3D5GA

Structure of ribonuclease sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5gA00
1RGFA 1BSBA 1LNIA 3D4AA 1BANA 1I0XA 3RNTA 1RN1A 1ZGXA 1BIRA 4RNTA 5GSPA 2SARA 1UCKA 1BNIA 2KF4A 1IYYA 1A2PA 1I3FA 1B2ZA 2GSPA 1R4YA 1LOWA 1RGHA 1B2SA 4J5KA 4GSPA 3WR2A 1BRNL 3AHWA 1I70A 1BRKA 5RNTA 4HAAA 1BNRA 3URPA 8RNTA 1HYFA 3AGNA 3D5IA 1TTOA 1GOVA 4HOHA 3WHOA 1RNBA 1I3IA 2KF5A 1MGWA 1FUSA 1BOXA 1PYLA 3DH2A 2HOHA 1UCJA 1BNFA 1GMRA 1X1WA 1AQZA 1RCKA 1RLSA 1BVIA 1BAOA 1SARA 2C4BA 3DGYA 2F4YA 4GHOA 1FYSA 1B2MA 1RDSA 3Q3FA 1I2GA 1FW7A 1BNEA 4BU4A 1BNGA 1RN4A 1GOYA 2F56A 1BRJA 1TRQA 3BU4A 1BSEA 7RNTA 1B27A 2F5MA 1B3SA 1CH0A 1X1XA 1T2HA 5BIRA 2ZA4A 3SYUA 1GOUA 1HZ1A 3HOHA 1Q9EA 1BRGA 2AADA 1BRHA 1RGCA 1JBTA 1FZUA 1RGKA 3KCHA 1RSNA 1BRIA 2KF3A 1BSCA 1GMQA 1I8VA 3GSPA 1DETA 1B21A 2KF6A 1BSDA 3AHSA 1LRAA 6GSPA 9RNTA 1FUTA 7GSPA 1GSPA 2RBIA 2KAAA 1BNJA 1RGEA 3AGOA 1JBSA 1JBRA 1X1YA 1RNTA 1RGGA 2BU4A 1B20A 1C54A 3D5GA 1TRPA 2F5WA 3BIRA 1LOYA 6RNTA 1I2FA 4BIRA 1PY3A 1I0VA 1BNSA 1RTUA 1YNVX 1BSAA 1MGRA 5BU4A 1BGSA 1RHLA 1BUJA 2AAEA 1T2IA 1YGWA 5HOHA 1LOVA 1B2XA 1GMPA 1B2UA 1RCLA 4J5GA 1BU4A 1RGAA 1AY7A 1X1UA 1G02A 3A5EA 2BIRA 1RMSA 1YVSA 1BRSA 1DE3A 1UCIA 1I2EA 1UCLA 1RGLA 2RNTA
chains in the Genus database with same CATH superfamily
2CFWA 1RGFA 4HBRA 1GD4A 2H0GA 1WNHA 1IVXA 1HU9A 3RNTA 5AEWB 1MNLA 2OTL3 1FGOA 1JV2B 2JDIH 4RNTA 3FF2A 3K0ZA 3WODG 3CXC2 5GSPA 2SARA 3KFQC 3K63A 1VQL3 1MWUA 1TU5A 4HM2B 3BNBA 3CC23 3IPTA 3X41A 3CNMA 1IT8A 1M1K4 1IDPA 1GS3A 3MWZA 4K1VA 5I97A 1S723 1T3BA 1M904 4KVHA 3NQZA 3WR2A 5BVBA 1QVF2 1I70A 3CCM3 2UUGC 5RNTA 3UL5A 1UI7A 4HAAA 1M1XB 5AIHA 3UNLA 1LQGC 3URPA 4OUQA 3EN1B 3D5IA 4STDA 1JB5A 1SQWA 1TTOA 3BNCA 3N54B 4MEIA 4MJDA 5M19A 4FMDA 3WMDA 5AYRB 2SBLA 1VQN3 2XF3A 3CPW2 2HMKB 2KF5A 3OW22 2M7OA 1QALA 2Y73A 3LH4A 3GRDA 1EG9B 1BOXA 3AMOB 1FGRA 2XFTA 3H51A 4AKYA 2FGTA 1IQYA 3LMLA 2IUKA 2W56B 1X1WA 3NV0A 1RLSA 1YJN3 3I0YA 3O8YA 2GXFA 5AIIA 3CME3 1A90A 1B2MA 3Q3FA 1FW7A 3FG1A 4HM3B 2FNQA 4BU4A 3U1WA 1QJGA 4BL3A 1JNQA 1BRJA 1TRQA 2C11A 2W9QA 3BU4A 3L0RA 3V99A 1B27A 3S29A 2OQEA 3X3XA 1B3SA 1X1XA 1T2HA 1KQS2 4N6TA 1OGZA 4O02B 1WMPA 1O7PB 1YGEA 8CHOA 1Q9EA 2IY2A 4XDVA 4NHFA 3NBRA 3G6E3 1RGKA 1IV9A 1T5YA 1RSNA 1IV7A 1BRIA 4LMIA 2KF3A 4EXRA 3U97A 3E99A 4X2OA 1GY5A 2Z76A 3DZLA 1DETA 3EQQB 4HM8B 3MPHA 2XR8B 4PEJA 3CCU3 1Q864 1KC84 4XBYA 1BSDA 2BT3A 4J9AA 3JUOA 1W6YA 1CQSA 3SX1A 1W01A 1Q42A 3KN4A 4O3VA 3VGNA 3J7Yd 3KZTA 2CFGA 2CX0A 1BNJA 1DVCA 5IEPA 1W4NA 1JBSA 3VSYA 2WOFA 4HM0B 1RNTA 5JPPA 3JUMA 3M8CA 1C54A 5G1LA 2XGNA 3BIRA 3RGRA 6RNTA 2F99A 1RTUA 1BNSA 2GU1A 3IJEB 1BSAA 1RHLA 1EEJA 1TP6A 3PCSA 3EX9A 3FSDA 2RCDA 4BTYA 1LOVA 1B2XA 1GMPA 1O7HB 2CW9A 3NQYA 1MOLA 1O7MB 4BTXA 1GY7A 1OF5A 