3D5GA

Structure of ribonuclease sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 24
structure length 96
sequence length 96
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5gA00
4J5GA 1BSAA 1BNGA 1RGKA 1UCKA 1BANA 1RGLA 1YNVX 4GHOA 1RLSA 1GOUA 1FW7A 1R4YA 1LRAA 9RNTA 1BOXA 8RNTA 1BRGA 5BIRA 2AAEA 3D5GA 2RBIA 3GSPA 1RDSA 1X1UA 1TRQA 1RCLA 1FUSA 2KF5A 1PY3A 2SARA 1RGCA 2HOHA 3DH2A 1T2IA 2AADA 2C4BA 1RMSA 1RGFA 1BNIA 1UCJA 1BNSA 3BU4A 3RNTA 1B27A 1RN1A 1AY7A 2F56A 3AGNA 3D5IA 6GSPA 1B20A 1SARA 4J5KA 2KF3A 1FUTA 1PYLA 1HYFA 1A2PA 1BAOA 1TRPA 1LOYA 1RGAA 3AGOA 1GMRA 1RGEA 1Q9EA 1GOYA 1UCIA 1YVSA 1B2UA 3DGYA 1LOVA 4GSPA 1LNIA 1GMPA 1GMQA 3A5EA 1BRIA 1BSCA 1BSEA 2F5WA 1I3FA 2KF4A 1MGRA 4HOHA 1B3SA 2RNTA 4BU4A 1BUJA 2BIRA 1ZGXA 1B21A 1I0XA 1B2SA 3AHWA 1BSDA 1YGWA 2ZA4A 1RNTA 1B2MA 2KAAA 1I8VA 1FZUA 3WHOA 1RNBA 5HOHA 1DETA 2GSPA 1UCLA 1BNRA 3BIRA 1CH0A 1DE3A 1BRSA 3HOHA 3AHSA 1X1YA 1GOVA 1RGGA 1BRJA 1BU4A 1I2FA 1I3IA 1BGSA 5BU4A 1BRKA 1BVIA 1I70A 1HZ1A 1JBSA 1MGWA 1LOWA 6RNTA 1BRNL 2BU4A 3Q3FA 1RN4A 1AQZA 4RNTA 1FYSA 7GSPA 1JBRA 5RNTA 2F5MA 1B2XA 1G02A 2KF6A 1JBTA 7RNTA 1BSBA 1BNEA 1TTOA 1BNFA 1X1WA 1BRHA 1RTUA 1RSNA 3D4AA 4BIRA 1I2GA 4HAAA 3KCHA 1I2EA 3WR2A 1RHLA 1T2HA 1I0VA 1GSPA 2F4YA 1BNJA 5GSPA 1IYYA 1B2ZA 3URPA 1X1XA 1C54A 1BIRA 1RGHA 1RCKA 3SYUA
chains in the Genus database with same CATH superfamily
2CWTA 5KP1A 1WNHA 4J5GA 1ZO2A 2BT3A 3EHCA 3V99A 1RGKA 3PYJA 1IK3A 1UUVB 4X2HA 1RLSA 1U8CB 1GOUA 3ER7A 1FW7A 2GBWB 1LRAA 2XSOB 1OHOA 2RCDA 9RNTA 4L8PA 1D6YA 5BIRA 2K0MA 1M1K4 3DGLA 3D5GA 2RBIA 1NB3I 2C10A 5KP4A 4N6LA 1JB5A 2JDIH 3NQZA 3CCS3 5M1AA 1T3BA 3U1WA 2KF5A 1JB2A 4MJDA 3FGYA 4KFFA 3F7XA 2P05A 3K9MC 3MG1A 1NWWA 2AADA 3EE1A 1DVCA 3JUMA 2C4BA 1QAKA 3JUQA 1RGFA 2RSXA 4U13A 1W7CA 2K3DA 3BU4A 3NM2A 4BTWA 2INXA 2CKFB 5M19A 2IYJA 2F56A 3BB9A 3Q2PA 3WOEB 1ULJB 3DGOA 1M904 3F8HA 4BL2A 1BAOA 1RGAA 1EA2A 6STDA 3FLJA 1QMAA 4EV2A 1UCIA 3DM8A 1B2UA 4H3UA 1LOVA 2D42A 1K9M4 2WOHA 1BRIA 3JUPA 1BSCA 4ILFA 2F5WA 5CK6A 3WA3A 1MGRA 1O7WB 4O02B 1B3SA 1GS3A 2CHCA 4HKVB 1B21A 1I0XA 1BSDA 3WOFB 1YGWA 2ZA4A 1AV4A 3O8YA 4RZMA 4N6OB 1RNTA 4TX4A 1B2MA 2KAAA 3NBBA 4RBNA 2QEX3 5BVBA 1RRHA 3T8NA 3LTCA 1IQXA 1VQ73 1UCLA 4WFOA 1VQK3 4EW5A 1Q864 3JUOA 3BIRA 2HMMB 3AMOA 4LYLB 3ZFZA 3SX1A 1DE3A 3CCV3 4LZIA 2UUGC 3EB8A 1KSIA 3STDA 4GL6A 1OCVA 4HM6B 5AIHA 1VQL3 1BUQA 1I2FA 4LSOA 1Q814 5BU4A 4R80A 1VZZA 2CFLA 1LXEA 2CG0A 3CC23 2CFGA 4MMZB 1JN5B 1JBSA 1UDII 2F98A 3DGNA 4HYZA 3HI7A 3Q3FA 3PCSA 5FW5A 1RN4A 3KSPA 2GEYA 2GEXA 4XDWA 7GSPA 3CC43 1JBRA 5RNTA 1GY6A 2F5MA 3NV0A 2P38A 1B2XA 2Z7AA 3G0KA 2KF6A 3QRDA 1TU5A 1JBTA 3PS8A 1D6UA 5ELJA 7RNTA 1BSBA 1DVDA 2QA43 1W5ZA 2Q07A 4BIRA 1RSNA 1UI7A 4HAAA 1M1XB 3KCHA 4HJLB 3V98A 1FUWA 