3D5OF

Structural recognition and functional activation of fcrr by innate pentraxins
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Serum amyloid P-component
publication title Structural recognition and functional activation of FcgammaR by innate pentraxins.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d5oF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d5oF02
4OFIA 5JMOC 1TIUA 4U6TA 4W81A 4WEMB 1EZVX 3IS0X 4XMKH 2EKSA 1T1ZB 2NQCA 4HF5H 4JFYB 4GMSL 5ISZB 5C0IB 3MJ9A 1RK1A 1UEYA 3CX5J 3K1KC 3SDAA 3CZJA 2X05A 1I85A 4HC1H 2QSCH 1XGUA 1XCQA 3BWAA 4ODHH 4N68A 4U33A 1JNLH 3SDXB 1FZOB 3G6JF 4AG4L 4KK6C 9CGTA 4J3TA 4KUZL 1HKFA 5DJ6B 1WZKA 1XCTA 4Y2DD 4OFYD 4XWOD 4MHHG 4Z8FH 4QOKE 2X44D 3MMEB 2ORBL 4TN9A 5CJ5A 4XBPA 3RWHB 2ZZUT 4HKZB 3RP1A 2BVOA 1P6FA 5IFJB 3U4BL 1QFHA 5FV1L 4NJ9L 1WBXA 1KFAH 5JNYA 5HDOA 1FPTH 1RJZB 3EBAA 4PJDF 1X5LA 3MOQA 1ETZA 3C9NA 3J7HA 3V7MA 4P5MA 5DZOA 4KJYB 1AQKL 2BXZA 1YJDL 1MHPH 2EDNA 1CLCA 5TE7L 3RHWK 2GT9B 4JRYE 5I73B 4PJHA 3DGGA 1ZHLA 3LH2H 3N9GL 4AQ1B 5CHNB 3NZHL 4XPGL 1ORSB 5TJWK 5HVFB 1KNOB 4K9EH 1BLNA 1RMFH 3FQNA 4YDIH 1Z2KA 5HY9A 5GGSB 2AXGB 2NY5C 4F9LC 2OTPA 3FT3B 3R1GH 4CDHA 1MWAL 4YHKL 3VFPA 3RWDB 1W72L 2HLAB 3GNMH 5HVHC 3W0WD 1OP3H 3PQYD 5KW9L 4PJEF 1XR8A 3RWJB 1E6OH 1LE5B 5ICZA 4FHBD 4CMMA 1S5HB 2O5XH 2GJ6D 1WJ3A 2QQQA 4R97B 5BQ7A 1I8MB 1DUYA 1UWGL 3MRMA 4O51B 4X5WA 4O2FB 5IVOA 4NKDA 1JZ4A 1KN2H 4GLRH 3FB8B 5ID1B 2AK1L 4U3XA 4XC1L 5D71L 4MA7L 3MA7A 2QHRH 3QUMH 3QHTC 3PGCA 4TSBH 2J3SA 2VDKH 4Q2ZA 1YMMD 1U93B 3N1GC 2A6IA 3P9WB 1OAXH 1DE4B 1QFUL 4D9QD 3DUUB 1HHHB 4JZOB 5MHSE 3EYOB 4JEGB 1LEIA 1D9KC 3H0TA 4ORZC 3BPLB 3ARBB 5CD5C 4U1MB 2V5TA 3QEGH 2MWCA 4MJ6A 1OB1B 3BDYL 5ESAB 4RAHA 5CD3B 4HEME 4JFDE 3W81A 5JPNA 3DOSA 2G75A 4I9WD 3WFHA 2B2XH 4X9IA 4OCMC 1QTYT 3GSVB 4ETQB 2VLMD 1FJ1B 1P7QB 4ZFGH 4OGAD 3QA3A 4LCCC 3QDGE 4MNGE 2YZ1A 5TF0A 1YEFL 1IC1A 5C09B 1EEQA 3X3FH 5CZVH 3LIZH 4MXWL 3VFOA 1AY1L 5EO0A 2FYYB 4X5XB 4EDWH 1XR9B 3WXVL 3D39E 1ZA3A 2Z31C 3F58L 2BX5A 1QSEB 3VI3E 3MV8B 2N1KA 2ADFL 3SPVB 4UQ2B 5E08L 1ZT1B 1CZ8L 4XHJD 4HCRH 4IHOB 4ZPTA 5H37G 1K5NA 4PJ9B 3B4NA 4M8QB 1KN4H 4RFOH 4XMKL 5C0AD 2F54E 5E5MA 2P5ED 4HF5L 2H8PB 2ESVE 3VGDA 2ZUSA 3WLWD 5ERWB 1I8KB 4PRIB 4WFGE 2AJ3A 3PV6A 3S3SA 3TBVA 4HC1L 4Q9QH 4NO0D 2QSCL 3TVMA 1DL7H 4K7PY 1CTOA 4ZAKA 4ODHL 2KH2B 1JNLL 5EUKB 2AEQH 4XNQA 4P5TA 4ZO8A 2FBJH 3PP3K 2YRLA 4JRXB 3LZFH 1EUUA 4Y89A 1T0MB 3TBYB 2IQAB 4D9RD 5KAQG 3JSSA 2EDWA 2X4UB 1T22A 4Z8FL 1OLZA 3MRIA 1F13A 5TE6H 1EVTC 2JLLA 4R9HA 5EN2A 5J12B 4XNZB 3VGBA 4XNMA 1FNEB 1ZKAA 2J6EH 2P8PA 1KFAL 2AXHA 2FJHB 4JO1H 1SEBA 1IAIM 1XF5A 2YN3A 3BH8A 3D9AH 3LRSA 4JGMA 1FPTL 4JVUA 3UPRB 4M1CC 4LRNH 3ARFB 3ZKQD 1S7TB 2HT2C 3RAJH 3VXUA 5BV7C 1MHPL 2OQJB 5INCB 5JDJA 1CXHA 3EYQD 4LSDA 4PP1C 1LO2H 3TZVC 5E70A 4AK1A 1BD2B 1G6RH 3RWCB 4QNPF 2C1PB 3SKNB 4QWWC 3LH2L 3CLFH 1Z6JT 3O9WB 4WHCA 2X89A 3X3GH 4JY5H 2A1WH 2HT4D 2QV2A 1MCHA 2OX5A 4K9EL 4YE4H 2IAMA 5GS2D 1RMFL 4HBQA 3BP6A 1DBMH 1DVFB 4YDIL 4XCYA 4LSSH 3HAEG 2X2YA 4KDTA 3RHWF 4QY8B 5DDHA 1QR4A 3FB5B 3R1GL 4LMQE 4Z7UB 1IAOB 5GS2H 4XCCH 3B2UD 5JLZB 2ICWB 2XZCH 3M17A 3GNML 1WSST 5EZLB 3IDJB 2V7NA 5EOCH 1D5MA 4D0CB 5D1QC 1E6OL 2H9GB 5K9JH 5J1SC 2RB8A 3IF1B 1FAKT 2YD1A 2O5XL 4F7CA 5KSBE 1OTUC 1NPUA 1HK6A 1KN2L 5J6GA 3C09C 1DQQA 3QFDB 3BVNB 1FFPA 2QHRL 3QUML 1XF2A 2AQ3A 2VDKL 3I75B 3UJJH 3RVUD 4LHUB 2FGWH 1OAXL 5ACZA 5JORB 3P30H 1Z9SA 5DJAB 4EZMA 3OX8B 3P0YH 3RRQA 2F74A 3F7QA 4PJBF 3QEGL 3ELAT 2XQYK 3GSRA 2CIKB 4O00A 2VQ1B 2YC1A 3RL2B 4ODXA 4JZJC 1VADA 1MFNA 5DMGC 3ZDXE 1WF5A 2EDEA 4G8IA 4KFZC 2CR6A 1QBMH 1B0GA 2B2XL 1QBBA 1IMHC 4N9GA 3TH4T 3T2NH 4X6EA 3SDDC 4ZFGL 2NY6C 3GO1H 4N0FB 1VGEH 1SQ2N 2BNRD 2XTJB 4NQVA 1UQSB 1VEPA 3X3FL 5CZVL 3LIZL 1LP9E 4EDWL 4HUMB 4HIHA 3O8XC 1E28A 3S4SA 4EVNA 4NC1E 4YXLH 4I0PC 5CUSH 4Z77A 5TPWH 3IXTB 4UUJA 1F6AA 1TFHA 5HHVH 1EFXA 5H2BA 3U9UA 2YEZA 2BFVH 3RNQB 1VKXB 1RULH 2AK4A 3G5VB 4BH7B 4EXPX 1I1AB 4G8GE 4OV5B 4HCRL 5A2IH 4WFHD 2DB8A 4NKIH 3MGOA 4OUUB 4S1DD 2YA0A 4K3EH 4L9DA 4PRDB 1KN4L 2FEEI 4RFOL 4Y4KA 4FABH 2CXGA 1B4JH 3RWFA 3TPUA 5CIPA 4N0UE 3PWPD 1T1WA 2PTTA 2AJSH 4GW4B 1FSKC 5IMLB 5EWIH 4L8SB 4P2RA 4NO2B 4HFWA 2RFXB 4Q9QL 4NFBA 1DL7L 5EOQH 3O3DB 4LSUH 2AEQL 5D2NE 2FBJL 2NX5E 1KIQB 4CN1A 4HPOH 3LZFL 4Z0BH 1RZGB 4B0MM 5JOFB 3ROLB 2EO9A 4HIIA 2E7MA 4H8WH 3LDBC 1YC7A 2MHAB 5D6CB 1AP2B 5K93A 3RI5K 4Z7VA 3SGEI 5TE6L 4FQXC 4F9PC 4PRAB 5E94B 3X14B 2R1XA 3IDGA 5IKCA 2J6EL 3KPQA 4JO1L 3KPRA 4RGND 3D9AL 3FFCD 4PYHA 1SY6A 5EZJB 3DO7B 3QXWA 3HMXA 4LRNL 5FO8B 3OAZH 3RAJL 2DF3A 4MD0B 2VE6A 1A21A 3GMQB 4LLUB 2J8UE 4UOW1 1S9XA 1LO2L 2JE8A 5T1KA 5HHPB 5HYQB 1XMWA 4NNXB 4NRZA 1G6RL 