3D5IA

Crystal structure of ribonuclease sa2 with exo-2',3'-cyclophosphorotioate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
92
Chain Sequence
ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 23
structure length 92
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3d5iA00
1FYSA 8RNTA 4J5KA 1LNIA 1BSAA 1RN1A 1BNEA 5BIRA 1BIRA 1GSPA 1RGHA 6RNTA 2KF6A 1BRJA 1BRHA 1I2FA 1AY7A 1RNTA 1LOYA 4BU4A 1DE3A 1UCIA 1YVSA 5BU4A 2RBIA 1B2XA 2SARA 1HZ1A 1RN4A 2F5MA 1FUTA 3Q3FA 3SYUA 2C4BA 1BRIA 1UCJA 1B20A 1GMQA 1LOVA 3D5GA 1I0VA 1JBSA 1MGWA 1I3FA 1BOXA 1IYYA 2GSPA 1BNIA 1FZUA 1BRNL 2AAEA 1TRQA 1A2PA 1LOWA 3D5IA 3DGYA 3WHOA 1BU4A 1RCKA 1BNFA 1GOUA 1I8VA 1UCKA 2RNTA 1AQZA 1FW7A 3D4AA 1BRGA 1TRPA 2AADA 1BNRA 4HOHA 3RNTA 1B2SA 1RGEA 1RHLA 1X1UA 1B2MA 1BSDA 1B3SA 1B2UA 1BVIA 1GMRA 3AHSA 1SARA 2HOHA 5HOHA 1BNSA 2KF4A 1B21A 5RNTA 1T2HA 3BU4A 2F56A 1PYLA 1C54A 1BSBA 1RLSA 5GSPA 4RNTA 4BIRA 3AGNA 1HYFA 1RGLA 1ZGXA 1BNJA 1RSNA 4J5GA 1RGCA 1RCLA 1YGWA 1MGRA 2F5WA 1BNGA 1BSCA 1I70A 1X1XA 2KF3A 1G02A 1BANA 1JBTA 1RDSA 1X1WA 6GSPA 1BUJA 2KAAA 3GSPA 1FUSA 1T2IA 1BSEA 1I2EA 1TTOA 1UCLA 4GSPA 1RNBA 3WR2A 4HAAA 1RGGA 3AHWA 3URPA 1JBRA 9RNTA 1CH0A 1GOVA 1BAOA 1GOYA 1Q9EA 2BIRA 3A5EA 3AGOA 4GHOA 1BGSA 2BU4A 3HOHA 1I2GA 1B2ZA 1PY3A 1RGKA 1RGAA 1DETA 1X1YA 7RNTA 3KCHA 1GMPA 1I0XA 3BIRA 7GSPA 2KF5A 1BRSA 1R4YA 2F4YA 1RTUA 1YNVX 1I3IA 1B27A 1RGFA 1RMSA 1LRAA 2ZA4A 1BRKA 3DH2A
chains in the Genus database with same CATH superfamily
1LNIA 3WODG 2GEYA 4ILFA 4WYKB 1RN1A 1HKXA 2CKFB 4BTWA 1OPYA 1GY7A 1OHOA 1BIRA 3FSDA 1GSPA 1RGHA 1OACA 3HIIA 1MWTA 4FMBA 4KFEA 1BRHA 3FCSB 3UL6A 5IG5A 2XF3A 2ZHXB 1VQ63 1U8CB 1YVSA 5TGNA 1V58A 4KVHA 2E2UA 3GZRA 4LMIA 5IEPA 1EUIC 2BMQB 3MKIA 5M19A 8CHOA 1K28A 2YFIB 1NWWA 2Y74A 1FUTA 4N6LA 3EHCA 3NBBA 1EA2A 1VQQA 3CCU3 1FGOA 1Q824 5D81A 4DKIA 3ZFZA 1KD14 1VQO3 3D5GA 4XBTA 3K5TA 1I3FA 1RN7A 2K54A 2ZDJA 3OW22 3CCQ3 2H0IA 2CK3H 3QK9A 2FNQA 1IYYA 1BNIA 2YFJB 2ML6A 3CU3A 5EEOA 1IV9A 2UX0A 1W2B2 3KE7A 1FGMA 2HMMB 1VQM3 1MNLA 3DGYA 1TU5A 1BU4A 3T0UA 1LNHA 2XH9A 3KSED 4FCMA 1K734 3HIGA 4N6UA 1I8VA 3N8BA 3VSYA 4LGQA 1FW7A 3LH4A 4HOHA 3WDGB 1U5OA 1RHLA 3OX9A 3HX8A 2YFLB 3EC9A 3EN1B 4H61A 2QGUA 4HM7B 3H3HA 1GMRA 1JJ22 3MWZA 3G713 1US1A 3EE1A 3G8ZA 3U1WA 1SARA 3X42A 1B21A 1Q40A 1EG9B 5RNTA 2QEX3 3UJMA 2F99A 2F56A 2KRTA 1HU9A 4O3VA 5AYRB 3G16A 4FCZA 3LTBA 4BIRA 3CCR3 1HYFA 2PNCA 1RGLA 1EQKA 4JRFA 4FCJA 1DMMA 1OUNA 1YGWA 1WTHA 1O7PB 1BSCA 2F5WA 4MMXB 1DYUA 1I70A 3DZLA 1UI7A 1SIHA 1W4NA 1JBTA 5AEUB 1NO3A 5G1LA 6GSPA 1VQN3 2WOFA 4R4KA 4CDLA 3PCRA 3F7SA 2WGQA 1BSEA 1TTOA 3BB9A 2RGQA 3SXXA 3WR2A 3PGBA 4WWUC 3E99A 1IVVA 4AKZA 2W04A 3SLUA 1WQLB 1R4CA 4BL2A 1KSIA 5KP4A 4FMDA 1RRLA 2XSOB 3AHWA 4KFDA 3URPA 4ZM8A 1JBRA 1F8NA 1SQWA 