3D4NA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with sulfonamide inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
261
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel, Potent Benzamide Inhibitors of 11beta-Hydroxysteroid Dehydrogenase Type 1 (11beta-HSD1) Exhibiting Oral Activity in an Enzyme Inhibition ex Vivo Model
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 100
structure length 261
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3d4nA00
3WBFA 1ONNA 1RYDA 3VVCA 2BI7A 4LISA 3VOSA 5A03A 2AQ8A 3ZGYA 4IGEA 1WMBA 1DOHA 1P45A 4J1NA 3S2EA 3CE6A 4MP3A 2FPIA 5ENVA 3HZZA 4B7CA 3UFXA 1K6JA 4CQMA 1C1XA 3NAQA 1M2WA 3FI9A 3OIFA 1FDWA 1I0ZA 3DMYA 1P77A 3PHGA 1IPEA 1GQYA 3ETDA 1YS4A 1A7KA 2YW9A 1SOWA 2JJYA 3S1LA 4CMCA 2AEJA 3F47A 3BMQA 4JBGA 3DBRA 3GDFA 3EVTA 3FNGA 4BUCA 3L9WA 1XSEA 3AWDA 3JQAA 3ZU4A 4J16A 1SCUA 4O0LA 4W7IA 1DBVO 1DB3A 2GO1A 4Q3NA 4LVUA 1O8CA 5CFZA 1R4NB 2YYYA 3BMOA 2J8ZA 4YAKA 3DBRB 4KDFA 5G4LA 1I33A 2Y05A 3IJPA 3SC6A 4TVOA 4RPJA 3EZLA 4BV9A 3NT4A 1ENPA 4DPKA 1TXGA 3ROKA 3GH3A 4ESOA 1R12A 5IZCC 4WLEA 1LDBA 2WYUA 3BIOA 3D64A 3DZBA 4BO8A 4M8SA 5A9SA 1N7GA 3ICPA 5KIAA 3TN7A 1Z74A 2IE0A 1PJ2A 1JA9A 4JJIA 1JTVA 3TZ6A 3Q1LA 3UKOA 1DJQA 3U4DA 2HU2A 4YT4A 2YFHA 2VHXA 3D3EA 5JXWA 2C7GA 4F6CA 2QRLA 4BVAA 4RLHA 2TMDA 2DT5A 1T25A 2PH3A 1P1RA 4PLVA 4ONEA 2ET6A 3RUDA 2GZ2A 2EERA 4MVJA 3ZZNA 3U4CA 4B4WA 5CDSA 3RC2A 4E6PA 2HAEA 2ZCVA 2WEKA 2JL1A 2O3RA 5TT0A 2YFQA 2ZYAA 3RUFA 4IQGA 4XDZA 2OZPA 4XGIA 4IM7A 4IIUA 2NTNA 1JDJA 2QG4A 2C20A 1PGJA 2X58A 3PFFA 4CM7A 1CWUA 5HS6A 1SEPA 4N7RA 3JQBA 2IDZA 2Y68A 4CM5A 3W8EA 2YV2A 4J7XA 4ZQGA 3QVXA 4ZN6A 4RJTA 3ADOA 3V5NA 4K28A 5A9TA 1CERA 5AQ1A 1DSSG 1XHLA 4WJZA 1LLCA 3H4VA 4IDGA 5CAEA 3F5SA 5FEUA 1Y8QA 4O1MA 3QVTA 3NT5A 1UJMA 3MJVA 2QRKA 3D4NA 3LVFO 1N92A 4A2CA 5TSDA 3TL3A 1D1TA 2PZKA 3WIEA 1P1HA 1HZJA 2X5KO 1IHXA 4J6FA 3IP3A 4L4SA 3ZWWA 4E4YA 3DOOA 4KMSA 4DTIA 3EDMA 5IJZA 3S2FA 2AG8A 3K92A 3G17A 3GEDA 3INTA 4OOEA 3V2HA 4OOFA 1PR9A 5LDGA 2AMFA 4RVFA 3BTOA 3ZNPA 2OP0A 4TKMA 1B3RA 2HKIA 2PH5A 3FNHA 3IDSA 4KWHA 3OP4A 4KUEA 3UHAA 5IDWA 4CLRB 4RZIA 1BWSA 4KUGA 4L75A 2E82A 3M2TA 4C7KA 3D4PA 1WZEA 3DZHA 2RHCA 5F3RA 1PL8A 4L76A 2EJVA 1CETA 4TQGA 3AK4A 4OXNA 4J3FA 1ISHA 3KETA 3CEAA 3IOYA 3JQ8A 1MXHA 4NHEA 2BRUA 2HO5A 1T4DA 1FDTA 4WLUA 4CODB 4PG5A 3BMOB 4PLZA 4CM3A 3RC7A 5JC1A 1FDSA 1E3WA 1RJWA 4TVBA 3W4JA 1E1LA 3JD4A 3OECA 1WZIA 5IZ4A 5JNLA 1K0UA 3EUWA 4W7HA 3C1OA 4GBJA 4URFA 1NM5A 4CQMB 4RDHA 2A4KA 3BTUA 2JHFA 1ISMA 1LX6A 5JDIA 1ORRA 1YE3A 1BVUA 4IJKA 1HETA 1DHTA 4D3DA 1PZGA 2Z95A 4UVHA 4BNWA 4R3WA 1Z75A 1LI4A 3L07A 2Q1TA 4M87A 5A4DA 1Y6JA 4Z0TA 4D45A 1N1EA 2NTJA 1CEQA 2EKLA 2QZ9A 5A9RA 2XPCA 2D59A 2X0NA 5CDTA 1BMDA 1WAMA 3KBOA 2AEFA 4WGGA 4FFLA 2Q99A 4L9RA 2AG5A 1ZEMA 2EJWA 4DYDA 2Y0CA 2V6BA 4MVJG 1QMGA 4BNUA 4PG7A 1PS8A 4RVSA 1LJ8A 2ZB4A 5G0SA 5K6AC 5B37A 2PZJA 3PZBA 3PWSA 5JCJD 4U5QA 4CM6A 2XXJA 3TF5A 2W90A 1VL0A 1VKNA 3G79A 4I5FA 2VT2A 4N5LA 4ALLA 3N58A 2UDPA 3C3XA 4IDBA 4DIOA 1H93A 3IL2A 1ADBA 2FOIA 4TROA 2O7QA 3F9IA 3G3EA 1IY8A 4MPDA 3AOGA 2GN8A 1HSOA 1FDUA 2NWQA 3HDQA 4UREA 4F3YA 3EVNA 2NVBA 1MFPA 2PZLA 3NDRA 1O95A 1LA2A 3FPLA 5KNLA 4GMGA 4I5DA 5CDGA 1NHGA 2DBQA 1HLPA 2O50A 1HYEA 4WNIA 3DQPA 4EITA 1KY5A 3AY7A 1G0NA 1UUFA 5TNXA 1N1GA 1JAYA 2OORA 4MIEA 1XWFA 3ANNA 1EVYA 1CRWG 1ZMTA 3D5TA 3H2SA 4I5EA 5G0UA 3ZHZA 1F12A 3SX2A 3IUSA 5BR7A 4L4XA 4FFPA 2HMVA 3K6JA 4MVJE 1WDMA 1ZEJA 3EC7A 3MZ0A 1GPDG 1JVBA 2CSUA 2CF6A 3JQ9A 4GX1A 4NBTA 1U2DA 1VM6A 1Z6ZA 2JFGA 3DTTA 1MLDA 3ZWBA 4E2WA 2NSDA 5JE8A 1B0AA 3OQ6A 4RVHA 1U5CA 2WD8A 2PGLA 3PHIA 5ILGA 3RUAA 4Z9XA 4E30A 4GLLA 5HWSA 1LLQA 1VJTA 2E6UX 1NVTA 4GL4A 1KEUA 4I5GA 3I9KA 4ND2A 1ZIDA 4O59O 5HBRA 3IP1A 4Z0PA 4FFOA 3UVEA 2W8ZA 2IXAA 1QV7A 1C3VA 4JXKA 4K6FA 2YUTA 4YT2A 3WNVA 1X1TA 1RKXA 4AJHA 1E7WA 4DIFA 4BNVA 2HQ1A 3GAFA 4A27A 1WMAA 4WLNA 5THQA 3GOHA 3PVZA 1PJ3A 4Q9NA 1BSVA 2BFOA 4BO7A 5DDIP 2JFFA 5CEEA 3FF4A 3QVSA 4XQEA 4ZD6A 3NDIA 1DC4A 3RUHA 3OJ0A 3PQEA 3RAJA 1G0OA 1XQ6A 2HRZA 4I8XA 1WP4A 1I10A 1DLJA 2O2SA 3KUXA 3RIHA 3RUEA 1NPTO 1U9JA 4NBWA 3GVIA 3OMLA 1KVQA 3FHLA 3ICCA 2Q2QA 3LU1A 3TOZA 1IZ0A 1HYGA 2X0JA 4W9NA 3DB2A 3PQDA 3OJFA 2B5WA 4B79A 2VWQA 4XWYA 5L95A 3JQ8B 2Q2WA 3QRWA 1UH5A 4NIMA 3FPCA 3U49A 1SBYA 3AUSA 1NXQA 1ZO8A 3ZWYA 3U4IA 3ZV5A 4K26A 2IYPA 4CMEC 4IPTA 1LNQA 2QZZA 4RF4A 1D8AA 1O94A 3ORFA 5L3ZA 3P5SA 1OZAA 3CZRA 3IKTA 1YDWA 2BLLA 1MUUA 4YWJA 1DC6A 4INAA 2NVUA 1DO8A 3E48A 1XEAA 4R51A 1R4NA 4IZIA 4E5YA 1YO6A 3NUGA 1NNUA 3TZHA 5HA5A 2DC1A 2DLDA 3L77A 3WMWA 1B2LA 1GTMA 1HDCA 2DBRA 1IYZA 1E7MA 4O5OA 4RLSA 1EEHA 4ZU3A 3TPCA 3WWYA 5DP2A 4ND3A 1I36A 4OIMA 1CYDA 3O9ZA 2E49A 2R00C 4FBGA 3ZI0A 4R3NA 3ZWMA 1ONPA 2B36A 3OQ1A 3H8VA 3GZNB 4PVDA 1QYXA 3C24A 4AJNA 4TZTA 1QLJA 3OJLA 4WCFA 3H6KA 3QVWA 1W4ZA 2A94A 4CLDA 4XQGA 1GYPA 4CMIA 1XU9A 1LLUA 4E33A 2P5UA 4YAEA 3GZNA 4QSMA 2O7SA 4JJFA 1VKOA 1R66A 4J4BA 4KQWA 3ITDA 2G76A 4OGWA 9LDTA 1C0PA 2IZZA 3C85A 4XQCA 1BW9B 4U8GA 4AJ1A 2DKNA 3GG9A 2FSSA 1J4AA 1MA0A 4YB8A 1JW9B 3DAPA 