3D5GA

Structure of ribonuclease sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5gA00
1FUTA 2GSPA 1B2ZA 4J5KA 2KF6A 1B3SA 1FW7A 1RGAA 1BNGA 1BNEA 3A5EA 1I0VA 1Q9EA 1BSCA 1I2FA 2HOHA 1BRKA 1BSEA 1LNIA 1BRGA 3BIRA 4GHOA 8RNTA 1C54A 4GSPA 1BNFA 2F4YA 1BRNL 3DH2A 1I70A 1RDSA 1YNVX 1LOWA 6RNTA 1RGLA 1DETA 1B20A 3D4AA 1AQZA 1X1UA 2F5MA 1YVSA 1FUSA 4HAAA 2F56A 1TRQA 1GOYA 7GSPA 1RGGA 1GSPA 5BIRA 1BIRA 1BRHA 3URPA 4HOHA 1BU4A 1B2UA 1RGKA 1BSBA 2AADA 5GSPA 3AGOA 1ZGXA 1I2GA 1RGCA 1UCJA 3GSPA 4RNTA 1BSAA 1PY3A 4J5GA 3D5GA 1SARA 6GSPA 1JBSA 1X1WA 1RHLA 1T2IA 2BU4A 4BIRA 1GMQA 1B2MA 1RMSA 1RSNA 1GMPA 1B21A 1RCLA 1TRPA 1I0XA 1A2PA 1CH0A 1RGFA 1BRSA 1BGSA 1G02A 1BRJA 1MGRA 3KCHA 1RGHA 3RNTA 4BU4A 2C4BA 1AY7A 1I8VA 1RGEA 1LOYA 3WHOA 7RNTA 1BANA 1X1YA 2KF4A 1RTUA 1X1XA 2SARA 1I2EA 2F5WA 3HOHA 1MGWA 2KF3A 3AHWA 2KAAA 1BNIA 1LOVA 3Q3FA 5HOHA 2AAEA 2ZA4A 5BU4A 1RCKA 2RNTA 1BUJA 1UCIA 1BRIA 1RN4A 1BOXA 1FZUA 1GOVA 1I3IA 1I3FA 3AHSA 2KF5A 1GMRA 3DGYA 1UCLA 1B27A 1FYSA 1BNJA 5RNTA 1HZ1A 3AGNA 1B2XA 1GOUA 1IYYA 1BVIA 1YGWA 1BNRA 1BNSA 2RBIA 1HYFA 1BSDA 2BIRA 1RNTA 3BU4A 1T2HA 3D5IA 9RNTA 1PYLA 1B2SA 1RN1A 1JBTA 1R4YA 1TTOA 1RNBA 1JBRA 3SYUA 1UCKA 1RLSA 3WR2A 1LRAA 1BAOA 1DE3A
chains in the Genus database with same CATH superfamily
2W56A 3DM8A 3GRDA 5M1AA 3U97A 3SXXA 1JRQA 2GEYA 1TUHA 1B3SA 1OACA 2F99A 2XGNA 3LXUX 3X42A 1IV9A 3DMCA 1Q40A 3A5EA 2ML6A 2UGIA 4KFFA 5DREA 4X2HA 3CXC2 1JV2B 3UB1A 3GZRA 3HX8A 1GY7A 1T5YA 1C54A 1BNFA 1EEJA 1VQL3 2HMNB 1AVKA 1YNVX 2F86B 2W9PA 1OPYA 3AMOA 4EV5A 2RSXA 6RNTA 2CFGA 3DUKA 4WP5A 3VGNA 5BVBA 3CCR3 4KZ1A 4HM8B 4RZMA 3H3HA 2F5MA 2BT3A 2QIYA 3LTCA 2M7OA 3D3LA 3HI7A 3OWYA 1QAFA 3G6E3 4HJLB 3SOAA 1IQYA 2INXA 3CCE3 2F56A 3S27A 3I553 1JJ22 7GSPA 1U5OA 3T8UA 1UI7A 4LZIA 5A0OB 1E3RA 1RRLA 1YIT3 5IG0A 2K54A 1FA3A 4I5QA 2CFLA 1ZGXA 5G1LA 1FGTA 1I2GA 4RNTA 3BNEA 5IW9A 4LGQA 1OUNA 1PY3A 3DXOA 4WYKB 3CD63 3KIIA 2WOFA 2BHMA 3LT8A 4MMZB 6GSPA 3B7CA 1JBSA 3V99A 1GMQA 1M1XB 2ZHXB 1RSNA 3FG1A 1B2MA 1GMPA 2UUGC 1W02A 3EF8A 4R80A 1B21A 5AYRB 4HM2B 2L1SA 1A2PA 1I0XA 1Q7Y4 4BL3A 4L8OA 1BRSA 1NU3A 1MGRA 1GD4A 2C4BA 1IV7A 1I8VA 1RGEA 1UW1A 5AIHA 2XF3A 3S28A 1U8CB 2XFSA 3LT9A 3V92A 4KVHA 1HKXA 2HMMB 2ZL8A 1X1YA 3KSPA 2QEX3 1OF5A 3MKIA 3EN1B 2SARA 3NM7A 1MGWA 1E3VA 1Q824 3FSDA 5D81A 1DVDA 4N6NB 4XM4A 1BNIA 1LOVA 1NDOB 4R9LA 3D9RA 1NB5I 1JB2A 4IIAA 1IVWA 2RNTA 5IENA 3QRDA 2GXFA 1UCIA 2CWVA 2D1WA 1RN4A 2W56B 3D79A 4K61A 1FZUA 1GOVA 1R4CA 1Y4KA 1ULJB 1I3FA 2W2CA 2FXTA 3I563 3WA3A 1KC84 1Q40B 1IVXA 5EEOA 2UX0A 1HZ1A 1BUQA 3EHCA 3DZLA 1B2XA 3EX9A 1A2VA 4KFEA 3F8XA 3EQQB 3X3YA 1YGWA 3B4PA 4FCZA 2BIRA 2CW9A 3G8ZA 1A2KA 1FGMA 9RNTA 3AMOB 1D6UA 3HZPA 1D6ZA 3PXMA 3STDA 2Y74A 1B2SA 1RN1A 4ORLA 1AV4A 