4N6UA 1QVG2 3FGYA 2JQ5A 3G0KA 1VQ83 3CC43 1ISKA 1OHSA 1Q7HA 4HM4B 2RSXA 1LNHA 2B24B 3DXOA 4FCJA 2P38A 3LTBA 3HZPA 3H3HA 1W2ZA 1WMNA 2RGQA 1VQ43 3CMA3 1UCLA 1RGLA 2RNTA 3KSED 1OF5B 3UL6A 5CK6A 1I0XA 1V57A 2P05A 4CCVA 2E2TA 2Y74A 3GAXA 5D83A 5AIGA 5DREA 2YX9A 3CC73 4I4KA 1JRQA 1IVVA 2W2CA 2YFIB 4OK0A 4K90B 7STDA 3FH1A 3LTAA 3GZRA 3PS8A 2OTJ3 1A2PA 2CC3A 4ORLA 1B2ZA 1QAFA 1GY6A 2GSPA 2MF7A 4FR9A 1R4YA 4R80A 3KIIA 2J8XB 4J5KA 5ELJA 3AHWA 1TFOA 2YFLB 2UX0A 3K5TA 4H61A 2CG0A 3F7SA 1N5HA 2C10A 2BNGA 4BTWA 4FCZA 1HYFA 1EUIC 1VQQA 1TFKA 4R9LA 1GOVA 3X3ZA 3ALAA 3SLUA 3JUQA 1ZO2A 1R4CA 2CIUA 3OWUA 2H0HA 4H3UA 3WA3A 1Y4KA 3N8BA 4I5QA 1OCVA 2K0MA 3PGBA 3EBTA 3LTDA 3DGYA 4GHOA 1VQO3 5EVHA 4N3VA 5IG4A 1FYSA 1JB4A 1RDSA 2ZHXB 1I2GA 3HK4A 1BNEA 3PZWA 3HX8A 1RN4A 1US1A 4RBNA 4FMAA 1LOXA 3BNEA 3SOAA 3WDGB 1JZOA 3FF0A 1K9M4 4CDLA 1RJOA 1A2KA 1BSEA 1U8CB 7RNTA 2STDA 1DVDA 1VQ93 2ZL8A 1CH0A 3ROBA 5BIRA 1OH0A 3MG1A 1Z1SA 2ZA4A 3AMOA 1HZ1A 5AYSC 2W56A 2XH9A 1MWRA 2GBWB 1BSCA 5KP1A 1I8VA 1O7GB 4KT3B 4MMXB 5AI1A 4K61A 5DRVA 2K3DA 1B21A 2R41A 1UUVB 3UJMA 2W04A 6STDA 3CPOA 1IVUA 1YJW3 1A2VA 1ULJB 1YI23 2KF6A 4FMBA 3AHSA 2CFDA 9RNTA 1JKGB 3CCR3 2XRXB 4EV2A 3OX9A 1E3RA 7GSPA 3LOYA 4N6NB 3Q1CA 2F98A 1PU4A 1FGTA 1DMQA 4MMYB 1U5OA 4LSOA 2WGOA 1RGGA 2H0IA 3CCQ3 5CF2A 1S5AA 5M1AA 2XFSA 4EW5A 3CCS3 5JBSA 3NX0A 1I2FA 4BIRA 5JPUA 1VQ73 1PY3A 3RDEA 1MGRA 3EBYA 1ZX2A 2ZDJA 1UGIA 1W6CA 1WTHA 4HM5B 2P0MA 2L1SA 1N8QA 1T2IA 4EBGA 1VZZA 5HOHA 2IYJA 3QK9A 2PNCA 4RNZA 1RCLA 1NB5I 1OGXA 3LYGA 1D6YA 2CFLA 4FMCA 3G713 5AEUB 4N6LA 2ML6A 2OWPA 3BB9A 4J8TA 3QRDA 3LZAA 3CCL3 1DE3A 4KFEA 2A15A 1UCIA 1QMAA 1YHQ3 3MG2A 4HM7B 4XDWA 3DGMA 1LQMB 3EC9A 1LNIA 1NNVA 2XEPA 3D4AA 3DY5A 3FG4A 1BANA 5IF6A 5EQLA 1ULIB 1OPYA 3CD63 2FXTA 2KRTA 1BIRA 2QA43 4HZBB 3MYTA 1CYUA 1A67A 3DM8A 1DMMA 1UGHI 3T8NA 3G8ZA 1UCKA 1TJDA 1AVLA 1BNIA 2KF4A 1W2B2 2KXGA 3EB8A 4KFFA 1NWWA 1V74A 2CWUA 1LOWA 5IENA 4KZ1A 4WFOA 4ILFA 5A0OB 3CCE3 1L5GB 1BRNL 1AR0A 2O3OA 5LC6A 1BRKA 3GWRA 3GZBA 2W9PA 2QEX3 3NHXA 5KP4A 1WQLB 3G16A 1JZDA 3LTCA 5ELUA 4HZ9B 2IUJA 2XGLA 3UB1A 8RNTA 2HMLB 1C7HA 3LT8A 2W0QA 1FA3A 1K28A 2INXA 1N8R4 3I563 1VQ53 1MWTA 3JUPA 2XSHB 1SIHA 4LYLB 1UI8A 3EF8A 1Q814 1FUSA 3D9RA 3LXUX 1STDA 1PYLA 4QWTA 4RZMA 2HMOB 1ASKA 3GZYB 3JUNA 3DGLA 1GMRA 2UGIA 2C4BA 1RCKA 1SARA 2W6JH 1BVIA 1M9GA 2F4YA 3SEDA 4JRFA 1IVWA 4WP5A 3FLJA 4U13A 5D81A 2F56A 1RKYA 3DUKA 2OCTA 1Q824 1LVNA 1W7CA 2L4VA 3V98A 2F5MA 3F7XA 1GYBA 2E2VA 2K54A 2W03A 4CPKA 1PFPA 1TUHA 5LC7A 3HIIA 1FGQA 4KFDA 4EYCA 4TX4A 3SXXA 1IK3A 3HOHA 4X2HA 4HM6B 1W02A 2GEXA 1RGCA 5FGOA 3ER7A 3S67A 1FZUA 5HGRA 3V92A 4LGQA 1NU3A 3X40A 1JJ22 2IA7A 1O7WB 3EE1A 3A76A 4L7KA 4BL2A 3B7CA 1DMNA 4WHAA 3DGNA 3ZG0A 1JB2A 5G1KA 5KP3A 1CEWI 