3D5GA

Structure of ribonuclease sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 24
structure length 96
sequence length 96
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5gA00
3GSPA 1BNJA 2RBIA 2KF4A 1RNBA 1RDSA 1PY3A 2AADA 1YGWA 1BNGA 1B2ZA 2AAEA 1MGWA 1UCKA 1ZGXA 3BIRA 3A5EA 1BSDA 4BU4A 1DETA 1GMPA 1B2UA 1X1UA 1YNVX 1BRJA 4HOHA 4J5KA 1FYSA 1GOVA 2KAAA 2F56A 1I0VA 1RGKA 2C4BA 1BNIA 1GMRA 2GSPA 1BNSA 2F5MA 1I3FA 2RNTA 1BVIA 1LOYA 2KF6A 1I2GA 1RLSA 1UCLA 1I0XA 6RNTA 7RNTA 1JBSA 1AQZA 1GOYA 1RMSA 1BNRA 3KCHA 3DH2A 5GSPA 1TRQA 2ZA4A 1RCLA 1BRNL 1IYYA 1LOVA 1B2SA 1BU4A 3AHWA 4GSPA 1RGCA 1RNTA 6GSPA 1R4YA 1RN4A 1B27A 1TRPA 4RNTA 3HOHA 1RTUA 3RNTA 1GMQA 1JBRA 1Q9EA 4J5GA 4GHOA 3D5IA 1BSBA 1HYFA 4HAAA 1B21A 3D5GA 3AGNA 1BIRA 2F5WA 1T2HA 4BIRA 1B2XA 5BU4A 1PYLA 1RGLA 3D4AA 5BIRA 1BRSA 1RSNA 3URPA 1UCIA 2HOHA 1B20A 1FZUA 1HZ1A 1CH0A 3BU4A 1BNFA 5HOHA 1BSCA 1LNIA 3Q3FA 3WR2A 3SYUA 1RHLA 2BU4A 1BSEA 1UCJA 1B2MA 1BSAA 1G02A 2KF3A 1BANA 1FW7A 1BRKA 3WHOA 1I2FA 1GOUA 1AY7A 1RCKA 5RNTA 1JBTA 1I8VA 1BRGA 1RN1A 1SARA 1TTOA 1BAOA 9RNTA 3AHSA 1X1WA 1C54A 1I2EA 2SARA 1BNEA 1BGSA 2F4YA 1BRIA 1RGFA 1X1XA 2BIRA 1RGEA 1DE3A 1I70A 1MGRA 1A2PA 1BRHA 1B3SA 3DGYA 1FUTA 1FUSA 1RGHA 3AGOA 2KF5A 1GSPA 1LOWA 7GSPA 1I3IA 1RGGA 1RGAA 1BOXA 1LRAA 1X1YA 1BUJA 1YVSA 1T2IA 8RNTA
chains in the Genus database with same CATH superfamily
1Q7HA 1O7PB 3OWYA 3F7XA 1OGXA 2W0QA 2K0MA 1TFKA 3F8HA 1VQO3 3GSPA 4LZIA 2RBIA 2KF4A 2OQEC 1RNBA 1PY3A 2AADA 3KE7A 3S28A 3D79A 1BNGA 2XF3A 3EE1A 4NPBA 1MGWA 3V99A 3A5EA 1BSDA 3G4S3 1GMPA 1K9M4 3CCR3 1N9EA 2QIYA 4J5KA 1FYSA 1RRLA 2INXA 5IG4A 4MMXB 1RN7A 1I0VA 4XBXA 1DMNA 3F14A 4O8SA 2RGQA 1GMRA 3PS8A 1Q40B 4N6UA 1I3FA 1ULJB 2O3OA 4NHFA 2F98A 3FLJA 1IT7A 4KFEA 2HMOB 2MF7A 1RLSA 3FCSB 4LYLB 4HBRA 4R4KA 1A2VA 1W2B2 1JBSA 3CCU3 5LC7A 3HX8A 1KQS2 1RMSA 1SQWA 1BNRA 3ZFZA 3GRDA 2KRTA 3FKAA 4FMCA 4K90B 2CWTA 3BLZA 1N5PA 2J8XB 3GAXA 3MSOA 1V57A 3CCM3 3NV0B 3K5TA 1E3VA 2UUGC 6GSPA 1UGHI 2CX1A 2R4IA 1KSIA 3WA2X 2CK3H 4J9AA 3ZG0A 3RNTA 2IYJA 1MWSA 1AR0A 2YX9A 1A90A 1CYVA 3N54B 4N6LA 1VQN3 3HIIA 3LH4A 4HAAA 1B21A 3JVCA 2HMMB 3BNDA 1K28A 5HGRA 1IT8A 2STDA 1O7GB 1NO3A 2F5WA 1T2HA 4WWUC 3LXUX 3PCSA 4XB5A 3ER7A 1EEJA 3QRDA 3D4AA 5IEOA 1LXEA 1N5HA 5I97A 1B20A 3SOYA 2BO9B 5AIHA 3BNCA 4XBYA 3EHCA 3Q3FA 1LNIA 3DXOA 1AV4A 3UL5A 3WOFB 2IY2A 1N8QA 3CCS3 1WMPA 3FG3A 1RHLA 4N6MA 3CU3A 1JN5A 1BSAA 2KF3A 2CHCA 7STDA 4IPBA 3CXC2 3LT8A 2OOVA 1I2FA 2WO0A 1GOUA 3D9RA 3KKGA 3CD63 3KIIA 2XFSA 1W02A 3LOYA 1JBTA 3G713 3CCQ3 1EKMA 1RN1A 1MWTA 1D6ZA 1IVUA 1JKGA 3SEDA 4R9KA 3SVAA 1ROAA 1BAOA 2HMLB 3NM2A 2LQVA 3AHSA 4EBGA 4J8TA 1BUQA 2IA7A 1O7WB 1GD4A 1NJI4 4HM5B 1NB5I 4X2HA 1SPUA 2XGLA 1RGFA 3HK4A 2BIRA 5CF1A 5AYSC 3AMOA 1WQLB 