4IGFA 3ZWCA 1OAAA 3NT2A 3ST7A 4JP3A 3CPSA 4RVGA 3GR6A 4AICA 4PN3A 1NAIA 2QIOA 5BSHA 1BG6A 3M2PA 5F5LA 1DXYA 1DEHA 3D4OA 4YT8A 4S1VA 4B7XA 1GL3A 4IJUA 1SAYA 1DFIA 4RZHA 2Q50A 3T7EA 2VRBA 2GSDA 1HDYA 2CDCA 2PNFA 4GLOA 4YTEA 2HSDA 4UVIA 1J0XO 3ZU5A 2DPHA 4D7AA 1KEVA 1ID1A 4H3VA 3TFOA 3I3OA 3E6AA 3FNFA 1KOLA 2B37A 5JDCC 4ZGWA 4NI5A 4M49A 3O4RA 3JQEA 1F17A 4FJ1A 5CPFA 3ULKA 1U3UA 4JGBA 5G4KB 2SCUA 2B4RO 4PZDA 1H2HA 3VAZA 1MB4A 2WJPA 2PTGA 4B3IA 1A7AA 5LCXA 4BQPA 1UXIA 4R4JA 4CMGA 3KYDB 3BZUA 2GCGA 4YRBA 3PHLA 3ZN2A 3IC5A 3C1TA 4IXTA 3DFUA 3O03A 4II2A 3EW7A 2C2YA 5CG2A 2GGSA 3DAFA 4MKXA 5AYVA 2AA3A 3OIGA 4BNIA 1JWBB 2WYWA 1YONA 4J1QA 3F1LA 1LSOA 1BXZA 4JROA 4WLOA 2W2LD 1U4OA 1ZJZA 3ZV3A 3TFQA 4DA9A 1VRWA 2VRCD 4HV4A 2WYVA 2R00A 2QX7A 2GF2A 1OI7A 1ARZA 3DMTC 4W82A 3KYBA 3FR7A 1M6HA 3O8QA 2YHUA 1YB1A 3H7AA 4CV3A 2V7PA 1R0LA 4FFMA 1RM4A 1Z45A 2P5YA 4PLGA 5A1TA 1H9BA 3D1LA 3MJTA 2WM3A 3VPFA 3L6DA 5G0TA 3VPGA 1WVGA 5FWNA 1WXDA 1NQOA 3KSUA 3RFTA 3BA1A 4XYGA 4ZQHA 4EI2A 3VC7A 2EP7A 1MG5A 4B3JA 4W9NC 1K5HA 3GZ4A 1GQQA 5I9LA 1O89A 4XEHA 3VKUA 1T1RA 3UN1A 2O23A 3W1VA 1YQGA 1I8TA 3MOIA 3UCFA 1JLLA 3I4CA 1MP0A 3PZRA 3ROPA 4E32A 3H9QA 2RBEA 5ITWA 4OHUA 5JFOA 1IZ9A 4C4OA 1EQ2A 3E5RA 1Y1PA 1TVEA 1DFHA 2J5QA 1YL7A 4CR8A 1E7YA 3GA0A 2G0TA 1M66A 5L7TA 4O6VA 5IDXA 3KM0A 1E1KA 1DRUA 5B4UA 2IZ0A 1JWAB 3DHYA 4M86A 1GYRA 2JCVA 4WOJA 3QVOA 2EGGA 4DC0A 1MC5A 2ZK7A 2BD0A 2C54A 1HDZA 2HMUA 1U2GA 1B26A 3AJRA 4XGNA 2C07A 3RBXA 3RWBA 2Q45A 1F0YA 3JQGB 4R1UA 3TSCA 4BQRA 2Q4EA 3I6IA 5A9SB 1KC1A 3GPDG 1I30A 4CM8B 2YV1A 2PR2A 3CH6A 2YHIB 3PGXA 2Q3EA 2I6TA 4PCVA 5ICSA 4BNNA 2F00A 1C0KA 3GNTA 5FF9A 4W4TA 5F21A 5I7VA 1E7QA 1Q0LA 4XX0A 3T4XA 1W6UA 2I5PO 4PG4A 4A73A 4ZRMA 2ZB3A 1C14A 1JU9A 3G0OA 5T64A 5THKA 2YHIA 3JQFC 2OHXA 3PHHA 1K89A 4Y6RA 3V8BA 3IKVA 5GMOA 4IMRA 4UUMA 2X23A 3K96A 2GD1O 2V6GA 3IIEA 4HNGA 1RM3A 4DGSA 3E5MA 4CJXA 1AXEA 4WECA 3DR3A 3WGTA 3WGYA 4CM4B 1I3NA 2C7VA 4EJ6A 3DZGA 4J9UE 3V1UA 1IPFA 3WBBA 1DIGA 2D5CA 3AUAA 3UXYA 3ZH2A 4J43A 3KRTA 5JAZA 3AOEC 4Z6KA 1EDZA 5MDHA 3F1KA 3PDJA 3COSA 2GDZA 4J1TA 1E1MA 1XA0A 3QLJA 4LN1A 3STHA 1BHSA 4DQXA 5JAIA 3JQ6A 3RUCA 2C82A 3WFJA 5LC1A 3DO5A 3ABIA 1ENYA 4QO7A 2HMWA 4IQ0A 1EVIA 4BMVA 3QA9A 7MDHA 1P1FA 2V6FA 4TSKA 1VL6A 4GKBA 1UXKA 2I99A 2NU8A 2X9VA 1NR1A 5KKCA 3DHEA 4LK3A 1XR3A 1PX0A 1F06A 5KJCA 1ZFNA 4CM9A 3DZKA 5T6BA 4CM1A 1H6AA 1ISIA 2AHRA 4WEOA 3S2IA 4E2YA 4F46A 2B4QA 4J90A 4D41A 1HT0A 2XXBA 1GPJA 1UXJA 4I1IA 4YQZA 5JW6A 3DHNA 5L4NA 4OKNA 1LQTA 2BGMA 1YKFA 2LDXA 3N7UA 4CUZA 4B4OA 1AN9A 1F14A 3AUUA 1YB4A 5CDUA 1Q1NA 3HFGA 4XB2A 3RC9A 1XIVA 1HXHA 2JAHA 1I32A 2CFCA 5JSFA 5BSGA 2NADA 4EJ0A 3N74A 3PGJA 4TRJA 5B1YA 4RF3A 1KBZA 3G1UA 4E31A 4P4NA 2ZATA 2YDXA 4YAIA 2I3GA 1B15A 3GHHA 3HUDA 4FD3A 5IAAA 1ISGA 5L53A 3JD1A 3OEYA 3GVCA 3A28A 1YGYA 4RDIA 3BMCA 1SB9A 4TRNA 4K1LA 4RQUA 3JQAB 3LLSA 4YR9A 4ALJA 3VDQA 4R41A 2OMEA 5MGBA 3BHIA 4U7WA 4XCVA 3TL2A 3IAHA 3LC7O 4UVGA 4YBZA 1EBUA 1DAPA 2PWZA 2BF7A 1U3WA 5TGDA 3GY0A 1H0KA 2E4AA 2GN9A 4CL3A 2NU7A 1YJQA 3KSDO 5BNIA 3UGKA 1ZK0A 2VOJA 5K0ZA 1GCOA 4G2NA 3H9UA 4MIOA 5KCZA 4XDYA 2FY8A 4A26A 3PWZA 5JS6A 4NDNE 3C7DB 4L74A 3WS7A 2I3AA 1LRKA 4D43A 1SB8A 5COQA 4BMSA 4MP8A 3LT2A 5DN9A 1ZSNA 2CY0A 3MEQA 3DL2A 1OC2A 3D3WB 4PIVA 4JP2A 4PVCA 3JV7A 2Y0DA 1SC6A 1EUDA 2D0IA 4XRRA 4XR4A 4D0SA 3ETEA 3PEFA 4AJIA 1D7OA 2HMSA 3CKYA 1JKFA 3X2EA 3WTBA 4DLLA 2Z1MA 1DPGA 5A5EA 4FC6A 2Q1UA 2CVOA 3JTMA 3PPIA 3GF4A 4J91A 4CV1A 2C5AA 1GADO 1YB5A 4H7PA 4KDEA 5L40A 2B35A 4IY1A 4BNKA 3HHPA 3MWEB 4CUKA 3C7AA 1KEWA 3PXXA 2B0JA 4E5MA 4ID9A 1FDVA 2YY7A 8LDHA 1HE2A 1UDAA 4RVUA 3KLPX 1A9ZA 2BGLA 1GZ6A 4OAQA 3ENNA 3L9XA 5T57A 4CPDA 4YJHB 1Y8RA 1N5DA 2GN6A 3AI2A 1DC3A 2BI8A 4GWGA 3RU7A 4NK4A 1L1FA 2HMTA 3L6OO 1R0KA 2LDBA 2NM0A 3UW3A 1U4SA 1ZKMA 2X0IA 3NJ8A 3DOJA 1R6DA 2NU9A 2EEZA 2QHXA 2CZCA 4YJHA 4D3SA 4KWIA 1NASA 3FTNA 1E1NA 2FR1A 3KXDA 4AJ2A 3B20A 4AJPA 1MX3A 1P1IA 2JCYA 3DC2A 1LC3A 1EK5A 3WYCA 4R5MA 5IZCA 4L73A 2DVMA 4RVDA 2JCXA 4ZHSA 4FCCA 3AOEA 1SEVA 1TB4A 3F4LA 1OFGA 5GZ6A 2FSVA 4AJJA 2O3SA 3EGOA 1NQ5A 4BO3A 4PG8A 1U7HA 5CPBA 3BAZA 1E3IA 2D1YA 1QRRA 4IINA 3WYBA 1PTJA 1MC4A 2YJZA 4J4TA 2Y67A 1HDGO 1N2SA 3CTMA 3KB6A 4XKJA 1GD1O 2DM6A 2YQ4A 3W6UA 5KWEA 1YL6A 3NGLA 3H3FA 1BVRA 3CUKA 5ICMA 2B5VA 3E03A 3I9JA 5TJHA 1ZJYA 1RWBA 1E5LA 3OSUA 3ZNOA 4GQAA 5A06A 4U0KA 1W8DA 4ALIA 3L4BA 2A9FA 2RHRA 1TEHA 4XYBA 3RC1A 5EQDA 4DIBA 3JQFA 2HCTA 2IEDA 5BSEA 3WWZA 4AJLA 3PIIA 1HF3A 5DULA 1UP6A 4RCVA 2VHZA 3I9NA 3HFSA 4JNKA 3D0OA 3K31A 4RO0A 5IXYA 3R1IA 4BV8A 1ZUD1 4ZICA 4GKVA 2CUKA 2ZTLA 2HLPA 3TWOA 4BNYA 2D5AA 3KLMX 4BIIA 3ZCXA 4HFRA 1NQAO 1T26A 1YBAA 2WE8A 4OM8A 5T8KA 4Q3DA 4Q39A 3ONEA 1BXGB 5C7LO 3WB9A 4WK6A 2O3JA 4XYLA 1NFQA 2ZYDA 2VQ3A 5I8WA 1QG6A 3V2GA 4EEZA 4PFJA 1YRLA 4BO4A 4BNZA 1NQTA 1S7CA 2QYTA 4QTZA 3R3JA 4CR6A 1HWYA 1ZK1A 4J7UA 1HYHA 4O63O 5K6AA 3BHMA 2BFAA 4MKZA 1H2BA 1R37A 4PLWA 3JYQA 2O48X 1DDOA 5DNAA 4TZKA 4JLWA 4Z0HO 4AFNA 4Y8VA 1ADFA 5U4QA 5EIOA 2GN4A 4RGBA 2ZTVA 2X8LA 3V1YA 1V0JA 4BO6A 2ZJ1A 2TMGA 2QW8A 