1LVNA 1RHLA 2R4IA 2W56B 2E2UA 4WYKA 1BNJA 5LC6A 1NB5I 1Q824 2W0QA 1A90A 3LTBA 1OF5B 1GYBA 2L1SA 3EC9A 5IG5A 1EQKA 3WDGB 1ULIB 4WHAA 3KKGA 4FMBA 2UX0A 1UCKA 4GHOA 1U5OA 2CW9A 3I0YA 1RKYA 1TFKA 2P09A 4BL3A 4KFEA 1DMQA 8RNTA 3NUVA 2AAEA 5LC7A 3S5CA 3DMCA 3DY5A 2HMKB 3F14A 3GSPA 4K1UA 1X1UA 1W01A 4WP5A 3B8LA 1VQ63 1RCLA 1QAFA 4HM8B 5BXQA 2SARA 1RGCA 3K7CA 2O9UX 3DH2A 1M9GA 1T2IA 2K54A 1YVBI 3T8UA 3Q1CA 4R4KA 1JZOA 1RMSA 1BNIA 3IJEB 1JNQA 2Z77A 3LT8A 2IUJA 4CPKA 3HIIA 3EQQB 2PNCA 3AGNA 1VQN3 2XFTA 3MG2A 1KC84 1SARA 2OQEA 1US1A 1YGEA 3SLUA 1FUTA 4I4KA 2RGQA 2Z6BA 4N6MA 1OPYA 4EYCA 2CK3H 1A2PA 1SJWA 1LOYA 5EEOA 2CG1A 3AGOA 2CH9A 1RGEA 2IMJA 5KP3A 1LNIA 1GMQA 2GU1A 3A5EA 3WMDA 2B1XB 1V74A 3NBJA 1E3RA 5STDA 2XSHB 3CCM3 1F8NA 3HZPA 1VQM3 3EF8A 4HOHA 1GD4A 1NO3A 1QALA 2KRTA 2LYXA 1IDPA 3BNCA 2QIYA 4XB5A 1R4CA 1B2SA 3CNMA 2BNGA 4LGQA 4EV5A 5A0OB 3CCE3 1W2B2 4FR9A 4R9KA 4HM0B 3B4PA 1I8VA 2P0XA 1FZUA 4FMCA 3ECFA 3MPHA 5HGRA 2UGIA 5D82A 3PCRA 7STDA 2OWPA 1N8QA 2ML5A 3CNXA 4MMYB 1BRSA 2J8XB 2IY2A 2JQ5A 3ZG5A 1QVG2 1FGMA 3NXJA 1KQS2 3FG3A 1ISKA 3LOYA 2QGUA 2WO0A 4CJNA 1NDOB 1C7HA 3CME3 1K41A 1RGGA 2OQEC 1WTHA 1DYUA 1MWUA 2GXFA 2SBLA 4HZBB 1ASKA 1OH0A 1AR0A 3CPOA 1HZ1A 3MSOA 1UUGB 3KFQC 1TIJA 1Q7Y4 1UUWB 3HIGA 2XF3A 3PGBA 2BU4A 1N5HA 5EVHA 1IVVA 3M8CA 5DREA 1FYSA 1K734 1WMPA 4DKIA 2W9QA 1DMNA 1WQLB 4G1MB 3LTDA 3CCJ3 1O7PB 1YJN3 2ZDJA 5G1KA 3CCQ3 2D1WA 1SIHA 3D9RA 4FCMA 1YJW3 3GZYB 1TFOA 1JN5A 1AVKA 1FGTA 2KCDA 2CC3A 2OCTA 1FGQA 3X3XA 1OF5A 4KVHA 1MNLA 3EN1B 1PFPA 1UW1A 4MEIA 1GSPA 3G16A 2Y74A 2CWUA 2F4YA 3BNBA 3LTAA 4L7KA 1EUIC 3KSED 4HM2B 4EC6A 3BNDA 3S27A 2H0HA 3KZTA 3UL5A 1IYYA 2BHMA 5AYRB 1G0TA 3URPA 1BIRA 3MWZA 1RGHA 1RCKA 1RDSA 2CX0A 3H3HA 4O2HA 1BSAA 1S5AA 1BNGA 3FCSB 5D81A 1JB4A 1BANA 1RGLA 1N9EA 2E2VA 1OUNA 1YNVX 2Y73A 3ALAA 4KT3B 1R4YA 1HKXA 3K0ZA 4Q53A 3U97A 3N9HA 1FA3A 1BRGA 1OHPA 3MHEA 4GB5A 3NX0A 3S29A 5DRVA 1RN7A 4N6UA 1QJGA 5M18A 3K5TA 5AEUB 5JPUA 1TRQA 2F86B 5ELUA 1FUSA 1PY3A 3V92A 4WWUC 3QK9A 2HOHA 4XBTA 3CXC2 3CU3A 3B7CA 3GZBA 2BMOB 4XDVA 3JUNA 2XH9A 3KE7A 3ROBA 1TUHA 1CQSA 1UCJA 4O8SA 5IENA 1BNSA 3RNTA 4BTYA 3NBRA 1W00A 1B27A 3CPW2 4HM7B 3FSDA 3D5IA 1O7HB 6GSPA 1B20A 1CYVA 1STFI 4J5KA 2KF3A 1GD3A 3F7SA 2M7OA 5AIIA 3ZG0A 3LXUX 3SOYA 1PYLA 2IA7A 3L0RA 1HYFA 2I9WA 1WMNA 4K61A 1A67A 2B24B 4O3VA 3PXMA 2BO9B 4N6TA 1GOYA 1YVSA 1JKGB 1GMPA 1NU3A 1E97A 2ZHXB 4AKYA 2YX9A 3BLZA 1CYUA 1BSEA 3D79A 2KF4A 3N54B 1STDA 1VQP3 5CF2A 1BUJA 2BIRA 1JKGA 1ZGXA 3NM7A 5G1LA 1IQ8A 3DGMA 4XBYA 1IV7A 2CFDA 5IG0A 1IVXA 1MWSA 3RGAA 3E99A 5AEWB 3LT9A 2CFKA 2CX1A 4LEHA 5CXOA 1DETA 2GSPA 4MMXB 1KD14 3CD63 1BNRA 1CEWI 3OX9A 4IPBA 4K90B 4JF8A 1RJOA 3HOHA 4N3VA 3CCL3 4K1VA 3AHSA 5JBSA 1X1YA 3SOAA 1GOVA 1LQMB 1GY5A 1BRJA 4XM4A 2HMNB 