3D5IA

Crystal structure of ribonuclease sa2 with exo-2',3'-cyclophosphorotioate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
92
Chain Sequence
ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 23
structure length 92
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5iA00
1PY3A 2GSPA 1B2XA 3DGYA 3KCHA 1BRIA 5BIRA 1UCKA 1BRGA 1UCLA 1I2FA 1G02A 4J5GA 1GOUA 1T2HA 1B21A 1BSEA 1X1WA 1I70A 1B2UA 5RNTA 5BU4A 1X1UA 2KF6A 1FYSA 3BU4A 3DH2A 1JBTA 1RNTA 1BNIA 2HOHA 3A5EA 1MGWA 1BIRA 3Q3FA 1B27A 3GSPA 1RGEA 1AQZA 1BNRA 4GHOA 2RBIA 1BRKA 3URPA 1FUTA 1TRQA 1FZUA 1T2IA 1UCJA 1B3SA 3AGOA 1B2ZA 1LOWA 1CH0A 1LNIA 1X1YA 4HOHA 2F4YA 1I0VA 5HOHA 1RGFA 1I2EA 1RDSA 3AHWA 1DE3A 1I3FA 4GSPA 1HYFA 1I0XA 2SARA 1SARA 1BSAA 1I2GA 1TRPA 1GSPA 3AHSA 3WHOA 1RNBA 1JBRA 1TTOA 1B2MA 1BRJA 1B2SA 2F56A 1BAOA 1RTUA 3RNTA 3HOHA 2AAEA 1RLSA 2KF3A 3BIRA 1BSCA 1MGRA 1BGSA 1Q9EA 7GSPA 1RHLA 1BNGA 3D4AA 1DETA 3D5IA 1YVSA 3AGNA 4RNTA 1RN4A 8RNTA 1LRAA 1BUJA 1RGLA 4J5KA 1BVIA 1RSNA 1RGCA 3SYUA 1IYYA 2ZA4A 1BSDA 1LOVA 9RNTA 1AY7A 6RNTA 1FUSA 7RNTA 1UCIA 1BRNL 1C54A 1LOYA 1YGWA 1GMPA 1I8VA 1RGKA 1JBSA 6GSPA 1BNEA 1X1XA 5GSPA 3WR2A 1R4YA 1RCKA 1RGHA 1GMRA 1GMQA 1RMSA 1ZGXA 1FW7A 2F5MA 2KAAA 1RGAA 1BOXA 2C4BA 1A2PA 1BU4A 1BNSA 1HZ1A 2BU4A 1BSBA 1RGGA 3D5GA 1BRSA 1YNVX 2KF5A 1GOVA 1BNJA 1I3IA 2F5WA 4BU4A 1BRHA 2KF4A 1RN1A 2RNTA 4BIRA 1BNFA 1GOYA 2AADA 1PYLA 1RCLA 4HAAA 1B20A 1BANA 2BIRA
chains in the Genus database with same CATH superfamily
3SXXA 2GBWB 2XSOB 3STDA 3G0KA 3FG3A 1MOLA 1KD14 3F8HA 1WMOA 4PEJA 5AIIA 2CKFB 1W5ZA 1B21A 1AR0A 1JKGA 4K1UA 1OUNA 4KVHA 4FMAA 2CC3A 1FW7A 3DH2A 3LT9A 1GD3A 1UGIA 1RNTA 2HOHA 1ZO2A 1Q40A 3PXMA 3E99A 4HM1B 2CWUA 4N3VA 1BIRA 1LNHA 3HI7A 4HVNA 3DGOA 4N6OB 4TX4A 1MNLA 1KQS2 1DMQA 3S27A 1GS3A 3AMOB 1OHSA 3MYTA 2RBIA 3PYJA 1O7HB 3JUPA 3CCM3 1OACA 1TRQA 1M1XB 1Q40B 3PCSA 1LQMB 3CCV3 1UUGB 3AGOA 1LOWA 1CH0A 1LNIA 2W9PA 3MG1A 4CDLA 1O7PB 3GAXA 1W01A 5IG0A 1TU5A 4Q53A 1I0VA 1RGFA 1I2EA 1WTHA 2CIUA 2R41A 3O8YA 1M904 1QAFA 3N9HA 1JV2B 3GWRA 3NQZA 4IPBA 1B2SA 2IUJA 1C7HA 3DGNA 2GEYA 1QVG2 3CD63 3F9SA 4N6LA 2I9WA 3WOFB 1W4NA 3EN8A 1Q7Y4 2F98A 3BIRA 3X40A 2BMQB 1YIT3 1U8CB 1RHLA 1BNGA 3D4AA 1DETA 4N6V0 3T8UA 1DMMA 1W6GA 4RNTA 1A2VA 3SEDA 4HKVB 1NB3I 3LTDA 3UB1A 4RBNA 4AKZA 5EEOA 3KSED 1ZS7A 3L0RA 2E2TA 2W04A 1BUJA 1BVIA 2GBXB 1NB5I 2UX0A 5IENA 3FGYA 2IUKA 3G4S3 3TDGA 1K8A4 5FGOA 3G6E3 4HYZA 2W0QA 4NHFA 1Q42A 1W00A 1UCIA 2PNCA 6RNTA 1KC84 4ILFA 1C54A 1LOYA 1QJGA 2P38A 3LH4A 4STDA 3SOYA 2QA43 5AEWB 2HMMB 1SIIA 1DMNA 4EYCA 4LZIA 1BNEA 3F7XA 3S29A 2QGUA 1A2KA 3FG4A 3K5TA 1R4YA 1VQM3 1OGZA 2CFLA 2B1XB 4MEIA 3I553 3QK9A 4WYKA 2CWTA 1RGAA 1JN5A 2D42A 3MG2A 3MWZA 1BU4A 1QAKA 1JZDA 2Q07A 3HK4A 2HMOB 3CCE3 1RGGA 1AVKA 1GOVA 1BNJA 