA 1L0QA 3PWJB 5I6MA 3L5HA 4XVTL 3L13A 5DRNA 1IM9B 2YPLE 3MTRA 5LBVA 1Q0EA 3U6XA 1WS8A 1QATA 3ULSA 3IFOB 1AOHA 4JGJA 5FGSA 3DPBB 1IKOP 3WNKA 4NENB 4Q74A 3SOBH 5IKCB 3KSXA 4TLSA 2YHGA 1EGJA 2FAUA 3B9KD 2DLHA 4NWTL 1E9QB 4LZ8A 2L7JA 1E30A 3VFUB 5F9WC 3AADB 5D7IB 1R24A 1WF5A 4BDQA 2BOBA 1KB5H 5IVOA 4GSDL 5CGTA 3IGKA 3PDOA 4WO4B 3T0EA 1JGIA 1G7LA 1WS7A 2L7EA 5F0JB 4L1DA 1AR2A 1ICTA 3OV6A 4PWHA 2NVUB 3P0YH 1UENA 4AVIA 5HHNA 3BPCB 4M1CC 3OLDA 1WC7A 5EOCL 4FORA 1FV1B 3ZDZE 4XMLL 4MNCA 4XWOC 3WXVL 1MW2A 5DD1H 4MMYA 4G2ZA 1MCFA 3VXRA 1AS8A 4PBWD 3Q3GA 1MWAH 1AE6H 5CBSA 4AKOA 3QPXL 3TWCH 1I8KA 1B3IA 2BVPA 5DVMA 2AF2A 3WY3A 1J11A 1T03H 3B6TA 1M5EA 1IKFL 4KR5A 1ORSB 1AG0A 1HHHA 5CMKA 2GI7A 1N70A 2ZUUA 3D8MA 4OQTH 1T4KA 3U48A 1OSZA 1FH5H 5ET5A 1UM5L 4YHKH 1QNIA 4C1TA 1JMXA 1WBZA 4XNBA 4ZW7A 3P4OB 1Q9LA 4KQ3L 4YUEL 4F7PB 3ISRA 5K59F 2C3XA 3JVFC 2VSKB 1RJLB 4TRPH 5JOPD 2DRUA 4DGVL 1X5KA 5HVFB 1DFBH 4JGMA 1DCLA 1TJIL 3NK3A 4IQHA 4W6YB 1CD0A 3V55A 4HTGA 3QNXA 3UAJC 3ULVD 2OA9A 3LTVA 1QUJA 1RIHH 1M57B 3PNRB 5GRWA 1AS6A 4L8SA 1BDYA 1EANA 2WCSA 3WSQL 1I85A 1O9WA 3GIZH 4FFYH 2ZUVA 3O4OC 2FEEI 2XV2A 3I3VA 3VFJA 3IFLH 2X4RA 3BQVA 4FQ2H 4PRAA 2RF1A 1OPOA 5TTRA 4NKIL 2Z31A 4AMXA 4QRFA 1O5DT 2BSED 4K3GA 1N04A 3DLNA 5DVJA 4PJ8B 3DUSB 4L5FL 2BZCA 3F12B 3OMNB 1MFNA 4JHWH 1ZMYA 5IOKA 1I3VA 4KMLB 2IALA 4YXHH 3BKCH 1I7ZA 3D3VE 3BGFB 3MA7A 3KCPB 4JDTL 3SDAB 1KN2L 5IESH 2P1SA 2DJMA 1D9KB 2P24B 4ZBJA 4H26A 2JKSA 1OCZB 2CD0A 4DFHA 1KJ3L 1CLOH 3VGAC 3AC0A 4F57L 4I62A 2G60L 2AEQH 1E67A 5HYJD 5AUMB 3ECBA 1H8SA 4XPHL 5D93C 3BKYH 3KS0J 4LSUL 1I7UB 1WISA 3E4RA 4MJOA 3GJFH 5HYQB 2QL3A 2WX9A 1JZ6A 2P8LB 4TOYL 3NCYP 3FFCA 5F44A 1JP5A 3BVVA 2AZAA 2ICES 1UM6H 2HKFL 4GAGH 3BVWA 3V2AR 1L9NA 1KDJA 1KSRA 2EDLA 4WGKA 1X5YA 1RFDL 4FZ8H 4XB3A 5C0JB 1O6TA 1SOSA 5D70H 4V33A 4JVIA 1P4IL 5AYUL 3OM3B 4N6RA 4I13B 3V9EA 4OLZL 5C9KA 