4XBXA 3UL6A 2W9PA 2YFLB 1BRKA 4H61A 3G6E3 2BMQB 1LOWA 5AIFA 3I553 1VQQA 2A15A 3G8ZA 5EQLA 1SQWA 4HM3B 1AVLA 2V1LA 1BRNL 1NJI4 1ZX2A 3NHXA 3WODG 1EKMA 2BMRB 4RNTA 1YIT3 1ROAA 5AIGA 2W03A 3MYTA 4NPBA 5IG3A 4N6NB 5TGNA 2O3OA 4RNYA 3PZWA 3B4OA 3RGRA 3GZXB 4AEQA 5IEPA 1OHSA 4FMAA 2RFRA 4CCVA 1TTOA 3K63A 1BRHA 1RTUA 2R41A 1I2GA 1K28A 2GBXB 3IMAB 1I2EA 3H51A 1S723 1A2KA 4HM4B 2HMOB 3Q90A 5G2GA 2W04A 4KFDA 1J2BA 3SXXA 1UGIA 2XFSA 3OXAA 3LH4A 4N6V0 5GSPA 4OVMA 2F99A 3IPTA 5JPPA 1LNHA 1X1XA 2OTJ3 4JRFA 3HX8A 2STDA 3SYUA 3X41A 3GAXA 4R1KA 1VQ83 4EBGA 1E3VA 3FH1A 5AI1A 3AMOB 1VQO3 2XEPA 3CC73 3FG1A 1T5YA 1L5GB 4J9AA 8CHOA 3VSYA 1BOXA 1LQGC 3DXOA 4HBRA 2FGTA 4HM5B 1VQ43 1K8A4 2LQVA 1MWRA 4FCJA 1YI23 1W6GA 2HMLB 2YFIB 2OOVA 1Y4KA 3EX9A 1NNVA 3JVCA 2H0GA 3LZAA 1IVWA 4STDA 2E2TA 2MF7A 3F9SA 1LOXA 3FF2A 4HZ9B 1GY7A 1OGZA 1ROVA 5D83A 4FMDA 3HK4A 2P0MA 3TDGA 3G4S3 2CWVA 5IW9A 3G713 1RN1A 1AY7A 2WOFA 2XGNA 3X42A 2YFJB 1ZS7A 2XGLA 3DUKA 4HVNA 3N8BA 3GZRA 3NQYA 1IQYA 1UI8A 4CDLA 5CF1A 1YJ93 2PZVA 1KWIA 3A76A 1TRPA 3I563 3UJMA 4KZ1A 1UGHI 2XR8B 1GMRA 4NREA 1Q9EA 3DGYA 3KIIA 4GSPA 4FCZA 2CIUA 1EG9B 1IU7A 2FNQA 4OK0A 1I3FA 1YIJ3 1JZDA 3VGNA 3OWYA 1Q42A 2RNTA 2W6JH 4BU4A 3FKAA 3CCR3 1W6YA 3AHWA 2OTL3 1Z1SA 3FZWA 4I5QA 4ORLA 1IVUA 3SEDA 1EEJA 2Z76A 3WHOA 1MOLA 5HOHA 1RNBA 4X2OA 4HM1B 1IT8A 2GU3A 1VQ53 1CH0A 2H0IA 1IV9A 1TP6A 2KXGA 3OW22 3X3ZA 4PEJA 1YHQ3 4AKZA 4QWTA 1BU4A 3RDEA 1I3IA 1BGSA 4LMIA 3S28A 1N5PA 3MKIA 5IERA 1RRLA 1BVIA 3EN8A 3MG3A 3BNEA 4L8OA 5I97A 1I70A 3WA2X 5AYSC 1IT7A 1MGWA 4ZM8A 1QVF2 6RNTA 1N9JA 3F40A 4IT7A 1O7MB 3VF1A 1OGXA 3UB1A 1D6ZA 1HU9A 1AQZA 1TJDA 3CMA3 4J8TA 4R9LA 1W2ZA 1A2VA 1FGRA 4BTXA 3F8XA 3LMLA 2OOVC 3NV0B 2IUKA 3D3LA 1G02A 2C11A 3EBYA 1WMOA 5IG4A 1MWTA 1FGOA 3UNLA 1DMMA 3X40A 1G96A 3OWUA 1W4NA 1BNEA 1BNFA 1V58A 1X1WA 5IEOA 2FXTA 3J7Yd 3D4AA 2MC8A 1Q40A 2ML6A 3GWRA 2CFWA 1W6CA 5CLKA 3FG4A 1VQ93 3WR2A 3CCU3 4EXRA 5IF6A 4OUQA 2L4VA 1V57A 1OACA 2HMJB 3KN4A 1T2HA 1I0VA 1O7GB 3OV4A 1Q7HA 1Q40B 4RNZA 3S67A 1N8R4 3X3YA 5FGOA 2W2CA 4NHFA 4WYKB 2XRXB 3FF0A 2WGQA 2W56A 1SPUA 1O7NB 2WGOA 3T0UA 1JV2B 4IIAA 1W02A 1B2ZA 2ZL8A 3EBTA 3DZLA 1PU4A 3GRDA 1C54A 3EJVA 3LYGA 3OWSA 1SIIA 1JRQA 1JJ22 3SVAA
chains in the Genus database with same CATH topology
4J5GA 1BSAA 1BNGA 1RGKA 1UCKA 1BANA 1RGLA 1YNVX 4GHOA 1RLSA 1GOUA 1FW7A 1R4YA 1LRAA 9RNTA 1BOXA 8RNTA 1BRGA 5BIRA 2AAEA 3D5GA 2RBIA 3GSPA 1RDSA 1X1UA 1TRQA 1RCLA 1FUSA 2KF5A 1PY3A 2SARA 1RGCA 2HOHA 3DH2A 1T2IA 2AADA 2C4BA 1RMSA 1RGFA 1BNIA 1UCJA 1BNSA 3BU4A 3RNTA 1B27A 1RN1A 1AY7A 2F56A 3AGNA 3D5IA 6GSPA 1B20A 1SARA 4J5KA 2KF3A 1FUTA 1PYLA 1HYFA 1A2PA 1BAOA 1TRPA 1LOYA 1RGAA 3AGOA 1GMRA 1RGEA 1Q9EA 1GOYA 1UCIA 1YVSA 1B2UA 3DGYA 1LOVA 4GSPA 1LNIA 1GMPA 1GMQA 