1XLTA 3VZPA 3OJEA 3WR5A 1ZBQA 5U9CA 1Q0QA 4HFNA 5JAQA 5J23A 1PL7A 2VYNA 1HTBA 3BMNB 3GK3A 4XRGA 2VWGA 1UZMA 5A5FA 5K9ZA 3QQPA 5JAMA 4YVFA 5G2OA 3PLNA 4IIVA 4P8RA 1HDOA 2PV7A 2PKRA 3GC6A 2OOSA 2X86A 1LQUA 4NJOA 1R16A 4NBRA 2EV9A 1XELA 3AU8A 4ZRNA 3QHAA 4HXYA 1C0IA 2Q46A 4CMIB 2VOEA 1HLDA 1E5QA 1QSGA 4B4UA 1PZFA 3QE3A 1Z7EA 3GUCA 1KVUA 1NFRA 1SMKA 3UICA 2EKQA 4ITUA 4OJNA 5TS3A 3NGXA 3B1FA 4OYRA 5A3VA 4FSHA 3NTOA 1AGNA 3KZVA 4UVDA 3ZU3A 4YRAA 3WOHA 5BNFA 4LSWA 1HKUA 3PJEA 4ZQFA 4MDHA 4ALMA 2QQ5A 4DC1A 4J49A 2PD6A 1HE5A 1V3TA 3RUIA 4BNXA 1X7GA 2D2IA 2WSBA 4AVYA 2JFHA 2OBNA 3JQBC 1E3WB 4MVJP 5IN4A 4OL9A 4WNCA 3NTQA 2DFDA 5JMWA 5DBIA 1EZ4A 1JKJA 1YJ8A 5C5IA 4YRDA 2FRDA 3NDJA 4UAGA 4CLEA 2DUUA 5DCWA 3BMQB 1I2ZA 4FJ0A 3EAGA 4R1NA 1B16A 3H9EO 1D4FA 1ZMOA 4G65A 2X1HA 2J3JA 4FFNA 2H1SA 3JD0A 2C5EA 4L0QA 4FOSA 2AEMA 4WLVA 3L6EA 4DVJA 1TI7A 1PZEA 3R6DA 1R4MB 1NBOA 5JBIA 1XCBA 1E0DA 1K3TA 3O8QB 4UEJA 3ROMA 3ZV6A 2FZWA 2XOXA 3WTCA 4E2ZA 1QYDA 4CUJA 3VPSA 4RV9A 4YA6A 2UVDA 3B70A 2DTXA 5A05A 1DC5A 2H9IA 3GLQA 1QLHA 1G1AA 2Y66A 4KQXA 1WWKA 2PGJA 2X5OA 3UAGA 1HRDA 3ANLA 3HN2A 2NTVA 1GU7A 5AXDA 1QXSA 3QSGA 2EKPA 4H15A 2OO5A 2DU8A 4P4GA 1FMCA 5ADHA 2AW5A 4UUOA 3LQFA 2HJSA 3E18A 5COAA 4CMBA 5JLAA 3VH3A 1X0VA 4R68A 3GQVA 1PEDA 3FWZA 1B14A 5DBGA 1EQUA 3GGOA 3GGGA 4M1QA 2PK3A 1I01A 4PZCA 3BMNA 5IN5A 3DXFA 1A72A 1X7DA 1LRJA 2Q49A 1TT5A 1NAHA 1VL8A 3IUPA 3DDNA 1P74A 2ZQZA 3MJCA 3TZQA 3I9MA 1UXHA 3JYLA 5HRUA 3TJRA 4OKIA 3L0DA 4FJ2A 5ES3A 4NJMB 5JCXA 4A7PA 3RD5A 4EGFA 2OUIA 4FGWA 4ALKA 1O9BA 1PS0A 1GUZA 2Y99A 1E3SA 3KSZO 2RAFA 5B4VA 3LDHA 2J5KA 3CSDA 5KTKA 1VI2A 3X2FA 5KVVA 3OETA 1DIAA 2Z1NA 3INGA 2HJRA 2EG9A 2UV8A 1KEPA 3H5RA 2IZ1A 2I76A 4RPGA 3V1TC 1L7EA 3DMTA 1BTOA 3RFXA 3PJFA 4DQUA 3C8MA 5I9MA 4R5HA 3E9NA 4JBHA 4D46A 2HK9A 4HKTA 4FIZA 4JBIA 3U9LA 3GDGA 1YDEA 1PJTA 3IJRA 2P68A 3D3WA 3A06A 4DBZA 1P31A 1CF2O 1M6WA 4D3FA 2WWRA 4Y9DA 1FK8A 1I24A 3S55A 3AUTA 3WGIA 1AXGA 1HE4A 1P44A 1UDBA 3JD3A 1IE3A 1OMOA 3QWIA 3W6ZA 3E82A 4IDAA 1ISJA 4BKUA 2IYOA 1I3KA 4Q3CA 4WKGA 1V9LA 3H2ZA 1LXCA 2FR8A 2O3QA 4IBOA 1YOVB 5TJ9A 4P4LA 3Q3CA 2X6TA 2CF5A 1KERA 1F8FA 2BH9A 4MP6A 5CP8A 4DWVA 3I9LA 1DIRA 4MO2A 4GX2A 4HX5A 3D5QA 2P91A 5EN4A 2E37A 3S8MA 3OJOA 1WW8A 1PWZA 3Q11A 1IOLA 5AXCA 4PLFA 3ZHBA 1MXFA 1PWXA 3Q2KA 5TLSA 3QJ5A 3ZWNA 2EWMA 1VPDA 3VH2A 1GFSA 2O2YA 3C1AA 3V2UA 2Q2VA 3IS3A 3GGPA 4BGIA 4OQYA 4GH5A 5JY6A 1IUKA 1V3VA 3PRJA 3LC1O 4JIGA 4CLRA 5AXAA 2Q1SA 1PJLA 5TX7A 1UP4A 4I08A 5I7FA 1DIHA 3UUWA 2O3TA 1M76A 2DFVA 4BNHA 1WNTA 1Y7TA 3W4IA 3WFIA 3ZWXA 4YJFA 3GVPA 3NTRA 3DAGA 3WICA 3EHEA 4X54A 1AHHA 1K2WA 4L4RA 4UUPA 1FJHA 4DPMA 3JYPA 3GEMA 3SLKA 4MINA 3WXBA 4U6SA 1NPDA 4FR5A 5JMPA 4FDAA 4MVJF 2POQX 4XB1A 3PIDA 4R1TA 1PS9A 1H6CA 3WIDA 3I9OA 3E1KA 4J2HA 1K6XA 2VYVD 2VRCA 4PLHA 3SVTA 5IG2A 2UYYA 1ZZEA 1I3MA 2YV3A 4GX5A 1E7RA 4FFRA 1Q0HA 3ROQA 4ND5A 2J3HA 1GZ4A 3P2YA 5GZ3A 4IZHA 3K8ZA 2BHLA 1I2CA 4J0EA 4MIYA 4Q3AA 4Q3EA 1C1DA 2VHVA 3MJSA 1V3UA 4R1SA 2YQ5A 4E5KA 6LDHA 1ZCJA 2J3IA 3JD2A 4EBFA 8ADHA 1XYGA 1VSVA 5L45A 3I23A 3MCVA 4AG3A 4ND4A 3P19A 1DJNA 2UUOA 1YBMA 2R2GA 4M54A 3OA0A 1ZH8A 1GY8A 3PLRA 3ETGA 3RCBA 3T7CA 3CMCO 4BNMA 1PGPA 3SJUA 3WSVA 1CIVA 5EL0A 5DCYA 2OL4A 3MTJA 5KJ1A 5JO0A 5ILOA 4CLOA 4OSPA 2ZTUA 3AM3A 3GMDA 4UEKA 3WQSB 3BXXA 3KV3O 4ROSA 3UH1A 1GQ2A 5KKAA 1NR7A 3WGQA 2UUPA 3AFMA 3INRA 4MKRA 4E21A 4DYVA 1DHRA 3TQHA 4DMMA 3UF0A 3FBTA 4IUYA 3M6IA 4EW6A 3BMCB 4G5HA 1QYVA 1B8UA 2I66A 5L7YA 1Q2XA 3WQQA 4ILKA 4RL6A 4TRMA 2IXBA 3DBLB 2G5CA 3LC2O 1T4BA 5EMHA 1E3JA 1UR5A 4MVJH 2FPPA 1A27A 3TZKA 4NPCA 2ZYGA 1J6UA 5C7IO 3PYLA 3GG2A 4IDCA 2P9GA 4DL9A 5CEFA 1ZVMA 1Y5RA 4RQTA 4D42A 3BYZA 1YXMA 3MJEA 1DIBA 1YVEI 3LT1A 1V35A 1ENOA 4Z9YA 1N8KA 3GPIA 4TWRA 2RH4A 1I5RA 3UOGA 3WGZA 3TOXA 2VHYA 4HP8A 2EXXA 2HDHA 1IB6A 3IMFA 1YL5A 2CDBA 3R3SA 3B6ZA 3D7LA 3OFSA 1KVTA 2VUUA 3KYDA 3MOGA 2VHWA 3AI1A 2FN7A 3CMMA 4NK5A 1CQIA 1W0CA 4BS9A 2DPGA 2H5LA 3WGOA 2WDZA 2WMDA 3KEOA 4Y6PA 4YDRA 4E12A 4D79A 4YPOA 3M1AA 1PGQA 3VH1A 5L7WA 1PL6A 1HSZA 1NHWA 1YOVA 3ZHXA 3ZWPA 4NZ9A 5FFFA 2QRJA 1V8BA 3PI7A 3QY9A 1UZNA 3K73O 5T8KC 3ANMA 3DTYA 5KJ6A 1H9AA 2Y1DA 1E6WA 5CHEA 1GEGA 2GASA 4QO8A 1ISFA 3HSKA 4CMKA 3WX0A 4XIYA 3LZ6A 2DTEA 4QUKA 4RF2A 4NG5A 1J5PA 3FD8A 3WG9A 3HB5X 1PJSA 2IODA 2JD2A 1E77A 3JYNA 4J7CA 4YACA 4W99A 4DQVA 4G81A 1T2CA 1YWGO 5DOZA 3HDHA 1ZW1A 3HWRA 4WCDA 4BKQA 2PD4A 1QP8A 1HE3A 2VCYA 3NX4A 2IRWA 4FOOA 2NQTA 3MTGA 1YQXA 4QQRA 3GMSA 2BKAA 4BNFA 3JQ7A 1ZNQO 2IEBA 3ASVA 4I9HA 5DP1A 3BTSA 1BRMA 4E5PA 1DLIA 3F46A 1PU2A 3ZNQA 2Y1CA 3H65A 1OBFO 2ZQYA 3UCEA 5IDYA 4IXWA 2OBYA 3PYXA 2EHDA 3KO8A 3ZWAA 1WDKA 4CLOB 4FW8A 4MVJD 2EGHA 1GCUA 4EUHA 2Y1EA 1PQPA 3SJ7A 1LSUA 4J9VA 4GSLA 5EPOA 3PK0A 4NFSA 1LEHA 1B8VA 3QWHA 4R01A 4OXYA 1QR6A 2J6IA 2JKVA 1T2FA 3JQGA 5AXBA 4XGKA 2YDYA 4FQ8A 5L4SA 3GAZA 3Q2IA 3H5AA 3MWDB 3GFGA 4EYEA 4DBVO 1P9LA 2CD9A 2CNBA 2PY6A 3NV9A 3HADA 4ALNA 1EBFA 4GVXA 2Y1GA 3FN4A 4KUHA 1VSUA 1XG5A 2W2KB 5B12A 3ASUA 2VUTA 2GNAA 1F8GA 3WSWA 4IDEA 4BMNA 1A9YA 4LVCA 1Y8RB 3RJ5A 2EW2A 1KIFA 