3HZMB 3MV9D 3QNZA 3MREA 5E8OA 4BKLB 3CLFL 4U31A 3X3GL 1MQ8A 4JY5L 4YFLI 5MEPB 2A1WL 4NQEA 2XIDA 4PLJC 4YE4L 3ZTNH 1UWEH 2UWEA 3TIDA 1DBML 4X8JB 4HEPG 4LSSL 1SYVB 3H9SA 2YMXH 5T5NF 1URLA 1EO7A 5D7LE 3MLWH 4JHAH 4PTTA 4KK9C 3F12A 4XCCL 5HGBA 4G42A 2GITA 4IOFC 2XZCL 1IAII 2X70B 1T3FA 3NFPB 5B38B 5EOCL 3IXAA 1AHWC 5K9JL 2OBGA 5IB1B 2V6HA 3EOAA 4HV8B 2WIMA 1UYWH 4L4VA 1W0VA 2E9BA 2IBBA 4ZFZB 2X4TB 1IT9H 1RK0A 1A3QA 2JB6A 1CS6A 3FB7B 1R5VB 3NA4A 4XPHH 4JM2A 2YD2A 3WEXA 5JHDB 4PB9H 3QO1B 3WJJC 1N26A 3M1BA 4XVSH 3PWLA 1IJ9A 1FV1A 3UJJL 1NCAL 1GGUA 2FGWL 2BERA 1KGCD 3P30L 1CT8B 4FA8A 5MERB 3T0XA 3P0YL 4S0TD 1JGEB 5GGRY 2ARJQ 1P1ZB 4OCNC 1DQDH 1NAKH 5KSUB 4K71C 3TESA 1U8LA 1NGWB 5D7JC 1BAFH 5CCKH 4PRHA 1J8HB 4U1IB 2VZOA 2V9QA 2EIEA 3KPOB 1U3HD 3BAEH 1HCFX 1QBML 2YZ8A 4Y0GA 2BCKA 2VLRA 4E5XB 1P4LA 1NFDF 3FN3A 1QR1A 3MA9H 3P2TA 3T2NL 1RY7B 3JWOL 3HRZA 3GO1L 1T80A 4OCRL 1VGEL 3B9KD 1S7SA 2CUMA 3QNYB 5IB2B 1L6XA 3CFBA 5JZ7D 2F19H 4ZS7H 3HS0A 3RQ3A 2FO4A 4LCIH 4ONOA 4Y5YB 1P4IH 4J6RH 3O2WH 4P49A 4PJXE 4YXLL 5IW1A 3KVQA 3UPAA 2NY2D 1I1RA 5TPWL 3MUHL 3U46B 5HHVL 1WZLA 1X5GA 5DJXB 2BFVL 3GM0A 3X11A 1RULL 3BGFB 1VHPA 5CEYA 3Q5TA 3S5LB 5BZDB 5IVXF 3IU3A 4UNTA 4NKIL 1EA9C 3SY0B 5KSAD 3BUYA 2IG2H 3FFDB 4K3EL 2JJSA 5AWNL 4FABL 1B4JL 5DYOB 5L8JB 1U58B 1C1EH 1J0JA 3HR5B 2AJSL 5ACMA 3L3DB 1WGOA 5EWIL 1RIVH 3OTTA 4LVNC 3JWDC 4U05A 1OCWH 5D1XB 4NDMB 2BSED 3GGWA 5DI8A 5EOQL 3SJVA 3EO9H 4WW2F 4LSUL 5L9DH 1BPVA 4S2SB 4GUPB 4HPOL 5IMKB 2DQFA 4W4OA 1A4JA 1S9VB 1LO0H 1U3JA 4FXKA 2WWMC 4H8WL 1UM5H 3QDMA 35C8H 4QTHB 2VOTA 4N8PA 4MZ2A 5EO1A 3ETBF 1ZANH 4OZIE 4MD4B 4XCNB 5AEAA 1CXIA 2DYPA 4L3CA 2EIDA 5CS7A 4MVBD 4DN3H 4I18B 1NCTA 4KJYA 3QUXD 4NNPH 1NBZA 2BVPB 1MVUA 3QAZC 3SOBH 2PW1B 4PV8B 5HHOA 5BS0D 2DQIH 3V6FB 1OGAE 3CIQA 5EU7E 4X7EC 1Q38A 3VXTA 4DGVH 1JNHB 1CVSC 2IADB 4FG6D 5IBUG 3T3ME 4IIQA 5HYJB 2W92A 4X9BA 1KLUA 5D2NC 3KWWA 4JQXC 3S35X 3GSUB 3G6AA 4TNVK 5E9DD 4MCYB 3ZTNL 1UWEL 3O2DA 1N6UA 3P0GB 4OCXH 2BSTA 3QZWG 2C3VA 3OJMB 3L5WA 2YMXL 3IRPX 5LGHH 3MLWL 4JHAL 3FN9A 5ADPH 4K94H 5ESQA 4F37K 2E7LA 1BVKB 1NUNB 3KXFB 5D7IF 4CMHC 1T83C 3T2QA 3DI3B 4YIQB 5GRUH 4GAYB 3OKOB 4L3AA 3RGVD 3P4MB 1TZHA 4P2YA 1U8KB 4AEIH 4PG2C 3QJHB 4OGYH 4G6MH 2H32A 2V2TB 2OL3H 5DQDH 4GBXD 4QCIB 1UYWL 5T1MB 4CU7A 1IT9L 5DK3A 3MBEB 5J3HC 4JY4B 1FORH 4XXDB 4EUPB 1DE4A 4PB9L 4V1DA 4WO4A 3RPIB 3TN0C 3UYRH 4XVSL 1I7ZA 2P8LA 1C12B 1U8NA 2A73B 4H1LH 3CXDH 3LQZB 1YMHA 3ARXA 4CW1A 2BSSB 4X6CE 3ISWA 3U0TB 3ULUF 5I1IH 3BKMH 3IJYB 3WUWA 4OF5A 1C5CH 1QP1A 2UUDK 3FB6A 3G04B 1MHHB 1DQDL 1NAKL 2NNAA 1U95A 3ES6B 4EIZC 4CUCA 1BAFL 1IZJA 5CCKL 1F45A 5GSRB 1W8OA 3GSVA 3OKEA 4WU5A 5F7KC 2A6KB 3BAEL 4KV5E 3QWRD 3OXSA 1LE9A 4LLVB 5ICXB 2X4SB 3EZJB 3MA9L 4ZQKA 4W6XB 3F6LA 3L5HA 3SDCA 1WFOA 1QEWA 5GRWA 3WJLA 2F19L 4ZS7L 2F53E 1J1PH 3ZMRA 4YXHH 5LGKA 5SWSA 4LCIL 4NN5C 1P4IL 2IPUG 4J6RL 2WANA 1G7MB 1GH7A 3O2WL 3LRGA 2RAMA 2UYLB 4U1HA 3LKNA 2EYRB 1UADC 1YEJH 4YO0B 4UT7H 4E41B 2GY5A 2MFNA 1A1NB 1T5XB 3QJFB 1CGYA 4P9HH 1H3XA 3VXSB 2DWDB 2IG2L 4R7NB 1AKJB 1F3DH 2H8PA 3DRQB 3NACH 4PRBB 3D48R 5I30L 4MAYD 1P84K 2C3WA 1C1EL 4BH8A 4ORGA 1K85A 4DCQB 3MUZ1 1BJ8A 1RIVL 4QLRA 5IWLC 1MCRA 5AYUH 4HDIA 1OCWL 4MSWB 1OT2A 1CD0A 4J3VA 3ZHDA 5DSCB 3EO9L 3VFTB 5L9DL 5BW7C 3OZ9H 1S7VB 5L0QC 5F1IA 1NEZA 2D7OA 1FVDA 1LO0L 2FBOJ 3LAFA 3KLSA 4PGDA 1FL6A 3D1MC 2HVJB 1M7DA 1HHIB 4HSQA 4OCWH 5F89B 1UM5L 35C8L 4JO2H 2NTSP 1MI5A 4FFZH 4E9LA 1YQVH 3VXPA 4CNIA 4L9LC 3A6CH 3MUJA 4BYHA 1ZANL 1WWCA 3PDGA 3S34H 3DSFH 4LPTA 2BNUB 4OZGE 3VXMA 3OPZH 4DN3L 5A3ID 4NNPL 3RDTC 1F90H 3SOBL 3HMWH 1A6WH 3VGAC 1S7XB 5IB3B 2EDBA 1T03H 4UI2A 2DQIL 4UV7H 3QT2A 4L4TA 3CDYA 1BFOA 3DJ9A 1H5BC 2GHWB 1KUMA 3MRHA 4BQCA 1FNHA 2VC2H 4DGVL 2PXYA 1T89C 4MDIB 5MEOA 4ODSH 3ZDZF 4DN4H 5J4MA 4XHQA 4OZFA 3IT8D 4PJHF 2HJLA 3FOMB 1WV7T 4NKMA 5DTFA 2MJWA 1OP5K 1TZIA 4HGWA 2OZ4A 1OSZB 1U9KA 4OCXL 2F5BH 2DKSA 2FNBA 4KZDH 3LRHA 43C9B 3U7YH 5KANG 4D3CH 5LGHL 5ADPL 3IYLW 3DECA 5MEND 1UVQA 3HC4H 3MLTA 1ND0A 4K94L 4XCFH 2AJVH 1BF2A 2DIJA 5GRUL 5FYJD 2DM3A 4L8CA 2YPKB 1XIWB 4AEIL 5JXEA 3BW9B 3MXWH 3NPZB 4KQ3H 4G6ML 4OGYL 4YDVA 2OL3L 1UZ8A 5DQDL 3WNPA 1QO3B 5FYJH 2LAAA 5EU7C 1MCBA 1VENA 5DFVC 1ZMYA 3MRJA 1K9TA 2EDQA 3NBNA 3BZEB 5I9QC 1K8IB 2XI9A 4NFCA 1PKOA 1FORL 5DHYB 5A1AA 3UYRL 4LVHB 5JORA 3GSWA 3RY4A 5ILTH 5EIQA 3D6GA 3CXDL 1EK3A 4ELME 5EUOE 5I1IL 2CIKA 1C5CL 1J12A 4WEBH 1GGTA 1PKQA 3UXFA 4P0DA 1S7UA 2AEWA 4BQ8A 3LPWA 4XCEB 1FL3B 4Z78B 1X4YA 3W0WE 1YJDC 3SN6N 4UNUA 3PQYE 3O6FC 4WDIA 3T2OA 5L2KA 5DF0A 5JW4N 1SJXA 3QI9B 5FYLD 5CLWA 2Q7YA 2MCPH 4XB7A 2GJ6E 2Q7NA 3VFSA 2GTWB 1UQSA 1JTTA 4U6HA 3ARBD 5FYLH 4YHIB 4OB5H 1S78C 5E4EC 4YQXH 