1R4YA 2XRXB 1IK3A 1VQ63 4HYZA 1UGIA 5EQLA 1WNHA 4FR9A 1LNHA 4OK0A 4WYKA 1JZOA 4IPBA 3WR2A 3CCJ3 3MWZA 3LZAA 3X3ZA 3EB8A 1VQ83 3LMLA 3S29A 4CJNA 4J5KA 3LYGA 4WFOA 1FW7A 4BTXA 1I2FA 2XH9A 2HOHA 1EKMA 2OQEA 1BRKA 5ELJA 1AR0A 3GWRA 1KWIA 1BSEA 1MWRA 1BRGA 1SQWA 2HMLB 4GHOA 3NBBA 4XBTA 8RNTA 4EW5A 2YFIB 1VQP3 2W04A 3DH2A 3H51A 1VQK3 3CCQ3 2R41A 3FZWA 4LSOA 4HM6B 4KT3B 2GBXB 4LMIA 5I97A 1RGLA 1WMNA 2KRTA 1QALA 3KE7A 1GY5A 2E2VA 3DY5A 4H61A 1AQZA 3WOEB 1VQ43 1K8A4 4XDVA 3KKGA 1FGOA 3MPHA 4XDWA 4XBXA 3CME3 3S5CA 1OF5B 3NBRA 2FGTA 5TGNA 4RBNA 3FLJA 2P38A 5BIRA 3L0RA 3MG3A 3DGLA 1W2B2 1BSBA 5G2GA 2L4VA 1K41A 1HU9A 3GZBA 2OTL3 4HM7B 3Q90A 4O02B 2KXGA 4BTYA 5BXQA 4HVNA 5G1KA 2XGLA 4J5GA 4N6LA 4MMXB 5EVHA 3FKAA 5ELUA 1IVVA 1X1WA 1ROAA 1OCVA 2P09A 4BIRA 3NUVA 1LVNA 3K0ZA 2W6JH 1RMSA 1N8R4 1EA2A 5AEWB 1W6GA 1RCLA 3F9SA 1S723 4AEQA 1TFOA 2WGQA 2ML5A 1RRHA 2OCTA 3PYJA 1ZX2A 1OHSA 1BRJA 4XB5A 3KCHA 3CNXA 1W4NA 1DVCA 1UGHI 1V57A 3GZYB 1K734 4LYLB 1S5AA 1F8NA 7RNTA 1BANA 3I0YA 3CC43 3FF0A 2Z7AA 4EBGA 3MHEA 1VQQA 3BLZA 4N6OB 5AEUB 1YI23 3M8CA 3KSED 3AHWA 2KAAA 3VF1A 1YJN3 3OXAA 2OWPA 5HOHA 1VQ93 2AAEA 2ZA4A 3FGYA 4G1MB 3QK9A 1AVLA 2IUJA 1RJOA 3N54B 2OQEC 2D42A 4PEJA 3G4S3 2MC8A 4HM4B 2MF7A 4HM1B 3AHSA 5LC6A 2KF5A 4O3VA 1GMRA 6STDA 1TU5A 3IJEB 2E2TA 4BTWA 3HIIA 4FMDA 1US1A 1FYSA 3SOYA 4EYCA 3AGNA 2J8XB 2W9QA 2W03A 3BB9A 1K9M4 2P0MA 2OOVA 3PZWA 2Z6BA 2RGQA 2XEPA 8CHOA 2O3OA 4GL6A 7STDA 1OGXA 2I9WA 3F14A 1BSDA 2IYJA 2F98A 3D5IA 1WQLB 4HZ9B 1TJDA 4O2HA 3Q2PA 4MEIA 2CG1A 3OV4A 1ZO2A 3SX1A 1O7NB 2WGOA 2BNGA 2Y73A 1LQGC 5KP1A 1W00A 1E97A 5CF1A 5LC7A 2XSOB 1JB4A 1JKGA 2O9UX 3JUPA 1LRAA 3F7XA 3N8BA 3OWUA 4Q53A 3NHXA 4GB5A 4R1KA 3CCV3 2QA43 2BMOB 3MG2A 1B2ZA 4U13A 1D6YA 2RFRA 2KF6A 1RGAA 3K7CA 5IEOA 3CCM3 1BSCA 1WMPA 1OGZA 1STDA 3FF2A 1MWTA 5JBSA 4N6MA 2YX9A 5AYSC 1VQO3 4TX4A 2FNQA 3BIRA 3NQZA 1UDII 1QVG2 5CK6A 4GSPA 1YGEA 1CEWI 2HMOB 5AIFA 2F4YA 3JVCA 4QWTA 1QAKA 1LOXA 1I70A 2Z76A 1LOWA 4K90B 1YVBI 2SBLA 5CXOA 1DMQA 3NXJA 3NQYA 3CCS3 1B20A 3EBTA 1UI8A 3NV0A 3OW22 5D82A 1PFPA 1O7MB 4MJDA 1YVSA 1VQ73 3J7Yd 2V1LA 1SPUA 1FUSA 3G713 1TRQA 2P0XA 3EE1A 3S67A 1GSPA 1NNVA 1BIRA 1BRHA 2XR8B 3PCRA 3URPA 4HOHA 1BU4A 1B2UA 1ISKA 2AADA 3JUOA 3AGOA 5GSPA 3X3XA 1DYUA 4N6TA 4NHFA 3DGMA 3ZG0A 3U1WA 1O7PB 1UCJA 1W6CA 1C7HA 2CIUA 3MYTA 1YHQ3 3D5GA 2CH9A 1SARA 1TIJA 4NREA 1YIJ3 1KQS2 1N8QA 2OOVC 1G0TA 4CDLA 3CPW2 1CQSA 1MOLA 1IT7A 3K9MC 2QGUA 3CPOA 4K1UA 1TRPA 3KFQC 2JQ5A 1Q814 5AIIA 1CH0A 1SIIA 1RGFA 3B4OA 1BGSA 1G02A 3NBJA 3ZFZA 2BMQB 1PU4A 1FUWA 3UNLA 1AY7A 2Z77A 1WTHA 3UJMA 1LOYA 1UUWB 1JZDA 4FCJA 4RNZA 3T0UA 4XBYA 2CHCA 3EJVA 4H3UA 1QVF2 4JF8A 1X1XA 1Z1SA 2CG0A 4FMBA 4HBRA 1Q864 2F5WA 3WODG 1CYUA 5HGRA 4X2OA 1O7WB 4BL2A 3Q3FA 3DGOA 