3A5EA 1BRIA 1BSCA 1BSEA 2F5WA 1I3FA 2KF4A 1MGRA 4HOHA 1B3SA 2RNTA 4BU4A 1BUJA 2BIRA 1ZGXA 1B21A 1I0XA 1B2SA 3AHWA 1BSDA 1YGWA 2ZA4A 1RNTA 1B2MA 2KAAA 1I8VA 1FZUA 3WHOA 1RNBA 5HOHA 1DETA 2GSPA 1UCLA 1BNRA 3BIRA 1CH0A 1DE3A 1BRSA 3HOHA 3AHSA 1X1YA 1GOVA 1RGGA 1BRJA 1BU4A 1I2FA 1I3IA 1BGSA 5BU4A 1BRKA 1BVIA 1I70A 1HZ1A 1JBSA 1MGWA 1LOWA 6RNTA 1BRNL 2BU4A 3Q3FA 1RN4A 1AQZA 4RNTA 1FYSA 7GSPA 1JBRA 5RNTA 2F5MA 1B2XA 1G02A 2KF6A 1JBTA 7RNTA 1BSBA 1BNEA 1TTOA 1BNFA 1X1WA 1BRHA 1RTUA 1RSNA 3D4AA 4BIRA 1I2GA 4HAAA 3KCHA 1I2EA 3WR2A 1RHLA 1T2HA 1I0VA 1GSPA 2F4YA 1BNJA 5GSPA 1IYYA 1B2ZA 3URPA 1X1XA 1C54A 1BIRA 1RGHA 1RCKA 3SYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5G A;  1BSA A;  1BNG A;  1RGK A;  1UCK A;  1BAN A;  1RGL A;  1YNV X;  4GHO A;  1RLS A;  1GOU A;  1FW7 A;  1R4Y A;  1LRA A;  9RNT A;  1BOX A;  8RNT A;  1BRG A;  5BIR A;  2AAE A;  3D5G A;  2RBI A;  3GSP A;  1RDS A;  1X1U A;  1TRQ A;  1RCL A;  1FUS A;  2KF5 A;  1PY3 A;  2SAR A;  1RGC A;  2HOH A;  3DH2 A;  1T2I A;  2AAD A;  2C4B A;  1RMS A;  1RGF A;  1BNI A;  1UCJ A;  1BNS A;  3BU4 A;  3RNT A;  1B27 A;  1RN1 A;  1AY7 A;  2F56 A;  3AGN A;  3D5I A;  6GSP A;  1B20 A;  1SAR A;  4J5K A;  2KF3 A;  1FUT A;  1PYL A;  1HYF A;  1A2P A;  1BAO A;  1TRP A;  1LOY A;  1RGA A;  3AGO A;  1GMR A;  1RGE A;  1Q9E A;  1GOY A;  1UCI A;  1YVS A;  1B2U A;  3DGY A;  1LOV A;  4GSP A;  1LNI A;  1GMP A;  1GMQ A;  3A5E A;  1BRI A;  1BSC A;  1BSE A;  2F5W A;  1I3F A;  2KF4 A;  1MGR A;  4HOH A;  1B3S A;  2RNT A;  4BU4 A;  1BUJ A;  2BIR A;  1ZGX A;  1B21 A;  1I0X A;  1B2S A;  3AHW A;  1BSD A;  1YGW A;  2ZA4 A;  1RNT A;  1B2M A;  2KAA A;  1I8V A;  1FZU A;  3WHO A;  1RNB A;  5HOH A;  1DET A;  2GSP A;  1UCL A;  1BNR A;  3BIR A;  1CH0 A;  1DE3 A;  1BRS A;  3HOH A;  3AHS A;  1X1Y A;  1GOV A;  1RGG A;  1BRJ A;  1BU4 A;  1I2F A;  1I3I A;  1BGS A;  5BU4 A;  1BRK A;  1BVI A;  1I70 A;  1HZ1 A;  1JBS A;  1MGW A;  1LOW A;  6RNT A;  1BRN L;  2BU4 A;  3Q3F A;  1RN4 A;  1AQZ A;  4RNT A;  1FYS A;  7GSP A;  1JBR A;  5RNT A;  2F5M A;  1B2X A;  1G02 A;  2KF6 A;  1JBT A;  7RNT A;  1BSB A;  1BNE A;  1TTO A;  1BNF A;  1X1W A;  1BRH A;  1RTU A;  1RSN A;  3D4A A;  4BIR A;  1I2G A;  4HAA A;  3KCH A;  1I2E A;  3WR2 A;  1RHL A;  1T2H A;  1I0V A;  1GSP A;  2F4Y A;  1BNJ A;  5GSP A;  1IYY A;  1B2Z A;  3URP A;  1X1X A;  1C54 A;  1BIR A;  1RGH A;  1RCK A;  3SYU A; 
#chains in the Genus database with same CATH topology