1N9JA 2RBIA 3AGOA 1JBRA 2CFKA 1Q40B 1X1YA 3X3YA 1AV4A 1B20A 1E3VA 3NM7A 3D5GA 3SVAA 2BMRB 2P0XA 1TRPA 2F5WA 4WYKB 1LOYA 2HMMB 4AKZA 1I0VA 1SJWA 1WMOA 5BU4A 2BMQB 2V1LA 3DMCA 2AAEA 3EJVA 1JKGA 3NM2A 1QAKA 3EN8A 1YGWA 3X42A 2Q07A 3CCV3 3Q2PA 1BUQA 4XM4A 1B2UA 4L8PA 4J5GA 1BU4A 1RGAA 4O8SA 4R9KA 5IEOA 4XBXA 5AIFA 1G02A 3T0UA 4EC6A 5CF1A 4NREA 2GEYA 2BIRA 1RMSA 5BXQA 4R4KA 5IG3A 3I553 4OVMA 3S5CA 1NDOB 4RNYA 1I2EA 4HM1B 1RRHA 4LEHA 1UUGB 2B1XB 2CKFB 4XB5A 2WO0A 1BSBA 4HVNA 3CNXA 2IMJA 1ROAA 1FUWA 3K9MC 5IG5A 2F86B 3BLZA 1W6GA 1RN1A 3EHCA 2LQVA 1TIJA 3JVCA 4NPBA 1ZGXA 2R4IA 4L8OA 1VQP3 2RFRA 1LXEA 1OUNA 1W5ZA 1SPUA 3D79A 2CG1A 2LYXA 3PYJA 1KSIA 1OHOA 3RGAA 1STFI 2BHMA 4EV5A 2ML5A 3NXJA 1IYYA 1V58A 1I3FA 2OOVC 1D6UA 1F8NA 2YFJB 2CWTA 4R1KA 1EQKA 4FCMA 1RGHA 1RRLA 1B2SA 2CH9A 3FZWA 3OWYA 3NBJA 4GSPA 5FW5A 4CJNA 3WA2X 1UUWB 1UDII 3NV0B 5CXOA 4MMZB 1K734 2CX1A 4IPBA 1VQK3 1ROVA 1EA2A 3WOFB 3B4OA 4N6OB 3AGNA 4IIAA 4AEQA 3DGOA 1G96A 2P09A 1KWIA 4HOHA 3WHOA 3FKAA 4IT7A 3F9SA 1D6ZA 1KD14 1RNBA 3N9HA 3NUVA 1I3IA 4LZIA 2CK3H 2Z6BA 2O9UX 1DYUA 1YIJ3 1MGWA 3S27A 5IERA 5TGNA 3DH2A 2HOHA 1UCJA 1BNFA 5IW9A 1AQZA 1BAOA 4WWUC 3TDGA 4O2HA 1NO3A 1BNGA 1FGMA 1GOYA 2E2UA 4N6MA 1IQXA 1O7NB 3OXAA 2Z77A 3SOYA 2Z7AA 4ZM8A 4G1MB 1SIIA 4GL6A 5D82A 3SYUA 3BNDA 3GZXB 1GOUA 3HI7A 3PXMA 4HJLB 1RN7A 1BRGA 2AADA 2HMJB 1BRHA 5G2GA 1JBTA 3OV4A 3KCHA 1YVBI 1NB3I 3MSOA 3OWSA 3FCSB 1Q7Y4 1GMQA 3FG3A 3F40A 1N9EA 3CU3A 3GSPA 4HKVB 4XBTA 2QGUA 2HMNB 2BO9B 1NJI4 4Q53A 2WGQA 3F8HA 1LRAA 1JN5A 3B8LA 6GSPA 2OOVA 3ECFA 3KSPA 1FUTA 1IT7A 1GSPA 1K41A 2KAAA 1RGEA 3MG3A 1YJ93 3IMAB 4HYZA 1E97A 3S28A 3G4S3 1OHPA 5IG0A 3HIGA 1EKMA 2BU4A 1JN5B 2GBXB 3PCRA 3STDA 4K1UA 2QIYA 5EEOA 2BMOB 2GU3A 5M18A 3MKIA 4DKIA 1YNVX 1CYVA 2KCDA 1K8A4 1BGSA 3LT9A 3Q90A 1BUJA 1VQ63 3MHEA 3ZFZA 1VQM3 3VF1A 2I9WA 5CLKA 1G0TA 3WOEB 3D3LA 1N5PA 1Q40A 4N6V0 2CWVA 1W00A 1AY7A 3F8XA 1GD3A 1X1UA 3A5EA 4JF8A 2MC8A 1HKXA 1OACA 1ZS7A 1YVSA 3KKGA 1BRSA 1IQ8A 2PZVA 4WYKA 3ZG5A 2D1WA 3F14A 3T8UA 1UW1A 3B4PA 2OQEC 2CHCA 3K7CA 3CCJ3 3NBBA 1J2BA 1MWSA 1IU7A 1AVKA 3KE7A 2XSOB 5STDA 1YIT3 2WOHA 2D42A 1BNRA 4GB5A
chains in the Genus database with same CATH topology
1RGFA 1BSBA 1LNIA 3D4AA 1BANA 1I0XA 3RNTA 1RN1A 1ZGXA 1BIRA 4RNTA 5GSPA 2SARA 1UCKA 1BNIA 2KF4A 1IYYA 1A2PA 1I3FA 1B2ZA 2GSPA 1R4YA 1LOWA 1RGHA 1B2SA 4J5KA 4GSPA 3WR2A 1BRNL 3AHWA 1I70A 1BRKA 5RNTA 4HAAA 1BNRA 3URPA 8RNTA 1HYFA 3AGNA 3D5IA 1TTOA 1GOVA 4HOHA 3WHOA 1RNBA 1I3IA 2KF5A 1MGWA 1FUSA 1BOXA 1PYLA 3DH2A 2HOHA 1UCJA 1BNFA 1GMRA 1X1WA 1AQZA 1RCKA 1RLSA 1BVIA 1BAOA 1SARA 2C4BA 3DGYA 2F4YA 4GHOA 1FYSA 1B2MA 1RDSA 3Q3FA 1I2GA 1FW7A 1BNEA 4BU4A 1BNGA 1RN4A 1GOYA 2F56A 1BRJA 1TRQA 3BU4A 1BSEA 7RNTA 1B27A 2F5MA 1B3SA 