4EW5A 1MGRA 2CFLA 1ISKA 1SIHA 1Q814 3DGYA 3M8CA 1FUTA 1LVNA 4K1UA 1YIT3 1S5AA 1VZZA 4N3VA 1LOXA 3MG1A 1RGGA 1OF5A 2H0GA 1NNVA 2CFKA 1IQYA 2M7OA 4IIAA 4JF8A 2CWUA 5AI1A 5DREA 4HM6B 5KP4A 4OVMA 2K3DA 5M18A 2Z76A 4OK0A 2Y73A 4R9LA 3OWSA 2CKFB 1TJDA 1JZOA 2BMQB 3N8BA 1EG9B 1VQP3 4LGQA 2L4VA 3DUKA 3FSDA 1MNLA 1TUHA 1HU9A 1UCKA 1ZGXA 3BIRA 3H51A 1YJW3 2ZDJA 4WYKA 3SX1A 3MPHA 4EC6A 1O7NB 1GOVA 4AKYA 2CW9A 2KAAA 3CNMA 5KP3A 3BNBA 3MWZA 1YHQ3 2C4BA 4HM2B 1FGOA 1VQM3 5JBSA 1CEWI 1W2ZA 1BNIA 2BMRB 2FGTA 4JRFA 4BL3A 1M9GA 3KZTA 1CYUA 1TIJA 2P0XA 2F99A 2H0HA 4IT7A 2CC3A 2ML5A 1Q864 4MMYB 5IG5A 3F8XA 4HM7B 4N6V0 1IU7A 3EJVA 1V58A 4XBTA 3CMA3 2CIUA 1I2GA 4O02B 4HYZA 1G96A 2W56A 1GOYA 2CX0A 4FMAA 3DH2A 1W00A 1TRQA 2E2TA 4HM3B 2OQEA 1RRHA 2ZA4A 3V98A 1YIJ3 2D1WA 1E3RA 1IV7A 1BU4A 1LOVA 1YGEA 3PZWA 3T8NA 3PCRA 4PEJA 1N9JA 4XDVA 1OHSA 1JNQA 4CPKA 3GZRA 3I553 2W9PA 3CME3 3X42A 1VQ43 1K41A 1JB2A 4XDWA 3NUVA 4RNZA 3HOHA 1YI23 4X2OA 1JBRA 4J5GA 4GHOA 2ZHXB 2B1XB 1LQGC 3MHEA 3LTBA 4AKZA 1VQ93 1US1A 4H3UA 1HYFA 4RZMA 1VQK3 5FW5A 3D5GA 3KSPA 4FMDA 3CPW2 3DM8A 3NM7A 2K54A 5G1KA 1Q824 3G16A 3X3ZA 4RNYA 1B2XA 2Q07A 1QAFA 1PYLA 1T5YA 3S29A 3WMDA 3EBTA 4BTYA 5IEPA 1K734 1IVXA 3B8LA 3CPOA 2ZL8A 4N6TA 3G0KA 5CK6A 2BMOB 1HZ1A 1W6YA 3IPTA 3EF8A 5G1LA 3U1WA 5HOHA 1QVF2 1ASKA 1BSCA 2WGOA 3X41A 3WR2A 2XSOB 3RGAA 2O9UX 2PNCA 3NBJA 1PFPA 4EV5A 1KC84 1HKXA 2UGIA 3FZWA 5AIIA 1UCJA 4G1MB 3T8UA 4KZ1A 4GB5A 4HZBB 1BANA 5ELUA 1FW7A 3WHOA 1VQL3 3WA3A 3ROBA 4HM0B 1G0TA 1K8A4 3OX9A 4CJNA 3LTCA 1BRGA 4L7KA 3NV0A 1U8CB 3S67A 4HKVB 2FNQA 4BTWA 3JUNA 4KFFA 2QEX3 2JDIH 3MG3A 1JB5A 4LEHA 1J2BA 3EC9A 4LSOA 1VQ63 3DMCA 2GEXA 1ZX2A 1RGEA 1S723 3IJEB 3JUOA 1I70A 4L8PA 1MWRA 5AIGA 4AEQA 2WOHA 1W4NA 2BT3A 3IMAB 1RGHA 5JPPA 2KF5A 1LQMB 2YFJB 2R41A 4KVHA 1IQ8A 3ECFA 5EEOA 3D3LA 1IV9A 1DVCA 2KCDA 2CG1A 1BOXA 1LRAA 5CF2A 4HVNA 1OGZA 3SLUA 1BUJA 2XR8B 1W6CA 2A15A 1SJWA 3A76A 3GZBA 3MKIA 1T3BA 1BNJA 3Q1CA 4HZ9B 1W6GA 1RDSA 3CC23 1W7CA 1YGWA 1CQSA 4O3VA 3K9MC 4Q53A 1QJGA 3UJMA 2OTL3 2P09A 2GEYA 1GS3A 2AAEA 2Y74A 3LZAA 4BU4A 3X3XA 1B2UA 2F56A 2RFRA 5AEWB 1JN5B 2XH9A 5KP1A 1E97A 4ZM8A 1SIIA 2P05A 2XFTA 3F40A 1JV2B 1IQXA 2GBXB 5D83A 1BNSA 2F5MA 2E2VA 3T0UA 3KFQC 8CHOA 3DY5A 4CDLA 2RNTA 1TFOA 2OCTA 4HM1B 4KFDA 1DMQA 1LOYA 1AVKA 5FGOA 1UCLA 5STDA 3TDGA 4K1VA 3UNLA 4MEIA 6RNTA 4ILFA 1AQZA 2I9WA 5GSPA 6STDA 4K61A 1RJOA 4WFOA 5AEUB 1FUWA 1FGMA 1VQ83 1AVLA 1LNHA 1IYYA 1QALA 3BNEA 5ELJA 1B2SA 2C11A 3BB9A 4GSPA 3GZYB 1UW1A 5M1AA 1RGCA 1R4YA 2IUJA 4WP5A 5A0OB 1IK3A 2GU3A 1RN4A 2ML6A 2CG0A 1M1XB 2GXFA 2W03A 3F7SA 2CWVA 4FCMA 4RNTA 4DKIA 1ZS7A 1RTUA 2BNGA 2XGNA 1DVDA 3B4OA 4QWTA 3LTAA 3D5IA 3ALAA 1FA3A 2CH9A 1KD14 2QA43 4CCVA 3NQYA 1MOLA 1TP6A 2XEPA 3KSED 3DZLA 3J7Yd 1N8R4 1A67A 