1TJDA 1G96A 5D83A 2KF4A 2RNTA 3D9RA 3DMCA 2L4VA 4OK0A 4BTYA 1Q814 1UI8A 2IYJA 5D81A 1ZX2A 2CW9A 2K3DA 4O02B 2JDIH 4JF8A 1N5HA 2AADA 4HM7B 1PYLA 3EC9A 3GZYB 2HMKB 3S28A 3CPW2 1OF5B 2IMJA 1PY3A 1W2B2 2RCDA 1LQGC 2Z76A 3G713 1YHQ3 4RNZA 3ZG5A 2R4IA 7STDA 1TFOA 5CXOA 5KP1A 1EUIC 2M7OA 5DRVA 4OUQA 1X1WA 1JB5A 3BNCA 1X1UA 2W6JH 1FYSA 2WGOA 2BO9B 2OCTA 3BU4A 3CCL3 3OWUA 2BNGA 4KFEA 1IV7A 3Q2PA 4MMXB 2UGIA 3CU3A 1T3BA 1VQL3 1B27A 1TUHA 1RGEA 1O7NB 5AIGA 4X2HA 4X2OA 2Z6BA 1AQZA 2FXTA 3KIIA 3T0UA 4MMYB 4GHOA 3Q1CA 4NREA 1STDA 2HMJB 2WOFA 1IQ8A 3F14A 1N5PA 1VQ43 2XH9A 1US1A 1IQYA 2JQ5A 4HM5B 1IQXA 3RDEA 1FUWA 3B4PA 1UUWB 4XBXA 1VZZA 2C11A 3FH1A 1R4CA 3KFQC 3NBBA 4RNYA 2CG0A 1V74A 5LC7A 1W02A 4L8OA 1RDSA 2B24B 3AHWA 3MG3A 4N6UA 5EQLA 3WODG 2GXFA 1DE3A 1HYFA 1W7CA 3PCRA 1GSPA 3JUQA 3BNEA 1RNBA 1D6ZA 4O3VA 2QEX3 1TTOA 4LEHA 3CC73 4K61A 1BRJA 3EX9A 1N8R4 1GY5A 1WMPA 2YFLB 4FCZA 3CCQ3 2OQEA 1RLSA 3PZWA 1BSCA 3NBJA 1MGRA 1UW1A 1Q9EA 7GSPA 3CXC2 4N6MA 3D5IA 3U1WA 3B4OA 4GB5A 3DGMA 1RN4A 1OH0A 5G1LA 2F86B 8RNTA 4IT7A 5BXQA 3WA3A 1LVNA 3MKIA 3RGAA 3GRDA 5IG3A 3VF1A 2FNQA 2IY2A 1JKGB 1EEJA 5AYRB 3MPHA 1MWSA 1KWIA 2CH9A 3CCJ3 1RGCA 5IEOA 1VQ93 1F8NA 1YJW3 2RFRA 1IYYA 3HIGA 1IDPA 2C10A 4QWTA 1AY7A 1V58A 7RNTA 4HM2B 3ZG0A 1PU4A 3S67A 1RN7A 3WOEB 4BL3A 1GD4A 3WMDA 1CQSA 1BUQA 2J8XB 1K41A 2KXGA 4HZBB 2XEPA 2OOVA 2L1SA 4LSOA 1ROAA 1RGHA 1GMRA 1CYVA 3DUKA 1PFPA 1WMNA 4CPKA 1RMSA 3OWSA 2KAAA 3EBYA 4R80A 1J2BA 1VQ83 2C4BA 1TP6A 2W56A 3UL5A 1Y4KA 2BU4A 1DVCA 2CX1A 1UUVB 3LTCA 3CPOA 2XRXB 4FMCA 1Z1SA 2HMLB 1I3IA 4R9KA 2K54A 3M8CA 3NM7A 5M19A 4R9LA 1YGEA 3JUOA 3QRDA 2P05A 5KP4A 1VQ53 1FGMA 1BNFA 2CG1A 1GOYA 5IF6A 3GZBA 3JUNA 1RCLA 3MHEA 2GU3A 3DZLA 3U97A 5EVHA 1NO3A 1MWTA 1KSIA 2XR8B 3DGYA 2ZDJA 3KCHA 5IW9A 3BNDA 3KZTA 4WYKB 1CYUA 5KP3A 1G0TA 3BNBA 3DM8A 4J5GA 2W03A 1BSEA 2H0HA 3OX9A 1I70A 1B2UA 4KT3B 1D6YA 5RNTA 4HM4B 1DYUA 1JBTA 1BNIA 1JRQA 5AIHA 5M1AA 1M9GA 1MGWA 2ML5A 5DREA 1GY7A 4EW5A 3GSPA 3GZXB 8CHOA 2A15A 4N6TA 2UUGC 2QIYA 3MSOA 1BNRA 4CJNA 1HU9A 4J9AA 3CCR3 1WNHA 3GZRA 3URPA 1S723 1FUTA 2K0MA 1TIJA 1FZUA 1B3SA 2H0IA 5BVBA 5CK6A 4FMBA 2O9UX 3F8XA 1IT7A 2F4YA 1VQ73 5HOHA 1D6UA 1BANA 3AMOA 1I3FA 3NV0A 4GSPA 2SARA 5D82A 1SPUA 1BSAA 1TRPA 3NXJA 4MJDA 1CEWI 2OQEC 1IVXA 1RRLA 1OHOA 3HIIA 4XBTA 2GU1A 2MC8A 3X3XA 2Y73A 1Q824 1O7MB 3ZFZA 1K9M4 4BTWA 2CFDA 3D3LA 3FLJA 4AEQA 1ULIB 2F56A 1EG9B 5HGRA 1RTUA 3RNTA 2CFGA 3N8BA 2ZL8A 4KFDA 3NBRA 4NPBA 3VSYA 3DY5A 3HOHA 2W56B 5AYSC 1E3RA 1LXEA 1U5OA 1JJ22 3V98A 3B8LA 3ER7A 4GL6A 4BL2A 1FGTA 1BGSA 3X42A 2GEXA 5IEPA 4O8SA 3IPTA 1YVSA 3IMAB 4WFOA 2OWPA 1LRAA 3DGLA 3RGRA 4LGQA 1JB2A 2W2CA 3JVCA 1K28A 1FGRA 1JZOA 1ASKA 1IT8A 1UI7A 3FZWA 1IVWA 4FCJA 4I4KA 4EC6A 4H3UA 2YFIB 4EXRA 1VQO3 2ZA4A 3LZAA 5CLKA 