1N9JA 1NB3I 1JKGB 2B24B 3IMAB 5IEPA 3ER7A 1EG9B 3CCL3 1ASKA 1OH0A 1BUJA 2LQVA 1BOXA 1JB5A 1MWSA 1I3IA 1SJWA 3K5TA 5STDA 1KD14 1JN5A 1FGQA 1NO3A 4CPKA 4HM5B 1RN7A 3UL5A 5KP4A 4OUQA 1UCLA 2ZDJA 3HK4A 3DGNA 1B27A 3RGRA 1BNJA 4N3VA 2HMJB 5IERA 5RNTA 3FG3A 3CC73 1IQXA 3JUQA 3OWSA 2K0MA 4L7KA 1GD3A 3HIGA 2C10A 1BVIA 1Q42A 2CWTA 1BNSA 2RBIA 5JPUA 5IG4A 1HYFA 2GBWB 3SLUA 3CCU3 3UL6A 1G96A 1T2HA 2H0HA 3BU4A 4KFDA 1PYLA 1OHOA 1KSIA 4K1VA 1J2BA 4LEHA 1YJ93 1A67A 3GZXB 2RCDA 3OX9A 1N9EA 3A76A 3LTBA 3NV0B 1NJI4 4FMAA 2HMKB 3PGBA 3SVAA 1RNBA 3SEDA 3FCSB 3SYUA 3WOFB 1GYBA 1VZZA 1EUIC 3F40A 1QMAA 2W0QA 1BAOA 3BNBA 3WDGB 1VQ53 3RGAA 5AI1A 4FMCA 4NPBA 1FUTA 2GSPA 1TFKA 3G0KA 4HZBB 2JDIH 3JUMA 5D83A 2P05A 2CC3A 1OHPA 1NWWA 4HM3B 1Q7HA 1BNGA 3WA2X 1BNEA 1I0VA 1Q9EA 4R4KA 2XSHB 5JPPA 1M904 1MWUA 1W5ZA 2CK3H 3KZTA 3T8NA 4R9KA 4J8TA 1LNIA 2IA7A 4N6V0 2STDA 1T3BA 3LOYA 4ZM8A 3F7SA 4N6UA 3BNCA 3EC9A 1FGRA 1BRNL 3CMA3 2GEXA 2B1XB 3MG1A 1RDSA 1V58A 5AIGA 1N5PA 1DMNA 5IG3A 1DETA 3IPTA 4JRFA 3D4AA 1IDPA 3N9HA 4IT7A 1X1UA 3WMDA 4EV2A 5DRVA 2PNCA 5M18A 4HAAA 3NX0A 3F8HA 3X41A 1GOYA 2LYXA 1RGGA 2PZVA 2E2UA 2Q07A 3MSOA 4J9AA 1RGKA 3PS8A 1W6YA 1ROVA 2YFJB 2YFLB 1EQKA 2C11A 4L8PA 1IVUA 3CU3A 3CC23 1RGCA 3GSPA 1BSAA 1LXEA 3GAXA 2KCDA 3B8LA 1O7HB 2K3DA 4I4KA 5FW5A 3RDEA 3V98A 4O8SA 1JN5B 4EC6A 1RHLA 1T2IA 2BU4A 3O8YA 1YJW3 2H0IA 1K28A 3ZG5A 2GU3A 4WWUC 4EXRA 5KP3A 5CLKA 2BMRB 1N5HA 3TDGA 2IUKA 3VSYA 1STFI 2H0GA 3E99A 3LTAA 3FH1A 4FCMA 1RGHA 3RNTA 1GS3A 4BU4A 4HKVB 1VQM3 1M1K4 2R4IA 2BO9B 3EN8A 2WOHA 3WHOA 3LH4A 5IF6A 5M19A 2KF4A 1RTUA 1A90A 4MMYB 1I2EA 3HOHA 3Q1CA 1IT8A 2KF3A 1M9GA 2CFKA 5FGOA 2OTJ3 2CWUA 1W7CA 1L5GB 1IU7A 2IY2A 2WO0A 3ECFA 3BNDA 1W2ZA 2GU1A 5BU4A 1RCKA 3CNMA 4AKZA 1BRIA 1UUVB 2CKFB 2CFDA 1IQ8A 4AKYA 3DGYA 3G16A 4HM0B 4RNYA 4CCVA 1LQMB 2CFWA 5IG5A 4OVMA 2IMJA 3KN4A 3LTDA 1ZS7A 2A15A 4STDA 3NM2A 1GOUA 5CF2A 1IYYA 1GY6A 1JNQA 1RKYA 1VQN3 1BNRA 1SIHA 3ALAA 4DKIA 1ULIB 1O7GB 3FG4A 2XFTA 2CX0A 4WHAA 1RNTA 1UUGB 1W01A 3X40A 1QJGA 1DMMA 1WMOA 1V74A 1TP6A 1MNLA 3JUNA 1TTOA 4ILFA 3EBYA 3ROBA 3PCSA 2CX1A 1JBRA 1UCKA 1RLSA 1CYVA 1JBTA 3K63A 1DE3A
chains in the Genus database with same CATH topology
1FUTA 2GSPA 1B2ZA 4J5KA 2KF6A 1B3SA 1FW7A 1RGAA 1BNGA 1BNEA 3A5EA 1I0VA 1Q9EA 1BSCA 1I2FA 2HOHA 1BRKA 1BSEA 1LNIA 1BRGA 3BIRA 4GHOA 8RNTA 1C54A 4GSPA 1BNFA 2F4YA 1BRNL 3DH2A 1I70A 1RDSA 1YNVX 1LOWA 6RNTA 1RGLA 1DETA 1B20A 3D4AA 1AQZA 1X1UA 2F5MA 1YVSA 1FUSA 4HAAA 2F56A 1TRQA 1GOYA 7GSPA 1RGGA 1GSPA 5BIRA 1BIRA 1BRHA 3URPA 4HOHA 1BU4A 1B2UA 1RGKA 1BSBA 2AADA 5GSPA 3AGOA 1ZGXA 1I2GA 1RGCA 1UCJA 3GSPA 4RNTA 1BSAA 1PY3A 4J5GA 3D5GA 1SARA 6GSPA 1JBSA 1X1WA 1RHLA 1T2IA 2BU4A 4BIRA 1GMQA 1B2MA 1RMSA 1RSNA 1GMPA 1B21A 1RCLA 