1CH0A 1X1XA 1T2HA 5BIRA 2ZA4A 3SYUA 1GOUA 1HZ1A 3HOHA 1Q9EA 1BRGA 2AADA 1BRHA 1RGCA 1JBTA 1FZUA 1RGKA 3KCHA 1RSNA 1BRIA 2KF3A 1BSCA 1GMQA 1I8VA 3GSPA 1DETA 1B21A 2KF6A 1BSDA 3AHSA 1LRAA 6GSPA 9RNTA 1FUTA 7GSPA 1GSPA 2RBIA 2KAAA 1BNJA 1RGEA 3AGOA 1JBSA 1JBRA 1X1YA 1RNTA 1RGGA 2BU4A 1B20A 1C54A 3D5GA 1TRPA 2F5WA 3BIRA 1LOYA 6RNTA 1I2FA 4BIRA 1PY3A 1I0VA 1BNSA 1RTUA 1YNVX 1BSAA 1MGRA 5BU4A 1BGSA 1RHLA 1BUJA 2AAEA 1T2IA 1YGWA 5HOHA 1LOVA 1B2XA 1GMPA 1B2UA 1RCLA 4J5GA 1BU4A 1RGAA 1AY7A 1X1UA 1G02A 3A5EA 2BIRA 1RMSA 1YVSA 1BRSA 1DE3A 1UCIA 1I2EA 1UCLA 1RGLA 2RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGF A;  1BSB A;  1LNI A;  3D4A A;  1BAN A;  1I0X A;  3RNT A;  1RN1 A;  1ZGX A;  1BIR A;  4RNT A;  5GSP A;  2SAR A;  1UCK A;  1BNI A;  2KF4 A;  1IYY A;  1A2P A;  1I3F A;  1B2Z A;  2GSP A;  1R4Y A;  1LOW A;  1RGH A;  1B2S A;  4J5K A;  4GSP A;  3WR2 A;  1BRN L;  3AHW A;  1I70 A;  1BRK A;  5RNT A;  4HAA A;  1BNR A;  3URP A;  8RNT A;  1HYF A;  3AGN A;  3D5I A;  1TTO A;  1GOV A;  4HOH A;  3WHO A;  1RNB A;  1I3I A;  2KF5 A;  1MGW A;  1FUS A;  1BOX A;  1PYL A;  3DH2 A;  2HOH A;  1UCJ A;  1BNF A;  1GMR A;  1X1W A;  1AQZ A;  1RCK A;  1RLS A;  1BVI A;  1BAO A;  1SAR A;  2C4B A;  3DGY A;  2F4Y A;  4GHO A;  1FYS A;  1B2M A;  1RDS A;  3Q3F A;  1I2G A;  1FW7 A;  1BNE A;  4BU4 A;  1BNG A;  1RN4 A;  1GOY A;  2F56 A;  1BRJ A;  1TRQ A;  3BU4 A;  1BSE A;  7RNT A;  1B27 A;  2F5M A;  1B3S A;  1CH0 A;  1X1X A;  1T2H A;  5BIR A;  2ZA4 A;  3SYU A;  1GOU A;  1HZ1 A;  3HOH A;  1Q9E A;  1BRG A;  2AAD A;  1BRH A;  1RGC A;  1JBT A;  1FZU A;  1RGK A;  3KCH A;  1RSN A;  1BRI A;  2KF3 A;  1BSC A;  1GMQ A;  1I8V A;  3GSP A;  1DET A;  1B21 A;  2KF6 A;  1BSD A;  3AHS A;  1LRA A;  6GSP A;  9RNT A;  1FUT A;  7GSP A;  1GSP A;  2RBI A;  2KAA A;  1BNJ A;  1RGE A;  3AGO A;  1JBS A;  1JBR A;  1X1Y A;  1RNT A;  1RGG A;  2BU4 A;  1B20 A;  1C54 A;  3D5G A;  1TRP A;  2F5W A;  3BIR A;  1LOY A;  6RNT A;  1I2F A;  4BIR A;  1PY3 A;  1I0V A;  1BNS A;  1RTU A;  1YNV X;  1BSA A;  1MGR A;  5BU4 A;  1BGS A;  1RHL A;  1BUJ A;  2AAE A;  1T2I A;  1YGW A;  5HOH A;  1LOV A;  1B2X A;  1GMP A;  1B2U A;  1RCL A;  4J5G A;  1BU4 A;  1RGA A;  1AY7 A;  1X1U A;  1G02 A;  3A5E A;  2BIR A;  1RMS A;  1YVS A;  1BRS A;  1DE3 A;  1UCI A;  1I2E A;  1UCL A;  1RGL A;  2RNT A; 
#chains in the Genus database with same CATH topology