1M904 1IVVA 3V92A 3AGNA 4R80A 1BIRA 4BIRA 2Z7AA 1OCVA 4MMZB 3SXXA 1M1K4 1C7HA 5BIRA 3X40A 3MG2A 3URPA 1JKGB 3CCJ3 1JZDA 3EX9A 3EQQB 1Y4KA 1JB4A 3PXMA 3Q2PA 4R1KA 3VGNA 1CH0A 5JPUA 1BNFA 1EQKA 2RCDA 3Q90A 3EB8A 3ZG5A 2P38A 3EN1B 1WMOA 3OWUA 5BVBA 2BU4A 3RDEA 4I4KA 2GBWB 1G02A 5IG0A 2BHMA 1QVG2 4KT3B 1BRKA 4I5QA 3UL6A 1AY7A 2RSXA 2YFLB 5RNTA 3QK9A 1Q40A 3HI7A 4H61A 5TGNA 1F8NA 2GU1A 3EBYA 5IF6A 4HM4B 3B7CA 1SARA 1UGIA 3KN4A 1VQQA 3NBRA 2E2UA 3DGMA 5EQLA 4EXRA 1KWIA 3CC73 1STFI 2SARA 3N9HA 1BNEA 3VSYA 1A2KA 1BRIA 1STDA 1X1XA 4HJLB 4FR9A 5AIFA 3STDA 1FGRA 5CLKA 5D81A 1L5GB 3L0RA 3CCL3 3AGOA 2HMJB 7GSPA 1IVWA 1I3IA 1VQ53 1GY5A 1OH0A 2Z6BA 1V74A 3CC43 4BL2A 2SBLA 3HIGA 4O2HA 2MC8A 1OHPA 8RNTA 3FGYA 1R4CA 2P0MA 2XRXB 1YVBI 3PGBA 3B4PA 4TX4A 3OXAA 1ZO2A 1ULIB 4NREA 3HZPA 4HM8B 4FMBA 4U13A 4GL6A 3AMOB 5BXQA 1B2ZA 1BRNL 2W04A 3EN8A 1WMNA 1DETA 1MWUA 1X1UA 1YNVX 1BRJA 4HOHA 3NQZA 1YJN3 5IW9A 1RGKA 1W01A 3E99A 1EUIC 3CNXA 1D6UA 4L8OA 3NX0A 1NWWA 2GSPA 4OUQA 3X3YA 1OACA 4EV2A 4WHAA 2OOVC 1BVIA 2LYXA 3JUMA 3NBBA 2KF6A 1OPYA 1I0XA 3WDGB 7RNTA 3O8YA 4WYKB 3RGRA 1QAKA 2H0IA 3KCHA 4XM4A 2QGUA 1NDOB 2CFGA 3F9SA 1RCLA 2HMNB 3FG4A 2CFWA 1UI7A 2FXTA 1UUWB 5D82A 5IERA 3AHWA 2W9QA 3NXJA 1RNTA 2IMJA 2YFIB 3GZXB 3LT9A 1Q7Y4 2PZVA 1B27A 1TRPA 4FCZA 3FG1A 3JUQA 1W5ZA 1IDPA 3MYTA 1RKYA 4RBNA 1GMQA 2KXGA 1WNHA 1Q9EA 1D6YA 3FH1A 5DRVA 3G6E3 2W56B 1PU4A 1FGTA 3FF2A 2JQ5A 1BSBA 4N6NB 3I563 5EVHA 3S5CA 1OF5B 1UDII 3LTDA 1VQ73 3CCE3 4N6OB 2OTJ3 2W6JH 3FF0A 2L1SA 5BU4A 1RGLA 1TU5A 2F86B 5AYRB 3DGLA 1BRSA 1RSNA 3I0YA 5LC6A 1UCIA 2HOHA 3H3HA 1FZUA 1GD3A 3JUPA 2OWPA 2D42A 3BU4A 1GYBA 4BTXA 1ROVA 1U5OA 4STDA 3SYUA 2HMKB 3K7CA 1JJ22 1BSEA 5CXOA 2WOFA 2B24B 1B2MA 1NB3I 3U97A 2UX0A 3G8ZA 1WTHA 2WGQA 3SOAA 3WOEB 3WODG 1RCKA 1O7HB 4EYCA 1GY7A 3GWRA 1UI8A 1UUGB 3LYGA 5M19A 1I8VA 3OV4A 5IENA 1TTOA 2Z77A 4LMIA 1OHOA 1UUVB 1DMMA 3OW22 3PYJA 1GY6A 9RNTA 1X1WA 3DGOA 4ORLA 3VF1A 1C54A 1I2EA 3DGNA 2F4YA 1BGSA 1YJ93 1FGQA 2C10A 3LMLA 1DE3A 1NU3A 1O7MB 3K0ZA 4MJDA 1EA2A 1QMAA 1A2PA 1BRHA 1B3SA 1JRQA 2W2CA 3K63A 1FUSA 5IG3A 3UB1A 2XSHB 1GSPA 2CFDA 1LOWA 2IUKA 3S27A 3CCV3 1Q42A 2V1LA 1RGAA 1DYUA 5G2GA 1Z1SA 1X1YA 1YVSA 3NHXA 4FCJA 1T2IA 1OUNA
chains in the Genus database with same CATH topology
3GSPA 1BNJA 2RBIA 2KF4A 1RNBA 1RDSA 1PY3A 2AADA 1YGWA 1BNGA 1B2ZA 2AAEA 1MGWA 1UCKA 1ZGXA 3BIRA 3A5EA 1BSDA 4BU4A 1DETA 1GMPA 1B2UA 1X1UA 1YNVX 1BRJA 4HOHA 4J5KA 1FYSA 1GOVA 2KAAA 2F56A 1I0VA 1RGKA 2C4BA 1BNIA 1GMRA 2GSPA 1BNSA 2F5MA 1I3FA 2RNTA 1BVIA 1LOYA 2KF6A 1I2GA 1RLSA 1UCLA 1I0XA 6RNTA 7RNTA 1JBSA 1AQZA 1GOYA 1RMSA 1BNRA 3KCHA 3DH2A 5GSPA 1TRQA 2ZA4A 1RCLA 1BRNL 1IYYA 1LOVA 1B2SA 1BU4A 3AHWA 4GSPA 1RGCA 1RNTA 6GSPA 1R4YA 1RN4A 1B27A 1TRPA 4RNTA 3HOHA 