1J1PL 1MCDA 4XRCB 3IXTA 4YXHL 1RHHB 1YMME 1BECA 4QRRB 5IBLD 1VFBA 4D9QE 2D0GA 3DROB 5KVFH 1N5YH 1YEJL 2WP3O 1P7QD 4KK8C 4UT7L 2ZNWA 3EO0B 2BP3A 1DEDA 3S9DB 4GOSA 4Y4FB 1G7IA 4P9HL 3ZDYF 2VZ3A 5J1AA 3MCKB 5C09D 3PDOB 4X0KA 2NZ9D 5GZOC 3U82B 3D2UB 5FM4A 3U30C 3WHE1 3NACL 4I9WE 1WAAE 2QSVA 2MOVA 2VLME 3OKDB 2FZ3A 5CZXC 1QSED 1RI8A 1ZVSB 1CLZH 3O3DA 2EECA 4QRUB 1PX3A 3IETB 5AYUL 1INQB 4W6YB 4C4KT 4YGVA 4F7PB 4PJ9D 3OZ9L 4JAMB 3E3QC 3REWA 1FVEA 5IT2H 3ZE1F 1K6QH 1A7PH 4LGRB 2I9LB 4OCWL 2NY1B 4JY6B 5I74C 3OKMB 2ZUVA 3G5XB 4JO2L 2VLLB 4WUKH 4FFZL 2R29H 4KKCD 4P2OD 1INEH 4PRID 1YQVL 3A6CL 1I8IB 4WTZG 1FG2A 2VMFA 1OQXA 1ZGLP 5C0AE 3S34L 3QQ4B 3RUGB 3DSFL 3H9ZA 5AAWA 3OPZL 2P5EE 5KS9B 1DLHA 3V5KB 3RZCB 1F90L 3HMWL 1A6WL 1NJ9B 15C8H 4OD2A 1M05B 1T03L 2C3XA 3BXNA 2V5SA 3EYFA 1MFCH 4UV7L 3DMMC 2NY0C 2GUOA 4UQ3A 3HZMA 4KK5D 4X98A 1KG0A 1FO0B 2VC2L 3ME0A 4U1SA 4ODSL 4Y5XC 3TNNA 4WV1C 3LY6A 5H8DA 4DN4L 5FUCC 4OZHE 3T77A 5MEPA 3F7YA 5DRWA 1HQRA 4RAUA 5T1DH 3V5DA 4D0BB 5EPMB 4JDVA 4D9RE 2H6PB 1MCWM 3TP4A 3QG6B 1IKFL 3B3IB 2F5BL 1NKOA 1JRHI 5ESVA 4X9GA 1WCBA 1A2YA 4KZDL 1P84J 4I48B 3U7YL 4D3CL 5BXFB 5K9QG 1U92B 3HC4L 1I1YB 4XCFL 2AJVL 3O4OB 1BD2D 4QXTB 1L9NA 1LEGA 2L4OA 3O9WD 4GW5B 3MXWL 4KQ3L 1XFPA 4ZMAT 4OT1H 4NNYA 2GIYA 3IB4A 1DVFD 3BQUB 4LKXA 4ZOAA 5DXWA 5E5RB 5FYJL 4JKMA 1DUZB 1N6VA 3UBXG 1HSAA 5CGTA 1P53A 3FOLA 3ZLQC 5CJOH 5FGBA 5CLTA 5B8CB 2VXTH 1J0IA 1AD9B 3K1DA 4DKEH 4QO1A 5ILTL 4NQDB 1YECL 2HMID 3QXUA 4Y2DC 3RJDA 4H1LG 4RQQA 3DXAB 4WEBL 5DJZA 2CDFB 3BIBX 2ERJC 5FK9A 5AUMA 2ZUQB 3VD9A 5DEFB 3WIHH 4RNRA 2A74A 3MNWA 1QRNB 4UV4H 3FO2B 4G43A 4EI5D 4LHUD 2MCPL 3L5JA 3QNYA 4XB8A 3GHEH 4KXZI 3RL1A 2GSIA 5L6YH 5FYLL 4I3GA 5F9WC 4OB5L 1MFDH 2D0HA 4JVPA 4LFHD 1MCOH 4YQXL 4HZLB 3VWJC 1HE7A 3L3HA 3U46A 3D69B 1IQWH 1KIRA 5DJXA 1PEZA 3HE6B 4ZUWA 4WHYH 1N5YL 1MELA 1CICB 1YPZE 3EYVA 5CMAA 5IP4A 3TGXA 1CDIA 4X6DE 4F7TB 4M00A 1QHPA 1ZA6A 3PP4H 1U58A 1AQDA 1FIEA 5SWZD 4X8XA 1C5BH 1QACA 5LAXB 2BDNH 1IGTA 3GI8H 2W0FA 4N0RA 4M5YH 1LO5B 4KZEH 1VFOA 3BHBB 3OJDA 1QD0A 2BNRE 1CLZL 5I8CB 5FYJU 3BH9A 4TQEH 1KPRB 2IH1B 3MUGB 4MJ4A 3EYUH 1EEZA 1MJUH 2XACC 3EFDH 2XRAH 1F3JB 5IT2L 5F7EH 4DUWA 4CGTA 1K6QL 1A7PL 3B43A 4U1NA 1YNTA 2WAHA 1F6FB 4WUKL 2R29L 5DMKB 1INEL 1VCAA 4NYLB 4WFHE 3DV4A 4Z7VF 2BOBA 1FIGH 3PWNB 4KKLD 1TQBB 3TFKD 1IL1B 2EXWD 2P43B 4R4FH 1O0VA 4H5SB 3PWPE 4OF8A 1AE6H 3ORJA 15C8L 1OGTB 1JNHA 4IBLT 4OGAC 4FQCH 1MFCL 2EDDA 2L7UA 4KRPB 3QEQA 1AXSB 4QHKI 1FFNB 3O81A 5FUZH 3MR9A 1ES0A 5DRXA 3O11A 1PQZA 1EPFA 5IM7B 1OM3H 5T1DL 5FYKD 3DVIA 4OIIH 3IVKB 5HGHB 4XAWH 4CAGA 3AM8C 2LU3A 2Y1VA 3THMH 2D2OA 3IAPA 4NPYB 4YBQD 5KS9F 4E0RA 1P9MC 5FYKH 43CAB 2QADD 1JMZA 4YIQA 3I02A 5LVEA 4PJGA 4KGJA 5GPRA 1G9MH 4RGNE 3FFCE 1NANI 1J05B 3MX0A 5SX5K 1UJ3B 2ADJB 3G5YB 1MCLA 4IRSA 4OT1L 4Y16C 2X4QA 4KDWA 4RBPH 2W9LA 3BI9X 5I17B 2ATPB 1WK0A 5ICYA 5DJDA 3P77A 1BBDH 3RFZC 3VFRB 3CSYB 2HP4A 3O45A 4TUOB 5CJOL 3MV9E 5DHVH 2VXTL 4JFQA 3NZ8A 4UAOC 4DKEL 3BPNC 4PGCA 3ULUD 2OR8A 4JRWA 5CBAB 1B90A 4ERSH 4XWGH 2GQHA 2R9HD 1NGXB 3QDJA 5CWSB 1R5IA 1FVCA 5CP3A 3ULUH 1AI1H 2Z8SA 3HUJB 4U1LB 1KB9K 4IRJA 2CKBH 1DSFH 3AS2A 1AGFB 2I9TB 4P4RB 1KJ2A 5JHDD 3WIHL 4DVBA 2XWBA 1G7HA 4UV4L 1HQ4A 4POZC 4Y5VC 5C07D 2C4XA 5FV2A 1R6VA 3GHEL 4S0SD 3JBG7 1CI5A 1JPGB 4Z9KB 5L6YL 5D5MB 5LJYH 3T8XB 1XZ0A 4EN3A 1MCOL 4R7DB 3T0EA 2UYLA 3FTGA 4J3UA 3RKDD 1IQWL 3I6KA 3HPLB 3W39B 4U1GB 4D0DB 1KGCE 3PGDB 4E41A 4OZ4A 1U8JA 2DTSA 4ODUB 3LD8B 4QTIH 3M8OH 1QQDA 4PJ7A 4H20H 5J11C 5T1LB 3CPLB 4XXCC 1ADQA 5IEHA 3PP4L 3B2UC 2D9QB 2CH8A 2AJZB 3ECBB 1C5BL 4Z7NF 2BDNL 4Z7OE 3GI8L 3HG1B 4ZYKB 3PE9A 4I13B 4MNQA 4GG6B 4M5YL 3SDAD 4KZEL 4MSWA 2BZDA 1ED3A 1HDMA 5GGRA 3SKUD 3D5OF 4TQEL 2VL5B 5AD0A 2BHZA 2ZUWA 3AB0C 3EYUL 1CWVA 1X5IA 3RU8H 1MJUL 1U36A 4GRWE 4PLOB 5A16B 3EFDL 2XRAL 2E6JA 1CCZA 2FWOB 1CD9B 3RVUC 5F7EL 5CGYD 4R0LA 5TQ0H 4LIQH 3O4LB 2ICES 2GJZB 4NT6B 4P23A 1J10A 4KROD 2ED7A 2XQBH 5IK3B 4R26H 4DZ8B 4MNGB 1P5UA 3RTQB 3P4OA 3DURA 1FIGL 3KLHC 3BO8A 5D1XD 4WI7A 3TO2B 4M61B 2XPGB 4N5UA 5C0DA 2A9MH 4R4FL 4DVRH 3DUSA 4EI6A 2CDGB 3U4EA 3DUHA 4Y1AE 5C0CA 1AE6L 4PJFA 2W9EH 2BY2A 3JTTB 1X44A 4FQCL 5GRZA 3KPMB 3G6JE 2VUOA 4FZEL 2CIIB 2C5DC 5FUZL 3AXLB 1JWMB 4NM8H 5FO7A 1OM3L 4OIIL 2B8OT 4NN6B 3VFWA 4XAWL 2F54B 2KUTA 4P46A 3IDMB 3T0BA 4HK0B 3THML 4EIGB 2WBJC 1LK2A 4GMTH 2W60B 2Y5TA 3OAYK 2X41A 5FYKL 2QR0A 3OXRA 3IU4H 1QBLH 3ARGB 4QRTA 4N1EA 3VFVB 2NLJA 1G9ML 2ZOLB 4PLKC 4PJDE 4APQC 5HYJD 2LV4A 5TDNB 3D87B 1JN6A 5F9OH 4F3FB 2EIBA 3PUCA 5BS0E 4JGJA 5T5NG 4QT5A 4U6VH 4GQPH 2NW3B 5FHBH 4LSTH 1IEAB 1CD1B 2BY3A 5HI5D 1BIIA 1BBDL 1IAKA 4H8WC 2OTUA 1JGVH 1U8MB 1KTRL 3FRUA 3KXFD 3NPSC 4Z7QF 5E9DE 