 2CFW A;  1RGF A;  4HBR A;  1GD4 A;  2H0G A;  1WNH A;  1IVX A;  1HU9 A;  3RNT A;  5AEW B;  1MNL A;  2OTL 3;  1FGO A;  1JV2 B;  2JDI H;  4RNT A;  3FF2 A;  3K0Z A;  3WOD G;  3CXC 2;  5GSP A;  2SAR A;  3KFQ C;  3K63 A;  1VQL 3;  1MWU A;  1TU5 A;  4HM2 B;  3BNB A;  3CC2 3;  3IPT A;  3X41 A;  3CNM A;  1IT8 A;  1M1K 4;  1IDP A;  1GS3 A;  3MWZ A;  4K1V A;  5I97 A;  1S72 3;  1T3B A;  1M90 4;  4KVH A;  3NQZ A;  3WR2 A;  5BVB A;  1QVF 2;  1I70 A;  3CCM 3;  2UUG C;  5RNT A;  3UL5 A;  1UI7 A;  4HAA A;  1M1X B;  5AIH A;  3UNL A;  1LQG C;  3URP A;  4OUQ A;  3EN1 B;  3D5I A;  4STD A;  1JB5 A;  1SQW A;  1TTO A;  3BNC A;  3N54 B;  4MEI A;  4MJD A;  5M19 A;  4FMD A;  3WMD A;  5AYR B;  2SBL A;  1VQN 3;  2XF3 A;  3CPW 2;  2HMK B;  2KF5 A;  3OW2 2;  2M7O A;  1QAL A;  2Y73 A;  3LH4 A;  3GRD A;  1EG9 B;  1BOX A;  3AMO B;  1FGR A;  2XFT A;  3H51 A;  4AKY A;  2FGT A;  1IQY A;  3LML A;  2IUK A;  2W56 B;  1X1W A;  3NV0 A;  1RLS A;  1YJN 3;  3I0Y A;  3O8Y A;  2GXF A;  5AII A;  3CME 3;  1A90 A;  1B2M A;  3Q3F A;  1FW7 A;  3FG1 A;  4HM3 B;  2FNQ A;  4BU4 A;  3U1W A;  1QJG A;  4BL3 A;  1JNQ A;  1BRJ A;  1TRQ A;  2C11 A;  2W9Q A;  3BU4 A;  3L0R A;  3V99 A;  1B27 A;  3S29 A;  2OQE A;  3X3X A;  1B3S A;  1X1X A;  1T2H A;  1KQS 2;  4N6T A;  1OGZ A;  4O02 B;  1WMP A;  1O7P B;  1YGE A;  8CHO A;  1Q9E A;  2IY2 A;  4XDV A;  4NHF A;  3NBR A;  3G6E 3;  1RGK A;  1IV9 A;  1T5Y A;  1RSN A;  1IV7 A;  1BRI A;  4LMI A;  2KF3 A;  4EXR A;  3U97 A;  3E99 A;  4X2O A;  1GY5 A;  2Z76 A;  3DZL A;  1DET A;  3EQQ B;  4HM8 B;  3MPH A;  2XR8 B;  4PEJ A;  3CCU 3;  1Q86 4;  1KC8 4;  4XBY A;  1BSD A;  2BT3 A;  4J9A A;  3JUO A;  1W6Y A;  1CQS A;  3SX1 A;  1W01 A;  1Q42 A;  3KN4 A;  4O3V A;  3VGN A;  3J7Y d;  3KZT A;  2CFG A;  2CX0 A;  1BNJ A;  1DVC A;  5IEP A;  1W4N A;  1JBS A;  3VSY A;  2WOF A;  4HM0 B;  1RNT A;  5JPP A;  3JUM A;  3M8C A;  1C54 A;  5G1L A;  2XGN A;  3BIR A;  3RGR A;  6RNT A;  2F99 A;  1RTU A;  1BNS A;  2GU1 A;  3IJE B;  1BSA A;  1RHL A;  1EEJ A;  1TP6 A;  3PCS A;  3EX9 A;  3FSD A;  2RCD A;  4BTY A;  1LOV A;  1B2X A;  1GMP A;  1O7H B;  2CW9 A;  3NQY A;  1MOL A;  1O7M B;  4BTX A;  1GY7 A;  1OF5 A;  4N6U A;  1QVG 2;  3FGY A;  2JQ5 A;  3G0K A;  1VQ8 3;  3CC4 3;  1ISK A;  1OHS A;  1Q7H A;  4HM4 B;  2RSX A;  1LNH A;  2B24 B;  3DXO A;  4FCJ A;  2P38 A;  3LTB A;  3HZP A;  3H3H A;  1W2Z A;  1WMN A;  2RGQ A;  1VQ4 3;  3CMA 3;  1UCL A;  1RGL A;  2RNT A;  3KSE D;  1OF5 B;  3UL6 A;  5CK6 A;  1I0X A;  1V57 A;  2P05 A;  4CCV A;  2E2T A;  2Y74 A;  3GAX A;  5D83 A;  5AIG A;  5DRE A;  2YX9 A;  3CC7 3;  4I4K A;  1JRQ A;  1IVV A;  2W2C A;  2YFI B;  4OK0 A;  4K90 B;  7STD A;  3FH1 A;  3LTA A;  3GZR A;  3PS8 A;  2OTJ 3;  1A2P A;  2CC3 A;  4ORL A;  1B2Z A;  1QAF A;  1GY6 A;  2GSP A;  2MF7 A;  4FR9 A;  1R4Y A;  4R80 A;  3KII A;  2J8X B;  4J5K A;  5ELJ A;  3AHW A;  1TFO A;  2YFL B;  2UX0 A;  3K5T A;  4H61 A;  2CG0 A;  3F7S A;  1N5H A;  2C10 A;  2BNG A;  4BTW A;  4FCZ A;  1HYF A;  1EUI C;  1VQQ A;  1TFK A;  4R9L A;  1GOV A;  3X3Z A;  3ALA A;  3SLU A;  3JUQ A;  1ZO2 A;  1R4C A;  