 2CWT A;  5KP1 A;  1WNH A;  4J5G A;  1ZO2 A;  2BT3 A;  3EHC A;  3V99 A;  1RGK A;  3PYJ A;  1IK3 A;  1UUV B;  4X2H A;  1RLS A;  1U8C B;  1GOU A;  3ER7 A;  1FW7 A;  2GBW B;  1LRA A;  2XSO B;  1OHO A;  2RCD A;  9RNT A;  4L8P A;  1D6Y A;  5BIR A;  2K0M A;  1M1K 4;  3DGL A;  3D5G A;  2RBI A;  1NB3 I;  2C10 A;  5KP4 A;  4N6L A;  1JB5 A;  2JDI H;  3NQZ A;  3CCS 3;  5M1A A;  1T3B A;  3U1W A;  2KF5 A;  1JB2 A;  4MJD A;  3FGY A;  4KFF A;  3F7X A;  2P05 A;  3K9M C;  3MG1 A;  1NWW A;  2AAD A;  3EE1 A;  1DVC A;  3JUM A;  2C4B A;  1QAK A;  3JUQ A;  1RGF A;  2RSX A;  4U13 A;  1W7C A;  2K3D A;  3BU4 A;  3NM2 A;  4BTW A;  2INX A;  2CKF B;  5M19 A;  2IYJ A;  2F56 A;  3BB9 A;  3Q2P A;  3WOE B;  1ULJ B;  3DGO A;  1M90 4;  3F8H A;  4BL2 A;  1BAO A;  1RGA A;  1EA2 A;  6STD A;  3FLJ A;  1QMA A;  4EV2 A;  1UCI A;  3DM8 A;  1B2U A;  4H3U A;  1LOV A;  2D42 A;  1K9M 4;  2WOH A;  1BRI A;  3JUP A;  1BSC A;  4ILF A;  2F5W A;  5CK6 A;  3WA3 A;  1MGR A;  1O7W B;  4O02 B;  1B3S A;  1GS3 A;  2CHC A;  4HKV B;  1B21 A;  1I0X A;  1BSD A;  3WOF B;  1YGW A;  2ZA4 A;  1AV4 A;  3O8Y A;  4RZM A;  4N6O B;  1RNT A;  4TX4 A;  1B2M A;  2KAA A;  3NBB A;  4RBN A;  2QEX 3;  5BVB A;  1RRH A;  3T8N A;  3LTC A;  1IQX A;  1VQ7 3;  1UCL A;  4WFO A;  1VQK 3;  4EW5 A;  1Q86 4;  3JUO A;  3BIR A;  2HMM B;  3AMO A;  4LYL B;  3ZFZ A;  3SX1 A;  1DE3 A;  3CCV 3;  4LZI A;  2UUG C;  3EB8 A;  1KSI A;  3STD A;  4GL6 A;  1OCV A;  4HM6 B;  5AIH A;  1VQL 3;  1BUQ A;  1I2F A;  4LSO A;  1Q81 4;  5BU4 A;  4R80 A;  1VZZ A;  2CFL A;  1LXE A;  2CG0 A;  3CC2 3;  2CFG A;  4MMZ B;  1JN5 B;  1JBS A;  1UDI I;  2F98 A;  3DGN A;  4HYZ A;  3HI7 A;  3Q3F A;  3PCS A;  5FW5 A;  1RN4 A;  3KSP A;  2GEY A;  2GEX A;  4XDW A;  7GSP A;  3CC4 3;  1JBR A;  5RNT A;  1GY6 A;  2F5M A;  3NV0 A;  2P38 A;  1B2X A;  2Z7A A;  3G0K A;  2KF6 A;  3QRD A;  1TU5 A;  1JBT A;  3PS8 A;  1D6U A;  5ELJ A;  7RNT A;  1BSB A;  1DVD A;  2QA4 3;  1W5Z A;  2Q07 A;  4BIR A;  1RSN A;  1UI7 A;  4HAA A;  1M1X B;  3KCH A;  4HJL B;  3V98 A;  1FUW A;  1LVN A;  1RHL A;  2R4I A;  2W56 B;  2E2U A;  4WYK A;  1BNJ A;  5LC6 A;  1NB5 I;  1Q82 4;  2W0Q A;  1A90 A;  3LTB A;  1OF5 B;  1GYB A;  2L1S A;  3EC9 A;  5IG5 A;  1EQK A;  3WDG B;  1ULI B;  4WHA A;  3KKG A;  4FMB A;  2UX0 A;  1UCK A;  4GHO A;  1U5O A;  2CW9 A;  3I0Y A;  1RKY A;  1TFK A;  2P09 A;  4BL3 A;  4KFE A;  1DMQ A;  8RNT A;  3NUV A;  2AAE A;  5LC7 A;  3S5C A;  3DMC A;  3DY5 A;  2HMK B;  3F14 A;  3GSP A;  4K1U A;  1X1U A;  1W01 A;  4WP5 A;  3B8L A;  1VQ6 3;  1RCL A;  1QAF A;  4HM8 B;  5BXQ A;  2SAR A;  1RGC A;  3K7C A;  2O9U X;  3DH2 A;  1M9G A;  1T2I A;  2K54 A;  1YVB I;  3T8U A;  3Q1C A;  4R4K A;  1JZO A;  1RMS A;  1BNI A;  3IJE B;  1JNQ A;  2Z77 A;  3LT8 A;  2IUJ A;  4CPK A;  3HII A;  3EQQ B;  2PNC A;  3AGN A;  1VQN 3;  2XFT A;  3MG2 A;  1KC8 4;  1SAR A;  2OQE A;  1US1 A;  1YGE A;  3SLU A;  1FUT A;  4I4K A;  2RGQ A;  2Z6B A;  4N6M A;  1OPY A;  4EYC A;  2CK3 H;  1A2P A;  1SJW A;  1LOY A;  5EEO A;  2CG1 A;  3AGO A;  2CH9 A;  1RGE A;  2IMJ A;  