4I4KA 1MWSA 9RNTA 5AYSC 1VQP3 1WMNA 3S67A 1Q9EA 3B7CA 2BIRA 2R4IA 4IT7A 3VGNA 1M1XB 4K61A 4MEIA 3DY5A 2JDIH 1B2ZA 1PY3A 2H0HA 3KIIA 2CG1A 2CIUA 2IA7A 1X1YA 1GY6A 7GSPA 1O7NB 3FG3A 5M1AA 3KZTA 5D82A 1R4YA 1OGXA 2ZL8A 4N6NB 1YNVX 1NB5I 1RGFA 1X1UA 1LRAA 2Z6BA 2ZA4A 1BRKA 3HOHA 1FYSA 4HVNA 8RNTA 4J5KA 3CCV3 5JPUA 4BTXA 2CX1A 4RZMA 2HMKB 5STDA 1LQGC 1OGZA 1W01A 4O8SA 4AKYA 1VQ83 3CC73 3X40A 1JV2B 3D3LA 3MSOA 3UNLA 1M904 4TX4A 3KKGA 3Q2PA 1QAKA 1D6UA 4K1VA 2STDA 4KFFA 4CJNA 1UCIA 3NQYA 1W6CA 4GB5A 1IT7A 2CFKA 2RBIA 2HMOB 3CPW2 3LZAA 1A90A 5M18A 3B8LA 1ZS7A 1SIIA 3X3ZA 5JPPA 1IT8A 1WNHA 3SYUA 5JBSA 1K9M4 1DVDA 3WA2X 1VQ53 2Z7AA 2M7OA 4HJLB 1O7HB 1B20A 4U13A 4XDWA 1I0VA 1JBSA 3MG2A 1N5PA 1VZZA 1TJDA 2O9UX 3EF8A 3GAXA 5CF1A 1TRQA 5KP1A 4PEJA 4R9KA 3S28A 4KT3B 3MG1A 3PS8A 2IMJA 1STDA 3WHOA 2MC8A 4N6MA 1RCKA 5IW9A 1SJWA 5ELJA 3F8XA 1AR0A 3FH1A 4EV2A 1UCKA 3FG4A 2P09A 3FF2A 3K63A 2A15A 3LMLA 1W7CA 1N8QA 3D4AA 1BRGA 3RDEA 3T8NA 2OTJ3 3CCE3 4WFOA 3DXOA 2UGIA 4XB5A 1OF5B 1YJN3 2OWPA 4XBYA 1ZX2A 4R9LA 3VF1A 1KC84 1BVIA 1GS3A 1JKGA 3NBJA 1M1K4 3EJVA 1OHSA 3X3YA 3DGOA 4L7KA 3JUPA 1S5AA 3DGLA 3G0KA 1T2HA 1JB5A 3WMDA 3M8CA 1C54A 4GL6A 1K8A4 3ALAA 2GBWB 2XEPA 3K7CA 4RBNA 3AGNA 4EBGA 2E2VA 1BNJA 1D6ZA 1RSNA 1RGCA 2GXFA 3EBYA 2GBXB 4J5GA 2IUJA 3OWYA 1VQ73 1FGRA 1JZDA 3NXJA 1AVLA 2KF3A 1UW1A 3DGMA 1G02A 4JF8A 3OXAA 2F98A 3U97A 3F7XA 5D83A 1BUJA 3OWUA 3TDGA 1E97A 2J8XB 2KAAA 3AMOA 3GSPA 3PZWA 4HM2B 1FUSA 2UUGC 1N8R4 3FGYA 1I2EA 1JZOA 1E3VA 1K41A 1UCLA 1KWIA 3A76A 1Q814 1RNBA 3WA3A 1IVWA 1GY5A 3AMOB 1IK3A 4K90B 5G1KA 5CLKA 3GWRA 1FUWA 1UGHI 1QVG2 3NM7A 4NHFA 4J9AA 1Q7HA 2W56B 2D42A 3NBRA 4H3UA 1PFPA 1GOYA 1RRHA 1V57A 3S29A 1VQ93 1NB3I 3J7Yd 4GHOA 1JB2A 1NU3A 2BU4A 3IPTA 1E3RA 3EBTA 1ASKA 4LZIA 1JN5B 4R80A 3SEDA 4R1KA 1ZO2A 3GZXB 2O3OA 3CCL3 1Q864 1N9EA 3DM8A 1GMPA 3F14A 3BIRA 3BNEA 3F40A 5IF6A 2I9WA 4MJDA 4NREA 5AEWB 2F4YA 1RTUA 1T3BA 1RMSA 3SOAA 1J2BA 3A5EA 3NV0A 3F9SA 3S27A 5IENA 4X2OA 1G96A 2YX9A 2FGTA 3QRDA 3ROBA 5CK6A 1T5YA 1JKGB 3GZBA 4G1MB 1RKYA 6RNTA 5IERA 5LC6A 4MMYB 5IG4A 3NX0A 1I2FA 2L1SA 1AY7A 3CXC2 1RNTA 1LOYA 1TFOA 1W02A 4XBXA 5BVBA 1DE3A 1IV7A 3CD63 3CC43 4N3VA 4EXRA 2OOVC 5BU4A 1TUHA 4EYCA 1TFKA 2SARA 3UL5A 3EQQB 2P05A 3JUMA 1HZ1A 2XR8B 3GZYB 2F5MA 3RGAA 3IMAB 3Q3FA 5CXOA 2XGLA 1IVUA 4HM8B 1BRIA 1EEJA 1FGTA 2QIYA 1GMQA 2Q07A 4STDA 5DRVA 1D6YA 4WP5A 1BOXA 3DGNA 3O8YA 1JNQA 1STFI 4XDVA 2GSPA 2IYJA 2V1LA 4HM4B 1AV4A 1FZUA 1G0TA 2AAEA 1A2PA 2W9PA 4CCVA 4FMAA 1GYBA 1A2KA 2F86B 3SOYA 5AI1A 1VQK3 1GOUA 4O2HA 2RNTA 1AQZA 3PYJA 4LYLB 4O02B 1TRPA 3B4PA 3DUKA 1ULIB 2AADA 2OCTA 3S5CA 1BNRA 4OVMA 3WOEB 1B2SA 2ML5A 1YIT3 2JQ5A 4HM5B 3NQZA 1B3SA 3B4OA 3H51A 3K0ZA 3FF0A 1W00A 1UGIA 3JUNA 3CCS3 2CFGA 3LOYA 3AHSA 3MHEA 1M9GA 5HOHA 