1TRPA 1I0XA 1A2PA 1CH0A 1RGFA 1BRSA 1BGSA 1G02A 1BRJA 1MGRA 3KCHA 1RGHA 3RNTA 4BU4A 2C4BA 1AY7A 1I8VA 1RGEA 1LOYA 3WHOA 7RNTA 1BANA 1X1YA 2KF4A 1RTUA 1X1XA 2SARA 1I2EA 2F5WA 3HOHA 1MGWA 2KF3A 3AHWA 2KAAA 1BNIA 1LOVA 3Q3FA 5HOHA 2AAEA 2ZA4A 5BU4A 1RCKA 2RNTA 1BUJA 1UCIA 1BRIA 1RN4A 1BOXA 1FZUA 1GOVA 1I3IA 1I3FA 3AHSA 2KF5A 1GMRA 3DGYA 1UCLA 1B27A 1FYSA 1BNJA 5RNTA 1HZ1A 3AGNA 1B2XA 1GOUA 1IYYA 1BVIA 1YGWA 1BNRA 1BNSA 2RBIA 1HYFA 1BSDA 2BIRA 1RNTA 3BU4A 1T2HA 3D5IA 9RNTA 1PYLA 1B2SA 1RN1A 1JBTA 1R4YA 1TTOA 1RNBA 1JBRA 3SYUA 1UCKA 1RLSA 3WR2A 1LRAA 1BAOA 1DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUT A;  2GSP A;  1B2Z A;  4J5K A;  2KF6 A;  1B3S A;  1FW7 A;  1RGA A;  1BNG A;  1BNE A;  3A5E A;  1I0V A;  1Q9E A;  1BSC A;  1I2F A;  2HOH A;  1BRK A;  1BSE A;  1LNI A;  1BRG A;  3BIR A;  4GHO A;  8RNT A;  1C54 A;  4GSP A;  1BNF A;  2F4Y A;  1BRN L;  3DH2 A;  1I70 A;  1RDS A;  1YNV X;  1LOW A;  6RNT A;  1RGL A;  1DET A;  1B20 A;  3D4A A;  1AQZ A;  1X1U A;  2F5M A;  1YVS A;  1FUS A;  4HAA A;  2F56 A;  1TRQ A;  1GOY A;  7GSP A;  1RGG A;  1GSP A;  5BIR A;  1BIR A;  1BRH A;  3URP A;  4HOH A;  1BU4 A;  1B2U A;  1RGK A;  1BSB A;  2AAD A;  5GSP A;  3AGO A;  1ZGX A;  1I2G A;  1RGC A;  1UCJ A;  3GSP A;  4RNT A;  1BSA A;  1PY3 A;  4J5G A;  3D5G A;  1SAR A;  6GSP A;  1JBS A;  1X1W A;  1RHL A;  1T2I A;  2BU4 A;  4BIR A;  1GMQ A;  1B2M A;  1RMS A;  1RSN A;  1GMP A;  1B21 A;  1RCL A;  1TRP A;  1I0X A;  1A2P A;  1CH0 A;  1RGF A;  1BRS A;  1BGS A;  1G02 A;  1BRJ A;  1MGR A;  3KCH A;  1RGH A;  3RNT A;  4BU4 A;  2C4B A;  1AY7 A;  1I8V A;  1RGE A;  1LOY A;  3WHO A;  7RNT A;  1BAN A;  1X1Y A;  2KF4 A;  1RTU A;  1X1X A;  2SAR A;  1I2E A;  2F5W A;  3HOH A;  1MGW A;  2KF3 A;  3AHW A;  2KAA A;  1BNI A;  1LOV A;  3Q3F A;  5HOH A;  2AAE A;  2ZA4 A;  5BU4 A;  1RCK A;  2RNT A;  1BUJ A;  1UCI A;  1BRI A;  1RN4 A;  1BOX A;  1FZU A;  1GOV A;  1I3I A;  1I3F A;  3AHS A;  2KF5 A;  1GMR A;  3DGY A;  1UCL A;  1B27 A;  1FYS A;  1BNJ A;  5RNT A;  1HZ1 A;  3AGN A;  1B2X A;  1GOU A;  1IYY A;  1BVI A;  1YGW A;  1BNR A;  1BNS A;  2RBI A;  1HYF A;  1BSD A;  2BIR A;  1RNT A;  3BU4 A;  1T2H A;  3D5I A;  9RNT A;  1PYL A;  1B2S A;  1RN1 A;  1JBT A;  1R4Y A;  1TTO A;  1RNB A;  1JBR A;  3SYU A;  1UCK A;  1RLS A;  3WR2 A;  1LRA A;  1BAO A;  1DE3 A; 
#chains in the Genus database with same CATH topology