1RTUA 3RNTA 1GMQA 1JBRA 1Q9EA 4J5GA 4GHOA 3D5IA 1BSBA 1HYFA 4HAAA 1B21A 3D5GA 3AGNA 1BIRA 2F5WA 1T2HA 4BIRA 1B2XA 5BU4A 1PYLA 1RGLA 3D4AA 5BIRA 1BRSA 1RSNA 3URPA 1UCIA 2HOHA 1B20A 1FZUA 1HZ1A 1CH0A 3BU4A 1BNFA 5HOHA 1BSCA 1LNIA 3Q3FA 3WR2A 3SYUA 1RHLA 2BU4A 1BSEA 1UCJA 1B2MA 1BSAA 1G02A 2KF3A 1BANA 1FW7A 1BRKA 3WHOA 1I2FA 1GOUA 1AY7A 1RCKA 5RNTA 1JBTA 1I8VA 1BRGA 1RN1A 1SARA 1TTOA 1BAOA 9RNTA 3AHSA 1X1WA 1C54A 1I2EA 2SARA 1BNEA 1BGSA 2F4YA 1BRIA 1RGFA 1X1XA 2BIRA 1RGEA 1DE3A 1I70A 1MGRA 1A2PA 1BRHA 1B3SA 3DGYA 1FUTA 1FUSA 1RGHA 3AGOA 2KF5A 1GSPA 1LOWA 7GSPA 1I3IA 1RGGA 1RGAA 1BOXA 1LRAA 1X1YA 1BUJA 1YVSA 1T2IA 8RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSP A;  1BNJ A;  2RBI A;  2KF4 A;  1RNB A;  1RDS A;  1PY3 A;  2AAD A;  1YGW A;  1BNG A;  1B2Z A;  2AAE A;  1MGW A;  1UCK A;  1ZGX A;  3BIR A;  3A5E A;  1BSD A;  4BU4 A;  1DET A;  1GMP A;  1B2U A;  1X1U A;  1YNV X;  1BRJ A;  4HOH A;  4J5K A;  1FYS A;  1GOV A;  2KAA A;  2F56 A;  1I0V A;  1RGK A;  2C4B A;  1BNI A;  1GMR A;  2GSP A;  1BNS A;  2F5M A;  1I3F A;  2RNT A;  1BVI A;  1LOY A;  2KF6 A;  1I2G A;  1RLS A;  1UCL A;  1I0X A;  6RNT A;  7RNT A;  1JBS A;  1AQZ A;  1GOY A;  1RMS A;  1BNR A;  3KCH A;  3DH2 A;  5GSP A;  1TRQ A;  2ZA4 A;  1RCL A;  1BRN L;  1IYY A;  1LOV A;  1B2S A;  1BU4 A;  3AHW A;  4GSP A;  1RGC A;  1RNT A;  6GSP A;  1R4Y A;  1RN4 A;  1B27 A;  1TRP A;  4RNT A;  3HOH A;  1RTU A;  3RNT A;  1GMQ A;  1JBR A;  1Q9E A;  4J5G A;  4GHO A;  3D5I A;  1BSB A;  1HYF A;  4HAA A;  1B21 A;  3D5G A;  3AGN A;  1BIR A;  2F5W A;  1T2H A;  4BIR A;  1B2X A;  5BU4 A;  1PYL A;  1RGL A;  3D4A A;  5BIR A;  1BRS A;  1RSN A;  3URP A;  1UCI A;  2HOH A;  1B20 A;  1FZU A;  1HZ1 A;  1CH0 A;  3BU4 A;  1BNF A;  5HOH A;  1BSC A;  1LNI A;  3Q3F A;  3WR2 A;  3SYU A;  1RHL A;  2BU4 A;  1BSE A;  1UCJ A;  1B2M A;  1BSA A;  1G02 A;  2KF3 A;  1BAN A;  1FW7 A;  1BRK A;  3WHO A;  1I2F A;  1GOU A;  1AY7 A;  1RCK A;  5RNT A;  1JBT A;  1I8V A;  1BRG A;  1RN1 A;  1SAR A;  1TTO A;  1BAO A;  9RNT A;  3AHS A;  1X1W A;  1C54 A;  1I2E A;  2SAR A;  1BNE A;  1BGS A;  2F4Y A;  1BRI A;  1RGF A;  1X1X A;  2BIR A;  1RGE A;  1DE3 A;  1I70 A;  1MGR A;  1A2P A;  1BRH A;  1B3S A;  3DGY A;  1FUT A;  1FUS A;  1RGH A;  3AGO A;  2KF5 A;  1GSP A;  1LOW A;  7GSP A;  1I3I A;  1RGG A;  1RGA A;  1BOX A;  1LRA A;  1X1Y A;  1BUJ A;  1YVS A;  1T2I A;  8RNT A; 
#chains in the Genus database with same CATH topology