1KYQA 1MG0A 2DBVO 5JDIC 2NVWA 1JN0A 3LK7A 1XGKA 4FS3A 4LRSB 4YJGB 5HS4A 1DRVA 3T4EA 3JSAA 4YT5A 4K6CA 3S2GA 1E7SA 3LSYA 4HWKA 3NRCA 1QKIA 1LLDA 3B1KA 4YQYA 4GPD1 2NV6A 4R9SA 3TRIA 4E5NA 3K9QO 1PJBA 2JAPA 4EJMA 2OP1A 2EIHA 1M75A 1OC4A 2EP5A 2V6MA 2WE7A 5JC8A 4CMEA 1VJ1A 2B4TO 1NYTA 4IJWA 3WGHA 4RPHA 1YQDA 4RF5A 4EDFA 4FN4A 3P2OA 4PRKA 2D8AA 2PKQP 1B7GO 3RI3A 3P7MA 4HY3A 3A14A 4CR7A 4NU5A 2NNLD 4XD2A 3PTZA 2RIRA 3RFVA 2AE1A 3GEGA 3W4KA 5L4LA 2HRBA 4BNLA 2O3UA 3GN2A 2Y93A 3WJ7A 5KVSA 4ZVVA 1O0SA 2VTEA 4UVEA 5U1PA 4B4VA 4NBVA 5H81A 3RBZA 3TDKA 3WYEA 5ENDA 2EF1A 3RJ9A 2CDAA 3Q9UA 1KS9A 4BKOA 1Z7BA 4NR0A 1JQBA 1D1SA 1ZXBA 3O26A 4C7JA 5I7EA 2I65A 5KJEA 5FI5A 5JY1A 1KC3A 4Z9FA 4WOKA 1UAGA 4Q3BA 5JYEA 1E92A 2FMUA 1GZ3A 2FR0A 3CZMA 1TA4A 3F6YA 1Z82A 3GNQA 3OF2A 1W73A 5EINA 5KVCA 4HBGA 3H9JA 1ULSA 1BGVA 1ONOA 1KETA 2AQHA 2FZEA 4CM9D 4E3ZA 5EJ2A 5H82A 1LDEA 3MJ4A 1H94A 2VZ8A 4P22A 3ZNNA 5I9NA 4YYZA 2BFPA 3QW2A 1LUAA 1IULA 4KOAA 4RPLA 3CINA 4WCFB 2H63A 5TT1A 4CLXA 3B1JA 4DREA 1RYEA 3I83A 1C1XB 2D3TA 2W4QA 3GNSA 1GYQA 4B8WA 3OICA 3AW9A 1GAEO 1L7DA 4IMPA 1PZHA 2NVUB 3W8FA 5DBFA 4PRLA 5T67A 4B3HA 3WNQA 1C0LA 3NJ4A 3QWAA 1N9GB 2AQKA 4JQCA 3GDOA 3VZRA 4CM4A 3VZSA 1R0SA 2FWMX 1Y8QB 3GN1A 4KZPA 4N54A 4EZBA 4II3A 2DBZA 2VT3A 4A03A 4PG6A 1HL3A 2XAAA 2W98A 3EY4A 4MVJM 1N9GA 4GVLA 4LCJA 2AXQA 4XZ3A 1Y9AA 4Z3KA 1DAOA 2DUWA 2BGKA 4A5OA 1WLYA 3VTFA 2JHGA 2O4UX 5KVQA 3WDSA 4K9DA 1PGOA 3CIFA 3DZIA 4BB6A 4I9UA 5JDCA 3QWBA 4AL4A 2GR9A 2PFGA 3ZWVA 4BO1A 5BQFA 1IHYA 2J5RA 3PHJA 3SXPA 4ZJUA 3ZW9A 4IS2A 2ZIZA 1C1DB 1X14A 1GUYA 4PLTA 5HTOA 1EDOA 1SOVA 1U3TA 2NUAA 2I67A 4E13A 1ZSYA 3BTVA 3VHRA 1P0FA 2Z5LA 2GRAA 3Q0EA 1PSDA 5COBA 4XQ9A 4B8ZA 3SC4A 4RPKA 1MGOA 3DBVO 3SEFA 4E2XA 1NP3A 2FP4A 3ZDFA 4R9RA 5G4KA 3L4BC 5A04A 5C37A 2A92A 4GAEA 4AJ4A 1GV1A 4BGVA 4HUJA 1T2EA 4LCEA 5A02A 4CMJA 1Y5MA 3QIVA 5TC4A 1DFGA 3GHYA 3VZQA 1UZLA 3JQ9C 3GVHA 5IXSA 3IQDB 2VZ0A 2FPGA 5DOVA 5HM8A 4IDDA 3JYOA 3F4BA 1N7HA 5BNTA 1P33A 1HEUA 2OFPA 5C7OO 4EUEA 2GYYA 3Q6IA 1GV0A 3FNEA 7ADHA 4D44A 2HK7A 3QWFA 1UXGA 2VWPA 5JPIA 4WE3A 1LDGA 4NH4A 1CDOA 2X9GA 4BNTA 1XKQA 1ENZA 3I1JA 2DTDA 4GX0A 2G1UA 1T1SA 3JQDA 3LF1A 3ZV4A 2C29D 4LSMA 1EK6A 4BNGA 2VTDA 3HN7A 4FPXA 4DXHA 1U8XX 1O6ZA 2GPTA 4BNJA 1A71A 1VLLA 2C0CA 2ILTA 1BDBA 3KVOA 2W2LA 4E0BA 3NYWA 2JD1A 5IFLA 4M89A 1H6DA 1Y81A 1NPYA 3ENKA 4BGEA 3GFBA 1PJ4A 1NFFA 3H3JA 1O5IA 3WLEA 3CXRA 1X15A 2Y1FA 1EVJA 3HQ4O 4NFHA 1QV6A 3HDJA 5H83A 1EE9A 2V65A 3U62A 5CDYA 4CV2A 3RBVA 5A3JA 4MOWA 1H5QA 1S6YA 5JO9A 4YAGA 2DAPA 1ZXLA 5CEJA 4AJEA 3Q9NA 1JKIA 5C3MA 2D4AA 4LW8A 3H9GA 4S3MA 1WPQA 1GR0A 2Q4BA 3LT0A 3K30A 1FF9A 3GRKA 1RM0A 4YCAA 3LLVA 2WTBA 4GMFA 2X9NA 5F1KA 4AJOA 1VC2A 4PZEA 4Z3DA 3VVBA 3FRJA 4YAJA 1NWCA 1ADCA 1AHIA 3F5QA 2GUGA 2FHSA 3RU9A 5LDHA 2OGUA 2RH8A 3HJAA 4BO9A 1PQUA 1HDXA 5BT9A 3A1NA 2G17A 4JK3A 4QXMA 4HNHA 1J49A 4ZA2A 2NACA 4XYEA 3I6QA 4JCOA 2ZTMA 4XYMA 5BSFA 2ZJ0A 4BGUA 4IS3A 2YZ7A 1SNYA 2X5JO 4NMHA 1EUCA 3KTDA 3OIDA 2RCYA 1A4IA 1AE1A 3K2EA 4WCFC 1PIWA 4BB5A 1NTOA 4UULA 4TRRA 3RVDA 5IDQA 1GUFA 4WASA 1SO8A 3L4SO 4F45A 1HZZA 4J2OA 1A4UA 3AFNA 3DOCA 2OXIA 5KOIA 4N5NA 4QX6A 3SLGA 3FR8A 1X13A 1GEEA 2Y0EA 1P1JA 2CVQA 1U28A 3OEWA 4R69A 5GZ1A 2PGDA 4DMLA 4XJSA 3U3XA 1YBVA 4D0RA 1JAXA 3KOUA 1P0CA 2PKQO 1BDMA 1D3AA 4AJKA 3E9MA 3VPXA 2NU6A 2H6EA 1KVSA 3GUYA 2P2SA 1YH3A 2PLAA 2ZB8A 5ITVA 2PA3A 1UAYA 1EVZA 2HUNA 1LDNA 3KEQA 3JQCA 1PJQA 3HE3A 5FYDA 1BW9A 4MVJI 4H16A 4YJFB 2P4HX 3E9QA 2VUSA 1AUPA 2B69A 4RORA 4OO3A 4LGVA 3DZJA 1NWHA 4DRYA 5EERA 3OM9A 1RM5A 4F6LA 4NFYA 4QT0A 1EE2A 3ADPA 5DT9A 3RROA 4GGOA 4CMHA 4EUFA 4J4HA 3AU9A 4BO5A 1LDYA 3LF2A 2JD0A 3TZCA 1LC0A 2C2XA 2BMAA 4NBUA 4Y98A 4NJMA 3AM4A 3EYWA 1H6BA 2ZKLA 3OA2A 1BXGA 5ER6A 4CL8A 3U5TA 4R16A 4N5MA 3OHSX 4OMUA 4BKPA 1KY4A 2X22A 1KVRA 4JX8A 4CV0A 1XU7A 1E6EA 1HDRA 1I3LA 1T2AA 5G0WA 4GSKA 3U0BA 3ONDA 4PGFA 1LRLA 4YEDA 4IQ8A 4M55A 3ZWOA 1R15A 4LMRA 4GWKA 1CJCA 3PJGA 3VH4A 1ZSVA 1K6IA 3I4FA 3O38A 3OQBA 2X0RA 3PJDA 4KTTE 1LTHR 3WMXA 4CQLB 4CLHA 2VYND 1EFKA 1XDWA 4Y67A 4B7UA 4OSOA 1X1EA 1PGNA 1V6AA 1BXKA 3PQFA 1JVSA 5G0VA 2E48A 2GLXA 5KJFA 3WJAA 2C59A 1Z73A 3A4VA 3WGGA 1NVMB 1ZK2A 5FI3A 2X7HA 4IJVA 1U3VA 3H5NA 5TRTA 4DLBA 3PDUA 3EZYA 4CQLA 4JN6B 1EMDA 4NU6A 4TKLA 4QFCA 3W8DA 3ZW8A 4HFJA 5B4TA 3PFWO 2DQ4A 2PZMA 4LMPA 1I2BA 1NX6A 2HK8A 2NLOA 3KYCB 1LSJA 3AI3A 4OQZA 2AE2A 1P3DA 2NQ8A 4N18A 4BO2A 1G6KA 3PYMA 3HDYA 2EW8A 3FWNA 2Y1OA 1TT7A 3KHUA 4QECA 2P9CA 2GZ3A 2X4GA 4GGPA 1SZJG 2VNSA 2B83A 1B8PA 4WLFA 1Y9EA 2GERA 4WPGA 1VE9A 3JCZA 1PQWA 1Q7BA 5DF1A 3LT4A 3EMKA 3FSRA 4U0JA 1OOEA 1X0XA 4BKRA 4EEXA 5CG1A 3HG7A 3PWKA 4OH1A 1TLTA 1CQJA 1IL0A 4TMFA 2F1KA 4DPLA 4J1SA 4XR9A 3U09A 2I9PA 1EFLA 2XF8A 3R0IA 4HFMA 2G82A 4A10A 4NQZA 3VKVA 4QFDA 1ML3A 4Y6SA 1FXSA 3K2BA 5AOVA 2R6JA 2ZB7A 4CQMD 3ZU2A 4I9NA 4YJDA 3A9WA 3RASA 1T24A 3QV1A 4BHTA 5IF3A 4NNJA 1EUZA 1PR3A 4XJTA 5ER9A 3VPHA 5TIIA 1MFZA 3FTPA 3GRPA 3JQAD 3VTZA 3RQSA 4W6ZA 5DZSA 1XQ1A 4BO0A 3RSHA 4PLCA 3DFZA 4FC7A 1QORA 4KTVE 1LBEA 1LDMA 1B3BA 1M67A 4XA8A 2O4CA 4P38A 