1DMNA 5AIFA 1BNSA 2XRXB 1YHQ3 1ISKA 4EV5A 2WGOA 1YIJ3 1YJW3 1LXEA 3EB8A 1WMOA 1BSBA 1IQ8A 1RLSA 4HKVB 4K1UA 4RNTA 4N6V0 4OK0A 3ECFA 3SX1A 2GEXA 3JUOA 1RJOA 2R41A 5KP3A 3N54B 3LYGA 3Q90A 2OQEA 5AIGA 1N5HA 2PZVA 2WO0A 1UUWB 2D1WA 2Z77A 1X1XA 3JUQA 3PCSA 3CNMA 2IY2A 1PU4A 1Y4KA 1RDSA 4HM6B 2CHCA 2B24B 2HMJB 1MWUA 3KFQC 4X2HA 3SVAA 1DVCA 2E2TA 3NUVA 3LTAA 3CMA3 3BNCA 1T2IA 1A67A 3ER7A 5A0OB 3KN4A 4GSPA 4BL3A 2P0XA 1W6YA 2CFWA 3LXUX 4XM4A 3BNBA 2P38A 1Q7Y4 3I563 1UDII 3V92A 2CFDA 2RCDA 1GOVA 3L0RA 4J8TA 5FW5A 3AGOA 1GD3A 4QWTA 5AIHA 3HK4A 3LT9A 2CWUA 1IVXA 1RGKA 3NHXA 2BT3A 1QALA 2BHMA 7RNTA 2QA43 2OOVA 3OV4A 4HM0B 1I0XA 5I97A 1IDPA 1O7GB 2KF5A 5IG3A 2K3DA 1FGQA 2CWVA 2INXA 4HYZA 2W9QA 1CQSA 3CC23 2GU3A 1BSAA 3BLZA 1BNEA 1GD4A 3BNDA 3KSPA 5BIRA 3DMCA 1ROAA 1UI8A 3CNXA 4RNYA 3G4S3 2KF6A 3HZPA 1Q40B 1BRJA 3T8UA 2W0QA 3D79A 4CPKA 2H0GA 4L8OA 3CCJ3 1TIJA 1CYUA 4BU4A 2B1XB 2KXGA 2BO9B 4Q53A 3PXMA 3I0YA 1B2XA 5CF2A 1QVF2 3RGRA 1O7WB 3CCM3 1RN4A 1AVKA 2CG0A 3F8HA 2C4BA 4LSOA 4LEHA 4FR9A 2HMNB 3HI7A 4EC6A 1UCJA 1FA3A 2C10A 1LOVA 4BTYA 1MGWA 1IU7A 1Q42A 2OTL3 5LC7A 2W56A 3MPHA 3G6E3 1BRNL 1ULJB 1YVBI 1OCVA 2XSHB 1NDOB 1QAFA 3V98A 4FMCA 4AEQA 2Z76A 2BMRB 2KCDA 3EX9A 3CME3 2K0MA 1LOWA 3D5IA 5DREA 1BNFA 5FGOA 4NPBA 3NM2A 1MWRA 2P0MA 3LTDA 4HZ9B 1YJ93 2CX0A 1DMQA 1TP6A 1O7MB 1MOLA 1BUQA 1LOXA 1W2ZA 3OWSA 1W6GA 1YGEA 3NV0B 3MG3A 3RNTA 2W2CA 4HBRA 3LTCA 1RGEA 1B2MA 1WMPA 1VQL3 1BSDA 3LT8A 1B2UA 3EN8A 4MMZB 2HMLB 1JB4A 1LQMB 2XGNA 3STDA 2W6JH 3X3XA 2CC3A 1S723 7STDA 6STDA 4N6TA 2HOHA 1N9JA 2KF4A 2XFTA 3FG1A 2SBLA 4L8PA 5HGRA 5EVHA 3BU4A 1EKMA 1PYLA 4HM3B 1OH0A 1IQXA 5GSPA 2CWTA 4I5QA 3GRDA 2L4VA 2W03A 1V74A 1ZGXA 5ELUA 5G2GA 5EQLA 1RCLA 4RNZA 3I553 1MGRA 2XFSA 1BNGA 2CW9A 1VQ43 1ROVA 2BNGA 5AIIA 1BANA 3FLJA 2Y73A 2RFRA 3CPOA 3FZWA 4KZ1A 1W5ZA 1X1WA 1A2VA 1JRQA 1UUVB 3MYTA 1SPUA 2WOHA 3N9HA 4EW5A 3X41A 2C11A 3K9MC 3V99A 1NJI4 4N6OB 5IEOA 2IUKA 4HAAA 3D9RA 1RGGA 4OUQA 5BXQA 1L5GB 2GU1A 3FKAA 3UB1A 1CH0A 2CFLA 2OQEC 4HZBB 1BAOA 1QMAA 1KQS2 2MF7A 3Q1CA 4WHAA 3ZG5A 5IG0A 3JVCA 1UUGB 1BGSA 1I2GA 1Z1SA 2RSXA 1RGAA 1DETA 1LVNA 2LYXA 4ORLA 1NNVA 3WOFB 3IJEB 2CH9A 3KCHA 4HM1B 2FXTA 2BMOB 1JN5A 2LQVA 4IIAA 1YI23 4WYKA 1BRSA 3ZG0A 4IPBA 1C7HA 1CEWI 1I3IA 1B27A 1QJGA 1OHPA 1OF5A 1IQYA 1CYVA 3DH2A
chains in the Genus database with same CATH topology