 1Q7H A;  1O7P B;  3OWY A;  3F7X A;  1OGX A;  2W0Q A;  2K0M A;  1TFK A;  3F8H A;  1VQO 3;  3GSP A;  4LZI A;  2RBI A;  2KF4 A;  2OQE C;  1RNB A;  1PY3 A;  2AAD A;  3KE7 A;  3S28 A;  3D79 A;  1BNG A;  2XF3 A;  3EE1 A;  4NPB A;  1MGW A;  3V99 A;  3A5E A;  1BSD A;  3G4S 3;  1GMP A;  1K9M 4;  3CCR 3;  1N9E A;  2QIY A;  4J5K A;  1FYS A;  1RRL A;  2INX A;  5IG4 A;  4MMX B;  1RN7 A;  1I0V A;  4XBX A;  1DMN A;  3F14 A;  4O8S A;  2RGQ A;  1GMR A;  3PS8 A;  1Q40 B;  4N6U A;  1I3F A;  1ULJ B;  2O3O A;  4NHF A;  2F98 A;  3FLJ A;  1IT7 A;  4KFE A;  2HMO B;  2MF7 A;  1RLS A;  3FCS B;  4LYL B;  4HBR A;  4R4K A;  1A2V A;  1W2B 2;  1JBS A;  3CCU 3;  5LC7 A;  3HX8 A;  1KQS 2;  1RMS A;  1SQW A;  1BNR A;  3ZFZ A;  3GRD A;  2KRT A;  3FKA A;  4FMC A;  4K90 B;  2CWT A;  3BLZ A;  1N5P A;  2J8X B;  3GAX A;  3MSO A;  1V57 A;  3CCM 3;  3NV0 B;  3K5T A;  1E3V A;  2UUG C;  6GSP A;  1UGH I;  2CX1 A;  2R4I A;  1KSI A;  3WA2 X;  2CK3 H;  4J9A A;  3ZG0 A;  3RNT A;  2IYJ A;  1MWS A;  1AR0 A;  2YX9 A;  1A90 A;  1CYV A;  3N54 B;  4N6L A;  1VQN 3;  3HII A;  3LH4 A;  4HAA A;  1B21 A;  3JVC A;  2HMM B;  3BND A;  1K28 A;  5HGR A;  1IT8 A;  2STD A;  1O7G B;  1NO3 A;  2F5W A;  1T2H A;  4WWU C;  3LXU X;  3PCS A;  4XB5 A;  3ER7 A;  1EEJ A;  3QRD A;  3D4A A;  5IEO A;  1LXE A;  1N5H A;  5I97 A;  1B20 A;  3SOY A;  2BO9 B;  5AIH A;  3BNC A;  4XBY A;  3EHC A;  3Q3F A;  1LNI A;  3DXO A;  1AV4 A;  3UL5 A;  3WOF B;  2IY2 A;  1N8Q A;  3CCS 3;  1WMP A;  3FG3 A;  1RHL A;  4N6M A;  3CU3 A;  1JN5 A;  1BSA A;  2KF3 A;  2CHC A;  7STD A;  4IPB A;  3CXC 2;  3LT8 A;  2OOV A;  1I2F A;  2WO0 A;  1GOU A;  3D9R A;  3KKG A;  3CD6 3;  3KII A;  2XFS A;  1W02 A;  3LOY A;  1JBT A;  3G71 3;  3CCQ 3;  1EKM A;  1RN1 A;  1MWT A;  1D6Z A;  1IVU A;  1JKG A;  3SED A;  4R9K A;  3SVA A;  1ROA A;  1BAO A;  2HML B;  3NM2 A;  2LQV A;  3AHS A;  4EBG A;  4J8T A;  1BUQ A;  2IA7 A;  1O7W B;  1GD4 A;  1NJI 4;  4HM5 B;  1NB5 I;  4X2H A;  1SPU A;  2XGL A;  1RGF A;  3HK4 A;  2BIR A;  5CF1 A;  5AYS C;  3AMO A;  1WQL B;  4EW5 A;  1MGR A;  2CFL A;  1ISK A;  1SIH A;  1Q81 4;  3DGY A;  3M8C A;  1FUT A;  1LVN A;  4K1U A;  1YIT 3;  1S5A A;  1VZZ A;  4N3V A;  1LOX A;  3MG1 A;  1RGG A;  1OF5 A;  2H0G A;  1NNV A;  2CFK A;  1IQY A;  2M7O A;  4IIA A;  4JF8 A;  2CWU A;  5AI1 A;  5DRE A;  4HM6 B;  5KP4 A;  4OVM A;  2K3D A;  5M18 A;  2Z76 A;  4OK0 A;  2Y73 A;  4R9L A;  3OWS A;  2CKF B;  1TJD A;  1JZO A;  2BMQ B;  3N8B A;  1EG9 B;  1VQP 3;  4LGQ A;  2L4V A;  3DUK A;  3FSD A;  1MNL A;  1TUH A;  1HU9 A;  1UCK A;  1ZGX A;  3BIR A;  3H51 A;  1YJW 3;  2ZDJ A;  4WYK A;  3SX1 A;  3MPH A;  4EC6 A;  1O7N B;  1GOV A;  4AKY A;  2CW9 A;  2KAA A;  3CNM A;  5KP3 A;  3BNB A;  3MWZ A;  1YHQ 3;  2C4B A;  4HM2 B;  1FGO A;  1VQM 3;  5JBS A;  1CEW I;  1W2Z A;  1BNI A;  2BMR B;  2FGT A;  4JRF A;  4BL3 A;  1M9G A;  3KZT A;  1CYU A;  1TIJ A;  2P0X A;  2F99 A;  2H0H A;  4IT7 A;  2CC3 A;  2ML5 A;  1Q86 4;  4MMY B;  5IG5 A;  3F8X A;  4HM7 B;  4N6V 0;  1IU7 A;  3EJV A;  1V58 A;  4XBT A;  3CMA 3;  2CIU A;  