2CIU A;  3OWU A;  2H0H A;  4H3U A;  3WA3 A;  1Y4K A;  3N8B A;  4I5Q A;  1OCV A;  2K0M A;  3PGB A;  3EBT A;  3LTD A;  3DGY A;  4GHO A;  1VQO 3;  5EVH A;  4N3V A;  5IG4 A;  1FYS A;  1JB4 A;  1RDS A;  2ZHX B;  1I2G A;  3HK4 A;  1BNE A;  3PZW A;  3HX8 A;  1RN4 A;  1US1 A;  4RBN A;  4FMA A;  1LOX A;  3BNE A;  3SOA A;  3WDG B;  1JZO A;  3FF0 A;  1K9M 4;  4CDL A;  1RJO A;  1A2K A;  1BSE A;  1U8C B;  7RNT A;  2STD A;  1DVD A;  1VQ9 3;  2ZL8 A;  1CH0 A;  3ROB A;  5BIR A;  1OH0 A;  3MG1 A;  1Z1S A;  2ZA4 A;  3AMO A;  1HZ1 A;  5AYS C;  2W56 A;  2XH9 A;  1MWR A;  2GBW B;  1BSC A;  5KP1 A;  1I8V A;  1O7G B;  4KT3 B;  4MMX B;  5AI1 A;  4K61 A;  5DRV A;  2K3D A;  1B21 A;  2R41 A;  1UUV B;  3UJM A;  2W04 A;  6STD A;  3CPO A;  1IVU A;  1YJW 3;  1A2V A;  1ULJ B;  1YI2 3;  2KF6 A;  4FMB A;  3AHS A;  2CFD A;  9RNT A;  1JKG B;  3CCR 3;  2XRX B;  4EV2 A;  3OX9 A;  1E3R A;  7GSP A;  3LOY A;  4N6N B;  3Q1C A;  2F98 A;  1PU4 A;  1FGT A;  1DMQ A;  4MMY B;  1U5O A;  4LSO A;  2WGO A;  1RGG A;  2H0I A;  3CCQ 3;  5CF2 A;  1S5A A;  5M1A A;  2XFS A;  4EW5 A;  3CCS 3;  5JBS A;  3NX0 A;  1I2F A;  4BIR A;  5JPU A;  1VQ7 3;  1PY3 A;  3RDE A;  1MGR A;  3EBY A;  1ZX2 A;  2ZDJ A;  1UGI A;  1W6C A;  1WTH A;  4HM5 B;  2P0M A;  2L1S A;  1N8Q A;  1T2I A;  4EBG A;  1VZZ A;  5HOH A;  2IYJ A;  3QK9 A;  2PNC A;  4RNZ A;  1RCL A;  1NB5 I;  1OGX A;  3LYG A;  1D6Y A;  2CFL A;  4FMC A;  3G71 3;  5AEU B;  4N6L A;  2ML6 A;  2OWP A;  3BB9 A;  4J8T A;  3QRD A;  3LZA A;  3CCL 3;  1DE3 A;  4KFE A;  2A15 A;  1UCI A;  1QMA A;  1YHQ 3;  3MG2 A;  4HM7 B;  4XDW A;  3DGM A;  1LQM B;  3EC9 A;  1LNI A;  1NNV A;  2XEP A;  3D4A A;  3DY5 A;  3FG4 A;  1BAN A;  5IF6 A;  5EQL A;  1ULI B;  1OPY A;  3CD6 3;  2FXT A;  2KRT A;  1BIR A;  2QA4 3;  4HZB B;  3MYT A;  1CYU A;  1A67 A;  3DM8 A;  1DMM A;  1UGH I;  3T8N A;  3G8Z A;  1UCK A;  1TJD A;  1AVL A;  1BNI A;  2KF4 A;  1W2B 2;  2KXG A;  3EB8 A;  4KFF A;  1NWW A;  1V74 A;  2CWU A;  1LOW A;  5IEN A;  4KZ1 A;  4WFO A;  4ILF A;  5A0O B;  3CCE 3;  1L5G B;  1BRN L;  1AR0 A;  2O3O A;  5LC6 A;  1BRK A;  3GWR A;  3GZB A;  2W9P A;  2QEX 3;  3NHX A;  5KP4 A;  1WQL B;  3G16 A;  1JZD A;  3LTC A;  5ELU A;  4HZ9 B;  2IUJ A;  2XGL A;  3UB1 A;  8RNT A;  2HML B;  1C7H A;  3LT8 A;  2W0Q A;  1FA3 A;  1K28 A;  2INX A;  1N8R 4;  3I56 3;  1VQ5 3;  1MWT A;  3JUP A;  2XSH B;  1SIH A;  4LYL B;  1UI8 A;  3EF8 A;  1Q81 4;  1FUS A;  3D9R A;  3LXU X;  1STD A;  1PYL A;  4QWT A;  4RZM A;  2HMO B;  1ASK A;  3GZY B;  3JUN A;  3DGL A;  1GMR A;  2UGI A;  2C4B A;  1RCK A;  1SAR A;  2W6J H;  1BVI A;  1M9G A;  2F4Y A;  3SED A;  4JRF A;  1IVW A;  4WP5 A;  3FLJ A;  4U13 A;  5D81 A;  2F56 A;  1RKY A;  3DUK A;  2OCT A;  1Q82 4;  1LVN A;  1W7C A;  2L4V