3RKRA 4JJGA 3U4HA 1UP7A 3DONA 1R4MA 1U1IA 2W2KA 2VYVA 4ZQBA 3BHJA 4CM8A 2WD7A 1UDCA 2P4QA 5L51A 2CMDA 1NVGA 3M1LA 2BELA 4ZQEA 4CMAA 3HB4X 4WEQA 4YJGA 3UCXA 3NEPX 1DRWA 3ITKA 2WD7B 1ZK4A 3C7CB 3G49A 1LSSA 2ZCUA 5JCJA 4U6QA 4KP7A 4HADA 3GT0A 4YXFA 4OXKA 2VNAA 3DZFA 4L8VA 4J0FA 3E8XA 5JYDA 5F1PA 3K5PA 1E6UA 2PD3A 5T5QA 3AY6A 3EK2A 1RPNA 1A5ZA 5I7SA 1LU9A 4MJLA 2GZ1A 1U5AA 3DBHA 2CVZA 3JQ7B 3OBBA 3ON5A 3QP9A 1Q7CA 1X7HA 4XIJA 5L9AA 2UAGA 4DLAA 3F3SA 4A0SA 1QYCA 9LDBA 1TT5B 5TF4A 3WQRA 2J3KA 4IDFA 1MV8A 2VZ9A 1QYWA 3LYLA 1ULUA 4ND1A 1P1KA 3OH8A 4UUNA 3DBLA 5DCUA 5GY7A 4LRTB 4PLYA 4WUVA 1E3LA 1U7TA 2Q1WA 5EESA 5TQVA 4QEDA 3ONFA 3NKLA 1PJCA 1T2DA 1Q7GA 2QYSA 1U8FO 2AQIA 4PLPA 2VN8A 4UEOA 4BOYA 5F5NA 3FBGA 5I8ZA 3RKUA 3PP8A 4FGSA 2BFMA 3GVXA 6ADHA 3I52A 3AM5A 3ZHYA 1GDHA 2P9EA 1VJ0A 5EQFA 3AY3A 2VWHA 3G1TA 3TNLA 1SPXA 3I5MA 1ZK3A 3SBOA 3HNPA 5AVOA 4BL5A 4DUPA 1WDLA 4FB5A 3DWFA 3VDRA 3FCOA 4GI2A 3WLFA 1E3EA 3KYCA 3DBHB 1ADGA 4R54A 3DEYX 5F1OA 2A35A
chains in the Genus database with same CATH superfamily
3LDUA 5F4ZA 3WBFA 1ONNA 2UVQA 3PPVA 4RQBA 1GT91 4LISA 3JR3A 4X64B 3GZJA 1YIOA 3ZGYA 3ER9A 1DOHA 4QFMA 4YJ3F 5IVIA 4ZJYA 1F2VA 1ZOOA 1XTZA 2FPIA 2R47A 4MP3A 4JR0A 4XFKA 2MSLA 1K6JA 3UFXA 1QRTA 1O3YA 2R6DA 1LPMA 3VYUB 1M2WA 5B2ZA 1VOTA 4OJQA 1HNWB 2AVDA 1J24A 1P77A 4N8SA 3P1JA 4FCWA 3KIPA 1A7KA 3IQHX 3BGOS 1SOWA 2JJYA 4G6ZA 2EEPA 4KFUA 2R4UA 3S1LA 3BMQA 3NI2A 3GDFA 2HO4A 3FNGA 3X2SA 4CDNA 3U4QA 1SOUA 2JFVA 3CLSC 3E35A 3K9CA 4TOIA 5LYJB 1WB5A 4UAJA 2F67A 1P3Y1 2HPHA 2JLAA 4W7IA 1EK2A 1MDFA 1RYZA 2FE1A 3O3OB 2I55A 1XMIA 3ZQKA 4AQ7A 2QU7A 2ZRQA 4FOPA 4G0WA 1T8UA 2GFIA 3R3HA 2YYYA 3WKDA 5CFZA 2J8ZA 1K7CA 1I33A 3E15A 5G4LA 2XSZD 4F92B 1BROA 4UDOA 3Q9LA 3RC8A 1PEAA 2ZT7A 3PB3A 1LTKA 4XPZA 4I4TB 3S7TA 5LDDC 4ESOA 4WADA 5CB4B 5IZCC 4NXMB 4KVGA 2WYUA 1L3BA 4C2UA 1FLVA 2M6LA 2A88A 4BO8A 3WLTA 5LWHA 1ZD8A 4QTTB 3MJRA 5A9SA 1N7GA 5BR1A 3ICPA 2E4VA 4G8CA 1NBHA 4QRDA 2ISQA 2GM4A 1PJ2A 1JDBB 1MF7A 3TZ6A 3NV7A 3NXKA 5A7FA 1E1RD 2ERYA 3RQIA 4DZTA 5J2TA 3BGDA 5JXWA 1ZONA 4C08A 4BXOA 4QSHA 3LIIA 1OLXB 2REOA 4BVAA 5KNBA 2Q3BA 4KO2S 5FXMA 3H18A 3DE3X 2GZ2A 2EERA 2HBRA 3H4IA 5F78A 1VPEA 2ANBA 3AIMA 1ETUA 3RC2A 4E6PA 1ZM3A 5A4KA 3ITEA 3KWJA 4FXPA 4JLPA 3T12A 4YUZA 2JL1A 2PRIA 2Q3FA 3NHFA 5TT0A 1IJBA 2C7RA 1UM9B 2ZYAA 1UBGA 3O2NA 4PRZA 4XDZA 3WIBA 4WXMA 4F4UA 5A3RA 5C1DA 1V45E 4RESA 1XZDA 2NTNA 5AVXA 3UEOA 2VJMA 3SFZA 3N6VA 4OXRA 1JLRA 3AKCA 5HS6A 2IPMA 4M1MA 5E1DA 3QPVA 2CMFA 4L6IA 2VIIA 2C8JA 4ZQGA 4JC4A 1BFUA 1QE3A 2ZREA 5E0KB 5IW8A 1H3EA 1XRPA 4ZN6A 1AQYA 3TOCA 5ALVA 2HJVA 4ZIRA 3TG8A 4R81A 1JQEA 2JFQA 2AMJA 4B73A 3HVUA 3HJCA 3MIIA 4EB0A 3C45A 4F6RB 2QJFA 4W7SA 5AHKA 3HBNA 1Z0KA 1DPFA 5FEUA 3EA5A 2OZLA 2XNDA 3ZW7A 3NT5A 1HM5A 3GA7A 3VR4H 1M2FA 1RYHA 3ENWA 2A57A 3D4NA 3LVFO 1C3OB 2IUSA 2A9RA 2BFCB 2MHCA 1KJIA 2VDLB 4A2CA 1RKUA 1D1TA 1Z0AA 3OPYB 3WIEA 5KNDD 3V8EA 2ZYSA 3TG2A 1JTEA 3W1EA 3BZBA 8ATCA 4LFAB 1V8FA 3I2GA 4L4SA 3DOOA 1PDWA 4MVXA 5B55A 2QD1A 2X76A 2WOJA 3G17A 2A2ZA 3INTA 3IQIX 1DBPA 3A4IA 2UVPB 4OFZA 1W94A 1Y3DE 2H0AA 4C6SA 4Z2YA 1PR9A 3A0RB 1JE0A 3Q15C 5ARDA 3WK5A 3DTVB 5BMVB 3MYRA 4JB8A 4CTOA 4DANA 2CE2X 3QLVC 4RVFA 3CUTA 4CGZA 4LZLA 3KOMA 4Q24A 5FWYA 3DNMA 3OX2A 4EYGA 3OP4A 4KUEA 4D8YA 3GEHA 1L4EA 3VMMA 3ZHSA 1BWSA 4ES6A 5I51A 5M3BA 1ITZA 2WAAA 4XTRA 4ZZ1A 4WESA 1SPBS 1MHTA 5EFZA 1Y9DA 4L76A 4TQGA 4FQ7A 1ISHA 3KETA 3ME5A 4OI2A 4C7MA 2BRUA 5CDFA 5AK6A 2ISCA 2ISSD 1IPHA 2GEJA 4POAA 3FI0A 4GOLD 4TYMA 3LRXA 4PHHA 4PLZA 1NY5A 3O73A 3L05A 4RFLA 5ARBA 1FDSA 5CCXA 1E3WA 4HLNA 3W4JA 3EVFA 1VFNA 3JD4A 2IIPA 2PZBA 2GH1A 1DWPA 4IV0A 2QLJA 3DVQX 1CZHA 1BVHA 4GBJA 2HEGA 4U9UA 5DN6D 4CQMB 4RDHA 3N6RA 2JHFA 1Y3CE 4L1KA 1LX6A 2ZAMA 3HRHA 2H2FA 1BVUA 2FK8A 4IJKA 2FZ4A 1A2QA 4NPHA 4MGYR 4D3DA 1KEKA 4EY8A 4TYQA 4PFSA 1Z75A 4R3WA 5I3CA 4PYJA 3L07A 3MPUA 2OXCA 4M87A 1QHGA 1Y6JA 3AGPA 3CUYA 5K0LA 1CEQA 2HQSA 2EKLA 4NZMA 1EGVB 5CFNA 5A9RA 1MT3A 1SVKA 2C42A 3WNDA 1P7ZA 2G67A 2I4IA 2X41A 2FEMA 3IP9A 4US0R 2ERCA 2AEFA 2Q5EA 4JENA 4FFLA 2VLIA 1DMSA 1OF1A 2IYFA 3OO1A 4QVIA 3HR7A 2EJWA 3RYIA 5E3JA 3K0FA 2JDIA 3IA2A 1AC5A 3HXLA 3G8AA 3LAWA 5DWDA 4AROA 3E27A 2AK2A 2R7NA 4JBXA 2ZJ4A 1V1RB 2CXOA 2I0FA 4H59A 3RK4A 3GCXA 3MGCA 1LPSA 2HNAA 4Q7QA 5B37A 1IIBA 5K6AC 1GRQA 3PPWA 4PSDA 5TVGA 3TF5A 1UDXA 4Z9AA 4YRLA 1VL0A 1V1JA 1RPAA 1G60A 2QT0A 1D09A 3N58A 2UDPA 1FPQA 1OKKA 3C3XA 3PUWA 3HVKA 4FNOA 2FPUA 1ADBA 3EXHA 3PNLA 3UHOA 4KQEA 2JZCA 1XKXA 2NPIA 2QJRA 2WTEA 3KJIA 2WJ3A 1NZFA 3BH7A 3M6AA 1BWQA 4MQLA 3TB4A 2H4JA 3BRQA 1FTQA 3EVNA 3FKJA 4JUFA 1O95A 2F8LA 2YIMA 4X95A 1WQ3A 5GQSA 1RYNA 2VXYA 5B7NA 3GLFA 4GMGA 5LMUB 3AIKA 4I5DA 1MR3F 2Z6VA 3H1GA 3EGWA 3L6BA 1C8LA 2QTTA 3CJQA 1G8JA 3QY0A 3NHLA 1JIJA 3GFPA 4WNIA 1KY5A 2FW1A 5IC5A 4NSNA 1MO5A 1V9CA 4OYHA 3DUFB 1KEEA 2W2OA 2WV9A 4EATA 1JAYA 5K3OA 1BDIA 2P3QA 3D7RA 3H2SA 2GVNA 3D5TA 5AUQA 4I5EA 1PZNA 4U2KA 2DWOA 4PHGA 3RTCA 5FNVA 2OHFA 5EWJB 2H9YA 5BR7A 4L4XA 4FFPA 3V1LA 3FZGA 2ZUTA 4BJ5A 4BX8A 1HDIA 3O4FA 1WU8A 3GNLA 1ZEJA 5DBOA 3NH6A 