1BSDA 1A67A 4CCVA 3EHCA 1FUSA 2Z7AA 3FCSB 4ORLA 1VQN3 4FMDA 4L7KA 4IIAA 1JN5B 1W2ZA 1GMPA 3H51A 2YX9A 3D79A 1N9JA 1N9EA 4XDWA 5JBSA 1RGKA 1JBSA 1OCVA 3NUVA 4KZ1A 6GSPA 3CMA3 3UNLA 1N8QA 1QVF2 1VQ63 3WR2A 2BT3A 4DKIA 2OTJ3 3I563 1UGHI 1RCKA 1QALA 1SQWA 3KE7A 4HM8B 1GMQA 2BMRB 2F99A 3K9MC 5IG5A 4EV2A 3EBTA 3IJEB 1W6CA 4EV5A 1BOXA 1A2PA 5CF2A 1K734 4N6NB 1BSBA 3BLZA 2IA7A 3F40A 1IVVA 1LOXA 1BRSA 3B7CA 3D5GA 4J8TA 1NJI4 3LTBA 2KF5A 2P0MA 4K1VA 1RN1A 4BIRA 4LYLB 1RJOA 1RRHA 4HM6B 2WOHA 1IU7A 3PGBA 3NV0B 4LMIA 1SJWA 3N54B 5FW5A 1L5GB 4XDVA 1E97A 4R1KA 3SX1A 1OGXA 2V1LA 3LT8A 2E2UA 2BIRA 2XSHB 3J7Yd 1O7WB 2KRTA 4FR9A 1NU3A 2GSPA 1B2XA 3F7SA 4HM3B 1BRIA 5BIRA 3SOAA 1YJN3 1UCKA 1BRGA 1UCLA 3FSDA 1ISKA 1I2FA 1G02A 2RSXA 3H3HA 3UL6A 1MWUA 1VQK3 2CK3H 1A90A 2MF7A 1GOUA 1NWWA 1T2HA 3EN1B 3LOYA 3K0ZA 3HX8A 2WGQA 4XB5A 3FKAA 1HKXA 2KF6A 2XF3A 5BU4A 1YVBI 3JUMA 2XFTA 3OWYA 4HBRA 4XBYA 3A5EA 3T8NA 1AV4A 2H0GA 3EF8A 2W9QA 3NX0A 1IV9A 1JNQA 3Q3FA 3HZPA 1Q7HA 1WQLB 2XGLA 2XGNA 2LYXA 4I5QA 1FGQA 4O2HA 1QMAA 3K7CA 6STDA 5LC6A 4HZ9B 4L8PA 3ECFA 2FGTA 3ROBA 1YJ93 1BRKA 3OV4A 1MWRA 1ROVA 2P09A 2LQVA 2CHCA 1VQQA 3CME3 1FA3A 1T2IA 1UCJA 3FF0A 3G8ZA 2OOVC 3NM2A 3SLUA 4BTXA 2E2VA 1B2ZA 4HOHA 1ULJB 1X1YA 3EQQB 3CCS3 3LTAA 3WA2X 4WWUC 4MMZB 3DXOA 3G16A 1I0XA 1AVLA 1SARA 3S5CA 1I2GA 2WO0A 2CFWA 3LYGA 3AHSA 3WHOA 1JBRA 1EKMA 1TFKA 1B2MA 4FCMA 1JB4A 1BAOA 3A76A 4AKYA 3NQYA 2BHMA 3EE1A 4JRFA 3X3YA 2AAEA 1T5YA 3I0YA 1IK3A 2KF3A 5IERA 5AEUB 4WHAA 4U13A 2D1WA 4KFFA 3EJVA 4WP5A 4HJLB 3KKGA 5TGNA 3BB9A 2CFKA 3V92A 5CF1A 2KCDA 3AGNA 5A0OB 1E3VA 2XFSA 2CWVA 1IVUA 4K90B 1GYBA 3Q90A 2RGQA 3KN4A 1STFI 2BMOB 5G1KA 5M18A 5I97A 1FGOA 1RGLA 4J5KA 4XM4A 1RSNA 3SVAA 2HMNB 1V57A 1OF5A 2O3OA 4G1MB 3SYUA 1NNVA 4R4KA 1LOVA 2INXA 3KSPA 3LMLA 9RNTA 3FG1A 2CX0A 3CNMA 1BRNL 1YGWA 3VGNA 3PS8A 4EBGA 3LXUX 3CC43 3CCU3 5AI1A 2OTL3 1I8VA 3WDGB 3NHXA 1VQP3 2ZHXB 1O7GB 2Y74A 5GSPA 1X1XA 1EA2A 1YIJ3 2P0XA 2Z77A 3OXAA 4H61A 1Q864 5G2GA 3CC23 1DVDA 1OHPA 1ZGXA 2F5MA 3ALAA 5ELJA 3EB8A 5JPPA 5STDA 2ML6A 1W6YA 2PZVA 4OVMA 5ELUA 3X3ZA 3X41A 1YI23 1RKYA 2SBLA 1BNSA 1HZ1A 1EQKA 4HM0B 1YNVX 1SIHA 1GY6A 3OW22 2STDA 2F5WA 4BU4A 1OPYA 1BRHA 3FF2A 4ZM8A 3UJMA 1M1K4 1NDOB 3V99A 3CNXA 5AIFA 5IG4A 3K63A 1S5AA 5JPUA 4RZMA 4HAAA 1B20A 1UDII 2YFJB
chains in the Genus database with same CATH topology
1PY3A 2GSPA 1B2XA 3DGYA 3KCHA 1BRIA 5BIRA 1UCKA 1BRGA 1UCLA 1I2FA 1G02A 4J5GA 1GOUA 1T2HA 1B21A 1BSEA 1X1WA 1I70A 1B2UA 5RNTA 5BU4A 1X1UA 2KF6A 1FYSA 3BU4A 3DH2A 1JBTA 1RNTA 1BNIA 2HOHA 3A5EA 1MGWA 1BIRA 3Q3FA 1B27A 3GSPA 1RGEA 1AQZA 1BNRA 4GHOA 2RBIA 1BRKA 3URPA 1FUTA 1TRQA 1FZUA 1T2IA 1UCJA 1B3SA 3AGOA 1B2ZA 1LOWA 1CH0A 1LNIA 1X1YA 4HOHA 2F4YA 1I0VA 5HOHA 1RGFA 1I2EA 1RDSA 3AHWA 1DE3A 1I3FA 4GSPA 