1FYSA 8RNTA 4J5KA 1LNIA 1BSAA 1RN1A 1BNEA 5BIRA 1BIRA 1GSPA 1RGHA 6RNTA 2KF6A 1BRJA 1BRHA 1I2FA 1AY7A 1RNTA 1LOYA 4BU4A 1DE3A 1UCIA 1YVSA 5BU4A 2RBIA 1B2XA 2SARA 1HZ1A 1RN4A 2F5MA 1FUTA 3Q3FA 3SYUA 2C4BA 1BRIA 1UCJA 1B20A 1GMQA 1LOVA 3D5GA 1I0VA 1JBSA 1MGWA 1I3FA 1BOXA 1IYYA 2GSPA 1BNIA 1FZUA 1BRNL 2AAEA 1TRQA 1A2PA 1LOWA 3D5IA 3DGYA 3WHOA 1BU4A 1RCKA 1BNFA 1GOUA 1I8VA 1UCKA 2RNTA 1AQZA 1FW7A 3D4AA 1BRGA 1TRPA 2AADA 1BNRA 4HOHA 3RNTA 1B2SA 1RGEA 1RHLA 1X1UA 1B2MA 1BSDA 1B3SA 1B2UA 1BVIA 1GMRA 3AHSA 1SARA 2HOHA 5HOHA 1BNSA 2KF4A 1B21A 5RNTA 1T2HA 3BU4A 2F56A 1PYLA 1C54A 1BSBA 1RLSA 5GSPA 4RNTA 4BIRA 3AGNA 1HYFA 1RGLA 1ZGXA 1BNJA 1RSNA 4J5GA 1RGCA 1RCLA 1YGWA 1MGRA 2F5WA 1BNGA 1BSCA 1I70A 1X1XA 2KF3A 1G02A 1BANA 1JBTA 1RDSA 1X1WA 6GSPA 1BUJA 2KAAA 3GSPA 1FUSA 1T2IA 1BSEA 1I2EA 1TTOA 1UCLA 4GSPA 1RNBA 3WR2A 4HAAA 1RGGA 3AHWA 3URPA 1JBRA 9RNTA 1CH0A 1GOVA 1BAOA 1GOYA 1Q9EA 2BIRA 3A5EA 3AGOA 4GHOA 1BGSA 2BU4A 3HOHA 1I2GA 1B2ZA 1PY3A 1RGKA 1RGAA 1DETA 1X1YA 7RNTA 3KCHA 1GMPA 1I0XA 3BIRA 7GSPA 2KF5A 1BRSA 1R4YA 2F4YA 1RTUA 1YNVX 1I3IA 1B27A 1RGFA 1RMSA 1LRAA 2ZA4A 1BRKA 3DH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  8RNT A;  4J5K A;  1LNI A;  1BSA A;  1RN1 A;  1BNE A;  5BIR A;  1BIR A;  1GSP A;  1RGH A;  6RNT A;  2KF6 A;  1BRJ A;  1BRH A;  1I2F A;  1AY7 A;  1RNT A;  1LOY A;  4BU4 A;  1DE3 A;  1UCI A;  1YVS A;  5BU4 A;  2RBI A;  1B2X A;  2SAR A;  1HZ1 A;  1RN4 A;  2F5M A;  1FUT A;  3Q3F A;  3SYU A;  2C4B A;  1BRI A;  1UCJ A;  1B20 A;  1GMQ A;  1LOV A;  3D5G A;  1I0V A;  1JBS A;  1MGW A;  1I3F A;  1BOX A;  1IYY A;  2GSP A;  1BNI A;  1FZU A;  1BRN L;  2AAE A;  1TRQ A;  1A2P A;  1LOW A;  3D5I A;  3DGY A;  3WHO A;  1BU4 A;  1RCK A;  1BNF A;  1GOU A;  1I8V A;  1UCK A;  2RNT A;  1AQZ A;  1FW7 A;  3D4A A;  1BRG A;  1TRP A;  2AAD A;  1BNR A;  4HOH A;  3RNT A;  1B2S A;  1RGE A;  1RHL A;  1X1U A;  1B2M A;  1BSD A;  1B3S A;  1B2U A;  1BVI A;  1GMR A;  3AHS A;  1SAR A;  2HOH A;  5HOH A;  1BNS A;  2KF4 A;  1B21 A;  5RNT A;  1T2H A;  3BU4 A;  2F56 A;  1PYL A;  1C54 A;  1BSB A;  1RLS A;  5GSP A;  4RNT A;  4BIR A;  3AGN A;  1HYF A;  1RGL A;  1ZGX A;  1BNJ A;  1RSN A;  4J5G A;  1RGC A;  1RCL A;  1YGW A;  1MGR A;  2F5W A;  1BNG A;  1BSC A;  1I70 A;  1X1X A;  2KF3 A;  1G02 A;  1BAN A;  1JBT A;  1RDS A;  1X1W A;  6GSP A;  1BUJ A;  2KAA A;  3GSP A;  1FUS A;  1T2I A;  1BSE A;  1I2E A;  1TTO A;  1UCL A;  4GSP A;  1RNB A;  3WR2 A;  4HAA A;  1RGG A;  3AHW A;  3URP A;  1JBR A;  9RNT A;  1CH0 A;  1GOV A;  1BAO A;  1GOY A;  1Q9E A;  2BIR A;  3A5E A;  3AGO A;  4GHO A;  1BGS A;  2BU4 A;  3HOH A;  1I2G A;  1B2Z A;  1PY3 A;  1RGK A;  1RGA A;  1DET A;  1X1Y A;  7RNT A;  3KCH A;  1GMP A;  1I0X A;  3BIR A;  7GSP A;  2KF5 A;  1BRS A;  1R4Y A;  2F4Y A;  1RTU A;  1YNV X;  1I3I A;  1B27 A;  1RGF A;  1RMS A;  1LRA A;  2ZA4 A;  1BRK A;  3DH2 A; 
#chains in the Genus database with same CATH topology