1GOGA 2C7UA 4TUJA 3S3JA 3H9HB 4ERSL 1T4KA 4XWGL 4YUEH 3HRPA 4ONHA 3VA2C 3VG9C 3TIEB 1FC1A 2H26A 3ULUL 1AI1L 2BHUA 1J88A 4HKBB 3OGCB 1Q9OB 3O3BA 4HXAH 4PGBB 4QRPA 5FA3B 2CPCA 2OLDA 3VGGA 2CKBL 1DSFL 4PJEE 5I76A 3W9EB 1HOCB 1ITCA 4KKAD 4YPGB 1OY3B 1GGBH 4R4BB 3DVGB 1FP5A 5I1AB 4M7LH 1U8QA 1QRKA 4PTUA 3BWUC 2ZCLH 1G7LA 2EDXA 5J9PB 3UEZA 2UUDH 1KLFA 1V3KA 5IIEA 1JTOA 1Q0XH 2ZPKH 3VH8A 2YOCA 3HUJF 5GGUA 4LHUG 4RA3A 2GCYA 4RX4D 4FTVB 3AUVA 5E24E 3MNVA 2ZG3A 2FR4B 4FMKA 1LDSA 4QTIL 3M8OL 4LFHG 4WHYG 1G7JB 4H20L 5FYKU 5JXAH 5KSBB 5HJ3B 4Z76B 4MA3A 1JK8A 3EGSB 1JPFB 1WIPA 3GSQB 1NCUA 2Z91A 2MMXA 5D5MF 4Z7WA 1PEWA 1RUKH 2VAAB 5EBLB 4MDJB 1JHTA 3C5ZB 4AEHH 1MJJA 4BFEA 2FX7H 1QVOA 4P48A 1QFWH 3D0LB 5C08D 3TVMD 4ZAKD 2KBGA 4XTRD 3QEUB 1Z0NA 4P5TD 3RU8L 3LKPA 1XF4B 4HKXA 1QPPA 5IR1A 3L1OH 1MFAH 4S1RH 1NMCC 4YNYA 1AGBA 3VWKD 5TQ0L 4LIQL 4POUB 1KB9J 4MJID 4EOWH 4UTAH 3WCYA 4G9DB 4R26L 4GG6F 4HJ0D 3BIAX 3UTSB 2ZSVB 1QLFB 5DUMH 1I8LC 4M9PA 4W70A 3ZYJA 1LP9B 2IBGA 4ZDHA 4DVRL 1BBJA 5HVWA 2X7LB 4PJ8C 3VFMA 4K7PX 5IQ7H 2W9EL 3TF7C 2DKUA 1RZIB 5EU6B 1M7IB 5ACLA 5I6XC 3JV6A 4Y8DC 2E6PA 3AAZB 1T0NB 3F7RA 5TH2B 4FQQA 4G8GB 4P4KB 3U0PA 4MZ3A 3X12A 3AC0A 3H2WA 4NM8L 1BJ1J 3VRJA 2X89D 4WWKC 2VABA 2COQA 2IAMD 1N3NA 1E0OB 4XVUD 3O2VH 4N0UB 3DX8B 1N5AA 4GMTL 1CQYA 4RWHA 3IU4L 4MX7B 1QBLL 5F9AC 5SV4A 5FECB 4ZFOB 2ADGB 5KJRH 2ZKHH 1BM3H 3MV7A 5KSAC 3SDXE 3VJ6B 1TENA 5KG9B 3FN0H 5F9OL 1J0HA 3GHBH 2NX5B 2XWJB 4C4KO 3VE0A 4AH2B 2Y06H 2ENSA 4YR6A 4F9LA 4U6VL 4DFIA 1OD9A 5FHBL 1MIMH 4G80B 4LSTL 4QNPE 1BOGB 4XP5H 4RFEA 5HGGS 4K2UH 4PBVC 1JGVL 3WIIH 3LVEA 4YHNB 1Q8MA 4XVTH 4NQTA 4HUWB 4YUEL 4M3JA 1QA9B 2VYRE 5ANMB 3VG0H 3VXQB 5IGXH 3NIGF 4YHPB 2HFTA 5J13C 1EEYA 5HPMA 2VIRB 3AS1A 4U3CA 5MENE 4LLDA 1FYTA 4HXAL 5FYJE 4LCWB 1IILE 1OWWA 1D6EB 4LLWA 2MNUA 1RJCA 1D9KA 1GGBL 2YWZA 5CEXB 3MBXH 4WI9A 3NIDF 2LFGA 1UWXH 1ZHNB 4M7LL 5FOBB 1IM9B 2ZCLL 5E6IB 2AGJH 4UT9H 2FSEB 5D9SB 1MAMH 4YFLF 1Q0XL 5ENWA 2ZPKL 2L0DA 1F11B 3HE6A 5HHQA 1I3RA 3TA3B 1A4KB 1M7XA 3WDHA 5IVNA 2IANA 4LCCA 1EFXD 2RJMA 4QHNB 4AENB 4PJBE 4K94C 2AK4D 5E1HB 1LVEA 3A0OA 2IPTH 3KHOA 4OCSH 1CGVA 1CLYH 5JXAL 3JWNC 3AREC 1FFOB 1IEBA 1CG9A 3GSOB 1XEDA 2Z31A 4IOIB 4MD5A 3ROOA 3KJ4C 4Y4KD 5E7FA 1BFVH 5FYLE 1AC6A 2CSPA 4LVOB 1RUKL 4QRRD 3RGVC 3PIQB 5F3BB 4RFNB 3UTTA 3DVNB 4AEHL 1Q1JH 3PNWB 2BSRB 3KPLB 4Y19B 5D70H 1QFWL 1FC2D 1SJEA 4MAUH 1TQCB 3UAJC 1RAMA 1T7YA 2H2SD 2GYSA 5BVJB 5E0QA 3SKMA 4Y4FD 2P4AB 1F3JA 4U6YA 3WO3B 2AS5M 2BRRH 3L1OL 4G9FA 1E6JL 1MFAL 1Y18A 1EVUA 3VD4A 2ITCB 3NN8A 3F7VB 4NZTH 4LNRA 3WLBB 4GKSA 4EOWL 4UTAL 3S5LG 1F97A 1ONQB 4JLRA 5EORH 5HSFA 3PWUA 5EFIA 1Y6NR 2A0LC 5HHMB 5C09E 4G6KH 5DUML 1FNGB 1I7RA 2X4PB 3ZT6A 1II4E 3MYJB 3KPRD 2P5WB 3GMOB 5I8EB 1O7SA 4NRYA 1NC2B 4PJXB 4UU9A 1QSEE 5IQ7L 3HPJA 5AG9A 4HS6B 2F15A 2R2BA 1JJUA 2CLRA 4Y4HC 3V52H 4JPKH 4ZUTB 3MGTB 4F15C 2HG5A 5T1KD 5F97E 1EUTA 4AIZA 1WWAX 1G0YR 3WDIA 5BRZA 2VL4A 43CAA 4DGYH 3SGKA 2BVQA 3O2VL 5IMOB 4PRIE 2ED8A 3ULSB 3O41B 4X4XB 2HFGH 3L95A 2E8YA 4PGJA 5KJRL 1D5XB 2Q3AA 2ZKHL 1BM3L 2EDOA 4JFFB 2HAZA 3FN0L 5E95B 5E6YA 3GHBL 3MRNA 1GZPB 1EHAA 2ATPA 4ZUSB 1FO0H 2Y06L 4QOKA 2E7HA 5I1DA 5ALCH 2FJGB 5A43C 1AFVH 5E2JA 2X6MA 2R0ZH 1MIML 5EBWB 4X6BA 4GS7C 4XP5L 5IB5A 4K2UL 2YBRA 1RZ8A 1FG9C 1CL7I 3EKCA 4HJGB 3IDYB 5D1QA 3WIIL 1CDHA 1LEKA 4DJMA 4XVTL 3ULVF 3VG0L 5IGXL 2JTDA 2R23B 4FQHA 5MP6H 3BQUD 5BVPH 4JRYA 1BQUA 1A9EA 1WEJH 3T65A 3CVIH 1BD2E 1D5ZB 5DQJA 5E1AB 1KIPA 2ZJSH 4YHMH 3DETD 3I3DA 4NQDD 3EJJX 1X7QA 3RWGB 3MBXL 3B6SB 3UTQB 4UIMA 2AGJL 1ZSDB 4UT9L 4F33B 4JZJA 4J1UB 1MAML 4FXGB 4WJ5B 3VFNA 3SO3B 4TTGA 2W0PA 5C0JB 3CCHB 1GIGH 3PJSA 3E6HB 3P11H 4RZCB 3ZTJH 3ZT5A 1YN6A 2QQKL 2XA3A 4LPUA 3SDDA 1KB5A 3F7PC 4XX1G 4Z5RB 4JANA 2CUHA 3QNXA 5F88A 2UY6A 2E3VA 3FONA 2IPTL 3UYOD 5J6HB 4OCSL 2NMSA 3SEPA 1CLYL 1BREA 4LCUA 2DS4A 4NUJB 2VZTA 4NZRH 3BRFA 3O8XA 3GMMB 4I0PA 2WSKA 4O2CA 1NFDE 3QULA 4IJ3C 1BFVL 3BP5A 1X5HA 3TCLB 1Q1JL 4X6CB 1FGNH 5D70L 1PBYA 1CICD 4MAUL 1DDHB 4QKXB 3SJVD 5DQ9B 1B2WH 4OTXH 1VDGA 4JFDA 1HXMB 2BRRL 5FDYA 4HIJA 1Y0LA 3TO4B 1B88A 4NQUA 1EHNA 4Q9RH 1AGDA 3IJHB 2NXYB 4I4WA 5D2LB 3QDGA 2E7LC 3DV6B 3QQ9D 4NZTL 3HHRB 5IVXE 1W0YT 3H3PH 4OD1H 3FJTA 5EORL 4L8DA 3TO2A 2QKIA 1I9EA 4G6KL 5SWZE 5DR5H 3D39A 3VRLF 3H9YA 3D3VA 4U3HA 1Q9WA 4Q6YA 4WU7B 4JFOB 5ELIA 1D5BA 3WIFB 1XGRB 4KDVA 4MWFA 2H45A 2QQNH 5HHOD 3RWIB 4JN2B 4FQXA 2HVKB 3MCLH 5CJXC 3WO4B 4F9PA 1PZUB 5L88H 4LP5A 2YD9A 3BPLC 1HIMH 3ARBC 4FOMA 3RX8A 3V52L 1PZ5A 2OXGA 3IAQA 4JPKL 1QSFA 2Q86A 1U3ZA 2GK0A 4J23A 4N5EC 2W65A 4O4YH 2XN9A 1EFQA 3D85B 1ZGLM 3BP4A 1KT2B 4NO5A 3W11D 5IBLC 1F02I 2ESVA 5L8LB 1RFDH 4DGYL 2IBZY 3C8KB 2YUZA 3DLQR 