1HYFA 1I0XA 2SARA 1SARA 1BSAA 1I2GA 1TRPA 1GSPA 3AHSA 3WHOA 1RNBA 1JBRA 1TTOA 1B2MA 1BRJA 1B2SA 2F56A 1BAOA 1RTUA 3RNTA 3HOHA 2AAEA 1RLSA 2KF3A 3BIRA 1BSCA 1MGRA 1BGSA 1Q9EA 7GSPA 1RHLA 1BNGA 3D4AA 1DETA 3D5IA 1YVSA 3AGNA 4RNTA 1RN4A 8RNTA 1LRAA 1BUJA 1RGLA 4J5KA 1BVIA 1RSNA 1RGCA 3SYUA 1IYYA 2ZA4A 1BSDA 1LOVA 9RNTA 1AY7A 6RNTA 1FUSA 7RNTA 1UCIA 1BRNL 1C54A 1LOYA 1YGWA 1GMPA 1I8VA 1RGKA 1JBSA 6GSPA 1BNEA 1X1XA 5GSPA 3WR2A 1R4YA 1RCKA 1RGHA 1GMRA 1GMQA 1RMSA 1ZGXA 1FW7A 2F5MA 2KAAA 1RGAA 1BOXA 2C4BA 1A2PA 1BU4A 1BNSA 1HZ1A 2BU4A 1BSBA 1RGGA 3D5GA 1BRSA 1YNVX 2KF5A 1GOVA 1BNJA 1I3IA 2F5WA 4BU4A 1BRHA 2KF4A 1RN1A 2RNTA 4BIRA 1BNFA 1GOYA 2AADA 1PYLA 1RCLA 4HAAA 1B20A 1BANA 2BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PY3 A;  2GSP A;  1B2X A;  3DGY A;  3KCH A;  1BRI A;  5BIR A;  1UCK A;  1BRG A;  1UCL A;  1I2F A;  1G02 A;  4J5G A;  1GOU A;  1T2H A;  1B21 A;  1BSE A;  1X1W A;  1I70 A;  1B2U A;  5RNT A;  5BU4 A;  1X1U A;  2KF6 A;  1FYS A;  3BU4 A;  3DH2 A;  1JBT A;  1RNT A;  1BNI A;  2HOH A;  3A5E A;  1MGW A;  1BIR A;  3Q3F A;  1B27 A;  3GSP A;  1RGE A;  1AQZ A;  1BNR A;  4GHO A;  2RBI A;  1BRK A;  3URP A;  1FUT A;  1TRQ A;  1FZU A;  1T2I A;  1UCJ A;  1B3S A;  3AGO A;  1B2Z A;  1LOW A;  1CH0 A;  1LNI A;  1X1Y A;  4HOH A;  2F4Y A;  1I0V A;  5HOH A;  1RGF A;  1I2E A;  1RDS A;  3AHW A;  1DE3 A;  1I3F A;  4GSP A;  1HYF A;  1I0X A;  2SAR A;  1SAR A;  1BSA A;  1I2G A;  1TRP A;  1GSP A;  3AHS A;  3WHO A;  1RNB A;  1JBR A;  1TTO A;  1B2M A;  1BRJ A;  1B2S A;  2F56 A;  1BAO A;  1RTU A;  3RNT A;  3HOH A;  2AAE A;  1RLS A;  2KF3 A;  3BIR A;  1BSC A;  1MGR A;  1BGS A;  1Q9E A;  7GSP A;  1RHL A;  1BNG A;  3D4A A;  1DET A;  3D5I A;  1YVS A;  3AGN A;  4RNT A;  1RN4 A;  8RNT A;  1LRA A;  1BUJ A;  1RGL A;  4J5K A;  1BVI A;  1RSN A;  1RGC A;  3SYU A;  1IYY A;  2ZA4 A;  1BSD A;  1LOV A;  9RNT A;  1AY7 A;  6RNT A;  1FUS A;  7RNT A;  1UCI A;  1BRN L;  1C54 A;  1LOY A;  1YGW A;  1GMP A;  1I8V A;  1RGK A;  1JBS A;  6GSP A;  1BNE A;  1X1X A;  5GSP A;  3WR2 A;  1R4Y A;  1RCK A;  1RGH A;  1GMR A;  1GMQ A;  1RMS A;  1ZGX A;  1FW7 A;  2F5M A;  2KAA A;  1RGA A;  1BOX A;  2C4B A;  1A2P A;  1BU4 A;  1BNS A;  1HZ1 A;  2BU4 A;  1BSB A;  1RGG A;  3D5G A;  1BRS A;  1YNV X;  2KF5 A;  1GOV A;  1BNJ A;  1I3I A;  2F5W A;  4BU4 A;  1BRH A;  2KF4 A;  1RN1 A;  2RNT A;  4BIR A;  1BNF A;  1GOY A;  2AAD A;  1PYL A;  1RCL A;  4HAA A;  1B20 A;  1BAN A;  2BIR A; 
#chains in the Genus database with same CATH topology