 1LNI A;  3WOD G;  2GEY A;  4ILF A;  4WYK B;  1RN1 A;  1HKX A;  2CKF B;  4BTW A;  1OPY A;  1GY7 A;  1OHO A;  1BIR A;  3FSD A;  1GSP A;  1RGH A;  1OAC A;  3HII A;  1MWT A;  4FMB A;  4KFE A;  1BRH A;  3FCS B;  3UL6 A;  5IG5 A;  2XF3 A;  2ZHX B;  1VQ6 3;  1U8C B;  1YVS A;  5TGN A;  1V58 A;  4KVH A;  2E2U A;  3GZR A;  4LMI A;  5IEP A;  1EUI C;  2BMQ B;  3MKI A;  5M19 A;  8CHO A;  1K28 A;  2YFI B;  1NWW A;  2Y74 A;  1FUT A;  4N6L A;  3EHC A;  3NBB A;  1EA2 A;  1VQQ A;  3CCU 3;  1FGO A;  1Q82 4;  5D81 A;  4DKI A;  3ZFZ A;  1KD1 4;  1VQO 3;  3D5G A;  4XBT A;  3K5T A;  1I3F A;  1RN7 A;  2K54 A;  2ZDJ A;  3OW2 2;  3CCQ 3;  2H0I A;  2CK3 H;  3QK9 A;  2FNQ A;  1IYY A;  1BNI A;  2YFJ B;  2ML6 A;  3CU3 A;  5EEO A;  1IV9 A;  2UX0 A;  1W2B 2;  3KE7 A;  1FGM A;  2HMM B;  1VQM 3;  1MNL A;  3DGY A;  1TU5 A;  1BU4 A;  3T0U A;  1LNH A;  2XH9 A;  3KSE D;  4FCM A;  1K73 4;  3HIG A;  4N6U A;  1I8V A;  3N8B A;  3VSY A;  4LGQ A;  1FW7 A;  3LH4 A;  4HOH A;  3WDG B;  1U5O A;  1RHL A;  3OX9 A;  3HX8 A;  2YFL B;  3EC9 A;  3EN1 B;  4H61 A;  2QGU A;  4HM7 B;  3H3H A;  1GMR A;  1JJ2 2;  3MWZ A;  3G71 3;  1US1 A;  3EE1 A;  3G8Z A;  3U1W A;  1SAR A;  3X42 A;  1B21 A;  1Q40 A;  1EG9 B;  5RNT A;  2QEX 3;  3UJM A;  2F99 A;  2F56 A;  2KRT A;  1HU9 A;  4O3V A;  5AYR B;  3G16 A;  4FCZ A;  3LTB A;  4BIR A;  3CCR 3;  1HYF A;  2PNC A;  1RGL A;  1EQK A;  4JRF A;  4FCJ A;  1DMM A;  1OUN A;  1YGW A;  1WTH A;  1O7P B;  1BSC A;  2F5W A;  4MMX B;  1DYU A;  1I70 A;  3DZL A;  1UI7 A;  1SIH A;  1W4N A;  1JBT A;  5AEU B;  1NO3 A;  5G1L A;  6GSP A;  1VQN 3;  2WOF A;  4R4K A;  4CDL A;  3PCR A;  3F7S A;  2WGQ A;  1BSE A;  1TTO A;  3BB9 A;  2RGQ A;  3SXX A;  3WR2 A;  3PGB A;  4WWU C;  3E99 A;  1IVV A;  4AKZ A;  2W04 A;  3SLU A;  1WQL B;  1R4C A;  4BL2 A;  1KSI A;  5KP4 A;  4FMD A;  1RRL A;  2XSO B;  3AHW A;  4KFD A;  3URP A;  4ZM8 A;  1JBR A;  1F8N A;  1SQW A;  4I4K A;  1MWS A;  9RNT A;  5AYS C;  1VQP 3;  1WMN A;  3S67 A;  1Q9E A;  3B7C A;  2BIR A;  2R4I A;  4IT7 A;  3VGN A;  1M1X B;  4K61 A;  4MEI A;  3DY5 A;  2JDI H;  1B2Z A;  1PY3 A;  2H0H A;  3KII A;  2CG1 A;  2CIU A;  2IA7 A;  1X1Y A;  1GY6 A;  7GSP A;  1O7N B;  3FG3 A;  5M1A A;  3KZT A;  5D82 A;  1R4Y A;  1OGX A;  2ZL8 A;  4N6N B;  1YNV X;  1NB5 I;  1RGF A;  1X1U A;  1LRA A;  2Z6B A;  2ZA4 A;  1BRK A;  3HOH A;  1FYS A;  4HVN A;  8RNT A;  4J5K A;  3CCV 3;  5JPU A;  4BTX A;  2CX1 A;  4RZM A;  2HMK B;  5STD A;  1LQG C;  1OGZ A;  1W01 A;  4O8S A;  4AKY A;  1VQ8 3;  3CC7 3;  3X40 A;  1JV2 B;  3D3L A;  3MSO A;  3UNL A;  1M90 4;  4TX4 A;  3KKG A;  3Q2P A;  1QAK A;  1D6U A;  4K1V A;  2STD A;  4KFF A;  4CJN A;  1UCI A;  3NQY A;  1W6C A;  4GB5 A;  1IT7 A;  2CFK A;  2RBI A;  2HMO B;  3CPW 2;  3LZA A;  1A90 A;  5M18 A;  3B8L A;  1ZS7 A;  1SII A;  3X3Z A;  5JPP A;  1IT8 A;  1WNH A;  3SYU A;  5JBS A;  1K9M 4;  1DVD A;  3WA2 X;  1VQ5 3;  2Z7A A;  2M7O A;  4HJL B;  1O7H B;  1B20 A;  4U13 A;  4XDW A;  1I0V A;  1JBS A;  3MG2 A;  1N5P A;  1VZZ A;  1TJD A;  