5KP3 A;  1LNI A;  1GMQ A;  2GU1 A;  3A5E A;  3WMD A;  2B1X B;  1V74 A;  3NBJ A;  1E3R A;  5STD A;  2XSH B;  3CCM 3;  1F8N A;  3HZP A;  1VQM 3;  3EF8 A;  4HOH A;  1GD4 A;  1NO3 A;  1QAL A;  2KRT A;  2LYX A;  1IDP A;  3BNC A;  2QIY A;  4XB5 A;  1R4C A;  1B2S A;  3CNM A;  2BNG A;  4LGQ A;  4EV5 A;  5A0O B;  3CCE 3;  1W2B 2;  4FR9 A;  4R9K A;  4HM0 B;  3B4P A;  1I8V A;  2P0X A;  1FZU A;  4FMC A;  3ECF A;  3MPH A;  5HGR A;  2UGI A;  5D82 A;  3PCR A;  7STD A;  2OWP A;  1N8Q A;  2ML5 A;  3CNX A;  4MMY B;  1BRS A;  2J8X B;  2IY2 A;  2JQ5 A;  3ZG5 A;  1QVG 2;  1FGM A;  3NXJ A;  1KQS 2;  3FG3 A;  1ISK A;  3LOY A;  2QGU A;  2WO0 A;  4CJN A;  1NDO B;  1C7H A;  3CME 3;  1K41 A;  1RGG A;  2OQE C;  1WTH A;  1DYU A;  1MWU A;  2GXF A;  2SBL A;  4HZB B;  1ASK A;  1OH0 A;  1AR0 A;  3CPO A;  1HZ1 A;  3MSO A;  1UUG B;  3KFQ C;  1TIJ A;  1Q7Y 4;  1UUW B;  3HIG A;  2XF3 A;  3PGB A;  2BU4 A;  1N5H A;  5EVH A;  1IVV A;  3M8C A;  5DRE A;  1FYS A;  1K73 4;  1WMP A;  4DKI A;  2W9Q A;  1DMN A;  1WQL B;  4G1M B;  3LTD A;  3CCJ 3;  1O7P B;  1YJN 3;  2ZDJ A;  5G1K A;  3CCQ 3;  2D1W A;  1SIH A;  3D9R A;  4FCM A;  1YJW 3;  3GZY B;  1TFO A;  1JN5 A;  1AVK A;  1FGT A;  2KCD A;  2CC3 A;  2OCT A;  1FGQ A;  3X3X A;  1OF5 A;  4KVH A;  1MNL A;  3EN1 B;  1PFP A;  1UW1 A;  4MEI A;  1GSP A;  3G16 A;  2Y74 A;  2CWU A;  2F4Y A;  3BNB A;  3LTA A;  4L7K A;  1EUI C;  3KSE D;  4HM2 B;  4EC6 A;  3BND A;  3S27 A;  2H0H A;  3KZT A;  3UL5 A;  1IYY A;  2BHM A;  5AYR B;  1G0T A;  3URP A;  1BIR A;  3MWZ A;  1RGH A;  1RCK A;  1RDS A;  2CX0 A;  3H3H A;  4O2H A;  1BSA A;  1S5A A;  1BNG A;  3FCS B;  5D81 A;  1JB4 A;  1BAN A;  1RGL A;  1N9E A;  2E2V A;  1OUN A;  1YNV X;  2Y73 A;  3ALA A;  4KT3 B;  1R4Y A;  1HKX A;  3K0Z A;  4Q53 A;  3U97 A;  3N9H A;  1FA3 A;  1BRG A;  1OHP A;  3MHE A;  4GB5 A;  3NX0 A;  3S29 A;  5DRV A;  1RN7 A;  4N6U A;  1QJG A;  5M18 A;  3K5T A;  5AEU B;  5JPU A;  1TRQ A;  2F86 B;  5ELU A;  1FUS A;  1PY3 A;  3V92 A;  4WWU C;  3QK9 A;  2HOH A;  4XBT A;  3CXC 2;  3CU3 A;  3B7C A;  3GZB A;  2BMO B;  4XDV A;  3JUN A;  2XH9 A;  3KE7 A;  3ROB A;  1TUH A;  1CQS A;  1UCJ A;  4O8S A;  5IEN A;  1BNS A;  3RNT A;  4BTY A;  3NBR A;  1W00 A;  1B27 A;  3CPW 2;  4HM7 B;  3FSD A;  3D5I A;  1O7H B;  6GSP A;  1B20 A;  1CYV A;  1STF I;  4J5K A;  2KF3 A;  1GD3 A;  3F7S A;  2M7O A;  5AII A;  3ZG0 A;  3LXU X;  3SOY A;  1PYL A;  2IA7 A;  3L0R A;  1HYF A;  2I9W A;  1WMN A;  4K61 A;  1A67 A;  2B24 B;  4O3V A;  3PXM A;  2BO9 B;  4N6T A;  1GOY A;  1YVS A;  1JKG B;  1GMP A;  1NU3 A;  1E97 A;  2ZHX B;  4AKY A;  2YX9 A;  3BLZ A;  1CYU A;  1BSE A;  3D79 A;  2KF4 A;  3N54 B;  1STD A;  1VQP 3;  5CF2 A;  1BUJ A;  2BIR A;  1JKG A;  1ZGX A;  3NM7 A;  5G1L A;  1IQ8 A;  3DGM