2OLKA 1GPDG 4JLVA 1NJ8A 4I1PA 2CKMA 2CSUA 4FMCF 2QTVB 1RWMA 3EH1A 3AF6A 1XWWA 3EVDA 5HM6A 2IYRA 2H85A 1TKRA 2X0FA 4B7ZA 5TDHA 5JE8A 1GITA 2XTMA 2WIKA 1VJRA 1YQEA 1ZINA 3PHIA 2BW0A 2OHIA 2WK1A 2JVIA 1N8SA 3K5HA 1VJTA 4GLLA 4HZIA 4NCKA 2E6UX 4LZJA 3WYDA 1QF7A 4GL4A 1KKUA 1CUSA 1KEUA 1U11A 2AL7A 3ZY6A 5CA0A 1E9DA 3HP7A 2Q7XA 4R8MA 1Q0ZA 1WVIA 1ZIDA 1JJFA 4ICIA 4CW7A 2XJ4A 5K8LA 3VC2A 3IP1A 1T0IA 3UVEA 4HVCA 3O47A 5BVHB 1NJGA 2RGUA 3W9YA 5IX8A 1C3VA 1V11A 1AK2A 3ADKA 3IAUA 4JXKA 1P0MA 4K9PA 4YT2A 2XCTB 1PR0A 5KUTA 1X1TA 1L4YA 1RKXA 2GM9A 4U9HS 3GAFA 4LXYA 4A27A 2ZJ6A 3DP7A 2PCJA 3IT1A 2R5WA 3IVRA 1FMTA 2OHVA 3GOHA 5G53C 2R7MA 1IG0A 4WA8A 4AS1A 2UVPA 3EX7C 1SIBE 3U3KA 2WJWA 3IBYA 4OJKA 5DDIP 4M0KA 3KB8A 3QUCA 2VSYA 3QXCA 5ITSA 2Q3JA 4DR5B 3PQEA 1P4AA 3MS4A 1G0OA 1BYIA 1U65A 4MRMA 1WP4A 2XRFA 1QH1A 1BHJA 1I10A 2Z3ZA 3W0LB 3A1TA 3TQOA 4X7RA 3KUXA 1S5PA 3E2MA 2GTHA 4F60A 2XHEA 4V3CA 1NPTO 3D8UA 4HQ6A 4U7PB 1MENA 1P0PA 1IZ0A 2HREA 2YZNA 2VNIA 3GLTA 3DB2A 4O4LA 1XRNA 4BCDA 5AM2A 3EA0A 3P45A 2B5WA 6CHYA 1RWXA 2IOFA 1TEXA 4XWYA 1N9ZA 2JCSA 2RK4A 1OFUX 3QRWA 4V0NA 3AHDA 1G42A 2ZJ8A 3KXKA 3LFUA 4JCCA 4W1QA 2F6RA 1SBYA 3ZWYA 1NXQA 5EJ6A 4N7JA 3RV4A 3U4IA 4K26A 4ZI3A 4CMEC 4IPTA 4QGHA 3W5DA 2CJPA 2QVGA 1Y3FE 2ID7A 3P26A 5H0IA 2PGNA 2ON6A 2F3TA 3ORFA 1DKLA 2Q0XA 2X2FA 1OZAA 3CZRA 2C3PA 3UH0A 1R5JA 4YWJA 3VDXA 2AG0A 1Y5IA 2Z58A 1K5GA 4PYRA 1P7YA 3GA5A 3SNKA 5EUQB 3PQ7A 5CCDA 2P41A 3M9WA 3KX2A 4FSDA 4E5YA 5GV8A 2A9KA 4M7WA 2B9VA 1NNUA 3QH4A 3TZHA 3SKXA 2NUPA 1WSWA 3FWYA 4JVSB 5EHIA 4ID3A 3GRZA 1B2LA 3PC3A 2DBRA 5JMTA 1UPTA 1O4WA 2EQAA 2QRZA 1YRYE 2I03A 4HZUA 4KPUB 4EB6A 3GFRA 3EXEB 2FRVA 3QBEA 1CZKA 4OIMA 1ZGGA 1CYDA 3O9ZA 4FONA 1UFKA 2R00C 3VHXA 1UKBA 4CTMA 3RTGA 3TLXA 3A9TA 5E6UA 1OFUA 4H1HA 3A11A 4WA7A 4QOHA 4ZEXA 3GZNB 3K9BA 4PVDA 4B3FX 2A86A 3SYMA 1F4PA 3C24A 4ZEMA 1S8AA 2IBTA 2JJMA 4L2IB 1QS0B 4M88A 3HN6A 5FTNA 1G3UA 4AQYB 1BXRA 4UASA 4D3XA 4QYIB 4GPBA 3MPOA 4QRIA 4CMIA 2W4IA 5ALMA 5AW8A 4E33A 2B61A 2C2GA 1TFRA 1MAVA 2Q4TA 3JAKB 4CKCB 3RWOA 2GHRA 4IVRA 3NJRA 4QSMA 3HGMA 3KOOA 4WUTA 3U6KA 4D9HA 4Z4EA 4BU1A 4J4BA 3H1EA 9LDTA 4Q1CA 1XL0A 1GAJA 2JJ2A 3ITDA 4JT8A 5I47A 3EG9B 1Z7GA 1WF3A 2IZZA 4V02A 1M2JA 4AWXA 1HLGA 3CBGA 3PRYA 1OHHD 4C6RA 4D92A 3PS9A 2HJWA 2XKKA 4D82A 1OWOA 4GYKA 2O8EB 5KNCD 3DOEA 4YB8A 5LQRA 1RPTA 3DAPA 4MJ3A 3ZWCA 2PQ0A 1OAAA 2PWPA 4OD0A 1N5RA 1SUSA 4IQ4A 4JP3A 1EFPA 1NXXA 2WZDA 4UZSA 1BHQ1 1EX1A 1KJJA 2Z8YM 5AW2A 5BSHA 4RUKA 3BWYA 2NO9A 3FCEA 3RT9A 3N2KA 4NV3A 3USCS 4KR0A 5BW4A 4AUEA 3D4OA 4ZAZA 1HL7A 1Z6XA 1Y48E 4UTOA 4NF2A 4CTJA 4DR3B 1DFIA 1DUSA 2ONCA 3T7EA 1JX6A 4B8YA 2JFXA 5EXPA 3VJRA 4A8JC 1AUQA 1FFDA 2CBXA 4GLOA 1A50B 4O4HF 3F0TA 2OD2A 2ZU6A 1J0XO 3HLKA 4C14A 4D7AA 2WHPB 1SXJD 2FW8A 4N8DA 3I28A 3USES 5MHTA 2AI2A 1A5SB 1UM9A 1AIPA 1I4WA 3FNFA 5EWMA 5TVKA 3TJMA 1G7CA 3QVUA 3WRVA 2B37A 3OJCA 4HK4A 2J32A 1YZVA 4RY0A 3LWDA 3JQEA 3R77A 2PWAA 5D85A 5CPFA 3ULKA 4FNAA 4N49A 3TAUA 5EE9A 1SKBA 3AVXA 1ZM7A 2HA6A 3JPWA 1INLA 4QDZA 3VAZA 2OCLA 2WJPA 3HJTA 5K3FA 3BXOA 1A7AA 1YRWA 2V8OA 3AWIA 4M9CA 5LCXA 4Q3KA 3TQCA 3I0ZA 4BFLA 1SG6A 2GCGA 3T4PA 4MDYA 4OQLA 2SBTA 1OWLA 3ZY2A 2YVQA 3DFUA 2C2YA 2RAVA 1ECLA 3BC1A 3JZAA 4IOMA 2GGSA 1PYDA 3OE7D 3TBKA 3M89A 5FOVA 3OUUA 4MWSA 2AA3A 1OIVA 4MV7A 1THTA 5AVWA 2IC5A 4BNIA 3HRIA 1GGJA 3QHPA 3ZVNA 1QQAA 3IA7A 2IVZA 4J94A 1LNSA 3MNFA 1LSOA 3UGJA 2EFGA 1ZGCA 1T6ZA 4DLXA 1ZJZA 2BEUA 3OFVA 1B6TA 3N07A 1VRWA 2FKNA 3PKZA 1ZLXA 1M1XB 1T4GA 4H7FA 4KQ9A 4B4DA 3I5XA 3ITNA 3DMTC 4UU0A 3FR7A 4D56A 5G41A 3RTBA 1FFXB 3WI7A 4ZV9A 1CY7A 1OJ7A 1YB1A 2XMQA 2QL9A 3H7AA 1RM4A 4G1EB 3ZYCA 3ABRB 4B43A 5KX5F 1QC5A 3G85A 2P5YA 2PT6A 1H9BA 2NU8B 2CLFB 3N3AC 3K0AB 2SNIE 5K3AA 3VPFA 4MRAA 5FWNA 2FDRA 4V38A 2QVLA 3LLMA 4S0XA 1J2EA 1RLUA 2MINB 2X6QA 4ZQHA 3VUEA 1KMIY 4QBKA 3U81A 4AYWA 1QCDA 4W9NC 5EYPA 1WW2A 3QPDA 2VT6A 3SJCA 5LOVB 1WS6A 3KQKA 5IT5A 3VKUA 2ZJOA 1B8OA 2O23A 3FPKA 5ERYA 3DMGA 4X65B 2D2XA 1GTZA 2CHFA 4P98A 2DG2A 5J43A 1D6SA 3AY0A 3I4CA 2ZB2A 5EIHA 1Z08A 5IJAA 4US1R 4JB3A 3ROPA 4E32A 2C9DA 3ESAA 4TKVB 3UJ8A 1G38A 1EQ2A 3CRQA 3R5SA 1Y1PA 1SA0B 1TVEA 3SF8A 4P6VF 4ARBA 1FEZA 1YL7A 4HDMB 2C77A 4NP6A 2G0TA 4DS3A 2H2DA 4O6VA 3TSZA 4DV2B 5LD2B 2HRCA 3VSAA 4KITB 1NDHA 1U1DA 3WZLA 1DRUA 5B4UA 5E4JA 4M86A 2H4HA 1L8QA 1GYRA 2JCVA 3Q6MA 4JJ4A 1EWQA 2CXRA 2QAGA 2QPOA 1HDZA 2HMUA 2YRXA 4DN6A 4QTYA 3SXUB 4ABTA 1CJUC 4MA5A 2VP4A 4PC7A 2Q45A 4PQFA 1JQAA 3JQGB 4TLLB 6Q21A 5KU7A 2Q4EA 5A9SB 5HF6A 2G9QA 3I42A 3ADBA 2YV1A 1O77A 4RY2A 1N7IA 4DCJA 2PR2A 4U6NA 3CH6A 2AYXA 3U3DA 5BMVA 2CHGA 5KYYB 2WB2A 2ZI7A 2PJRA 5CXXA 1FSZA 1YS9A 1AO3A 3FJ1A 2I6TA 4PCVA 4OHZA 1WBBA 5FD8A 3IPAA 5AK5A 4BNNA 3DAYA 2F00A 3GNTA 1W36C 4LBZA 5GVRA 1C7FA 2ZSIA 3I9V6 3FRHA 4M1YA 1W6UA 1T9HA 2RONA 1T9DA 3L0OA 5KTTA 2I5PO 3LYUA 1JXMA 4PG4A 1W44A 3HFJA 4O5AA 3ISTA 2JFWA 4EYSA 1JU9A 5FH9A 5THKA 1UIRA 2YHIA 1KJ9A 3JQFC 3OIWA 4Y6RA 1PK7A 2PL9A 3V8BA 5GGXA 5ALKA 1MJHA 3CC8A 1BEZA 4LV5B 4OVKA 5GMOA 3IIEA 1RT9A 3I76A 4GIBA 1A04A 2JKZA 3EF1A 2HHAA 4HNGA 3TD2A 