A;  3V98 A;  2F5M A;  3F7X A;  1GYB A;  2E2V A;  2K54 A;  2W03 A;  4CPK A;  1PFP A;  1TUH A;  5LC7 A;  3HII A;  1FGQ A;  4KFD A;  4EYC A;  4TX4 A;  3SXX A;  1IK3 A;  3HOH A;  4X2H A;  4HM6 B;  1W02 A;  2GEX A;  1RGC A;  5FGO A;  3ER7 A;  3S67 A;  1FZU A;  5HGR A;  3V92 A;  4LGQ A;  1NU3 A;  3X40 A;  1JJ2 2;  2IA7 A;  1O7W B;  3EE1 A;  3A76 A;  4L7K A;  4BL2 A;  3B7C A;  1DMN A;  4WHA A;  3DGN A;  3ZG0 A;  1JB2 A;  5G1K A;  5KP3 A;  1CEW I;  1N9J A;  2RBI A;  3AGO A;  1JBR A;  2CFK A;  1Q40 B;  1X1Y A;  3X3Y A;  1AV4 A;  1B20 A;  1E3V A;  3NM7 A;  3D5G A;  3SVA A;  2BMR B;  2P0X A;  1TRP A;  2F5W A;  4WYK B;  1LOY A;  2HMM B;  4AKZ A;  1I0V A;  1SJW A;  1WMO A;  5BU4 A;  2BMQ B;  2V1L A;  3DMC A;  2AAE A;  3EJV A;  1JKG A;  3NM2 A;  1QAK A;  3EN8 A;  1YGW A;  3X42 A;  2Q07 A;  3CCV 3;  3Q2P A;  1BUQ A;  4XM4 A;  1B2U A;  4L8P A;  4J5G A;  1BU4 A;  1RGA A;  4O8S A;  4R9K A;  5IEO A;  4XBX A;  5AIF A;  1G02 A;  3T0U A;  4EC6 A;  5CF1 A;  4NRE A;  2GEY A;  2BIR A;  1RMS A;  5BXQ A;  4R4K A;  5IG3 A;  3I55 3;  4OVM A;  3S5C A;  1NDO B;  4RNY A;  1I2E A;  4HM1 B;  1RRH A;  4LEH A;  1UUG B;  2B1X B;  2CKF B;  4XB5 A;  2WO0 A;  1BSB A;  4HVN A;  3CNX A;  2IMJ A;  1ROA A;  1FUW A;  3K9M C;  5IG5 A;  2F86 B;  3BLZ A;  1W6G A;  1RN1 A;  3EHC A;  2LQV A;  1TIJ A;  3JVC A;  4NPB A;  1ZGX A;  2R4I A;  4L8O A;  1VQP 3;  2RFR A;  1LXE A;  1OUN A;  1W5Z A;  1SPU A;  3D79 A;  2CG1 A;  2LYX A;  3PYJ A;  1KSI A;  1OHO A;  3RGA A;  1STF I;  2BHM A;  4EV5 A;  2ML5 A;  3NXJ A;  1IYY A;  1V58 A;  1I3F A;  2OOV C;  1D6U A;  1F8N A;  2YFJ B;  2CWT A;  4R1K A;  1EQK A;  4FCM A;  1RGH A;  1RRL A;  1B2S A;  2CH9 A;  3FZW A;  3OWY A;  3NBJ A;  4GSP A;  5FW5 A;  4CJN A;  3WA2 X;  1UUW B;  1UDI I;  3NV0 B;  5CXO A;  4MMZ B;  1K73 4;  2CX1 A;  4IPB A;  1VQK 3;  1ROV A;  1EA2 A;  3WOF B;  3B4O A;  4N6O B;  3AGN A;  4IIA A;  4AEQ A;  3DGO A;  1G96 A;  2P09 A;  1KWI A;  4HOH A;  3WHO A;  3FKA A;  4IT7 A;  3F9S A;  1D6Z A;  1KD1 4;  1RNB A;  3N9H A;  3NUV A;  1I3I A;  4LZI A;  2CK3 H;  2Z6B A;  2O9U X;  1DYU A;  1YIJ 3;  1MGW A;  3S27 A;  5IER A;  5TGN A;  3DH2 A;  2HOH A;  1UCJ A;  1BNF A;  5IW9 A;  1AQZ A;  1BAO A;  4WWU C;  3TDG A;  4O2H A;  1NO3 A;  1BNG A;  1FGM A;  1GOY A;  2E2U A;  4N6M A;  1IQX A;  1O7N B;  3OXA A;  2Z77 A;  3SOY A;  2Z7A A;  4ZM8 A;  4G1M B;  1SII A;  4GL6 A;  5D82 A;  3SYU A;  3BND A;  3GZX B;  1GOU A;  3HI7 A;  3PXM A;  4HJL B;  1RN7 A;  1BRG A;  2AAD A;  2HMJ B;  1BRH A;  5G2G A;  1JBT A;  3OV4 A;  3KCH A;  1YVB I;  1NB3 I;  3MSO A;  3OWS A;  3FCS B;  1Q7Y 4;  1GMQ A;  3FG3 A;  3F40 A;  1N9E A;  3CU3 A;  3GSP A;  4HKV B;  4XBT A;  2QGU A;  2HMN B;  2BO9 B;  1NJI 4;  4Q53 A;  2WGQ A;  3F8H