5CILH 4I9WE 3HZMB 5EEZA 4P4RB 4PJDF 4N2GA 3QSLA 4B7LA 3FT3B 2C9XA 3PREA 2ZMBA 3LKOB 5GSRB 3C5XA 2Q86A 5EIIG 5KVEE 2FLMA 1CVRA 4U6VH 1VFAB 3TCXA 4ZS9A 1AXIB 1WCBA 2B1AH 1U9KA 1YMMB 4NWUH 4YQXH 1X3DA 5CU9A 3QJOA 5A16B 5IJCC 1QHQA 2X6CA 3PAVA 4NC1E 4JUSA 5F89B 2HMIC 1EDQA 4MA3A 1KCBA 4ZYKB 2P1YA 4G8IB 3QEHB 4JO4H 4G83A 1MH5A 2X87A 1MDTA 5CLZA 5MEPA 3HR5B 2A73A 2PYFA 4YHIB 2E47A 1IMBA 2WNGA 4QRPA 4O2FA 4ZFZA 5EWIH 3GXDA 5C0AE 5C0ND 5DYHA 4OFKA 3B83A 2PCPA 3HOGA 5C0BA 3RB5A 4KNTA 4N90D 4JFEB 1UURA 5DO2D 2AJUL 5I59B 5D7LB 2ICWA 4B41A 4YU0A 3GSRB 3CZSA 3S4SG 5LN8A 1P6AB 3OPZH 2WVVA 3FSWA 3T65B 4BGLA 4ZMAT 8FABB 3BPNC 2WBJA 4WFED 2D0HA 4N0UB 3TVMA 2EH8H 2QDVA 4Q0XL 1GGCH 4XAWL 2LAOA 3OR6B 3OAYH 3C8KB 3OMAB 2MQ0A 4L3ED 4XXWA 1BZ7A 2BK8A 4IIZA 1LLSA 2YLKA 1F00I 4HZLA 1COBA 3DX4A 4JFHE 2FYYA 1EWHA 1DQQB 1OE1A 3CLWA 3KW7A 4NJ9H 4YN3A 4Z8FL 1GZHC 3TTLA 5DVPA 1JS4A 1F8TH 1NOAA 1AZBA 5C09E 4XGZA 4PLNC 2VDPL 1G7PB 4G7SB 2FEJA 5CN3A 1DJHA 3E2HB 3NJFA 4HFUH 2AERT 2O6AA 4LZ7A 4XCYA 5TFSL 2EZ0D 2VIRB 2WB7A 3UH8A 1QI5A 4B0MM 3GMNA 3DTXA 3ULVL 3WIFB 3GLEA 2E59A 3K7UA 2FO4B 1CZ8H 1U2CA 1A64A 1PSKH 5GJTL 4B50A 3GSNB 3GBNH 1HE7A 4ONGL 3PWNA 3TYHA 1V54B 1EFXB 1BYPA 3LKQB 3MRKB 3UC0L 1GGTA 2VLLA 4LU5H 4J3OD 4EKJA 3TU6A 5J12B 3T9XB 1O0VA 1KG0B 4F2MA 4XKQA 4NI6A 3UJTL 2IAMC 1W9XA 4Q52A 1AQKH 3K71B 2G5BB 4KJYA 1B3FA 3IO6A 3ZZLA 4YE4H 2HFEA 4OAWA 3NA4A 1HKFA 3P11L 3H9SA 2J5WA 2YJLA 1J5OL 1XVYA 1FO0H 4BZ2L 5JUEH 2NYYD 3ZE1F 1GGIH 4PRBA 3U2JA 1FG9C 2DBJA 3DX9A 5FDYA 3UYPB 4M6OH 1Y0LA 2ILLA 5E70A 1S7UA 4OHNA 5KTEH 4OF3A 1OF0A 2SEBB 2GT9B 2IBGA 3JSSA 2O1AA 4LN5A 5J9PB 1I82A 3DSNA 3IJEA 4XP4L 5EHFA 3VI4A 1QUNA 1FZJB 4OZIB 5EQAA 2FUQA 2NOYA 5TE7H 4DSYA 1FAIL 2FIRT 3WHXB 2D3IA 2OL3B 1QFWL 1SDDA 1XFPA 4F80A 4Y4KB 1H3DA 1BBJB 2MMXA 3DMMA 1PG7L 3GXUB 3X17A 1ET7A 4PJXE 4XHJD 1NOFA 3GMOB 4QLWA 2HYMA 1UD5A 3KPQA 2X6UA 