 3SXX A;  2GBW B;  2XSO B;  3STD A;  3G0K A;  3FG3 A;  1MOL A;  1KD1 4;  3F8H A;  1WMO A;  4PEJ A;  5AII A;  2CKF B;  1W5Z A;  1B21 A;  1AR0 A;  1JKG A;  4K1U A;  1OUN A;  4KVH A;  4FMA A;  2CC3 A;  1FW7 A;  3DH2 A;  3LT9 A;  1GD3 A;  1UGI A;  1RNT A;  2HOH A;  1ZO2 A;  1Q40 A;  3PXM A;  3E99 A;  4HM1 B;  2CWU A;  4N3V A;  1BIR A;  1LNH A;  3HI7 A;  4HVN A;  3DGO A;  4N6O B;  4TX4 A;  1MNL A;  1KQS 2;  1DMQ A;  3S27 A;  1GS3 A;  3AMO B;  1OHS A;  3MYT A;  2RBI A;  3PYJ A;  1O7H B;  3JUP A;  3CCM 3;  1OAC A;  1TRQ A;  1M1X B;  1Q40 B;  3PCS A;  1LQM B;  3CCV 3;  1UUG B;  3AGO A;  1LOW A;  1CH0 A;  1LNI A;  2W9P A;  3MG1 A;  4CDL A;  1O7P B;  3GAX A;  1W01 A;  5IG0 A;  1TU5 A;  4Q53 A;  1I0V A;  1RGF A;  1I2E A;  1WTH A;  2CIU A;  2R41 A;  3O8Y A;  1M90 4;  1QAF A;  3N9H A;  1JV2 B;  3GWR A;  3NQZ A;  4IPB A;  1B2S A;  2IUJ A;  1C7H A;  3DGN A;  2GEY A;  1QVG 2;  3CD6 3;  3F9S A;  4N6L A;  2I9W A;  3WOF B;  1W4N A;  3EN8 A;  1Q7Y 4;  2F98 A;  3BIR A;  3X40 A;  2BMQ B;  1YIT 3;  1U8C B;  1RHL A;  1BNG A;  3D4A A;  1DET A;  4N6V 0;  3T8U A;  1DMM A;  1W6G A;  4RNT A;  1A2V A;  3SED A;  4HKV B;  1NB3 I;  3LTD A;  3UB1 A;  4RBN A;  4AKZ A;  5EEO A;  3KSE D;  1ZS7 A;  3L0R A;  2E2T A;  2W04 A;  1BUJ A;  1BVI A;  2GBX B;  1NB5 I;  2UX0 A;  5IEN A;  3FGY A;  2IUK A;  3G4S 3;  3TDG A;  1K8A 4;  5FGO A;  3G6E 3;  4HYZ A;  2W0Q A;  4NHF A;  1Q42 A;  1W00 A;  1UCI A;  2PNC A;  6RNT A;  1KC8 4;  4ILF A;  1C54 A;  1LOY A;  1QJG A;  2P38 A;  3LH4 A;  4STD A;  3SOY A;  2QA4 3;  5AEW B;  2HMM B;  1SII A;  1DMN A;  4EYC A;  4LZI A;  1BNE A;  3F7X A;  3S29 A;  2QGU A;  1A2K A;  3FG4 A;  3K5T A;  1R4Y A;  1VQM 3;  1OGZ A;  2CFL A;  2B1X B;  4MEI A;  3I55 3;  3QK9 A;  4WYK A;  2CWT A;  1RGA A;  1JN5 A;  2D42 A;  3MG2 A;  3MWZ A;  1BU4 A;  1QAK A;  1JZD A;  2Q07 A;  3HK4 A;  2HMO B;  3CCE 3;  1RGG A;  1AVK A;  1GOV A;  1BNJ A;  1TJD A;  1G96 A;  5D83 A;  2KF4 A;  2RNT A;  3D9R A;  3DMC A;  2L4V A;  4OK0 A;  4BTY A;  1Q81 4;  1UI8 A;  2IYJ A;  5D81 A;  1ZX2 A;  2CW9 A;  2K3D A;  4O02 B;  2JDI H;  4JF8 A;  1N5H A;  2AAD A;  4HM7 B;  1PYL A;  3EC9 A;  3GZY B;  2HMK B;  3S28 A;  3CPW 2;  1OF5 B;  2IMJ A;  1PY3 A;  1W2B 2;  2RCD A;  1LQG C;  2Z76 A;  3G71 3;  1YHQ 3;  4RNZ A;  3ZG5 A;  2R4I A;  7STD A;  1TFO A;  5CXO A;  5KP1 A;  1EUI C;  2M7O A;  5DRV A;  4OUQ A;  1X1W A;  1JB5 A;  3BNC A;  1X1U A;  2W6J H;  1FYS A;  2WGO A;  2BO9 B;  2OCT A;  3BU4 A;  3CCL 3;  3OWU A;  2BNG A;  4KFE A;  1IV7 A;  3Q2P A;  4MMX B;  2UGI A;  3CU3 A;  1T3B A;  1VQL 3;  1B27 A;  1TUH A;  1RGE A;  1O7N B;  5AIG A;  4X2H A;  4X2O A;  2Z6B A;  1AQZ A;  2FXT A;  3KII A;  3T0U A;  4MMY B;  4GHO A;  3Q1C A;  4NRE A;  1STD A;  2HMJ B;  2WOF A;  1IQ8 A;  3F14 A;  1N5P A;  1VQ4 3;  2XH9 A;  1US1 A;  1IQY A;  2JQ5 A;  4HM5 B;  1IQX A;  3RDE A;  1FUW A;  3B4P A;  1UUW B;  4XBX A;  1VZZ A;  2C11 A;  3FH1 A;  1R4C A;  3KFQ C;  3NBB A;  4RNY A;  2CG0 A;  1V74 A;  5LC7 A;  1W02 A;  4L8O A;  1RDS A;  