5H35B 2AJYH 2NY4B 2P7TA 5DJCB 2ZUUA 2HFGL 3JXAA 5JOEA 3VXNB 3O2DH 1QLRB 4PJGF 3GMLA 3ILPB 5IOPB 5F3HA 2G2RA 3R0MA 2WINB 1FO0L 5ITFB 3CH1A 4OI8A 2ZWLT 4R4NC 5ALCL 4FN0A 1T04B 1AFVL 2R0ZL 3QR2A 3L3GB 4CN6A 1FN4A 1PG7X 4U2ZA 5JHLH 3REVB 3Q6FB 5IB4B 5IESH 3CFJA 3GB7B 4PJ9C 1VA9A 5FYKE 4G8EB 4OZGB 3KNBB 3IFOA 5GZND 3X13A 5SX5H 5C3TA 2Q20A 4JE4B 4HS3B 4KKCC 4PP2A 5TE4H 1A6AA 1U0QA 1CYGA 4D94A 5MP6L 2ZSWB 3ARDB 5D7IE 5BVPL 3WJJA 1WEJL 1YEDB 1F2QA 4PREB 3CVIL 2HTLD 3KYKH 1EBAA 1HHKA 4OLYH 3EYSH 1MHCB 4JFHD 1F4AA 4KKBD 3O3UN 4BSVB 3GUTA 2ZJSL 4YHML 1CFBA 3FZUC 3PHQA 3LKRB 1JL8A 5LG1A 2CDEA 2AKRA 4HZAA 3SDCD 2GFBB 5D7JA 2NXZC 4KK5C 4XZUB 3GMNB 3KDMA 3RVXD 1H15A 4JJ5A 1GIGL 5J12C 4XNZC 1HYSC 3P11L 3E6FB 3Q6GH 3TEUA 3IKKA 3ULUE 4ZSOB 3U7WH 1WFNA 5EH1A 3HZVB 5IBTH 4ZXBB 2IMNA 4Z76A 1NDGB 3ARFC 1AD0A 3FAWA 5I1LA 3Q1SH 2B20A 4XBGB 2Y7QB 2BC4A 4UB0H 4NZRL 1KPVB 3C6SA 1XGPB 5T5FH 3VRIA 1AH1A 3L9RB 2FIKA 3DYMA 5JHDE 4LP4A 3OQ3B 3LKOB 4FFVD 2VDMH 3PWVA 1DJSA 5DVMA 5C07E 3O9WC 1D3CA 3WNNA 5EBMB 1DVFC 1FGNL 2DQCL 2LU7A 1JWUB 1RURH 4NZDA 3V2AR 1EHLH 1B2WL 4OTXL 3VMOA 1J11A 4UNVA 4Q9RL 1KCKA 2FCBA 5B4MC 1B0WA 4YJZL 3QRFM 1PJ9A 2Y36H 3HG1D 1MI5D 3I9GH 4M4RA 1J9CT 1HILB 4UIKH 3H3PL 4LGSB 4K8RH 4OD1L 3QHFH 4G6AD 3RX7A 2UZYB 4P5KB 4N0YH 1X5YA 1LP9A 3AROA 5I0DA 4WI6A 4X6FA 5DR5L 3IGAB 1MCIA 4EDXA 5IJVB 3HI1A 3PL6A 3FQXA 2Q1EA 2P24A 4H25B 5I71B 2I27N 2QQNL 4L4TD 3FO9B 5CKGA 5DJ2A 3MCLL 3O4LD 4G8GA 1DQJB 4PJFF 5L88L 3MRKB 4R6UA 2YHGA 5D2LF 1HIML 2B1HH 2AQ1A 1HINH 1A9BA 4LIQE 4D8PA 3G5ZA 1V3JA 1CFTA 3CJJA 3QUYB 4O4YL 4OCLC 3CFCH 5IEKA 4N0UA 1ACZA 1JYVA 2HJFB 3HI6H 2HT3C 1RFDL 4LLQA 1FLRH 3D0VB 5F7UA 1GAFH 2AJYL 1ZWIA 5C0EA 1A3RH 4C58B 2NY3C 3L3OB 2VZ1A 2XTJC 4RIRA 2DQUH 5D2NA 3O2DL 2OZ4H 1T1XA 1M4KA 3RIAF 3CXHK 1KEMH 1BZ9B 3CC5B 3L5IA 3JUYA 5DLMH 3KAAA 5JXED 5TGBA 2NR6D 3GRWH 3V8CA 3KR3H 4MCZA 3ZDZE 1X5JA 2JIXA 2FD6H 4XP4H 1XGTA 1I1AC 5C0RH 3CUPB 3H7BB 1T83A 1IKNC 3ABZA 1A7OH 2O61B 1ZLWK 4K23H 3WL9A 5IESL 3ARGD 1S8DB 2Z0BA 3JV4B 1N8ZB 4HGKC 5GS3A 4JZNA 4Q7DA 3KYMB 2P5EB 2R2EB 2VB5A 4KRMB 3BFOA 1I1FA 3SGEH 3MLYH 2J8UA 1X4ZA 5TE4L 4HUUA 4GLRI 1FL5A 3VDCA 3TN0A 4OQTH 1KF9B 5CBEB 4KKLC 3IFNH 1MUJA 3MRDB 5HYJE 3KYKL 5F7NC 4OLYL 3EYSL 4OZHB 1U2HA 5DJ8A 3QXDA 2GTZA 1LWRA 2V2WA 4L8BA 5EU3A 2PW2B 2K9UA 2MQ3A 4F7EB 1T1YB 3NAAH 3N50A 3BGAA 5E2TH 5D7LA 3F5WA 2GAZB 4PBXA 2AP2A 3STZA 3OWEA 2VNCA 3KXFE 4H26A 3Q6GL 4L3ED 4QHNA 3WE6A 3GBMH 3U7WL 1CDBA 5IBUB 1BVLA 5E00B 5IBTL 3T1FB 2X1OA 3ZTJG 2VQUA 4GXUM 4HMEA 4HWUA 4YBQC 1PFCA 4J8RB 3LMJH 4BQ6A 3Q1SL 4N0CD 4UB0L 3MRLA 1I75A 2D7NA 5C0BB 5DD0H 5T5FL 2X1WL 4S11A 4G5ZH 5DRNB 1M6OA 2DMBA 4XGZA 2KZWA 2VDML 5DS8B 3K74B 4FTVD 3QUZB 4JN1H 5ETUB 2C1OB 3SE9H 5L7XH 1KELH 4XX1E 2B7DT 2DDQH 2VISB 2HFFA 4FMFA 32C2B 2AV1A 3NVQA 2AXFA 4U1KA 1RURL 1A7NH 3OSKA 1ZHKB 1EHLL 3FO1B 3C5SA 3L6FB 2VKWA 4RMRA 3RWEA 4UOW0 4WI4A 5F7LB 5JO5A 3GKZA 3ULUC 4HWZB 5C2UB 4BK4A 2DQEH 2Y36L 2AXJA 4RMSA 1REIA 5IWLA 3I9GL 4OLXH 5EC2B 4UIKL 2Q6WA 1Q9KB 3MRQA 3QHFL 1YC8A 3EOYG 1PG7W 4N0YL 4GRLD 5BW7A 3QIBB 3QXAB 1TVBB 3T04D 1OAQH 1U8HA 1U2CA 3O6LH 5FGBC 1I4FB 4NM4H 3BZDA 4L9LA 5C08E 2XYCA 4WNQB 3OG4B 2VDLH 2B1HL 1HINL 2Y07H 3CDGA 3KPSA 2XV6B 1S9YA 1DBKH 3UTSD 4HUVB 3RDTA 3ZE1E 3CFCL 5CILH 1NBYA 5DJ0A 3ULSA 3WN5B 5K9OB 3HI6L 4MJIE 4DZBA 3MLXH 4P3DB 5T3ZD 1H5BA 4ESKA 1FLRL 2EXYD 1HKLH 1GAFL 3CVHH 1GHFH 5EU6D 1SYSB 2Y6SC 1A3RL 3OG6B 3EFFA 3OR7A 4MQSB 3VD5A 2DQUL 3AMLA 2IPUK 2OZ4L 2FEEL 4P4KD 1KC5H 5T3ZH 3U6RA 3WS3B 1AGCA 3FQUA 2BNQB 4TNWK 1A47A 1KEML 2YD3A 1YQ2A 2YSSA 1PY4A 2BY1A 4Y5YC 5DLML 4KHXH 1CD8A 4DUVA 5LXGH 1G9EA 3MRBB 1QYGH 3GRWL 3KR3L 3V0VB 4BFIB 3QEHA 5JW4R 2HFEA 3MYZA 4O2EA 2FD6L 3BGFC 3O3AA 3OKLB 4XP4L 5EU5A 5F1KC 4Z0XA 2LTQB 3OR6A 3CFKA 5C0RL 4OZIA 4GAGH 2DI9A 5IMMB 1A7OL 2AERT 2A83B 4WY7H 4M93B 4K23L 5DGQA 4ZUVB 1MOEA 2D4DA 3CDCA 2QSQA 2VWEE 3ULVD 3LV3B 3I6GB 3Q48A 4AM0A 4YHYB 4HKJA 1OGAA 1HHJB 1L7IH 3PWPB 2EDYA 4HK3N 3BE1H 4BUHA 4ACPA 1IC7H 2FEDC 3ULVH 2NTFB 2ARJA 5FO9A 4OQTL 3OAUL 3WNOA 5E1AA 3IFNL 5F1NA 1CQKA 3QFJA 5HHNA 3HB3D 3RGHA 1I3VA 4FXLA 3TYFB 4PPTA 1T7XA 5C6TH 1GC1C 1FZMB 3TBWA 3MJ7A 1QLEH 2CLVB 3EJYD 5D1ZA 1NH6A 3SE3C 1IM3A 2V7HB 3NAAL 5E2TL 3SKOB 4PRNB 4HMDA 5FF6A 3O6FA 5J56B 1JUFB 2MSPA 5IHLB 4GW1B 5IG7B 2GW5A 1H8SA 4J7RA 1ZS8A 4FFWC 3T4YB 4LCWD 3GBML 4RGNB 3QCVH 2RBLA 1U91A 4PRPA 3MROA 1NUGA 5IW6A 5EA0H 1YN7A 1F4XH 3CXHJ 5MEQB 1LDPH 3LMJL 2XY1A 2PO6A 3HAEA 5DRZA 3UC0H 1IM9D 2YRZA 5E6ID 3HCVB 2VR4A 4S10A 5DD0L 3ZHKA 1GZQB 4RRPA 4G5ZL 5DJYA 1MWAA 1G7PB 2R1WB 5EOTA 3OKKA 3V5HA 2DKMA 4M7LT 5EC1A 3O6KH 3M45A 3TA3D 1W72A 4JN1L 3OF6A 3SE9L 5L7XL 2CLZA 1KELL 1DDHA 2UZXB 3LQAH 2DDQL 4JFXB 