 2W56 A;  3DM8 A;  3GRD A;  5M1A A;  3U97 A;  3SXX A;  1JRQ A;  2GEY A;  1TUH A;  1B3S A;  1OAC A;  2F99 A;  2XGN A;  3LXU X;  3X42 A;  1IV9 A;  3DMC A;  1Q40 A;  3A5E A;  2ML6 A;  2UGI A;  4KFF A;  5DRE A;  4X2H A;  3CXC 2;  1JV2 B;  3UB1 A;  3GZR A;  3HX8 A;  1GY7 A;  1T5Y A;  1C54 A;  1BNF A;  1EEJ A;  1VQL 3;  2HMN B;  1AVK A;  1YNV X;  2F86 B;  2W9P A;  1OPY A;  3AMO A;  4EV5 A;  2RSX A;  6RNT A;  2CFG A;  3DUK A;  4WP5 A;  3VGN A;  5BVB A;  3CCR 3;  4KZ1 A;  4HM8 B;  4RZM A;  3H3H A;  2F5M A;  2BT3 A;  2QIY A;  3LTC A;  2M7O A;  3D3L A;  3HI7 A;  3OWY A;  1QAF A;  3G6E 3;  4HJL B;  3SOA A;  1IQY A;  2INX A;  3CCE 3;  2F56 A;  3S27 A;  3I55 3;  1JJ2 2;  7GSP A;  1U5O A;  3T8U A;  1UI7 A;  4LZI A;  5A0O B;  1E3R A;  1RRL A;  1YIT 3;  5IG0 A;  2K54 A;  1FA3 A;  4I5Q A;  2CFL A;  1ZGX A;  5G1L A;  1FGT A;  1I2G A;  4RNT A;  3BNE A;  5IW9 A;  4LGQ A;  1OUN A;  1PY3 A;  3DXO A;  4WYK B;  3CD6 3;  3KII A;  2WOF A;  2BHM A;  3LT8 A;  4MMZ B;  6GSP A;  3B7C A;  1JBS A;  3V99 A;  1GMQ A;  1M1X B;  2ZHX B;  1RSN A;  3FG1 A;  1B2M A;  1GMP A;  2UUG C;  1W02 A;  3EF8 A;  4R80 A;  1B21 A;  5AYR B;  4HM2 B;  2L1S A;  1A2P A;  1I0X A;  1Q7Y 4;  4BL3 A;  4L8O A;  1BRS A;  1NU3 A;  1MGR A;  1GD4 A;  2C4B A;  1IV7 A;  1I8V A;  1RGE A;  1UW1 A;  5AIH A;  2XF3 A;  3S28 A;  1U8C B;  2XFS A;  3LT9 A;  3V92 A;  4KVH A;  1HKX A;  2HMM B;  2ZL8 A;  1X1Y A;  3KSP A;  2QEX 3;  1OF5 A;  3MKI A;  3EN1 B;  2SAR A;  3NM7 A;  1MGW A;  1E3V A;  1Q82 4;  3FSD A;  5D81 A;  1DVD A;  4N6N B;  4XM4 A;  1BNI A;  1LOV A;  1NDO B;  4R9L A;  3D9R A;  1NB5 I;  1JB2 A;  4IIA A;  1IVW A;  2RNT A;  5IEN A;  3QRD A;  2GXF A;  1UCI A;  2CWV A;  2D1W A;  1RN4 A;  2W56 B;  3D79 A;  4K61 A;  1FZU A;  1GOV A;  1R4C A;  1Y4K A;  1ULJ B;  1I3F A;  2W2C A;  2FXT A;  3I56 3;  3WA3 A;  1KC8 4;  1Q40 B;  1IVX A;  5EEO A;  2UX0 A;  1HZ1 A;  1BUQ A;  3EHC A;  3DZL A;  1B2X A;  3EX9 A;  1A2V A;  4KFE A;  3F8X A;  3EQQ B;  3X3Y A;  1YGW A;  3B4P A;  4FCZ A;  2BIR A;  2CW9 A;  3G8Z A;  1A2K A;  1FGM A;  9RNT A;  3AMO B;  1D6U A;  3HZP A;  1D6Z A;  3PXM A;  3STD A;  2Y74 A;  1B2S A;  1RN1 A;  4ORL A;  1AV4 A;  1R4Y A;  2XRX B;  1IK3 A;  1VQ6 3;  4HYZ A;  1UGI A;  5EQL A;  1WNH A;  4FR9 A;  1LNH A;  4OK0 A;  4WYK A;  1JZO A;  4IPB A;  3WR2 A;  3CCJ 3;  3MWZ A;  3LZA A;  3X3Z A;  3EB8 A;  1VQ8 3;  3LML A;  3S29 A;  4CJN A;  4J5K A;  3LYG A;  4WFO A;  1FW7 A;  4BTX A;  1I2F A;  2XH9 A;  2HOH A;  1EKM A;  2OQE A;  1BRK A;  5ELJ A;  1AR0 A;  3GWR A;  1KWI A;  1BSE A;  1MWR A;  1BRG A;  1SQW A;  2HML B;  4GHO A;  3NBB A;  4XBT A;  8RNT A;  4EW5 A;  2YFI B;  1VQP 3;  2W04 A;  3DH2 A;  3H51 A;  1VQK 3;  3CCQ 3;  2R41 A;  3FZW A;  4LSO A;  4HM6 B;  4KT3 B;  2GBX B;  4LMI A;  5I97 A;  1RGL A;  1WMN A;  2KRT A;  1QAL A;  3KE7 A;  1GY5 A;  2E2V A;  3DY5 A;  4H61 A;  1AQZ A;  3WOE B;  1VQ4 3;  1K8A 4;  4XDV A;  3KKG A;  1FGO A;  3MPH A;  4XDW A;  4XBX A;  3CME 3;  3S5C A;  1OF5 B;  3NBR A;  2FGT A;  5TGN A;  4RBN A;  3FLJ A;  2P38 A;  5BIR A;  3L0R A;  3MG3 A;  3DGL A;  1W2B 2;  