2B24 B;  3AHW A;  3MG3 A;  4N6U A;  5EQL A;  3WOD G;  2GXF A;  1DE3 A;  1HYF A;  1W7C A;  3PCR A;  1GSP A;  3JUQ A;  3BNE A;  1RNB A;  1D6Z A;  4O3V A;  2QEX 3;  1TTO A;  4LEH A;  3CC7 3;  4K61 A;  1BRJ A;  3EX9 A;  1N8R 4;  1GY5 A;  1WMP A;  2YFL B;  4FCZ A;  3CCQ 3;  2OQE A;  1RLS A;  3PZW A;  1BSC A;  3NBJ A;  1MGR A;  1UW1 A;  1Q9E A;  7GSP A;  3CXC 2;  4N6M A;  3D5I A;  3U1W A;  3B4O A;  4GB5 A;  3DGM A;  1RN4 A;  1OH0 A;  5G1L A;  2F86 B;  8RNT A;  4IT7 A;  5BXQ A;  3WA3 A;  1LVN A;  3MKI A;  3RGA A;  3GRD A;  5IG3 A;  3VF1 A;  2FNQ A;  2IY2 A;  1JKG B;  1EEJ A;  5AYR B;  3MPH A;  1MWS A;  1KWI A;  2CH9 A;  3CCJ 3;  1RGC A;  5IEO A;  1VQ9 3;  1F8N A;  1YJW 3;  2RFR A;  1IYY A;  3HIG A;  1IDP A;  2C10 A;  4QWT A;  1AY7 A;  1V58 A;  7RNT A;  4HM2 B;  3ZG0 A;  1PU4 A;  3S67 A;  1RN7 A;  3WOE B;  4BL3 A;  1GD4 A;  3WMD A;  1CQS A;  1BUQ A;  2J8X B;  1K41 A;  2KXG A;  4HZB B;  2XEP A;  2OOV A;  2L1S A;  4LSO A;  1ROA A;  1RGH A;  1GMR A;  1CYV A;  3DUK A;  1PFP A;  1WMN A;  4CPK A;  1RMS A;  3OWS A;  2KAA A;  3EBY A;  4R80 A;  1J2B A;  1VQ8 3;  2C4B A;  1TP6 A;  2W56 A;  3UL5 A;  1Y4K A;  2BU4 A;  1DVC A;  2CX1 A;  1UUV B;  3LTC A;  3CPO A;  2XRX B;  4FMC A;  1Z1S A;  2HML B;  1I3I A;  4R9K A;  2K54 A;  3M8C A;  3NM7 A;  5M19 A;  4R9L A;  1YGE A;  3JUO A;  3QRD A;  2P05 A;  5KP4 A;  1VQ5 3;  1FGM A;  1BNF A;  2CG1 A;  1GOY A;  5IF6 A;  3GZB A;  3JUN A;  1RCL A;  3MHE A;  2GU3 A;  3DZL A;  3U97 A;  5EVH A;  1NO3 A;  1MWT A;  1KSI A;  2XR8 B;  3DGY A;  2ZDJ A;  3KCH A;  5IW9 A;  3BND A;  3KZT A;  4WYK B;  1CYU A;  5KP3 A;  1G0T A;  3BNB A;  3DM8 A;  4J5G A;  2W03 A;  1BSE A;  2H0H A;  3OX9 A;  1I70 A;  1B2U A;  4KT3 B;  1D6Y A;  5RNT A;  4HM4 B;  1DYU A;  1JBT A;  1BNI A;  1JRQ A;  5AIH A;  5M1A A;  1M9G A;  1MGW A;  2ML5 A;  5DRE A;  1GY7 A;  4EW5 A;  3GSP A;  3GZX B;  8CHO A;  2A15 A;  4N6T A;  2UUG C;  2QIY A;  3MSO A;  1BNR A;  4CJN A;  1HU9 A;  4J9A A;  3CCR 3;  1WNH A;  3GZR A;  3URP A;  1S72 3;  1FUT A;  2K0M A;  1TIJ A;  1FZU A;  1B3S A;  2H0I A;  5BVB A;  5CK6 A;  4FMB A;  2O9U X;  3F8X A;  1IT7 A;  2F4Y A;  1VQ7 3;  5HOH A;  1D6U A;  1BAN A;  3AMO A;  1I3F A;  3NV0 A;  4GSP A;  2SAR A;  5D82 A;  1SPU A;  1BSA A;  1TRP A;  3NXJ A;  4MJD A;  1CEW I;  2OQE C;  1IVX A;  1RRL A;  1OHO A;  3HII A;  4XBT A;  2GU1 A;  2MC8 A;  3X3X A;  2Y73 A;  1Q82 4;  1O7M B;  3ZFZ A;  1K9M 4;  4BTW A;  2CFD A;  3D3L A;  3FLJ A;  4AEQ A;  1ULI B;  2F56 A;  1EG9 B;  5HGR A;  1RTU A;  3RNT A;  2CFG A;  3N8B A;  2ZL8 A;  4KFD A;  3NBR A;  4NPB A;  3VSY A;  3DY5 A;  3HOH A;  2W56 B;  5AYS C;  1E3R A;  1LXE A;  1U5O A;  1JJ2 2;  3V98 A;  3B8L A;  3ER7 A;  4GL6 A;  4BL2 A;  1FGT A;  1BGS A;  3X42 A;  2GEX A;  5IEP A;  4O8S A;  