A;  4XBY A;  1IV7 A;  2CFD A;  5IG0 A;  1IVX A;  1MWS A;  3RGA A;  3E99 A;  5AEW B;  3LT9 A;  2CFK A;  2CX1 A;  4LEH A;  5CXO A;  1DET A;  2GSP A;  4MMX B;  1KD1 4;  3CD6 3;  1BNR A;  1CEW I;  3OX9 A;  4IPB A;  4K90 B;  4JF8 A;  1RJO A;  3HOH A;  4N3V A;  3CCL 3;  4K1V A;  3AHS A;  5JBS A;  1X1Y A;  3SOA A;  1GOV A;  1LQM B;  1GY5 A;  1BRJ A;  4XM4 A;  2HMN B;  4XBX A;  3UL6 A;  2W9P A;  2YFL B;  1BRK A;  4H61 A;  3G6E 3;  2BMQ B;  1LOW A;  5AIF A;  3I55 3;  1VQQ A;  2A15 A;  3G8Z A;  5EQL A;  1SQW A;  4HM3 B;  1AVL A;  2V1L A;  1BRN L;  1NJI 4;  1ZX2 A;  3NHX A;  3WOD G;  1EKM A;  2BMR B;  4RNT A;  1YIT 3;  1ROA A;  5AIG A;  2W03 A;  3MYT A;  4NPB A;  5IG3 A;  4N6N B;  5TGN A;  2O3O A;  4RNY A;  3PZW A;  3B4O A;  3RGR A;  3GZX B;  4AEQ A;  5IEP A;  1OHS A;  4FMA A;  2RFR A;  4CCV A;  1TTO A;  3K63 A;  1BRH A;  1RTU A;  2R41 A;  1I2G A;  1K28 A;  2GBX B;  3IMA B;  1I2E A;  3H51 A;  1S72 3;  1A2K A;  4HM4 B;  2HMO B;  3Q90 A;  5G2G A;  2W04 A;  4KFD A;  1J2B A;  3SXX A;  1UGI A;  2XFS A;  3OXA A;  3LH4 A;  4N6V 0;  5GSP A;  4OVM A;  2F99 A;  3IPT A;  5JPP A;  1LNH A;  1X1X A;  2OTJ 3;  4JRF A;  3HX8 A;  2STD A;  3SYU A;  3X41 A;  3GAX A;  4R1K A;  1VQ8 3;  4EBG A;  1E3V A;  3FH1 A;  5AI1 A;  3AMO B;  1VQO 3;  2XEP A;  3CC7 3;  3FG1 A;  1T5Y A;  1L5G B;  4J9A A;  8CHO A;  3VSY A;  1BOX A;  1LQG C;  3DXO A;  4HBR A;  2FGT A;  4HM5 B;  1VQ4 3;  1K8A 4;  2LQV A;  1MWR A;  4FCJ A;  1YI2 3;  1W6G A;  2HML B;  2YFI B;  2OOV A;  1Y4K A;  3EX9 A;  1NNV A;  3JVC A;  2H0G A;  3LZA A;  1IVW A;  4STD A;  2E2T A;  2MF7 A;  3F9S A;  1LOX A;  3FF2 A;  4HZ9 B;  1GY7 A;  1OGZ A;  1ROV A;  5D83 A;  4FMD A;  3HK4 A;  2P0M A;  3TDG A;  3G4S 3;  2CWV A;  5IW9 A;  3G71 3;  1RN1 A;  1AY7 A;  2WOF A;  2XGN A;  3X42 A;  2YFJ B;  1ZS7 A;  2XGL A;  3DUK A;  4HVN A;  3N8B A;  3GZR A;  3NQY A;  1IQY A;  1UI8 A;  4CDL A;  5CF1 A;  1YJ9 3;  2PZV A;  1KWI A;  3A76 A;  1TRP A;  3I56 3;  3UJM A;  4KZ1 A;  1UGH I;  2XR8 B;  1GMR A;  4NRE A;  1Q9E A;  3DGY A;  3KII A;  4GSP A;  4FCZ A;  2CIU A;  1EG9 B;  1IU7 A;  2FNQ A;  4OK0 A;  1I3F A;  1YIJ 3;  1JZD A;  3VGN A;  3OWY A;  1Q42 A;  2RNT A;  2W6J H;  4BU4 A;  3FKA A;  3CCR 3;  1W6Y A;  3AHW A;  2OTL 3;  1Z1S A;  3FZW A;  4I5Q A;  4ORL A;  1IVU A;  3SED A;  1EEJ A;  2Z76 A;  3WHO A;  1MOL A;  5HOH A;  1RNB A;  4X2O A;  4HM1 B;  1IT8 A;  2GU3 A;  1VQ5 3;  1CH0 A;  2H0I A;  1IV9 A;  1TP6 A;  2KXG A;  3OW2 2;  3X3Z A;  4PEJ A;  1YHQ 3;  4AKZ A;  4QWT A;  1BU4 A;  3RDE A;  1I3I A;  1BGS A;  4LMI A;  3S28 A;  1N5P A;  3MKI A;  5IER A;  1RRL A;  1BVI A;  3EN8 A;  3MG3 A;  3BNE A;  4L8O A;  5I97 A;  1I70 A;  3WA2 X;  5AYS C;  1IT7 A;  1MGW A;  4ZM8 A;  1QVF 2;  6RNT A;  1N9J A;  3F40 A;  