1BSB A;  5G2G A;  2L4V A;  1K41 A;  1HU9 A;  3GZB A;  2OTL 3;  4HM7 B;  3Q90 A;  4O02 B;  2KXG A;  4BTY A;  5BXQ A;  4HVN A;  5G1K A;  2XGL A;  4J5G A;  4N6L A;  4MMX B;  5EVH A;  3FKA A;  5ELU A;  1IVV A;  1X1W A;  1ROA A;  1OCV A;  2P09 A;  4BIR A;  3NUV A;  1LVN A;  3K0Z A;  2W6J H;  1RMS A;  1N8R 4;  1EA2 A;  5AEW B;  1W6G A;  1RCL A;  3F9S A;  1S72 3;  4AEQ A;  1TFO A;  2WGQ A;  2ML5 A;  1RRH A;  2OCT A;  3PYJ A;  1ZX2 A;  1OHS A;  1BRJ A;  4XB5 A;  3KCH A;  3CNX A;  1W4N A;  1DVC A;  1UGH I;  1V57 A;  3GZY B;  1K73 4;  4LYL B;  1S5A A;  1F8N A;  7RNT A;  1BAN A;  3I0Y A;  3CC4 3;  3FF0 A;  2Z7A A;  4EBG A;  3MHE A;  1VQQ A;  3BLZ A;  4N6O B;  5AEU B;  1YI2 3;  3M8C A;  3KSE D;  3AHW A;  2KAA A;  3VF1 A;  1YJN 3;  3OXA A;  2OWP A;  5HOH A;  1VQ9 3;  2AAE A;  2ZA4 A;  3FGY A;  4G1M B;  3QK9 A;  1AVL A;  2IUJ A;  1RJO A;  3N54 B;  2OQE C;  2D42 A;  4PEJ A;  3G4S 3;  2MC8 A;  4HM4 B;  2MF7 A;  4HM1 B;  3AHS A;  5LC6 A;  2KF5 A;  4O3V A;  1GMR A;  6STD A;  1TU5 A;  3IJE B;  2E2T A;  4BTW A;  3HII A;  4FMD A;  1US1 A;  1FYS A;  3SOY A;  4EYC A;  3AGN A;  2J8X B;  2W9Q A;  2W03 A;  3BB9 A;  1K9M 4;  2P0M A;  2OOV A;  3PZW A;  2Z6B A;  2RGQ A;  2XEP A;  8CHO A;  2O3O A;  4GL6 A;  7STD A;  1OGX A;  2I9W A;  3F14 A;  1BSD A;  2IYJ A;  2F98 A;  3D5I A;  1WQL B;  4HZ9 B;  1TJD A;  4O2H A;  3Q2P A;  4MEI A;  2CG1 A;  3OV4 A;  1ZO2 A;  3SX1 A;  1O7N B;  2WGO A;  2BNG A;  2Y73 A;  1LQG C;  5KP1 A;  1W00 A;  1E97 A;  5CF1 A;  5LC7 A;  2XSO B;  1JB4 A;  1JKG A;  2O9U X;  3JUP A;  1LRA A;  3F7X A;  3N8B A;  3OWU A;  4Q53 A;  3NHX A;  4GB5 A;  4R1K A;  3CCV 3;  2QA4 3;  2BMO B;  3MG2 A;  1B2Z A;  4U13 A;  1D6Y A;  2RFR A;  2KF6 A;  1RGA A;  3K7C A;  5IEO A;  3CCM 3;  1BSC A;  1WMP A;  1OGZ A;  1STD A;  3FF2 A;  1MWT A;  5JBS A;  4N6M A;  2YX9 A;  5AYS C;  1VQO 3;  4TX4 A;  2FNQ A;  3BIR A;  3NQZ A;  1UDI I;  1QVG 2;  5CK6 A;  4GSP A;  1YGE A;  1CEW I;  2HMO B;  5AIF A;  2F4Y A;  3JVC A;  4QWT A;  1QAK A;  1LOX A;  1I70 A;  2Z76 A;  1LOW A;  4K90 B;  1YVB I;  2SBL A;  5CXO A;  1DMQ A;  3NXJ A;  3NQY A;  3CCS 3;  1B20 A;  3EBT A;  1UI8 A;  3NV0 A;  3OW2 2;  5D82 A;  1PFP A;  1O7M B;  4MJD A;  1YVS A;  1VQ7 3;  3J7Y d;  2V1L A;  1SPU A;  1FUS A;  3G71 3;  1TRQ A;  2P0X A;  3EE1 A;  3S67 A;  1GSP A;  1NNV A;  1BIR A;  1BRH A;  2XR8 B;  3PCR A;  3URP A;  4HOH A;  1BU4 A;  1B2U A;  1ISK A;  2AAD A;  3JUO A;  3AGO A;  5GSP A;  3X3X A;  1DYU A;  4N6T A;  4NHF A;  3DGM A;  3ZG0 A;  3U1W A;  1O7P B;  1UCJ A;  1W6C A;  1C7H A;  2CIU A;  3MYT A;  1YHQ 3;  3D5G A;  2CH9 A;  1SAR A;  1TIJ A;  4NRE A;  1YIJ 3;  1KQS 2;  1N8Q A;  2OOV C;  1G0T A;  4CDL A;  3CPW 2;  1CQS A;  1MOL A;  1IT7 A;  3K9M C;  2QGU A;  3CPO