1I2G A;  4O02 B;  4HYZ A;  1G96 A;  2W56 A;  1GOY A;  2CX0 A;  4FMA A;  3DH2 A;  1W00 A;  1TRQ A;  2E2T A;  4HM3 B;  2OQE A;  1RRH A;  2ZA4 A;  3V98 A;  1YIJ 3;  2D1W A;  1E3R A;  1IV7 A;  1BU4 A;  1LOV A;  1YGE A;  3PZW A;  3T8N A;  3PCR A;  4PEJ A;  1N9J A;  4XDV A;  1OHS A;  1JNQ A;  4CPK A;  3GZR A;  3I55 3;  2W9P A;  3CME 3;  3X42 A;  1VQ4 3;  1K41 A;  1JB2 A;  4XDW A;  3NUV A;  4RNZ A;  3HOH A;  1YI2 3;  4X2O A;  1JBR A;  4J5G A;  4GHO A;  2ZHX B;  2B1X B;  1LQG C;  3MHE A;  3LTB A;  4AKZ A;  1VQ9 3;  1US1 A;  4H3U A;  1HYF A;  4RZM A;  1VQK 3;  5FW5 A;  3D5G A;  3KSP A;  4FMD A;  3CPW 2;  3DM8 A;  3NM7 A;  2K54 A;  5G1K A;  1Q82 4;  3G16 A;  3X3Z A;  4RNY A;  1B2X A;  2Q07 A;  1QAF A;  1PYL A;  1T5Y A;  3S29 A;  3WMD A;  3EBT A;  4BTY A;  5IEP A;  1K73 4;  1IVX A;  3B8L A;  3CPO A;  2ZL8 A;  4N6T A;  3G0K A;  5CK6 A;  2BMO B;  1HZ1 A;  1W6Y A;  3IPT A;  3EF8 A;  5G1L A;  3U1W A;  5HOH A;  1QVF 2;  1ASK A;  1BSC A;  2WGO A;  3X41 A;  3WR2 A;  2XSO B;  3RGA A;  2O9U X;  2PNC A;  3NBJ A;  1PFP A;  4EV5 A;  1KC8 4;  1HKX A;  2UGI A;  3FZW A;  5AII A;  1UCJ A;  4G1M B;  3T8U A;  4KZ1 A;  4GB5 A;  4HZB B;  1BAN A;  5ELU A;  1FW7 A;  3WHO A;  1VQL 3;  3WA3 A;  3ROB A;  4HM0 B;  1G0T A;  1K8A 4;  3OX9 A;  4CJN A;  3LTC A;  1BRG A;  4L7K A;  3NV0 A;  1U8C B;  3S67 A;  4HKV B;  2FNQ A;  4BTW A;  3JUN A;  4KFF A;  2QEX 3;  2JDI H;  3MG3 A;  1JB5 A;  4LEH A;  1J2B A;  3EC9 A;  4LSO A;  1VQ6 3;  3DMC A;  2GEX A;  1ZX2 A;  1RGE A;  1S72 3;  3IJE B;  3JUO A;  1I70 A;  4L8P A;  1MWR A;  5AIG A;  4AEQ A;  2WOH A;  1W4N A;  2BT3 A;  3IMA B;  1RGH A;  5JPP A;  2KF5 A;  1LQM B;  2YFJ B;  2R41 A;  4KVH A;  1IQ8 A;  3ECF A;  5EEO A;  3D3L A;  1IV9 A;  1DVC A;  2KCD A;  2CG1 A;  1BOX A;  1LRA A;  5CF2 A;  4HVN A;  1OGZ A;  3SLU A;  1BUJ A;  2XR8 B;  1W6C A;  2A15 A;  1SJW A;  3A76 A;  3GZB A;  3MKI A;  1T3B A;  1BNJ A;  3Q1C A;  4HZ9 B;  1W6G A;  1RDS A;  3CC2 3;  1W7C A;  1YGW A;  1CQS A;  4O3V A;  3K9M C;  4Q53 A;  1QJG A;  3UJM A;  2OTL 3;  2P09 A;  2GEY A;  1GS3 A;  2AAE A;  2Y74 A;  3LZA A;  4BU4 A;  3X3X A;  1B2U A;  2F56 A;  2RFR A;  5AEW B;  1JN5 B;  2XH9 A;  5KP1 A;  1E97 A;  4ZM8 A;  1SII A;  2P05 A;  2XFT A;  3F40 A;  1JV2 B;  1IQX A;  2GBX B;  5D83 A;  1BNS A;  2F5M A;  2E2V A;  3T0U A;  3KFQ C;  8CHO A;  3DY5 A;  4CDL A;  2RNT A;  1TFO A;  2OCT A;  4HM1 B;  4KFD A;  1DMQ A;  1LOY A;  1AVK A;  5FGO A;  1UCL A;  5STD A;  3TDG A;  4K1V A;  3UNL A;  4MEI A;  6RNT A;  4ILF A;  1AQZ A;  2I9W A;  5GSP A;  6STD A;  4K61 A;  1RJO A;  4WFO A;  5AEU B;  1FUW A;  1FGM A;  1VQ8 3;  1AVL A;  1LNH A;  1IYY A;  1QAL A;  3BNE A;  5ELJ A;  1B2S A;  2C11 A;  3BB9 A;  4GSP A;  3GZY B;  1UW1 A;  5M1A A;  1RGC A;  1R4Y