2O9U X;  3EF8 A;  3GAX A;  5CF1 A;  1TRQ A;  5KP1 A;  4PEJ A;  4R9K A;  3S28 A;  4KT3 B;  3MG1 A;  3PS8 A;  2IMJ A;  1STD A;  3WHO A;  2MC8 A;  4N6M A;  1RCK A;  5IW9 A;  1SJW A;  5ELJ A;  3F8X A;  1AR0 A;  3FH1 A;  4EV2 A;  1UCK A;  3FG4 A;  2P09 A;  3FF2 A;  3K63 A;  2A15 A;  3LML A;  1W7C A;  1N8Q A;  3D4A A;  1BRG A;  3RDE A;  3T8N A;  2OTJ 3;  3CCE 3;  4WFO A;  3DXO A;  2UGI A;  4XB5 A;  1OF5 B;  1YJN 3;  2OWP A;  4XBY A;  1ZX2 A;  4R9L A;  3VF1 A;  1KC8 4;  1BVI A;  1GS3 A;  1JKG A;  3NBJ A;  1M1K 4;  3EJV A;  1OHS A;  3X3Y A;  3DGO A;  4L7K A;  3JUP A;  1S5A A;  3DGL A;  3G0K A;  1T2H A;  1JB5 A;  3WMD A;  3M8C A;  1C54 A;  4GL6 A;  1K8A 4;  3ALA A;  2GBW B;  2XEP A;  3K7C A;  4RBN A;  3AGN A;  4EBG A;  2E2V A;  1BNJ A;  1D6Z A;  1RSN A;  1RGC A;  2GXF A;  3EBY A;  2GBX B;  4J5G A;  2IUJ A;  3OWY A;  1VQ7 3;  1FGR A;  1JZD A;  3NXJ A;  1AVL A;  2KF3 A;  1UW1 A;  3DGM A;  1G02 A;  4JF8 A;  3OXA A;  2F98 A;  3U97 A;  3F7X A;  5D83 A;  1BUJ A;  3OWU A;  3TDG A;  1E97 A;  2J8X B;  2KAA A;  3AMO A;  3GSP A;  3PZW A;  4HM2 B;  1FUS A;  2UUG C;  1N8R 4;  3FGY A;  1I2E A;  1JZO A;  1E3V A;  1K41 A;  1UCL A;  1KWI A;  3A76 A;  1Q81 4;  1RNB A;  3WA3 A;  1IVW A;  1GY5 A;  3AMO B;  1IK3 A;  4K90 B;  5G1K A;  5CLK A;  3GWR A;  1FUW A;  1UGH I;  1QVG 2;  3NM7 A;  4NHF A;  4J9A A;  1Q7H A;  2W56 B;  2D42 A;  3NBR A;  4H3U A;  1PFP A;  1GOY A;  1RRH A;  1V57 A;  3S29 A;  1VQ9 3;  1NB3 I;  3J7Y d;  4GHO A;  1JB2 A;  1NU3 A;  2BU4 A;  3IPT A;  1E3R A;  3EBT A;  1ASK A;  4LZI A;  1JN5 B;  4R80 A;  3SED A;  4R1K A;  1ZO2 A;  3GZX B;  2O3O A;  3CCL 3;  1Q86 4;  1N9E A;  3DM8 A;  1GMP A;  3F14 A;  3BIR A;  3BNE A;  3F40 A;  5IF6 A;  2I9W A;  4MJD A;  4NRE A;  5AEW B;  2F4Y A;  1RTU A;  1T3B A;  1RMS A;  3SOA A;  1J2B A;  3A5E A;  3NV0 A;  3F9S A;  3S27 A;  5IEN A;  4X2O A;  1G96 A;  2YX9 A;  2FGT A;  3QRD A;  3ROB A;  5CK6 A;  1T5Y A;  1JKG B;  3GZB A;  4G1M B;  1RKY A;  6RNT A;  5IER A;  5LC6 A;  4MMY B;  5IG4 A;  3NX0 A;  1I2F A;  2L1S A;  1AY7 A;  3CXC 2;  1RNT A;  1LOY A;  1TFO A;  1W02 A;  4XBX A;  5BVB A;  1DE3 A;  1IV7 A;  3CD6 3;  3CC4 3;  4N3V A;  4EXR A;  2OOV C;  5BU4 A;  1TUH A;  4EYC A;  1TFK A;  2SAR A;  3UL5 A;  3EQQ B;  2P05 A;  3JUM A;  1HZ1 A;  2XR8 B;  3GZY B;  2F5M A;  3RGA A;  3IMA B;  3Q3F A;  5CXO A;  2XGL A;  1IVU A;  4HM8 B;  1BRI A;  1EEJ A;  1FGT A;  2QIY A;  1GMQ A;  2Q07 A;  4STD A;  5DRV A;  1D6Y A;  4WP5 A;  1BOX A;  3DGN A;  3O8Y A;  1JNQ A;  1STF I;  4XDV A;  2GSP A;  2IYJ A;  2V1L A;  4HM4 B;  1AV4 A;  1FZU A;  1G0T A;  2AAE A;  1A2P A;  2W9P A;  4CCV A;  4FMA A;  1GYB A;  1A2K A;  2F86 B;  3SOY A;  5AI1 A;  1VQK 3;  1GOU A;  4O2H A;  2RNT A;  1AQZ A;  3PYJ A;  4LYL B;  4O02 B;  1TRP A;  