4J3SA 4WUUB 4PV9A 1VERA 1A7NL 4GKZB 3VXRA 1TVHB 3UZVB 3EO1A 3IKCA 3IJHA 2V5RA 2CRIA 4LCYA 1CFSB 1MLCB 5GGTH 3DTXB 4PR5B 1KLGB 2DQEL 2AK4E 4JCLA 1KJVB 1YY9D 4DTGH 4OLXL 2NW2A 1RZ7H 4JFEB 1CFQB 5GIRA 4Y19D 1XF3B 2F53A 2R2HA 4O5LL 3MUY1 2I5YH 3MBEC 2DL9A 4JFOA 3BYYA 3K2MC 1NEZG 4HX1A 3AGVA 1L6ZA 2GKIA 3TBSB 5C3LD 1OAQL 4QRRE 4LEOB 3IDNB 3GSNA 3O6LL 1S7WA 5KTEH 2HJKB 5DC0A 3FT2A 4NOFA 4NM4L 2A6DB 1ZAGA 3QEQD 2DIAA 2FJFB 3DI2B 2VDLL 4KTYA 3S97C 4ZFFB 2FX9H 2Y07L 1E27A 4OAWA 3W2DH 5HHMD 1DBKL 3LEXA 5F7WC 1A3LH 2LQRA 5CILL 2EICA 1U3HB 2P5WD 4S1QH 3BEVA 3DMMA 5DJCA 4KH2A 4CU8A 3MLXL 2QSTA 4Z7VE 3QH3A 1HKLL 3CVHL 3B9KB 4L5FH 4Y5XA 1GHFL 2HH0L 4WV1A 4ODBD 5I19H 5I18H 3SGJA 1KC5L 5JDSA 3KPRE 5T3ZL 1U8IA 4NQXB 4C56B 1UXWA 2EYTA 3MGAA 1T21B 4GRWB 4KHXL 4PJIA 4EN3C 1T04A 1JWSB 2NY2B 1CIUA 3HZKB 4QF1A 5LXGL 3DX7A 5GISH 1YEIH 2YD5A 1QYGL 1JHLH 5D6DC 4F7MA 3LPFA 4KRNA 4CVXA 3C5JB 3Q3GA 4HS8H 2F9BT 2BRQA 4NHUA 4GAGL 1MCFA 2D9CA 4HC1A 4NQCB 4WY7L 1T20A 5IUSA 4KVCH 4ISVA 3RUGE 3BP7B 4JFFD 1JTPA 1A5FH 1MY5A 1MCPL 5E6ZA 5KS9E 3ZE2F 1JFQH 3RVWD 1Y6MR 4QRSB 5CSZB 4K71B 1L7IL 2JK5B 2ZSWA 4ZFOL 3QDJD 4QRQA 4XI5D 4NKQB 5KOMC 1KV3A 3BE1L 4X9HA 2VLKB 1IC7L 4QHLA 3ULVL 4HJ0C 4ZOCA 5FDWA 1T5WB 4CVZA 5DEGA 3FRPG 1P5VA 1CXEA 4Q58C 1DN0B 4LOUC 4Y2DA 4ZOEA 4OFYA 3VFUB 1AXTH 5C6TL 4PIRF 1QLEL 8FABA 2M26A 4GQ9H 5GGSY 5LCVL 4JCMA 1JF1A 1KJMA 3GMNA 3BSZH 3MLVH 2ICEB 3E8UH 3AY4A 3GKWH 1F4HA 5E2UH 1UXSA 3DX9A 1IQDA 4P23C 1DANU 3VCLA 3K4DA 5DK0B 4QHUB 2NYYD 3AU1A 1RJYB 5C8JB 1OF2A 1VSCA 4PG9B 2VDOH 1HXYB 5J8OA 3QCVL 2VWEC 5IQ9A 3QUXB 5EA0L 2Y7QA 3FQRB 4XVUC 3EHBD 5BS0B 4X4YA 3ARZA 1F4XL 3FCTA 1KPVA 4U1JB 4YC2C 4C54A 1LDPL 1BP3B 5C86A 3FMGH 2HKHH 4K3HA 3UC0L 4UBDD 4NKOB 1W0WB 3U0WH 4KI5C 4JKWA 3HR6A 1KYOK 2N4IA 4NQDE 3O6KL 4ELMA 5JPMB 3EDJA 1ZV5A 5EUOA 5E9DB 1UKTA 12E8H 4ONGH 1JWUA 1U8OB 3ZT7A 4IMLA 3LQAL 1WBYB 1R3LB 1XGQB 3DRTB 1CE6B 3W0WA 3PQYA 2X4RA 3AS0A 4PJEB 5GGTL 1UENA 2GSGB 3QUMA 2GJ6A 2OJEA 5IV2A 2VSCA 4OBRA 1XIWC 2D31B 3MC0A 4YDJA 3VA6A 4DTGL 2FECI 3O3EB 1QFOA 1RZ7L 5GGVY 4GBXB 5EULV 2V2XB 3GSXB 1TCRA 4H1LB 4DOHE 1JGDB 4Z7NE 4MXQC 2I5YL 1YMMA 4NN7C 2DOCA 2ZOKA 1HHGA 5GSVA 1B0RB 1KENH 3DPBA 4LVHC 4HWNA 5KTEL 1LO4H 5L2JB 5C0CD 5KW9H 3P4NA 2GEEA 3W9DA 2I07A 3JUZA 4YAQB 3T0VA 3CLEH 2VZVA 3SJVE 2FX9L 4KVNH 1CGXA 1CK0H 3TBTA 3W2DL 2H3NB 5I16A 5GS1B 2DICA 3GMPB 1WAAA 1A3LL 1A14H 4PGEB 4MJ5B 3CU7A 4P46D 4S1QL 4XH2B 4LKCB 3QI9C 2Z93B 3QDAA 3L3OA 3CX2A 2JJVA 4P2QB 4L5FL 5I19L 4P9MH 5I18L 1MFEH 1G7QB 5EU4A 2HRLA 2IPKA 3PHOB 1S9WA 1CFNB 1JPST 1E4JA 4HCRA 3JTSA 5DA4A 5K33A 3U4AA 1DEEB 1M71B 2OSLB 3AM8A 2VITB 3D85D 5HHOE 4ZO9A 1YZZA 1K4CB 5GISL 1YEIL 4OF0A 2HTKD 1JHLL 5FB8B 1NMAH 4AY0A 1LNUA 3T0WA 2Z8VC 5HPOA 3FQTA 2ZCHH 2VRAA 2NY4D 4HS8L 3W82A 5B3NA 5E8PA 4ZNEE 1EERB 5C0AA 1DLFH 3OKNA 4I2XB 1MCJA 4KVCL 1T66C 3T4AB 1A5FL 4Y16A 2V5MA 4MAYB 4R2GC 1JFQL 2BVUA 3UBXI 5TDOA 2RGSA 4NO0A 5CBEA 4JG1L 1Z5LB 2X4OA 5HHXH 4H88H 4IMKA 4OZHA 3JV5A 1B9ZA 3RNKA 1NGYA 3CMOL 3IFPA 5DGRA 4GT7A 3CMGA 3UCRA 1AXTL 2DQDH 1HI6B 2VUYA 4WHTA 2J6EA 3SCMB 5I0ZA 4LSVH 4GQ9L 3QO0B 1CGUA 2NY1C 4QEGA 3MRRB 2R0WH 2X9WA 5DD1L 3BSZL 3LQMA 3MLVL 4U7SA 3S88H 3E8UL 3NGBC 3GKWL 2LABA 3C6LB 3ARDD 4ODVH 4X83A 5E2UL 4Z7QE 1PD6A 1AO7A 1GGCH 2CRZA 2VDOL 4Y5VA 3LN5B 3V0AC 1G6RA 4A2LA 3KYOB 4W4NA 2EDKA 1OTSD 4OKVB 3RZCC 3I2CL 5I66A 1JRHH 1WLHA 5EO9B 3BN9D 3QZWA 3FMGL 3BGMB 2XNAB 5TDPB 2HKHL 3GJFH 3OKYA 4ZOBA 3CK0H 1NFIB 3Q0HA 3GJEA 1SJHB 1AIFA 3U0WL 4JFHE 2NZIA 4CJ1A 5ID0A 4U0QB 2P8MA 2OK0H 3QWQB 3LSOB 4ONGL 12E8L 1SMOA 1EX0A 3RBSA 4K7FB 4RGOH 4ZXBD 5A2KH 4XXCA 4GFTB 5L8KB 3HUJE 3KYNB 1K4DA 5MENB 3EUUA 1EAPA 2VSDA 1HH9B 2BMKB 1NC4B 3O4OC 2WBKA 4CBPA 4HHAA 4TVPD 4AQOA 3NOIA 1DBJH 4F2MB 3BPCA 3BQUC 3NCYP 1CFVH 5E8EB 5D5ME 4M6NH 5KVEH 3I3EA 3GFUA 4KK6D 4TVPH 1MNUH 2WMPA 2Z8RA 5FHAH 2IEPA 5I2IA 5B8CC 1FH5H 1KENL 1U3YA 3P3YA 4QHMB 2EYSA 1R5WB 1C5DB 5CGMA 3L3KB 1LO4L 4TTDD 2VLJB 4KXZH 4LBEA 4LLAA 1YPZA 3DARA 4PJBB 3MRGB 3CLEL 4PY7A 4LPXA 1KCLA 4X6DA 4KVNL 1EEUA 1CK0L 4U6XB 3PGFH 1C08A 4LARH 2ZUQC 1A14L 4XP9H 5F70A 4XNYH 2DWEA 5FKAA 1YDPB 3HG1E 1K2DA 1MI5E 1I7TB 2BNRA 4GG6E 4L4JA 2DMCA 2ZUTA 2BK8A 3KYAA 3KS0H 1NAMH 1WC7B 1A6ZB 4G7VH 4P9ML 5HGAB 1MFEL 4CU6A 3WFBH 3CZFA 3UZQA 1P6AB 2Q76B 1O5DT 3QUYD 3MFFA 3QIUB 3SQOH 4R96A 2WBJA 2PYEA 1XT5A 5FGSA 4L4TE 3HE6C 3O4LE 1NMAL 5IMMA 2ZCHL 2IWGA 3STLA 4LQ1A 1NLDH 2G5BB 1HH6A 1QFPA 4NCC1 3VMNA 3BD5A 4APQA 1HSBA 1BQHB 1DLFL 4Q6IB 1UB5A 1I3GH 4UILH 1JZ7A 5DD3L 3I6LD 4W68A 3LHPH 3MO1A 4ODWA 4A6YA 2SEBB 3PHSA 5EIIB 3CFDB 3I84A 4JDZB 4X4ZA 5HHXL 1WIUA 4H88L 1OTTC 3MLSH 3JZ7A 4WFED 2IGFH 5DHXB 2PKDA 3D25B 3WS6C 1ZLWH 1CGTA 3A6OA 4G3YH 4LLYA 