A;  2IUJ A;  4WP5 A;  5A0O B;  1IK3 A;  2GU3 A;  1RN4 A;  2ML6 A;  2CG0 A;  1M1X B;  2GXF A;  2W03 A;  3F7S A;  2CWV A;  4FCM A;  4RNT A;  4DKI A;  1ZS7 A;  1RTU A;  2BNG A;  2XGN A;  1DVD A;  3B4O A;  4QWT A;  3LTA A;  3D5I A;  3ALA A;  1FA3 A;  2CH9 A;  1KD1 4;  2QA4 3;  4CCV A;  3NQY A;  1MOL A;  1TP6 A;  2XEP A;  3KSE D;  3DZL A;  3J7Y d;  1N8R 4;  1A67 A;  1M90 4;  1IVV A;  3V92 A;  3AGN A;  4R80 A;  1BIR A;  4BIR A;  2Z7A A;  1OCV A;  4MMZ B;  3SXX A;  1M1K 4;  1C7H A;  5BIR A;  3X40 A;  3MG2 A;  3URP A;  1JKG B;  3CCJ 3;  1JZD A;  3EX9 A;  3EQQ B;  1Y4K A;  1JB4 A;  3PXM A;  3Q2P A;  4R1K A;  3VGN A;  1CH0 A;  5JPU A;  1BNF A;  1EQK A;  2RCD A;  3Q90 A;  3EB8 A;  3ZG5 A;  2P38 A;  3EN1 B;  1WMO A;  3OWU A;  5BVB A;  2BU4 A;  3RDE A;  4I4K A;  2GBW B;  1G02 A;  5IG0 A;  2BHM A;  1QVG 2;  4KT3 B;  1BRK A;  4I5Q A;  3UL6 A;  1AY7 A;  2RSX A;  2YFL B;  5RNT A;  3QK9 A;  1Q40 A;  3HI7 A;  4H61 A;  5TGN A;  1F8N A;  2GU1 A;  3EBY A;  5IF6 A;  4HM4 B;  3B7C A;  1SAR A;  1UGI A;  3KN4 A;  1VQQ A;  3NBR A;  2E2U A;  3DGM A;  5EQL A;  4EXR A;  1KWI A;  3CC7 3;  1STF I;  2SAR A;  3N9H A;  1BNE A;  3VSY A;  1A2K A;  1BRI A;  1STD A;  1X1X A;  4HJL B;  4FR9 A;  5AIF A;  3STD A;  1FGR A;  5CLK A;  5D81 A;  1L5G B;  3L0R A;  3CCL 3;  3AGO A;  2HMJ B;  7GSP A;  1IVW A;  1I3I A;  1VQ5 3;  1GY5 A;  1OH0 A;  2Z6B A;  1V74 A;  3CC4 3;  4BL2 A;  2SBL A;  3HIG A;  4O2H A;  2MC8 A;  1OHP A;  8RNT A;  3FGY A;  1R4C A;  2P0M A;  2XRX B;  1YVB I;  3PGB A;  3B4P A;  4TX4 A;  3OXA A;  1ZO2 A;  1ULI B;  4NRE A;  3HZP A;  4HM8 B;  4FMB A;  4U13 A;  4GL6 A;  3AMO B;  5BXQ A;  1B2Z A;  1BRN L;  2W04 A;  3EN8 A;  1WMN A;  1DET A;  1MWU A;  1X1U A;  1YNV X;  1BRJ A;  4HOH A;  3NQZ A;  1YJN 3;  5IW9 A;  1RGK A;  1W01 A;  3E99 A;  1EUI C;  3CNX A;  1D6U A;  4L8O A;  3NX0 A;  1NWW A;  2GSP A;  4OUQ A;  3X3Y A;  1OAC A;  4EV2 A;  4WHA A;  2OOV C;  1BVI A;  2LYX A;  3JUM A;  3NBB A;  2KF6 A;  1OPY A;  1I0X A;  3WDG B;  7RNT A;  3O8Y A;  4WYK B;  3RGR A;  1QAK A;  2H0I A;  3KCH A;  4XM4 A;  2QGU A;  1NDO B;  2CFG A;  3F9S A;  1RCL A;  2HMN B;  3FG4 A;  2CFW A;  1UI7 A;  2FXT A;  1UUW B;  5D82 A;  5IER A;  3AHW A;  2W9Q A;  3NXJ A;  1RNT A;  2IMJ A;  2YFI B;  3GZX B;  3LT9 A;  1Q7Y 4;  2PZV A;  1B27 A;  1TRP A;  4FCZ A;  3FG1 A;  3JUQ A;  1W5Z A;  1IDP A;  3MYT A;  1RKY A;  4RBN A;  1GMQ A;  2KXG A;  1WNH A;  1Q9E A;  1D6Y A;  3FH1 A;  5DRV A;  3G6E 3;  2W56 B;  1PU4 A;  1FGT A;  3FF2 A;  2JQ5 A;  1BSB A;  4N6N B;  3I56 3;  5EVH A;  3S5C A;  1OF5 B;  1UDI I;  3LTD A;  1VQ7 3;  3CCE 3;  4N6O B;  2OTJ 3;  2W6J H;  3FF0 A;  2L1S A;  5BU4 A;  1RGL A;  1TU5 A;  2F86 B;  5AYR B;  3DGL A;  1BRS A;  1RSN A;  3I0Y A;  5LC6 A;  1UCI A;  