4IT7 A;  1O7M B;  3VF1 A;  1OGX A;  3UB1 A;  1D6Z A;  1HU9 A;  1AQZ A;  1TJD A;  3CMA 3;  4J8T A;  4R9L A;  1W2Z A;  1A2V A;  1FGR A;  4BTX A;  3F8X A;  3LML A;  2OOV C;  3NV0 B;  2IUK A;  3D3L A;  1G02 A;  2C11 A;  3EBY A;  1WMO A;  5IG4 A;  1MWT A;  1FGO A;  3UNL A;  1DMM A;  3X40 A;  1G96 A;  3OWU A;  1W4N A;  1BNE A;  1BNF A;  1V58 A;  1X1W A;  5IEO A;  2FXT A;  3J7Y d;  3D4A A;  2MC8 A;  1Q40 A;  2ML6 A;  3GWR A;  2CFW A;  1W6C A;  5CLK A;  3FG4 A;  1VQ9 3;  3WR2 A;  3CCU 3;  4EXR A;  5IF6 A;  4OUQ A;  2L4V A;  1V57 A;  1OAC A;  2HMJ B;  3KN4 A;  1T2H A;  1I0V A;  1O7G B;  3OV4 A;  1Q7H A;  1Q40 B;  4RNZ A;  3S67 A;  1N8R 4;  3X3Y A;  5FGO A;  2W2C A;  4NHF A;  4WYK B;  2XRX B;  3FF0 A;  2WGQ A;  2W56 A;  1SPU A;  1O7N B;  2WGO A;  3T0U A;  1JV2 B;  4IIA A;  1W02 A;  1B2Z A;  2ZL8 A;  3EBT A;  3DZL A;  1PU4 A;  3GRD A;  1C54 A;  3EJV A;  3LYG A;  3OWS A;  1SII A;  1JRQ A;  1JJ2 2;  3SVA A; 
#chains in the Genus database with same CATH homology
 4J5G A;  1BSA A;  1BNG A;  1RGK A;  1UCK A;  1BAN A;  1RGL A;  1YNV X;  4GHO A;  1RLS A;  1GOU A;  1FW7 A;  1R4Y A;  1LRA A;  9RNT A;  1BOX A;  8RNT A;  1BRG A;  5BIR A;  2AAE A;  3D5G A;  2RBI A;  3GSP A;  1RDS A;  1X1U A;  1TRQ A;  1RCL A;  1FUS A;  2KF5 A;  1PY3 A;  2SAR A;  1RGC A;  2HOH A;  3DH2 A;  1T2I A;  2AAD A;  2C4B A;  1RMS A;  1RGF A;  1BNI A;  1UCJ A;  1BNS A;  3BU4 A;  3RNT A;  1B27 A;  1RN1 A;  1AY7 A;  2F56 A;  3AGN A;  3D5I A;  6GSP A;  1B20 A;  1SAR A;  4J5K A;  2KF3 A;  1FUT A;  1PYL A;  1HYF A;  1A2P A;  1BAO A;  1TRP A;  1LOY A;  1RGA A;  3AGO A;  1GMR A;  1RGE A;  1Q9E A;  1GOY A;  1UCI A;  1YVS A;  1B2U A;  3DGY A;  1LOV A;  4GSP A;  1LNI A;  1GMP A;  1GMQ A;  3A5E A;  1BRI A;  1BSC A;  1BSE A;  2F5W A;  1I3F A;  2KF4 A;  1MGR A;  4HOH A;  1B3S A;  2RNT A;  4BU4 A;  1BUJ A;  2BIR A;  1ZGX A;  1B21 A;  1I0X A;  1B2S A;  3AHW A;  1BSD A;  1YGW A;  2ZA4 A;  1RNT A;  1B2M A;  2KAA A;  1I8V A;  1FZU A;  3WHO A;  1RNB A;  5HOH A;  1DET A;  2GSP A;  1UCL A;  1BNR A;  3BIR A;  1CH0 A;  1DE3 A;  1BRS A;  3HOH A;  3AHS A;  1X1Y A;  1GOV A;  1RGG A;  1BRJ A;  1BU4 A;  1I2F A;  1I3I A;  1BGS A;  5BU4 A;  1BRK A;  1BVI A;  1I70 A;  1HZ1 A;  1JBS A;  1MGW A;  1LOW A;  6RNT A;  1BRN L;  2BU4 A;  3Q3F A;  1RN4 A;  1AQZ A;  4RNT A;  1FYS A;  7GSP A;  1JBR A;  5RNT A;  2F5M A;  1B2X A;  1G02 A;  2KF6 A;  1JBT A;  7RNT A;  1BSB A;  1BNE A;  1TTO A;  1BNF A;  1X1W A;  1BRH A;  1RTU A;  1RSN A;  3D4A A;  4BIR A;  1I2G A;  4HAA A;  3KCH A;  1I2E A;  3WR2 A;  1RHL A;  1T2H A;  1I0V A;  1GSP A;  2F4Y A;  1BNJ A;  5GSP A;  1IYY A;  1B2Z A;  3URP A;  1X1X A;  1C54 A;  1BIR A;  1RGH A;  1RCK A;  3SYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...