1KPUB 1VGKA 1D9KD 2JJWA 2Z35B 2DQDL 4NSKA 5A40E 1VPOL 3KPPA 2PYFA 1IGJA 4OM1H 4LSVL 1CVRA 2QLVB 2R0WL 4O9HH 4P2OB 1D7FA 3S88L 4EXKA 2JCCB 4ODVL 4NO3A 3KPNA 3FFCA 4AMKH 4U0RB 1ORQB 1GGCL 1TQBC 4ELKB 4MNHB 5DD6B 3NIGE 3P73B 3FT4B 4LVEA 4JHBA 3X17A 1PKQE 1N59B 1JRHL 4N8CH 3FAXA 4KRPC 1BZQK 4AEEA 2A6JB 3CK0L 3P9LA 3MV9A 1NANH 2Z31D 4TVSa 2MKLC 1HWGB 1J7VR 1MHEB 1WWWX 3NIDE 3U48A 2OK0L 4JFXA 4LLMA 1DP0A 3BRDA 5K59F 5B21A 1TCMA 5BJTB 4GKZA 4RGOL 4MMXC 4FZ8H 4BSWB 4HIXH 1F3DJ 1BWWA 1OSPH 2PCPB 4CVWA 4PJAB 1BZ7B 3FHAA 3J8F7 1UB6A 3S96A 1ZT4A 1FZJB 2EDJA 3SGKC 1QUNA 5B3JF 4E42A 5C0BD 1AR2A 4L3EE 4G9FD 5DUBB 5LGJA 2JELH 1R24B 4MS8C 1Q94B 1UG9A 3BIKA 4L29A 1V3LA 1ZHBB 1C8PA 3QUZD 4BSJA 1UJ3C 1VFAA 3BKJH 3GIVB 1DBJL 3HE7B 1NEUA 4ODTH 1CFVL 5F9JB 4M6NL 5KVEL 4TVPL 1MNUL 5T33H 1G9NH 2HJKA 3HC3H 5FHAL 2ZCKH 5HYIA 1FH5L 2NY0B 4FTVE 1A6TA 2XKNB 3KLAA 3QUKB 3BEWA 3OV6A 4HW6A 1AXIB 2VDRH 4OFDA 3EOBA 1I8LA 4C83B 1JZ3A 3RVXC 1U3HA 2K7PA 3PGFL 4PJCA 3QPQC 3QIBD 2ZUXA 4DWHA 4LARL 5BRZD 3WHXA 4PJ8A 4XP9L 2HT2D 1NFDB 2BOCA 5DO2C 4XNYL 1MJ7H 3MJ8B 1RJLB 2AV7B 3ARSA 3IAGC 1NCAH 3LKQB 4EI5B 3TZVD 1MEXH 4KC3B 3R4DA 4QGTA 1NAML 4JB9H 1MH5B 1MLBB 4G7VL 5BV7H 3IJSB 4QWWD 4KTDH 3WFBL 4AJ0A 5DD5H 4WWKA 5KN5A 3R06A 4DK6A 1PVHA 2IALB 3L3IB 1X9QA 4NZJA 4IS6A 5GJTH 1XH3B 3SQOL 1ZLSH 2YR3A 4U1GC 3C60B 5IHZB 1K3ZA 5IVXB 3LD8C 5HI3C 1LMKA 3JWOH 1AGEA 4JFPB 4OCRH 1NLDL 5KSAA 4TULH 2X4NB 3UTSE 5BZWB 4UDTA 5D1QD 1I3GL 4K8RC 4UILL 5SWZB 3NABH 2BNQD 4Y1AA 1LD9A 3PABB 5T3ZE 4P57B 3KJ6H 3L3JA 3LHPL 5C9JA 5K9KA 1R3HA 2VN4A 2CK0H 1I7UA 2CGRH 1H0DA 3Q5OA 5EU6E 5IF0A 3G6JA 1PX4A 1S7QA 3LKSA 1OVZA 4WW2B 4KI1A 3DHJA 4WTZA 4X4ME 5F44A 3MLSL 2M8XA 2IGFL 1Q9LB 2XG4A 4JPVH 2P45B 4BQBA 1P7KB 3UTOA 3ZKSD 4HAGA 4G3YL 5SWQA 1WCQA 3DBXA 3TNMA 3DWTA 5AWNH 4F58H 3ARQA 3IFLH 4OM1L 5I1EH 3D18A 4O9HL 4PJ5A 2RIKA 1G6VK 5DMGD 4HH9B 2DM4A 2YXMA 3RTQC 4PJDA 4HUXA 4AMKL 3CSGA 2WIIB 1A1OB 2ADIB 1ZK9A 3FO0H 3ULVE 1EXUB 5FA4A 4U1JA 1ZGLB 1T6VN 1TPXB 1MPAH 3FQWA 4N8CL 5E8NB 3VH8G 1L0YA 3DX6B 1JV5A 3MNZA 3O8XD 4KJPC 5D72L 2XWTA 4I0PD 4PLNC 25C8H 4X7TA 2JCCF 1N2RA 3HN3A 4LSRH 4NN6C 2IH3B 1RSFA 2HN7B 5ANME 5D93B 3AREA 4FZ8L 4HIXL 1OSPL 2OL3A 2QADB 3UBXA 3MQIA 2YWYA 3UTZB 3U2SB 3NH7H 5D7IB 2ATKB 1GYAA 5JW5A 3ARGC 3RGVA 3TT3H 4IDJH 4LCWE 4AT6B 2C3GA 2JELL 3HLAA 5DVLA 3FKUS 3ZO0A 5C0FB 1KTLB 5CFHA 1UJTA 2W9DH 3QIWB 4HLJA 3BKJL 1H3UA 4LF3A 4RBPK 2FX8H 5DHVB 3OHXB 3HNTH 2YPLB 4ODTL 2XOTA 3G08A 4WUUD 3V0WH 4OFVA 4AIXA 1JBJA 2CMRH 4PJAF 1G9NL 3D3VD 5IVZB 5T33L 1WBZB 3HC3L 2ZCKL 3IDIB 2E8ZA 1NCCH 1NDMB 3V79C 4X99A 4K07A 4GRMB 1ZEAH 4ZD3H 1YY8A 1VACA 4MJ2A 5F72S 2CKBB 3KHQA 1S7RB 2KQNA 2OM5A 2VDRL 4JFED 1QSFD 2D3VA 5DK2A 2EH7H 1N0XH 3DNKA 1A7RH 4HUKB 3WMSA 2XN9D 5F7DA 3B83A 3QWRA 3WNMA 4CDGC 1H9VA 3VXOB 3BZ4B 4WI8A 1BVZA 3IDUA 4RMWA 1HEZA 1UT9A 1FAIH 3MOAH 1MJ7L 2J12B 4Y4HA 5C07B 1MEXL 4K55A 4Y19E 1FZKA 5TQ2H 1MY7A 4JB9L 3VRLE 1A8JH 5BV7L 4KTDL 5DD5L 2FL5B 5CSGA 5DT1H 4RAVA 4C59B 4PLJD 5GJTL 4WW1A 3LN4A 1ZLSL 5C0GA 1NLBH 3DIFB 1BX2A 3HC0A 4PJIF 3RIFF 3WNKA 3LS4H 1K8DB 2I24N 4OLUH 3QEQE 3HNVH 5CP7B 2Z92B 5C9KA 4KK9D 1DANT 4UT6L 4IOFD 2E7CA 4FP8H 5HHME 4TULL 1TJIH 3BJLA 2YXFA 2IBZX 2EKSB 2Y4SA 4C56D 2P5WE 1YYLH 3NABL 1IC5H 2ZNXA 3KJ6L 4UMGA 1RK1B 2CK0L 2CGRL 3SDAB 3C5ZC 2V5YA 3HZYA 3MJGX 4PJGE 1XGUB 1XCQB 3G9AB 3BWAB 4GRWH 4JPVL 7FABH 4N8VG 1JF5A 1T1ZA 3SQBA 3ZE0F 4NQCD 2ICWJ 4JFYA 4GG8B 5ISZA 2CK2A 4F58L 3IFLL 1XCTB 4YHZH 5C0IA 5I30H 5I1EL 1JF6A 1ZVYA 2DBLH 4U2YA 4KROB 4M3KB 5D7JD 4XBPB 4HJJH 2BVOB 2R56H 2VLKD 3SDXA 5FFLA 1FZOA 1F3RB 1WBXB 4JFFE 5JA8B 3DYPA 3FO0L 2AEIT 5JNYB 5DJ6A 1DFBH 4OGXH 1ETZB 3C9NB 3QDJE 5TDPA 4NC1C 4P5MB 3MMEA 3S7GA 1NFIA 1MPAL 3PL6C 4HKZA 3RWHA 5FOJA 4F57H 1R0AL 4FQJH 2E27H 5IFJA 2F5AH 4WHDA 4P4KC 1GPOH 1ZTXH 3ARWA 4PJHB 3DGGB 25C8L 1ZHLB 1RJZA 2OYPA 4LSRL 4CN4A 3FQNB 5HY9B 1UH3A 1U8PB 3VFPB 2GT9A 3NH7L 3GBNH 1FGVH 3TT3L 4IDJL 4JM4H 5CHNA 3ULVC 1ORSA 1W8NA 1KNOA 1XR8B 1KCSH 5ICZB 2W9DL 4CMMB 5GGSA 2AXGA 1RHFA 5BQ7B 4NFDA 2FX8L 4X7DC 1DUYB 2J7LA 3FT3A 3HNTL 2FB4H 1I3UA 5JW4Q 3MRMB 4NKDB 3V0WL 4MB4A 3JWDH 3RWDA 3ARPA 2HLAA 2CMRL 3MA7B 2F58H 3PGCB 5HI4C 2WWMD 4Q2ZB 1NCCL 3RWJA 4Y8AA 3VD7A 2A6IB 1LE5A 1S5HA 1ZEAL 4ZD3L 3EJYC 1MCQA 4JDTH 1I8MA 1WTGT 3H0TB 4MB3A 5C0NC 4O51A 4U6XA 4O2FA 3FB8A 5ID1A 2FH8A 3B5TA 4M48H 4MJ6B 2EH7L 1N0XL 4HBCH 1A7RL 3VGFA 1EGJH 1F42A 1E4XH 1MQKH 1U93A 5JPNB 3PXHA 2G75B 1FAIL 3WFHB 3DUUA 3MOAL 1HHHA 4JZOA 5CJXA 3IRZA 3EYOA 4YPJA 3WFZA 3ARBA 3QA3B 4U1MA 1UA6H 5TQ2L 1OB1A 5ESAA 3QSKB 4D2NA 5CD3A 2H1PH 4KMLB 2E7BA 5DVKA 1A64A 3VFOB 5EO0B 1T2QH 3T09A 4JQIH 3LQAC 5DT1L 2YD6A 1ZA3B 2XZQH 2C3HA 3HFMH 4PJFE 5C0CE 3TA3C 