3ES9A 4MMXB 1P2GA 4W5WA 1YJ5A 4L9WA 2PUWA 2WF8A 3O91A 3WGYA 2VJAA 2BY4A 3OZSA 2G1PA 4BLSA 3SSOA 1EXWA 1I2AA 4YRZA 3DZGA 4QGAA 3OEHA 2GPYA 3T1OA 3V1UA 3VU1A 1EK0A 2OVBA 2PVSA 2YJ4A 4M0MA 1KEZA 1E1QD 2VDPB 1R8YA 3SR0A 3UXYA 3AP2A 5J5AA 2XQVA 3N28A 5HR5A 5JAZA 3BE8A 4PGHA 3UG7A 3AOEC 3LT5A 2EX1A 3H4TA 5A2GA 1CBUA 2CJYA 1JA1A 1H69A 3IV6A 2O0KA 3U31A 3L8EA 3GCZA 3DMHA 4QDOA 1NIJA 1ORWA 4NNOA 5FL3A 3ZZ1A 5J4LA 1YHYA 1IHUA 1TC2A 1E9VA 1BHSA 3OE7A 4DQXA 5JAIA 5EC8A 4J76A 5H80A 1P6UA 1P8AA 2Y76A 3BCHA 2O1XA 3WFJA 2HMWA 4IQ0A 1EVIA 3IHTA 4LJ7A 1K4KA 7MDHA 2V6FA 4RPIA 3BGVA 3ORQA 3AESA 1VL6A 1C8VB 2QVBA 1UXKA 2I99A 3CF4A 3WHIA 2WABA 4KCGA 2XUFA 1V8ZA 2N9UA 4LK3A 3VC1A 3EXIB 4JQSA 5HCNA 3SWWA 3QTBA 3AVQA 3CW2A 1Q12A 3RS2A 2LGJA 1D03A 1ZFNA 1JEDA 3C70A 2ZULA 4CM9A 2XLCA 1S2IA 3EGXA 3K1ZA 4IIJA 1XDDA 5AVJA 1DKPA 2JAOA 2PSSA 2BHRA 3IERA 5DW0A 1CYEA 2VZLA 4E2YA 4F46A 3DPSA 2EJCA 2B4QA 2D5LA 2OLJA 1HQDA 2YJ6A 4X0EA 2HIGA 4I1IA 4JBWA 4NRDA 3DHNA 5JW6A 2C5FA 3ABOB 2AN5A 3L8ZA 1JKMA 3OF3A 2BM1A 2YHAA 2LDXA 4BPBA 4B4OA 1AN9A 3IKLA 3UQZA 5CDUA 1YB4A 4ME6A 3GRVA 3HFGA 4HTFA 5MN6A 1XIVA 3QELB 4CT4B 5C9ZA 2JAHA 1UJNA 5JSFA 3ZVKA 5F98A 3TJZA 3BM5A 1E9CA 3I04A 2PUHA 1YMQA 4M9XA 1JPNA 2A58A 4RD0A 1YZKA 1MORA 4L7VA 1U8YA 4KX5A 1CPYA 3KR2A 3AF5A 2V5VA 2CUZA 4P4NA 4E31A 2I9KA 4FFVA 1QCZA 1HEYA 1B8NA 4M0LA 4FD3A 3VSEA 4OP3A 5IAAA 4QU8A 1RXEA 2K7FA 3GVCA 3UXEA 4LJRA 2O2IA 2HOQA 3A28A 3M6UA 3NPAA 3EE6A 4BYGA 1US8A 3QF4B 1X7ZA 2X8AA 1AQUA 4JODA 3J7AC 1TVMA 4JVLA 1MAUA 4S1PA 5JZMA 3WL3A 3TAHA 1ZI6A 1L1EA 2C9OA 4WQMA 1JG4A 5B3KA 3L8HA 5SYAA 2GCPA 5KPDA 1I7NA 3TL2A 4JC5A 2RHTA 2YW2A 5TGDA 2BF7A 4G1UC 2XR1A 4K9MA 4FR2A 3RFTA 2RK3A 4OU4A 2EX4A 4DV5B 4Y18A 1THZA 1T9AA 2NU7A 1OREA 3AUFA 5DBEX 3ZXUB 1TYZA 3G2JA 3LPNA 3L1UA 5DWVA 2I34A 2IYTA 1BH2A 3DJYA 3IPXA 1KJ8A 4LJLA 3FCUB 1E3QA 5CM2Z 4XDYA 3I2KA 3NDPA 2WKWA 1X7XB 2Z9DA 5KQSA 2PGXA 2R86A 2JLVA 5KNDH 3GLFE 1UFQA 1X1BA 1Q57A 3WS7A 2QRNA 2I3AA 5CDHA 4ENVA 2OUKA 5F9FA 3H2JA 3N59A 4CF3A 4EB6B 3EFHA 3R5TA 4URZR 2X2PA 1QDEA 5DN9A 4MUNA 2B4KA 3C15C 3MEQA 1L6RA 1VZ3A 2J0UB 5E1OA 4EJ2A 2Y0DA 1IXZA 4CCAA 3K0BA 4OHKA 3G2MA 4DVGA 3AZOA 2Y9PB 1NLMA 4XR4A 4AZVA 1ONBA 3ETEA 4PZZA 3D3QA 5K3SA 5LSAA 1JIIA 2FPOA 1NMXA 3PEFA 2H11A 4U2EA 6GPBA 2QLMA 2VG8A 1F5NA 4G5XA 1DPGA 1GTSA 1FFWA 3CM0A 3ETJA 1NW5A 2CVOA 2NSHA 1A2OA 4QUEA 4QYIA 1NKTA 2C5AA 4AZTA 4B7AA 4DLYA 5D3ZA 4F9FA 2B35A 3TS1A 3FPFA 1XRLA 4LXGA 4IY1A 4FFSA 1WMEA 3IOBA 4F11A 3KZNA 1H2FA 2B0JA 3PNYA 4ID9A 4MULA 4ZVMA 3LBFA 1A9XA 2YY7A 3GQBA 1HE2A 1QGAA 2BZ0A 2JGIA 1RLIA 3RKSA 5KTRA 1GL7A 4RVUA 1GT6A 1O94C 1A9ZA 2BGLA 4ZZ3A 4B3XA 3ENNA 1AKTA 2QR2A 2XT6A 4F96A 1AVTA 1E66A 5CK5A 3DE4X 4DA0A 3R44A 1I7PA 2J4DA 4QJ4A 1L1FA 4ARZB 3D8RA 4D8VA 3L6OO 1R0KA 1QDLB 2Q0HA 3L7IA 1CXZA 3PNKA 2WP8J 1MB0A 4ZVKA 4BMYA 2IYLD 4B6SA 4ZGBA 1R6DA 2NU9A 4PV7A 1UPFA 2ASEA 3DT8A 2QHXA 2G36A 2Q8QA 2CZCA 1NSTA 2MOKA 4LDJA 2NUPB 4WY5A 4YJHA 3SS7X 3E58A 3SDZA 3B20A 3QFHA 2GRJA 3QVKA 1JHPA 3VBCA 5IKXA 2HLDD 4YASA 4YRKA 2PSEA 4R5MA 3THWB 1FUUA 2B3DA 4E1VA 4MGIR 4O0MA 2DVMA 1V11B 2JCXA 2ZKIA 4P7GA 3LVBA 2Q6TA 1VKHA 3ZWQA 3WGNA 4Q02A 1QH8B 2O3SA 4ZOAA 3EGOA 3ZPXA 4BO3A 3K05A 3MBOA 2REXB 1L4KA 3I04M 4CI0B 2WWYA 4Z5XA 1U7HA 2AI1A 5CPBA 4MUXA 4O4IB 4JVOA 1VG9B 5CIYA 4J16C 3W6OA 3O1JC 1J8YF 4RGYA 5EJMA 2IF2A 1MC4A 2RHGB 3O2QB 2Y67A 2O5RA 3N3BC 1HDGO 3U9TA 1N2SA 4KYVA 2PHZA 4YROA 4U7JA 2DM6A 3W6UA 3EUAA 1GFZA 4RMJA 3NGLA 4ZT4A 3P9ZA 3IRUA 1NQXA 3K8QA 1BVRA 4Y2TA 2NGRA 2ZJZA 1Y1LA 2YVUA 1OWNA 3AT1A 4S2UA 1N0IA 2GI4A 4UM9D 3ZTYA 3R9XB 1TE2A 5CTAA 5A7HA 4JUIA 5EQTA 3TAXA 4KK4A 2QRHA 4ZU6X 4BRSA 5EI5A 3CRMA 3C6QA 3MWJA 3OOWA 3CX3A 4Y6QA 4B2YA 4C22A 2R751 3HABA 3N86A 5DEOA 3WRYC 4DLKA 1IC6A 1IY0A 3JQPA 3E23A 1P72A 4U0KA 3L4BA 5AJXA 2RHRA 1ULHA 2JFYA 3RC1A 2CLIB 1NY6A 2FLWA 4YRIA 3DLTA 4G1MB 4DIBA 2OHHA 1HR0B 3WWZA 3RU3A 1BGWA 3X1XA 4ASUD 2BHSA 1QK4A 3A1EA 3NM4A 4Z4QA 1RWPA 1BQ4A 2P2NA 2VHZA 4UU8A 1T0HB 2JEZA 3K31A 2YOFA 4RO0A 1NI4B 3R1IA 2VQDA 1KZ4A 2VDMB 4GZ3A 4XIGS 3WO1A 2ETXA 3OC6A 1C7IA 4GKVA 4JYPA 5FBLB 1SC3A 4R6XA 3X1YA 1IOZA 3HA3A 2HLPA 1T6YA 3D8NA 4BY9E 3L1JA 4PC2A 3R0QA 4MRMB 4KN8A 4PPNA 1T26A 5AUPB 3EWAA 1OBOA 1AK1A 1O2DA 1JEJA 3P9IA 5T8KA 4BVKA 4C5AA 4Q39A 3C6ZA 2A0XA 3HPQA 1F2UB 2OCAA 2VAMA 4YMWA 4NYMR 3X43A 4M21A 2GXAA 3A36A 2HQRA 1QHFA 2IV2X 4Y7CA 4E1BA 2WSYB 2Q0SA 2ZYDA 1LY1A 3V2GA 3WLKX 2EFEB 2V0CA 4BDTA 3O1LA 4EEZA 4TT3A 1NUUA 5JSQA 5FYQA 2KX7A 2W0SA 4L2IA 1BA3A 4L08A 3E0QA 1S7CA 2QYTA 4QUHA 3VSBA 3R3JA 1JB9A 4W5HA 4BQIA 2O2CA 2YCBA 4MI6A 2B2NA 1I4OA 4D0GA 3CZPA 4HYYA 4JNCA 1YB2A 3ZQUA 3FDZB 5A71A 3UMGA 1SBIA 8OHMA 4P53A 1CUDA 3JYQA 4BV8A 1KWGA 4LNUB 2IOFK 3MD9A 3A32A 1HV8A 4FILA 3LXRA 2QZJA 4ISCA 5JJLA 1EU1A 1XPJA 5EIOA 2GN4A 2X8LA 2AOUA 3GLKA 4W9MC 4OQXA 1WDWB 3C8DA 5TARA 3K0SA 5U9CA 1N8TA 1ZBQA 4KH1A 2PXHA 2JH9A 3H9BA 4R7ZA 3VR5H 3BWDD 2EVWX 2VYNA 3BMNB 3GK3A 4FZVA 2ZPAA 2VWGA 4H35A 3WGLA 2FN4A 1GUAA 5K9ZA 5JAMA 3PQ6A 1KSFX 4RAQA 3KB1A 2MCFA 4PHCA 2O6HA 3VXKA 4L5JA 3PLNA 2YOHA 3B85A 5KBYA 1Y89A 