3IPT A;  1YVS A;  3IMA B;  4WFO A;  2OWP A;  1LRA A;  3DGL A;  3RGR A;  4LGQ A;  1JB2 A;  2W2C A;  3JVC A;  1K28 A;  1FGR A;  1JZO A;  1ASK A;  1IT8 A;  1UI7 A;  3FZW A;  1IVW A;  4FCJ A;  4I4K A;  4EC6 A;  4H3U A;  2YFI B;  4EXR A;  1VQO 3;  2ZA4 A;  3LZA A;  5CLK A;  1BSD A;  1A67 A;  4CCV A;  3EHC A;  1FUS A;  2Z7A A;  3FCS B;  4ORL A;  1VQN 3;  4FMD A;  4L7K A;  4IIA A;  1JN5 B;  1W2Z A;  1GMP A;  3H51 A;  2YX9 A;  3D79 A;  1N9J A;  1N9E A;  4XDW A;  5JBS A;  1RGK A;  1JBS A;  1OCV A;  3NUV A;  4KZ1 A;  6GSP A;  3CMA 3;  3UNL A;  1N8Q A;  1QVF 2;  1VQ6 3;  3WR2 A;  2BT3 A;  4DKI A;  2OTJ 3;  3I56 3;  1UGH I;  1RCK A;  1QAL A;  1SQW A;  3KE7 A;  4HM8 B;  1GMQ A;  2BMR B;  2F99 A;  3K9M C;  5IG5 A;  4EV2 A;  3EBT A;  3IJE B;  1W6C A;  4EV5 A;  1BOX A;  1A2P A;  5CF2 A;  1K73 4;  4N6N B;  1BSB A;  3BLZ A;  2IA7 A;  3F40 A;  1IVV A;  1LOX A;  1BRS A;  3B7C A;  3D5G A;  4J8T A;  1NJI 4;  3LTB A;  2KF5 A;  2P0M A;  4K1V A;  1RN1 A;  4BIR A;  4LYL B;  1RJO A;  1RRH A;  4HM6 B;  2WOH A;  1IU7 A;  3PGB A;  3NV0 B;  4LMI A;  1SJW A;  3N54 B;  5FW5 A;  1L5G B;  4XDV A;  1E97 A;  4R1K A;  3SX1 A;  1OGX A;  2V1L A;  3LT8 A;  2E2U A;  2BIR A;  2XSH B;  3J7Y d;  1O7W B;  2KRT A;  4FR9 A;  1NU3 A;  2GSP A;  1B2X A;  3F7S A;  4HM3 B;  1BRI A;  5BIR A;  3SOA A;  1YJN 3;  1UCK A;  1BRG A;  1UCL A;  3FSD A;  1ISK A;  1I2F A;  1G02 A;  2RSX A;  3H3H A;  3UL6 A;  1MWU A;  1VQK 3;  2CK3 H;  1A90 A;  2MF7 A;  1GOU A;  1NWW A;  1T2H A;  3EN1 B;  3LOY A;  3K0Z A;  3HX8 A;  2WGQ A;  4XB5 A;  3FKA A;  1HKX A;  2KF6 A;  2XF3 A;  5BU4 A;  1YVB I;  3JUM A;  2XFT A;  3OWY A;  4HBR A;  4XBY A;  3A5E A;  3T8N A;  1AV4 A;  2H0G A;  3EF8 A;  2W9Q A;  3NX0 A;  1IV9 A;  1JNQ A;  3Q3F A;  3HZP A;  1Q7H A;  1WQL B;  2XGL A;  2XGN A;  2LYX A;  4I5Q A;  1FGQ A;  4O2H A;  1QMA A;  3K7C A;  6STD A;  5LC6 A;  4HZ9 B;  4L8P A;  3ECF A;  2FGT A;  3ROB A;  1YJ9 3;  1BRK A;  3OV4 A;  1MWR A;  1ROV A;  2P09 A;  2LQV A;  2CHC A;  1VQQ A;  3CME 3;  1FA3 A;  1T2I A;  1UCJ A;  3FF0 A;  3G8Z A;  2OOV C;  3NM2 A;  3SLU A;  4BTX A;  2E2V A;  1B2Z A;  4HOH A;  1ULJ B;  1X1Y A;  3EQQ B;  3CCS 3;  3LTA A;  3WA2 X;  4WWU C;  4MMZ B;  3DXO A;  3G16 A;  1I0X A;  1AVL A;  1SAR A;  3S5C A;  1I2G A;  2WO0 A;  2CFW A;  3LYG A;  3AHS A;  3WHO A;  1JBR A;  1EKM A;  1TFK A;  1B2M A;  4FCM A;  1JB4 A;  1BAO A;  3A76 A;  4AKY A;  3NQY A;  2BHM A;  3EE1 A;  4JRF A;  3X3Y A;  2AAE A;  1T5Y A;  3I0Y A;  1IK3 A;  2KF3 A;  5IER A;  5AEU B;  4WHA A;  4U13 A;  2D1W A;  4KFF A;  3EJV A;  4WP5 A;  4HJL B;  3KKG A;  5TGN A;  3BB9 A;  2CFK A;  3V92 A;  5CF1 A;  2KCD A;  3AGN A;  5A0O B;  1E3V A;  2XFS A;  2CWV A;  1IVU A;  4K90 B;  1GYB A;  3Q90 A;  2RGQ A;  3KN4 A;  1STF I;  2BMO