2HOH A;  3H3H A;  1FZU A;  1GD3 A;  3JUP A;  2OWP A;  2D42 A;  3BU4 A;  1GYB A;  4BTX A;  1ROV A;  1U5O A;  4STD A;  3SYU A;  2HMK B;  3K7C A;  1JJ2 2;  1BSE A;  5CXO A;  2WOF A;  2B24 B;  1B2M A;  1NB3 I;  3U97 A;  2UX0 A;  3G8Z A;  1WTH A;  2WGQ A;  3SOA A;  3WOE B;  3WOD G;  1RCK A;  1O7H B;  4EYC A;  1GY7 A;  3GWR A;  1UI8 A;  1UUG B;  3LYG A;  5M19 A;  1I8V A;  3OV4 A;  5IEN A;  1TTO A;  2Z77 A;  4LMI A;  1OHO A;  1UUV B;  1DMM A;  3OW2 2;  3PYJ A;  1GY6 A;  9RNT A;  1X1W A;  3DGO A;  4ORL A;  3VF1 A;  1C54 A;  1I2E A;  3DGN A;  2F4Y A;  1BGS A;  1YJ9 3;  1FGQ A;  2C10 A;  3LML A;  1DE3 A;  1NU3 A;  1O7M B;  3K0Z A;  4MJD A;  1EA2 A;  1QMA A;  1A2P A;  1BRH A;  1B3S A;  1JRQ A;  2W2C A;  3K63 A;  1FUS A;  5IG3 A;  3UB1 A;  2XSH B;  1GSP A;  2CFD A;  1LOW A;  2IUK A;  3S27 A;  3CCV 3;  1Q42 A;  2V1L A;  1RGA A;  1DYU A;  5G2G A;  1Z1S A;  1X1Y A;  1YVS A;  3NHX A;  4FCJ A;  1T2I A;  1OUN A; 
#chains in the Genus database with same CATH homology
 3GSP A;  1BNJ A;  2RBI A;  2KF4 A;  1RNB A;  1RDS A;  1PY3 A;  2AAD A;  1YGW A;  1BNG A;  1B2Z A;  2AAE A;  1MGW A;  1UCK A;  1ZGX A;  3BIR A;  3A5E A;  1BSD A;  4BU4 A;  1DET A;  1GMP A;  1B2U A;  1X1U A;  1YNV X;  1BRJ A;  4HOH A;  4J5K A;  1FYS A;  1GOV A;  2KAA A;  2F56 A;  1I0V A;  1RGK A;  2C4B A;  1BNI A;  1GMR A;  2GSP A;  1BNS A;  2F5M A;  1I3F A;  2RNT A;  1BVI A;  1LOY A;  2KF6 A;  1I2G A;  1RLS A;  1UCL A;  1I0X A;  6RNT A;  7RNT A;  1JBS A;  1AQZ A;  1GOY A;  1RMS A;  1BNR A;  3KCH A;  3DH2 A;  5GSP A;  1TRQ A;  2ZA4 A;  1RCL A;  1BRN L;  1IYY A;  1LOV A;  1B2S A;  1BU4 A;  3AHW A;  4GSP A;  1RGC A;  1RNT A;  6GSP A;  1R4Y A;  1RN4 A;  1B27 A;  1TRP A;  4RNT A;  3HOH A;  1RTU A;  3RNT A;  1GMQ A;  1JBR A;  1Q9E A;  4J5G A;  4GHO A;  3D5I A;  1BSB A;  1HYF A;  4HAA A;  1B21 A;  3D5G A;  3AGN A;  1BIR A;  2F5W A;  1T2H A;  4BIR A;  1B2X A;  5BU4 A;  1PYL A;  1RGL A;  3D4A A;  5BIR A;  1BRS A;  1RSN A;  3URP A;  1UCI A;  2HOH A;  1B20 A;  1FZU A;  1HZ1 A;  1CH0 A;  3BU4 A;  1BNF A;  5HOH A;  1BSC A;  1LNI A;  3Q3F A;  3WR2 A;  3SYU A;  1RHL A;  2BU4 A;  1BSE A;  1UCJ A;  1B2M A;  1BSA A;  1G02 A;  2KF3 A;  1BAN A;  1FW7 A;  1BRK A;  3WHO A;  1I2F A;  1GOU A;  1AY7 A;  1RCK A;  5RNT A;  1JBT A;  1I8V A;  1BRG A;  1RN1 A;  1SAR A;  1TTO A;  1BAO A;  9RNT A;  3AHS A;  1X1W A;  1C54 A;  1I2E A;  2SAR A;  1BNE A;  1BGS A;  2F4Y A;  1BRI A;  1RGF A;  1X1X A;  2BIR A;  1RGE A;  1DE3 A;  1I70 A;  1MGR A;  1A2P A;  1BRH A;  1B3S A;  3DGY A;  1FUT A;  1FUS A;  1RGH A;  3AGO A;  2KF5 A;  1GSP A;  1LOW A;  7GSP A;  1I3I A;  1RGG A;  1RGA A;  1BOX A;  1LRA A;  1X1Y A;  1BUJ A;  1YVS A;  1T2I A;  8RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...