5HQTA 3OC0A 4NJOA 1LQUA 4LYYA 2UZ0A 4NENA 1WOMA 4J6EA 5JZSA 4FB4A 1KNQA 1OUMA 4H3KB 3IFSA 3CRZA 3N7TA 5K0EA 4RHUA 2Q46A 2RGWA 1QWSA 3SJZA 1EFAA 2AXEA 1GGKA 4GC5A 1QB8A 4R2WA 3ZHUA 1QSGA 1PZFA 3JVDA 3QE3A 4HDQB 3ERCA 3GUCA 2IYEA 1IUNA 4I3GA 1BJTA 3I6MA 3OCCA 2MMGA 1X8LA 2CHQA 4YXWD 3RVQA 4G36A 4OHBA 1DCMA 4IICA 4OYRA 5A3VA 3TLYA 2BMFA 2HFKA 1BKDR 4OQEA 5TPZA 4CVNA 3HYNA 4R9UC 3PTLA 4F56A 3MHTA 1P9RA 3PJEA 2Q6OA 5DYYA 5AUNB 5EQJB 5H5JA 3EGXB 3EWNA 4OQ4A 4YCMA 3O8OA 2BFFA 3A6EA 1Q5PA 2BDEA 4QAJA 1HE5A 1V3TA 1BO6A 3WV5A 1OU4A 5B36A 3QV2A 4DIDA 2D2IA 3IVXA 3O9MA 2JIBA 2WSBA 3RAEC 4W5JA 1VB5A 1EWKA 1Z56C 2NXEA 3C98A 1OH6A 4E46A 1UBUS 1WUJS 4FHGA 1G8SA 5BYKA 4AY2A 2ID9A 3NTQA 1R7RA 1SUAA 4LZOA 5DBIA 5DTJA 5BSVA 1TJNA 4RJIA 2JGRA 2I6XA 1GSIA 1LK0A 2VO1A 4MW4A 3VGJA 4CLEA 5F3WB 4UW9A 3BMQB 1GILA 5DCWA 2ZM6B 4BE9A 2ODTX 4R1NA 3WHLA 3H9EO 1ZD3A 2IIBA 3PFCA 4BP3A 4EVRA 3OQOA 3HC7A 3NYQA 3OX3A 5T7BA 1W34A 1ZMOA 3WHPA 2OLEA 4A2WA 1HTTA 1FJ2A 4Q7MB 4QBIA 1XQWA 2JHPA 1W1IA 5LR6A 4FOSA 1LQ2A 1GCGA 1S2NA 2WUGA 1HK7A 4RHEA 1V8DA 4F4FA 1CF9A 1I0LA 2ZIEA 1E2QA 2BJWA 2C1EA 2LV8A 3CUEF 3ZV6A 1D7AA 2BHNA 2ORWA 1ZG3A 4UEJA 4DMUB 2VJMB 1VA4A 2ACWA 1X2BA 1YE5A 2VPYA 1PYOA 2O8CB 1O03A 4HLQB 4WFKA 2PIDA 2D54A 2DTXA 4FI3C 4DQLA 1OYOA 4C4XA 2C2HA 2PH7A 2OGSA 4PZ9A 5LYYA 4GPZA 3EH2A 4HCJA 3Q7TA 5BV2P 1DC5A 2J3EA 1DG9A 2HY7A 2D3WA 3F71A 4K9NA 3NOQA 4CG0A 1J8DA 1AV6A 1VYTA 4QICA 1GJRA 1G1AA 5GAJA 4F6RA 2QY6A 3EZNA 1V95A 2HIMA 3PGLA 2YUIA 3U39A 2VJLA 3FM9A 2J9RA 4N3NA 5BN5B 1GU7A 1LK7A 4I4CA 2DFTA 4H15A 4JYCA 3NWBA 5FLYA 1YF3A 1T36A 2H2AA 4D9GA 1CR0A 2XE4A 2OWEA 5JI3E 6YASA 2P6PA 4DB2A 2XB4A 1SXJC 1X0VA 1DJLA 1G20B 3B5IA 1PEDA 3G8CA 4INPA 4R68A 4UD6A 4D26A 1EQUA 5LZ4A 2PYIA 1NU8A 2RGNA 4PZCA 4RKYA 5IN5A 1LRJA 2Z09A 1TT5A 3F2IA 1NAHA 3LH5A 1VL8A 4MUKA 5U4XA 1X86B 3DDNA 1R18A 3DMFA 2C5GA 3U40A 4CN9A 1ESMA 1IDN1 3TZQA 2IY8A 1M0SA 2CNWD 1RABA 1G7SA 3L0DA 3QU4A 1E9EA 1RJDA 4FJ2A 4KVZA 4LQLA 4CQJA 4Z1OA 5JCXA 2FFQA 5AHWA 4ALKA 4TYNA 2QSUA 3B1WA 1P3JA 2H1IA 5CFQA 1GUZA 1VKRA 1L7QA 5B1HA 1XTTA 4TN5A 4AP5A 4RV4A 3RRZA 1O6CA 3FRIA 3CSDA 3PBKA 1OU0A 2H59A 3TE7A 4TTAA 3FGOA 3IRVA 3LPDA 2AVNA 3LHSA 3SVLA 3KFLA 2QMYA 1W47A 2W6OA 2HJRA 4K6OA 3TIGA 2EG9A 4AZ3B 3ED1A 4RLFA 2B7LA 2Q6LA 1THGA 2BFNA 1KEPA 4MUJA 4S2EA 5EXTA 3STUA 2JJ2D 2I76A 4M0FA 3FCXA 3V1TC 4DSZA 1L7EA 3L6RA 3PJFA 1NV9A 1U2PA 2BEJA 2PX0A 4HXGA 5I9MA 2XV1A 2Y92A 5AW5A 2H1FA 1L0BA 1QHXA 2HK9A 1LB1B 4FIZA 4JBIA 4JR2A 5K3DA 3LTEA 1WXWA 2F2TA 2JGJA 3S8EA 1XD2B 2P68A 3C5VA 4X00A 3CA8A 4X5OA 4EHJA 4BFXA 2CYAA 3OCUA 4WJLA 3MK31 4KI7A 4Y9DA 3S55A 2V97A 2JG3A 1HE4A 1P44A 3OURA 3V8PA 3SXUA 2KLBA 4C0KA 1IE3A 3W9UA 4B6FA 4ZJZA 4JEMA 4IDAA 2BVNA 4WV3A 2ONYA 1UK7A 2H1HA 1UOPA 4EY4A 3NGMA 2GVZC 3I8OA 3DBIA 1NI3A 1CR6A 1I3KA 1GPMA 4ZOLB 4BGDA 3LZCA 4CNQA 2AJTA 2BMWA 4WESB 2FR8A 2O3QA 4GI7A 2XMCA 1SQ5A 2WM9B 4IBOA 4IL5A 4N1AA 4OGKA 3Q3CA 2X6TA 1RQXA 4OBEA 2R6R1 4DWVA 2BGRA 5DNYB 3G1WA 2P7HA 3BQ9A 4MO2A 3TR0A 4F04A 3D5QA 4Z1MD 3R6TA 2QVYX 5EN4A 1RQRA 3LX6A 3M1YA 4V0KA 1ODIA 1IOLA 1TUBB 2PRYA 2W8BB 2P3LA 1FSGA 1MXFA 2WJ4A 3Q2KA 1FMFA 3QJ5A 5BN1A 2O7VA 1UEJA 3N2EA 2P7IA 4NZZA 5DXAA 3IEUA 5H59A 5AKIA 1U02A 4XFJA 2O54A 3AJAA 3VH2A 1OTYA 1OT5A 4QUGA 1FRZA 1QG2A 3KJNA 5ECDA 5BP7A 3I30X 1EM8A 2IZ7A 1O97D 2F3RA 3OM8A 4LYJA 2QEQA 2J3QA 1RIIA 4NV0A 2IUTA 1IUKA 1T0UA 4NG4A 4CLRA 2H4ZA 2Q3HA 5D2CA 1TF5A 1UJCA 2DERA 2L18A 4ZHQB 4M99A 3ENQA 3W2HA 1UANA 5HOEA 2Z98A 4BNHA 5CXSA 4EL0A 1Y80A 3BXFA 3NP9A 3TDNA 3UYLA 1IHPA 2R2AA 3DAGA 5KQLA 3B1ZA 3EHEA 4X54A 2JJQA 2XD4A 1XCOA 4UUPA 2G06A 3G0GA 3AVOA 2ARKA 2BM9A 1EZZA 5HVNA 4NLLA 5DX0A 1U2SA 4MINA 1QRDA 1RZVA 1ZVJA 1P60A 2EJTA 2CYCA 4IRMA 4GS5A 3JPYA 4BFYA 1PUIA 3CRVA 3PIDA 4QYXA 4U3JA 4OHYA 2FDXA 2GN0A 1KBQA 1TZBA 1GTRA 1ECBA 3SKVA 1D5CA 3WIDA 4KFSA 1AMNA 4V03A 3E1KA 3SQWA 1MC1A 2VYVD 4PLHA 4QASA 1GDTA 2I4OA 2YJNA 4RK4A 4WZBB 3VHQA 4RMGA 3ZWDA 2XWPA 2YV3A 5ESWA 1E7RA 2ES4A 1ML4A 4DIUA 2FW6A 4IV8A 3WLPA 1WNFA 3O74A 5DGHA 4OB6A 5GZ3A 4KKXB 2R6HA 4IZHA 4N82A 3VOAA 1I2CA 5J5VA 2HTFA 1C1YA 3MJSA 1C5KA 3HI6A 1W5SA 4IUBS 5ESDA 6LDHA 5I48A 3LZDA 2O2GA 4EBFA 3TK1A 1ICEA 3TX6A 5IK2D 4NECA 1XYGA 3KHKA 5KNBD 4XGRA 1NC1A 2DFNA 1V8OA 1HY3A 4WBSA 3E8SA 2P35A 3HYTA 3MG9A 1FX1A 4DZRA 1WX1A 2J9XB 2NAFA 5J1SB 3W2TA 5DYGA 2BZ1A 2X40A 2UUOA 3HKCA 4FKZA 1YBMA 4GNKA 1A8QA 4HRAA 4DA8A 3TKYA 4YCLA 2UZ3A 5B64A 1PT7A 4MI9A 5BNWA 1P2FA 1PAUA 1T1GA 2F9FA 2JBWA 3ETGA 3G8DA 3T7CA 5KYNA 1Q20A 4B3MB 5CLLA 1MJGM 3W05A 4DDHA 121PA 3PQ5A 3MXOA 1PGPA 3B48A 3R7BA 1YS7A 4TLCA 3TTWA 1N3LA 4EFMA 3ROZA 4HD8A 5KJ1A 3L8FA 3KG2A 1Q83A 1TU0A 4RBNA 5CGQB 4TVSA 2BTQB 1TOAA 3ANTA 1L5NA 3A9SA 3SIRA 3PKIA 3UH1A 2PJDA 4RXMA 5AI5A 1UBCA 3KQQA 4QPNA 1SVLA 2FGJA 4G4IA 4LF9B 2VJKA 3IEPA 5TQ0A 3RVNA 1H8EA 1QOPB 4G67A 3MJFA 1AUOA 3P32A 3S44A 5ALQA 4UBKA 4ZFNA 1SXPA 1QYVA 1B8UA 1DO0A 2JIRA 2WYIA 1SKMA 4AMGA 2VTBB 4TRMA 4CEHA 3DBLB 2O07A 1HT3A 2CCJA 5EMHA 3EEBA 1ISRA 4HRYA 4G5OA 4IO0A 4L3OA 3LX5A 4S0ZA 5TE9A 3JAMA 1EGAA 1V96A 2IEAA 1GDDA 3TZKA 3LO8A 3NS7A