3PE9A 3FN3A 4J23A 2ESVA 4TSCH 3TTSA 1L7TL 3WE6B 1WAAE 2UXVA 3RU8H 4I18C 3GMRB 2IPUG 3BT0A 3UIYA 4OVTA 5FYKU 3QFGA 4DO6A 4NRXB 2JWYA 2NX5D 3HVDA 3AM8C 4XB7A 4H13C 1BV8A 4EAEA 3OHMB 2BM3A 3QJHB 1RUKL 2ZOUA 3MV11 4U1LB 4ZO7A 1I7TB 3OD3A 4AV0A 3W37A 4M7KH 2YA0A 2Z0UA 3B2VL 4PG9A 5B1CA 2Z8VC 3NSFA 5MENB 5E4EB 2YBGA 3NFNB 2AQSA 4K9EL 2YPKA 1DBZA 4NT6B 3M7OA 5J11C 4I77H 3STLB 4QHNB 3DOHA 2NYKA 2V3FA 4AH2B 1P84K 2JK5B 4M7LL 5HP5A 2EC8A 1OF2B 3V0WH 1RUAL 1QBBA 3ISPA 3WYRA 1C1EH 2X4NB 5E9DD 1WQVT 5GIRA 5EUOF 4AZ8B 3HUJB 1NAML 1W72H 4NQXB 2BX5A 4XXCA 2XXYA 5CD3B 1G7JB 4S1RL 5E8EB 5ESAB 5D72L 3DVGA 1DL7H 5GRZA 2AQPA 3RI5F 1I8LA 2OSLB 4F3SA 2Q6WB 3NJJA 1NINA 1FSAA 1XF3A 2W0FB 4MHHG 2G2RB 2XJKA 4QF9A 2B5IC 4YLQT 1KGWA 1I8IA 2ALWA 5EC1B 3CFKB 5FHBH 3HBZA 5IAIA 1NDTA 1NEUA 2ROYA 3AAZA 2JJKA 1UKTA 4QT5B 1LMIA 2Y7LA 1BQ5A 3MBXH 4Y2LA 1IC5H 1T20B 2UXGA 3I6GB 1F3DH 4P5KA 3GB7A 2WANA 3UL4A 4MB4A 2NT1A 4NCC2 4PHXA 4Q89A 2P42B 4CSTA 5T1LA 2XXVA 3MYUA 3VI3B 3U36A 2Y25A 4JY4B 3T0WA 1DO5A 1BOYA 4NFDA 2XZAL 4XVSL 3KPSA 2FBJH 5EU4B 3S5LA 3ECRA 3OSKA 3CN2A 3W1ZA 2XXUA 1HOCA 3CFXA 1E3FA 4PFEA 5GS1A 3ROOA 4ZMPA 2PTTA 2X3CA 3WELA 4S0SD 3ZK0A 4EQ9A 3P7IA 2CSPA 2YA1A 1NH7A 5KS9B 3K6IA 4C47A 4E41A 3PYCA 1XCXA 1ROWA 1J5IA 3BZEB 4YK4C 2IPTL 2KZWA 2VT0A 3UG5A 2ZOKB 1ND0B 3L48A 3FN0L 4HQQL 4NS0A 4HPHA 4Z23A 4JFFD 3MTXA 1M3JA 1SUHA 4MWFB 4OD1H 3FQUA 1F86A 2P8PB 2RFXB 1F02I 1JHLL 2DLEA 2VDRB 1HXYB 3KR3L 4Z76B 3X13B 5KYYA 1ZS2A 5EO9A 2DH3A 1E9OA 3JWDH 3SBRA 2MNWA 3T9HB 4LO9A 2EDBA 2HLFC 4OZFA 4PRHA 5FYJH 1H15B 5E2VL 4QRUB 5MI0B 2QVVA 3SDYH 3QA3A 5AB0A 3IAPA 4HXBL 4ELPA 1MI5D 4IRSA 3F7LA 2HUHA 1P4LA 4PS8A 4HPYH 4ICXA 4UV7H 4IB2A 4OKVB 2HLAA 1KYUA 3GYRA 3S88H 2AYSA 4O3BA 3SBWA 4H4NA 1X7QA 2WWKT 4WUUD 5F21B 1MY0A 2J57A 1TYRA 3HNSH 5J4MA 3FB5A 3V6FB 5F93C 3A3CA 3TO4D 3ALXA 3QZWA 4UQ2B 4JFHD 4PGCA 3UO1H 3V95A 1P7HL 2I58A 