A;  4K1U A;  1TRP A;  3KFQ C;  2JQ5 A;  1Q81 4;  5AII A;  1CH0 A;  1SII A;  1RGF A;  3B4O A;  1BGS A;  1G02 A;  3NBJ A;  3ZFZ A;  2BMQ B;  1PU4 A;  1FUW A;  3UNL A;  1AY7 A;  2Z77 A;  1WTH A;  3UJM A;  1LOY A;  1UUW B;  1JZD A;  4FCJ A;  4RNZ A;  3T0U A;  4XBY A;  2CHC A;  3EJV A;  4H3U A;  1QVF 2;  4JF8 A;  1X1X A;  1Z1S A;  2CG0 A;  4FMB A;  4HBR A;  1Q86 4;  2F5W A;  3WOD G;  1CYU A;  5HGR A;  4X2O A;  1O7W B;  4BL2 A;  3Q3F A;  3DGO A;  1N9J A;  1NB3 I;  1JKG B;  2B24 B;  3IMA B;  5IEP A;  3ER7 A;  1EG9 B;  3CCL 3;  1ASK A;  1OH0 A;  1BUJ A;  2LQV A;  1BOX A;  1JB5 A;  1MWS A;  1I3I A;  1SJW A;  3K5T A;  5STD A;  1KD1 4;  1JN5 A;  1FGQ A;  1NO3 A;  4CPK A;  4HM5 B;  1RN7 A;  3UL5 A;  5KP4 A;  4OUQ A;  1UCL A;  2ZDJ A;  3HK4 A;  3DGN A;  1B27 A;  3RGR A;  1BNJ A;  4N3V A;  2HMJ B;  5IER A;  5RNT A;  3FG3 A;  3CC7 3;  1IQX A;  3JUQ A;  3OWS A;  2K0M A;  4L7K A;  1GD3 A;  3HIG A;  2C10 A;  1BVI A;  1Q42 A;  2CWT A;  1BNS A;  2RBI A;  5JPU A;  5IG4 A;  1HYF A;  2GBW B;  3SLU A;  3CCU 3;  3UL6 A;  1G96 A;  1T2H A;  2H0H A;  3BU4 A;  4KFD A;  1PYL A;  1OHO A;  1KSI A;  4K1V A;  1J2B A;  4LEH A;  1YJ9 3;  1A67 A;  3GZX B;  2RCD A;  3OX9 A;  1N9E A;  3A76 A;  3LTB A;  3NV0 B;  1NJI 4;  4FMA A;  2HMK B;  3PGB A;  3SVA A;  1RNB A;  3SED A;  3FCS B;  3SYU A;  3WOF B;  1GYB A;  1VZZ A;  1EUI C;  3F40 A;  1QMA A;  2W0Q A;  1BAO A;  3BNB A;  3WDG B;  1VQ5 3;  3RGA A;  5AI1 A;  4FMC A;  4NPB A;  1FUT A;  2GSP A;  1TFK A;  3G0K A;  4HZB B;  2JDI H;  3JUM A;  5D83 A;  2P05 A;  2CC3 A;  1OHP A;  1NWW A;  4HM3 B;  1Q7H A;  1BNG A;  3WA2 X;  1BNE A;  1I0V A;  1Q9E A;  4R4K A;  2XSH B;  5JPP A;  1M90 4;  1MWU A;  1W5Z A;  2CK3 H;  3KZT A;  3T8N A;  4R9K A;  4J8T A;  1LNI A;  2IA7 A;  4N6V 0;  2STD A;  1T3B A;  3LOY A;  4ZM8 A;  3F7S A;  4N6U A;  3BNC A;  3EC9 A;  1FGR A;  1BRN L;  3CMA 3;  2GEX A;  2B1X B;  3MG1 A;  1RDS A;  1V58 A;  5AIG A;  1N5P A;  1DMN A;  5IG3 A;  1DET A;  3IPT A;  4JRF A;  3D4A A;  1IDP A;  3N9H A;  4IT7 A;  1X1U A;  3WMD A;  4EV2 A;  5DRV A;  2PNC A;  5M18 A;  4HAA A;  3NX0 A;  3F8H A;  3X41 A;  1GOY A;  2LYX A;  1RGG A;  2PZV A;  2E2U A;  2Q07 A;  3MSO A;  4J9A A;  1RGK A;  3PS8 A;  1W6Y A;  1ROV A;  2YFJ B;  2YFL B;  1EQK A;  2C11 A;  4L8P A;  1IVU A;  3CU3 A;  3CC2 3;  1RGC A;  3GSP A;  1BSA A;  1LXE A;  3GAX A;  2KCD A;  3B8L A;  1O7H B;  2K3D A;  4I4K A;  5FW5 A;  3RDE A;  3V98 A;  4O8S A;  1JN5 B;  4EC6 A;  1RHL A;  1T2I A;  2BU4 A;  3O8Y A;  1YJW 3;  2H0I A;  1K28 A;  3ZG5 A;  2GU3 A;  4WWU C;  4EXR A;  5KP3 A;  5CLK A;  2BMR B;  1N5H A;  3TDG A;  2IUK A;  3VSY A;  1STF I;  2H0G A;  3E99 A;  3LTA A;  3FH1 A;  4FCM A;  1RGH A;  3RNT A;  1GS3 A;  4BU4 A;  4HKV B;  1VQM 