B;  5G1K A;  5M18 A;  5I97 A;  1FGO A;  1RGL A;  4J5K A;  4XM4 A;  1RSN A;  3SVA A;  2HMN B;  1V57 A;  1OF5 A;  2O3O A;  4G1M B;  3SYU A;  1NNV A;  4R4K A;  1LOV A;  2INX A;  3KSP A;  3LML A;  9RNT A;  3FG1 A;  2CX0 A;  3CNM A;  1BRN L;  1YGW A;  3VGN A;  3PS8 A;  4EBG A;  3LXU X;  3CC4 3;  3CCU 3;  5AI1 A;  2OTL 3;  1I8V A;  3WDG B;  3NHX A;  1VQP 3;  2ZHX B;  1O7G B;  2Y74 A;  5GSP A;  1X1X A;  1EA2 A;  1YIJ 3;  2P0X A;  2Z77 A;  3OXA A;  4H61 A;  1Q86 4;  5G2G A;  3CC2 3;  1DVD A;  1OHP A;  1ZGX A;  2F5M A;  3ALA A;  5ELJ A;  3EB8 A;  5JPP A;  5STD A;  2ML6 A;  1W6Y A;  2PZV A;  4OVM A;  5ELU A;  3X3Z A;  3X41 A;  1YI2 3;  1RKY A;  2SBL A;  1BNS A;  1HZ1 A;  1EQK A;  4HM0 B;  1YNV X;  1SIH A;  1GY6 A;  3OW2 2;  2STD A;  2F5W A;  4BU4 A;  1OPY A;  1BRH A;  3FF2 A;  4ZM8 A;  3UJM A;  1M1K 4;  1NDO B;  3V99 A;  3CNX A;  5AIF A;  5IG4 A;  3K63 A;  1S5A A;  5JPU A;  4RZM A;  4HAA A;  1B20 A;  1UDI I;  2YFJ B; 
#chains in the Genus database with same CATH homology
 1PY3 A;  2GSP A;  1B2X A;  3DGY A;  3KCH A;  1BRI A;  5BIR A;  1UCK A;  1BRG A;  1UCL A;  1I2F A;  1G02 A;  4J5G A;  1GOU A;  1T2H A;  1B21 A;  1BSE A;  1X1W A;  1I70 A;  1B2U A;  5RNT A;  5BU4 A;  1X1U A;  2KF6 A;  1FYS A;  3BU4 A;  3DH2 A;  1JBT A;  1RNT A;  1BNI A;  2HOH A;  3A5E A;  1MGW A;  1BIR A;  3Q3F A;  1B27 A;  3GSP A;  1RGE A;  1AQZ A;  1BNR A;  4GHO A;  2RBI A;  1BRK A;  3URP A;  1FUT A;  1TRQ A;  1FZU A;  1T2I A;  1UCJ A;  1B3S A;  3AGO A;  1B2Z A;  1LOW A;  1CH0 A;  1LNI A;  1X1Y A;  4HOH A;  2F4Y A;  1I0V A;  5HOH A;  1RGF A;  1I2E A;  1RDS A;  3AHW A;  1DE3 A;  1I3F A;  4GSP A;  1HYF A;  1I0X A;  2SAR A;  1SAR A;  1BSA A;  1I2G A;  1TRP A;  1GSP A;  3AHS A;  3WHO A;  1RNB A;  1JBR A;  1TTO A;  1B2M A;  1BRJ A;  1B2S A;  2F56 A;  1BAO A;  1RTU A;  3RNT A;  3HOH A;  2AAE A;  1RLS A;  2KF3 A;  3BIR A;  1BSC A;  1MGR A;  1BGS A;  1Q9E A;  7GSP A;  1RHL A;  1BNG A;  3D4A A;  1DET A;  3D5I A;  1YVS A;  3AGN A;  4RNT A;  1RN4 A;  8RNT A;  1LRA A;  1BUJ A;  1RGL A;  4J5K A;  1BVI A;  1RSN A;  1RGC A;  3SYU A;  1IYY A;  2ZA4 A;  1BSD A;  1LOV A;  9RNT A;  1AY7 A;  6RNT A;  1FUS A;  7RNT A;  1UCI A;  1BRN L;  1C54 A;  1LOY A;  1YGW A;  1GMP A;  1I8V A;  1RGK A;  1JBS A;  6GSP A;  1BNE A;  1X1X A;  5GSP A;  3WR2 A;  1R4Y A;  1RCK A;  1RGH A;  1GMR A;  1GMQ A;  1RMS A;  1ZGX A;  1FW7 A;  2F5M A;  2KAA A;  1RGA A;  1BOX A;  2C4B A;  1A2P A;  1BU4 A;  1BNS A;  1HZ1 A;  2BU4 A;  1BSB A;  1RGG A;  3D5G A;  1BRS A;  1YNV X;  2KF5 A;  1GOV A;  1BNJ A;  1I3I A;  2F5W A;  4BU4 A;  1BRH A;  2KF4 A;  1RN1 A;  2RNT A;  4BIR A;  1BNF A;  1GOY A;  2AAD A;  1PYL A;  1RCL A;  4HAA A;  1B20 A;  1BAN A;  2BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...