3B4P A;  3DUK A;  1ULI B;  2AAD A;  2OCT A;  3S5C A;  1BNR A;  4OVM A;  3WOE B;  1B2S A;  2ML5 A;  1YIT 3;  2JQ5 A;  4HM5 B;  3NQZ A;  1B3S A;  3B4O A;  3H51 A;  3K0Z A;  3FF0 A;  1W00 A;  1UGI A;  3JUN A;  3CCS 3;  2CFG A;  3LOY A;  3AHS A;  3MHE A;  1M9G A;  5HOH A;  1DMN A;  5AIF A;  1BNS A;  2XRX B;  1YHQ 3;  1ISK A;  4EV5 A;  2WGO A;  1YIJ 3;  1YJW 3;  1LXE A;  3EB8 A;  1WMO A;  1BSB A;  1IQ8 A;  1RLS A;  4HKV B;  4K1U A;  4RNT A;  4N6V 0;  4OK0 A;  3ECF A;  3SX1 A;  2GEX A;  3JUO A;  1RJO A;  2R41 A;  5KP3 A;  3N54 B;  3LYG A;  3Q90 A;  2OQE A;  5AIG A;  1N5H A;  2PZV A;  2WO0 A;  1UUW B;  2D1W A;  2Z77 A;  1X1X A;  3JUQ A;  3PCS A;  3CNM A;  2IY2 A;  1PU4 A;  1Y4K A;  1RDS A;  4HM6 B;  2CHC A;  2B24 B;  2HMJ B;  1MWU A;  3KFQ C;  4X2H A;  3SVA A;  1DVC A;  2E2T A;  3NUV A;  3LTA A;  3CMA 3;  3BNC A;  1T2I A;  1A67 A;  3ER7 A;  5A0O B;  3KN4 A;  4GSP A;  4BL3 A;  2P0X A;  1W6Y A;  2CFW A;  3LXU X;  4XM4 A;  3BNB A;  2P38 A;  1Q7Y 4;  3I56 3;  1UDI I;  3V92 A;  2CFD A;  2RCD A;  1GOV A;  3L0R A;  4J8T A;  5FW5 A;  3AGO A;  1GD3 A;  4QWT A;  5AIH A;  3HK4 A;  3LT9 A;  2CWU A;  1IVX A;  1RGK A;  3NHX A;  2BT3 A;  1QAL A;  2BHM A;  7RNT A;  2QA4 3;  2OOV A;  3OV4 A;  4HM0 B;  1I0X A;  5I97 A;  1IDP A;  1O7G B;  2KF5 A;  5IG3 A;  2K3D A;  1FGQ A;  2CWV A;  2INX A;  4HYZ A;  2W9Q A;  1CQS A;  3CC2 3;  2GU3 A;  1BSA A;  3BLZ A;  1BNE A;  1GD4 A;  3BND A;  3KSP A;  5BIR A;  3DMC A;  1ROA A;  1UI8 A;  3CNX A;  4RNY A;  3G4S 3;  2KF6 A;  3HZP A;  1Q40 B;  1BRJ A;  3T8U A;  2W0Q A;  3D79 A;  4CPK A;  2H0G A;  4L8O A;  3CCJ 3;  1TIJ A;  1CYU A;  4BU4 A;  2B1X B;  2KXG A;  2BO9 B;  4Q53 A;  3PXM A;  3I0Y A;  1B2X A;  5CF2 A;  1QVF 2;  3RGR A;  1O7W B;  3CCM 3;  1RN4 A;  1AVK A;  2CG0 A;  3F8H A;  2C4B A;  4LSO A;  4LEH A;  4FR9 A;  2HMN B;  3HI7 A;  4EC6 A;  1UCJ A;  1FA3 A;  2C10 A;  1LOV A;  4BTY A;  1MGW A;  1IU7 A;  1Q42 A;  2OTL 3;  5LC7 A;  2W56 A;  3MPH A;  3G6E 3;  1BRN L;  1ULJ B;  1YVB I;  1OCV A;  2XSH B;  1NDO B;  1QAF A;  3V98 A;  4FMC A;  4AEQ A;  2Z76 A;  2BMR B;  2KCD A;  3EX9 A;  3CME 3;  2K0M A;  1LOW A;  3D5I A;  5DRE A;  1BNF A;  5FGO A;  4NPB A;  3NM2 A;  1MWR A;  2P0M A;  3LTD A;  4HZ9 B;  1YJ9 3;  2CX0 A;  1DMQ A;  1TP6 A;  1O7M B;  1MOL A;  1BUQ A;  1LOX A;  1W2Z A;  3OWS A;  1W6G A;  1YGE A;  3NV0 B;  3MG3 A;  3RNT A;  2W2C A;  4HBR A;  3LTC A;  1RGE A;  1B2M A;  1WMP A;  1VQL 3;  1BSD A;  3LT8 A;  1B2U A;  3EN8 A;  4MMZ B;  2HML B;  1JB4 A;  1LQM B;  2XGN A;  3STD A;  2W6J H;  3X3X A;  2CC3 A;  1S72 3;  7STD A;  6STD A;  4N6T A;  2HOH A;  1N9J A;  2KF4 A;  2XFT A;  3FG1 A;  2SBL A;  4L8P A;  5HGR A;  5EVH A;  3BU4 A;  1EKM A;  1PYL A;  4HM3 B;  1OH0 A;  1IQX A;  5GSP A;  2CWT A;  4I5Q A;  