3;  1M1K 4;  2R4I A;  2BO9 B;  3EN8 A;  2WOH A;  3WHO A;  3LH4 A;  5IF6 A;  5M19 A;  2KF4 A;  1RTU A;  1A90 A;  4MMY B;  1I2E A;  3HOH A;  3Q1C A;  1IT8 A;  2KF3 A;  1M9G A;  2CFK A;  5FGO A;  2OTJ 3;  2CWU A;  1W7C A;  1L5G B;  1IU7 A;  2IY2 A;  2WO0 A;  3ECF A;  3BND A;  1W2Z A;  2GU1 A;  5BU4 A;  1RCK A;  3CNM A;  4AKZ A;  1BRI A;  1UUV B;  2CKF B;  2CFD A;  1IQ8 A;  4AKY A;  3DGY A;  3G16 A;  4HM0 B;  4RNY A;  4CCV A;  1LQM B;  2CFW A;  5IG5 A;  4OVM A;  2IMJ A;  3KN4 A;  3LTD A;  1ZS7 A;  2A15 A;  4STD A;  3NM2 A;  1GOU A;  5CF2 A;  1IYY A;  1GY6 A;  1JNQ A;  1RKY A;  1VQN 3;  1BNR A;  1SIH A;  3ALA A;  4DKI A;  1ULI B;  1O7G B;  3FG4 A;  2XFT A;  2CX0 A;  4WHA A;  1RNT A;  1UUG B;  1W01 A;  3X40 A;  1QJG A;  1DMM A;  1WMO A;  1V74 A;  1TP6 A;  1MNL A;  3JUN A;  1TTO A;  4ILF A;  3EBY A;  3ROB A;  3PCS A;  2CX1 A;  1JBR A;  1UCK A;  1RLS A;  1CYV A;  1JBT A;  3K63 A;  1DE3 A; 
#chains in the Genus database with same CATH homology
 1FUT A;  2GSP A;  1B2Z A;  4J5K A;  2KF6 A;  1B3S A;  1FW7 A;  1RGA A;  1BNG A;  1BNE A;  3A5E A;  1I0V A;  1Q9E A;  1BSC A;  1I2F A;  2HOH A;  1BRK A;  1BSE A;  1LNI A;  1BRG A;  3BIR A;  4GHO A;  8RNT A;  1C54 A;  4GSP A;  1BNF A;  2F4Y A;  1BRN L;  3DH2 A;  1I70 A;  1RDS A;  1YNV X;  1LOW A;  6RNT A;  1RGL A;  1DET A;  1B20 A;  3D4A A;  1AQZ A;  1X1U A;  2F5M A;  1YVS A;  1FUS A;  4HAA A;  2F56 A;  1TRQ A;  1GOY A;  7GSP A;  1RGG A;  1GSP A;  5BIR A;  1BIR A;  1BRH A;  3URP A;  4HOH A;  1BU4 A;  1B2U A;  1RGK A;  1BSB A;  2AAD A;  5GSP A;  3AGO A;  1ZGX A;  1I2G A;  1RGC A;  1UCJ A;  3GSP A;  4RNT A;  1BSA A;  1PY3 A;  4J5G A;  3D5G A;  1SAR A;  6GSP A;  1JBS A;  1X1W A;  1RHL A;  1T2I A;  2BU4 A;  4BIR A;  1GMQ A;  1B2M A;  1RMS A;  1RSN A;  1GMP A;  1B21 A;  1RCL A;  1TRP A;  1I0X A;  1A2P A;  1CH0 A;  1RGF A;  1BRS A;  1BGS A;  1G02 A;  1BRJ A;  1MGR A;  3KCH A;  1RGH A;  3RNT A;  4BU4 A;  2C4B A;  1AY7 A;  1I8V A;  1RGE A;  1LOY A;  3WHO A;  7RNT A;  1BAN A;  1X1Y A;  2KF4 A;  1RTU A;  1X1X A;  2SAR A;  1I2E A;  2F5W A;  3HOH A;  1MGW A;  2KF3 A;  3AHW A;  2KAA A;  1BNI A;  1LOV A;  3Q3F A;  5HOH A;  2AAE A;  2ZA4 A;  5BU4 A;  1RCK A;  2RNT A;  1BUJ A;  1UCI A;  1BRI A;  1RN4 A;  1BOX A;  1FZU A;  1GOV A;  1I3I A;  1I3F A;  3AHS A;  2KF5 A;  1GMR A;  3DGY A;  1UCL A;  1B27 A;  1FYS A;  1BNJ A;  5RNT A;  1HZ1 A;  3AGN A;  1B2X A;  1GOU A;  1IYY A;  1BVI A;  1YGW A;  1BNR A;  1BNS A;  2RBI A;  1HYF A;  1BSD A;  2BIR A;  1RNT A;  3BU4 A;  1T2H A;  3D5I A;  9RNT A;  1PYL A;  1B2S A;  1RN1 A;  1JBT A;  1R4Y A;  1TTO A;  1RNB A;  1JBR A;  3SYU A;  1UCK A;  1RLS A;  3WR2 A;  1LRA A;  1BAO A;  1DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...