A;  1LRA A;  1JN5 A;  3B8L A;  6GSP A;  2OOV A;  3ECF A;  3KSP A;  1FUT A;  1IT7 A;  1GSP A;  1K41 A;  2KAA A;  1RGE A;  3MG3 A;  1YJ9 3;  3IMA B;  4HYZ A;  1E97 A;  3S28 A;  3G4S 3;  1OHP A;  5IG0 A;  3HIG A;  1EKM A;  2BU4 A;  1JN5 B;  2GBX B;  3PCR A;  3STD A;  4K1U A;  2QIY A;  5EEO A;  2BMO B;  2GU3 A;  5M18 A;  3MKI A;  4DKI A;  1YNV X;  1CYV A;  2KCD A;  1K8A 4;  1BGS A;  3LT9 A;  3Q90 A;  1BUJ A;  1VQ6 3;  3MHE A;  3ZFZ A;  1VQM 3;  3VF1 A;  2I9W A;  5CLK A;  1G0T A;  3WOE B;  3D3L A;  1N5P A;  1Q40 A;  4N6V 0;  2CWV A;  1W00 A;  1AY7 A;  3F8X A;  1GD3 A;  1X1U A;  3A5E A;  4JF8 A;  2MC8 A;  1HKX A;  1OAC A;  1ZS7 A;  1YVS A;  3KKG A;  1BRS A;  1IQ8 A;  2PZV A;  4WYK A;  3ZG5 A;  2D1W A;  3F14 A;  3T8U A;  1UW1 A;  3B4P A;  2OQE C;  2CHC A;  3K7C A;  3CCJ 3;  3NBB A;  1J2B A;  1MWS A;  1IU7 A;  1AVK A;  3KE7 A;  2XSO B;  5STD A;  1YIT 3;  2WOH A;  2D42 A;  1BNR A;  4GB5 A; 
#chains in the Genus database with same CATH homology
 1RGF A;  1BSB A;  1LNI A;  3D4A A;  1BAN A;  1I0X A;  3RNT A;  1RN1 A;  1ZGX A;  1BIR A;  4RNT A;  5GSP A;  2SAR A;  1UCK A;  1BNI A;  2KF4 A;  1IYY A;  1A2P A;  1I3F A;  1B2Z A;  2GSP A;  1R4Y A;  1LOW A;  1RGH A;  1B2S A;  4J5K A;  4GSP A;  3WR2 A;  1BRN L;  3AHW A;  1I70 A;  1BRK A;  5RNT A;  4HAA A;  1BNR A;  3URP A;  8RNT A;  1HYF A;  3AGN A;  3D5I A;  1TTO A;  1GOV A;  4HOH A;  3WHO A;  1RNB A;  1I3I A;  2KF5 A;  1MGW A;  1FUS A;  1BOX A;  1PYL A;  3DH2 A;  2HOH A;  1UCJ A;  1BNF A;  1GMR A;  1X1W A;  1AQZ A;  1RCK A;  1RLS A;  1BVI A;  1BAO A;  1SAR A;  2C4B A;  3DGY A;  2F4Y A;  4GHO A;  1FYS A;  1B2M A;  1RDS A;  3Q3F A;  1I2G A;  1FW7 A;  1BNE A;  4BU4 A;  1BNG A;  1RN4 A;  1GOY A;  2F56 A;  1BRJ A;  1TRQ A;  3BU4 A;  1BSE A;  7RNT A;  1B27 A;  2F5M A;  1B3S A;  1CH0 A;  1X1X A;  1T2H A;  5BIR A;  2ZA4 A;  3SYU A;  1GOU A;  1HZ1 A;  3HOH A;  1Q9E A;  1BRG A;  2AAD A;  1BRH A;  1RGC A;  1JBT A;  1FZU A;  1RGK A;  3KCH A;  1RSN A;  1BRI A;  2KF3 A;  1BSC A;  1GMQ A;  1I8V A;  3GSP A;  1DET A;  1B21 A;  2KF6 A;  1BSD A;  3AHS A;  1LRA A;  6GSP A;  9RNT A;  1FUT A;  7GSP A;  1GSP A;  2RBI A;  2KAA A;  1BNJ A;  1RGE A;  3AGO A;  1JBS A;  1JBR A;  1X1Y A;  1RNT A;  1RGG A;  2BU4 A;  1B20 A;  1C54 A;  3D5G A;  1TRP A;  2F5W A;  3BIR A;  1LOY A;  6RNT A;  1I2F A;  4BIR A;  1PY3 A;  1I0V A;  1BNS A;  1RTU A;  1YNV X;  1BSA A;  1MGR A;  5BU4 A;  1BGS A;  1RHL A;  1BUJ A;  2AAE A;  1T2I A;  1YGW A;  5HOH A;  1LOV A;  1B2X A;  1GMP A;  1B2U A;  1RCL A;  4J5G A;  1BU4 A;  1RGA A;  1AY7 A;  1X1U A;  1G02 A;  3A5E A;  2BIR A;  1RMS A;  1YVS A;  1BRS A;  1DE3 A;  1UCI A;  1I2E A;  1UCL A;  1RGL A;  2RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...