3ECWA 4LLDB 2CU9A 2W65B 3FBKA 2BZ7A 4LSRL 3Q2NA 4X4ZA 4H8WC 4EQBA 2EXTA 4DP4X 4JRXE 4G68A 2BO0A 5EUOA 3UGWA 3VJ6A 2ENPA 3PAYA 3QUZB 5H35B 2ARJQ 3FCTB 4C56D 2CHDA 5DC9B 1B3HA 2V3QA 3BKIB 3H85A 4UM9B 3RY3A 1Q0XL 3PU7A 1TVHA 1M5BA 2ADIB 5EZLA 1BZEA 3O3AB 4P2OA 2DS9A 2MFNA 4RMRA 1WICA 3S9DB 4TV3A 4GQ9L 1SEQL 3IMSA 2NDGA 2PYEE 3WJJA 4XX5A 3MCYA 2O1LA 1QLRA 3D85B 1HHIB 3WEBA 1BQLH 3Q2CA 2I07B 4G7YL 3VXCA 4ZE8A 2B1OA 3SQBB 3ATFA 3UC2A 3GO1H 1B32A 1ASQA 1JXJA 2R1YB 2XD2A 4M9OA 4JR9L 1KEMH 1JWMB 3N85L 2H2PD 1NEPA 1RMFL 2ADGB 2E74C 1UWXH 3O0RL 5E8NA 3SDFA 4K73A 3F2LA 3RWJA 3SPHA 5C08A 4N0CD 2WXLA 1T5XA 3M8UA 4N15A 5GGTL 3U9PH 2YAQA 3NCMA 4IRZL 2ZXAA 4NN5C 4Z3FA 3FT2A 3P9LB 3VYNA 1M1SA 5F9OL 1PGRB 1WHPA 1U8QB 1U93A 4YSPA 1R4XA 3T2NH 5ACZA 4UB0L 4DGUA 2ZX6A 4ZUWB 2JXMB 1KCVH 1UXWA 3L9BA 4BZ1A 1MDQA 3UBGA 3NA9H 1I1FB 1A21A 4HK0A 4DXBA 3MV7A 2FATL 2J8UA 1EZVY 3F7KA 3VVVA 1AC6A 4KYDA 4R0LB 3N42F 5J3HC 3IAQA 5HPMA 2OMZA 4PW9A 5D71H 1IQWL 1WUZA 3BSZL 2V37A 1X4ZA 2APXA 2HWZL 3G6AA 3TONA 2QADB 3ULUE 1FBEA 2I69A 3PPEA 4KRPD 4KK5D 4RETB 5I8KL 2YRZA 1OQOA 1UACL 1Q35A 4IOFD 4WW2F 4S1DD 3X11B 3BP7B 3TTMA 3K80A 1TEFA 4UABA 4DGYH 2EYSB 2P5PA 4U1KB 4HD9A 4O5LL 2LU4A 1Z9MA 2AVFA 4PWEA 1RURH 1BF5A 1CD1B 4ONOA 1N0LB 2XWIA 3IRPX 1MRCL 4IW4C 4KNQA 3O3DA 3VXTB 1DANT 3ESMA 2YMOA 1QI4A 4PN6A 3VXNB 1WTLA 5E4EC 2UVIA 2CLVA 4I3SL 3G7TA 4IO3A 2GUOA 2BP8A 4OA4A 4MNQD 3DTDA 2GFBA 5ETUB 5HYSA 3BWUF 1IBDA 1RIVH 4JN1H 2ITDB 3C12A 3GMQB 3LOWA 2LE9A 2A3TA 1UXSB 2AXJA 1CS6A 1IAIH 3QJVB 1SYSB 2CXGA 1H8NA 2G75A 2OJEB 3WLBA 3HG2A 2YQBA 4HDIB 1T21A 4LDCA 3MFFB 1HXMB 4I7ZC 4NO0D 4K3EH 3VQ2C 4R4ND 1A6WH 5FO7A 4I85A 1SXZA 2VDNH 5LBGA 3X14B 5MEQA 4ZMOA 5C7ZA 4R7XA 1JZEA 1AI1L 3D39D 1EEUA 3IXTA 3QFJB 4K3DL 4AGQA 4NM4L 3WUWB 4LQFH 4ELQA 4UZGA 3IX1A 4KGJA 4FAJA 4G1EB 1AHWB 1H3WM 5IUCA 1H5BB 2Z4QB 4LCWB 4XPTH 5CJXA 1B5HA 1CK0H 3FW6A