3GRD A;  2L4V A;  2W03 A;  1V74 A;  1ZGX A;  5ELU A;  5G2G A;  5EQL A;  1RCL A;  4RNZ A;  3I55 3;  1MGR A;  2XFS A;  1BNG A;  2CW9 A;  1VQ4 3;  1ROV A;  2BNG A;  5AII A;  1BAN A;  3FLJ A;  2Y73 A;  2RFR A;  3CPO A;  3FZW A;  4KZ1 A;  1W5Z A;  1X1W A;  1A2V A;  1JRQ A;  1UUV B;  3MYT A;  1SPU A;  2WOH A;  3N9H A;  4EW5 A;  3X41 A;  2C11 A;  3K9M C;  3V99 A;  1NJI 4;  4N6O B;  5IEO A;  2IUK A;  4HAA A;  3D9R A;  1RGG A;  4OUQ A;  5BXQ A;  1L5G B;  2GU1 A;  3FKA A;  3UB1 A;  1CH0 A;  2CFL A;  2OQE C;  4HZB B;  1BAO A;  1QMA A;  1KQS 2;  2MF7 A;  3Q1C A;  4WHA A;  3ZG5 A;  5IG0 A;  3JVC A;  1UUG B;  1BGS A;  1I2G A;  1Z1S A;  2RSX A;  1RGA A;  1DET A;  1LVN A;  2LYX A;  4ORL A;  1NNV A;  3WOF B;  3IJE B;  2CH9 A;  3KCH A;  4HM1 B;  2FXT A;  2BMO B;  1JN5 A;  2LQV A;  4IIA A;  1YI2 3;  4WYK A;  1BRS A;  3ZG0 A;  4IPB A;  1C7H A;  1CEW I;  1I3I A;  1B27 A;  1QJG A;  1OHP A;  1OF5 A;  1IQY A;  1CYV A;  3DH2 A; 
#chains in the Genus database with same CATH homology
 1FYS A;  8RNT A;  4J5K A;  1LNI A;  1BSA A;  1RN1 A;  1BNE A;  5BIR A;  1BIR A;  1GSP A;  1RGH A;  6RNT A;  2KF6 A;  1BRJ A;  1BRH A;  1I2F A;  1AY7 A;  1RNT A;  1LOY A;  4BU4 A;  1DE3 A;  1UCI A;  1YVS A;  5BU4 A;  2RBI A;  1B2X A;  2SAR A;  1HZ1 A;  1RN4 A;  2F5M A;  1FUT A;  3Q3F A;  3SYU A;  2C4B A;  1BRI A;  1UCJ A;  1B20 A;  1GMQ A;  1LOV A;  3D5G A;  1I0V A;  1JBS A;  1MGW A;  1I3F A;  1BOX A;  1IYY A;  2GSP A;  1BNI A;  1FZU A;  1BRN L;  2AAE A;  1TRQ A;  1A2P A;  1LOW A;  3D5I A;  3DGY A;  3WHO A;  1BU4 A;  1RCK A;  1BNF A;  1GOU A;  1I8V A;  1UCK A;  2RNT A;  1AQZ A;  1FW7 A;  3D4A A;  1BRG A;  1TRP A;  2AAD A;  1BNR A;  4HOH A;  3RNT A;  1B2S A;  1RGE A;  1RHL A;  1X1U A;  1B2M A;  1BSD A;  1B3S A;  1B2U A;  1BVI A;  1GMR A;  3AHS A;  1SAR A;  2HOH A;  5HOH A;  1BNS A;  2KF4 A;  1B21 A;  5RNT A;  1T2H A;  3BU4 A;  2F56 A;  1PYL A;  1C54 A;  1BSB A;  1RLS A;  5GSP A;  4RNT A;  4BIR A;  3AGN A;  1HYF A;  1RGL A;  1ZGX A;  1BNJ A;  1RSN A;  4J5G A;  1RGC A;  1RCL A;  1YGW A;  1MGR A;  2F5W A;  1BNG A;  1BSC A;  1I70 A;  1X1X A;  2KF3 A;  1G02 A;  1BAN A;  1JBT A;  1RDS A;  1X1W A;  6GSP A;  1BUJ A;  2KAA A;  3GSP A;  1FUS A;  1T2I A;  1BSE A;  1I2E A;  1TTO A;  1UCL A;  4GSP A;  1RNB A;  3WR2 A;  4HAA A;  1RGG A;  3AHW A;  3URP A;  1JBR A;  9RNT A;  1CH0 A;  1GOV A;  1BAO A;  1GOY A;  1Q9E A;  2BIR A;  3A5E A;  3AGO A;  4GHO A;  1BGS A;  2BU4 A;  3HOH A;  1I2G A;  1B2Z A;  1PY3 A;  1RGK A;  1RGA A;  1DET A;  1X1Y A;  7RNT A;  3KCH A;  1GMP A;  1I0X A;  3BIR A;  7GSP A;  2KF5 A;  1BRS A;  1R4Y A;  2F4Y A;  1RTU A;  1YNV X;  1I3I A;  1B27 A;  1RGF A;  1RMS A;  1LRA A;  2ZA4 A;  1BRK A;  3DH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...