1NLBL 4ETQA 1FJ1A 1JZ8A 1P7QA 5D2LE 4JG0H 4JO3H 3LS4L 4OLUL 2JIXD 3HNVL 5C09A 4WI2A 4P2QD 4ZPTB 4FP8L 3H6JA 1TJIL 4P3WA 2FYYA 1K5NB 2VR9A 4X5XA 1XR9A 1RUMH 3N1MC 4JO4H 5E5MB 1YYLL 1QSEA 2VZUA 3MV8A 5GRVL 4LVOC 1IC5L 3SPVA 4HWBH 4UQ2A 4XP1H 1WZMA 3OB8A 4RFNC 1ZT1A 1ZLVK 2AJ3B 3PV6B 3TBVB 4NC2B 4IHOA 2MPAH 5C08B 3TN0D 3TVMB 3WYRA 1OW0C 1TQCC 4PJ9A 4ZAKB 4M8QA 5I1KH 1PDKA 2AJXH 3CD4A 7FABL 4P5TB 2EDTA 3ZKXB 1A6PA 4YHZL 5ERWA 1I8KA 1T22B 4PRIA 3VWKB 2DBLL 4MJIB 3MRIB 4HJJL 4ZO6A 5EN2B 2R56L 4LDLB 5EUKA 2HKFH 5A2JH 2DRUA 3QHZH 4JRXA 4XNMB 2P8PB 1SVCP 1SEBB 3LRSB 1XF5B 1T0MA 3BH8B 2IQAA 3TBYA 3H3BC 1DFBL 4OGXL 2X4UA 2R69H 1FHGA 4GH7B 1R3JB 4RSVA 3SCMD 2EIZB 3VXUB 2ZUYA 2EEAA 4F57L 1RPQA 4FQJL 2E27L 4WGVB 2VDNH 2F5AL 1FNEA 1GPOL 1ZTXL 3C6LD 2FJHA 5C6PB 5B39G 4ETYA 2YUWA 3UPRA 3ARFA 5FXCH 1S7TA 1P4BH 2IAMB 3BP6B 2OQJA 4TPRH 4XCYB 5INCA 3WFCH 5DDHB 1CL7H 5DUBA 1HZHH 1KEGH 3R0NA 1BD2A 3RWCA 4YDLB 1CU4H 2C1PA 3GBNL 3SKNA 1I9IH 1FCGA 3M17B 1FGVL 3LN9A 4JM4L 3O9WA 2V7NB 3DGCR 1MRCH 4HFUH 2Y9RT 3STBA 5HDQH 5JIHA 5HXMA 1D5MB 5CAYB 1KCSL 1DVFA 4F7CB 4XI5C 2PTUA 1NMBH 4QY8A 3FB5A 2FB4L 7CGTA 1IKFH 4Q9BA 3CX5K 4Z7UA 1IAOA 1DQQB 5EB9A 5JLZA 3JWDL 2ICWA 4G6FD 3MTRA 3DVFA 1FFPB 5EZLA 3IDJA 2F58L 3ESUF 1XF2B 2K3TA 4ZSOE 4D0CA 1NC4D 2H9GA 1A7QH 3IF1A 1IGCH 2W0KA 5ACZB 2YUVA 2EZ0C 3WIHA 4PFEA 4JDTL 3RY5A 1X4XA 2FDBP 2F74B 5F6HJ 4QXUH 3KPSD 4M48L 3QFDA 3BVNA 3GSRB 4HBCL 4Y2OA 2YC1B 4ODXB 1VADB 1NGPH 2NYYC 3I75A 1EGJL 1E4XL 1JI1A 1MQKL 3LKQA 4G8IB 4LHUA 4EI5A 2Z8WC 4EKXA 1B0GB 2HLFD 5DJAA 4TVPE 4N9GB 3OX8A 2LVEA 1YEHH 1YECH 4X6EB 2VLJD 2EDHA 3EHBC 3ET9F 1UWXK 3U83A 4XBEH 1UA6L 4Y7MA 3LB6D 4NQVB 2WUBH 2VQ1A 3RL2A 1FQ9C 4UBDC 3HKFA 4TSAH 5D1ZC 2CR3A 2H1PL 3SO3C 1T2QL 4JQIL 4HIHB 4EVNB 3GMRB 4Z77B 2XZQL 5IHZA 3HFML 4UUJB 4M7ZB 1F6AB 2W38A 1EFXB 5H2BB 3U9UB 3NCMA 4N0FA 3KLDA 2YEZB 4JG0L 2DLEA 2I25N 4JO3L 2AK4B 4WI3A 4J4PD 5BZWA 1HN1A 4CRPA 5SWZA 1G0XA 3MGOB 1D6VL 4YX2H 1GOFA 2PO6C 1GOHA 1RUML 4JO4L 4Y4KB 3RWFB 3QIUD 3TPUB 5CIPB 3RNQA 1VKXA 1T1WB 4HWBL 4XP1L 2PTTB 3G5VA 4BH7A 1I1AA 5DFVD 2UZIH 3NTCH 1IKNA 4P2RB 4HFWB 4OV5A 2MPAL 1MAKA 4OUUA 3S37X 4GAFB 5I1KL 3QFJD 2AJXL 4PRDA 2XY2A 1B3JA 1CDUA 3N1QC 4IM8A 4JKKA 3TO4C 1KULA 4HIIB 4GW4A 2NXYC 5IMLA 4KU1A 4L8SA 1HNGA 4NO2A 2RFXA 4Z7VB 1EHXA 4NWTL 1SVZA 1GJIA 2HKFL 1BJMA 3IDGB 3NCCB 1YNLH 1SBSH 3QHZL 4J3WA 5IKCB 2XG5A 1KIQA 3KPQB 1RZGA 3KPRB 5JOFA 3T2PA 3ROLA 4PRPD 2WZPD 3I6LE 1WT5C 4HK3J 1I1CA 2R69L 3ILQC 2MHAA 5D6CA 1AP2A 1FNFA 1S78D 2VE6B 3WO4C 4PRAA 5E94A 5D4QA 4M6MH 2IMMA 1S9XB 3X14A 5JUEH 4NQSB 4WFEE 2VDNL 1QKZH 5T1KB 4NRZB 3NCEB 1B4RA 3W5MA 3QNZB 5EZJA 3DO7A 2P44B 1WFUA 2J1KA 5E8OB 3LOWA 5CJ8A 2B5IC 3OF6D 5FO8A 1J8KA 4NQEB 5JQHC 1P4BL 2UWEB 3TIDB 2HTKC 2UY7A 4MD0A 4TPRL 2ENYA 2FLBT 3GMQA 4LLUA 3WFCL 3H9SB 1KXVC 3VXRD 2NY4C 3BZFB 4I3SH 1CL7L 1HZHL 1EIBA 5HHPA 5HYQA 1KEGL 4NNXA 4PTTB 1CU4L 3F12B 5HGBB 1I9IL 3WKNA 4DEPB 4G42B 2GITB 3ARRA 4BKLA 1T3FB 1MRCL 4HFUL 3K8LA 1ZLUH 5HDQL 3SGJC 3IXAB 2N7AA 4X8JA 1SYVA 3EOAB 4PD4K 5FEBA 1NMBL 4L4VB 1W0VB 4Z6AT 1GRWA 2JB6B 4OLEA 4JM2B 3WEXB 2X70A 3M1BB 3PWLB 4U7MA 3NFPA 1FV1B 3LPGA 5B38A 2A2QT 3V6BR 2DJ4A 1A7QL 1J0KA 1IGCL 5IB1A 1YYMH 4HV8A 8CGTA 1N0LA 4WFFD 1VESA 3EJZD 4ZFZA 4ZO7A 2X4TA 2B4CH 3GSNH 3Q2CA 4QXUL 3HE7D 3FB7A 1R5VA 3ARDC 1U8LB 5C0BE 5JHDA 5BOZG 3QO1A 4G9FE 1NGPL 1FNLA 4PRHB 1YEGH 4PJCF 4OLZH 3TV3H 2BCKB 2VLRB 2Y72A 2NY0D 1P4LB 4JR9H 1CT8A 5MERA 1OTSC 1QR1B 1YEHL 1JGEA 3HRZB 3ARVA 3BN9C 4XBEL 1P1ZA 4XWOC 5KSUA 2B0SH 2WUBL 3VFGH 1NGWA 4TSAL 1H3TA 4I3RH 2FO4B 1J8HA 4U1IA 3KPOA 2NCMA 3MZTA 3AY4C 1K8DA 5IW1B 4E5XA 4AZ8A 3X11B 4ZXBC 5CEYB 5IB2A 3IU3B 2O93L 1CGWA 4Y5YA 5BRZE 3BUYB 4YX2L 3SBWC 4DOHB 4K9EC 4ONFH 1KCUH 1UKSA 1A7BA 1L0QA 2DTMH 3BMWA 5IJKA 3C60D 4PY8J 3S5LA 2UZIL 4Q9CA 5BZDA 3NTCL 3SE8H 5H94B 5CKAA 3LCYA 5DI8B 3GGWB 3SY0A 4AL8H 3SJVB 2P47B 3FFDA 4GG8A 4DKAA 3BT2H 3QBTB 2DQFB 2IC2A 5DYOA 4XNXH 1A4JB 4TTDC 3HR5A 4FXKB 2MCG1 3QDMB 3L3DA 1Q72H 1PSKH 4X80H 5D1XA 4NDMA 4WTXA 5EO1B 5GRYA 5F93C 1YNLL 1SBSL 2DYPB 4S2SA 2VXVH 2ZG1A 3ZE2E 4GUPA 3MXVH 4L3CB 5IMKA 2BNQE 1S9VA 3SE3A 1NBZB 1MVUB 4G7YH 2GI7A 4QTHA 5HHOB 5I71C 2E9JA 3T0DA 3VWJD 4M6ML 3VXTB 2LVCA 4IJ3B 4FNLH 4MD4A 5JUEL 4ALAH 4XCNA 1QKZL 3SKJH 4IIQB 4BK5A 1KIUA 4I18A 3QUYC 1EAJA 1KLUB 3KWWB 2BVPA 2PW1A 3G6AB 4PV8A 1U8PA 3V6FA 4EEEA 2OTWB 2BSTB 1MVFA 2C3VB 1UC6A 3B5GA 2IADA 2WM0A 3L5WB 4I3SL 4LDEB 1J0YA 5HDLA 5HYJA 4FZEH 5ESQB 3GSUA 1PLGH 1TZHB 2Q3ZA 4MCYA 2H32B 5DMIH 4OF7A 4YZFF 2CO6B 4KJWD 1UEMA 2UWEF 1BVKA 3KXFA 4XHJC 4V1DB 4WO4B 4GAYA 3OKOA 1R3IH 3P4MA 1I7ZB 1U8KA 2P8LB 4M1GH 3QP3A 3QJHA 2UV3A 1U8NB 1YMHB 5SV3A 2V2TA 4CW1B 1YYML 4QCIA 3WUWB 5T1MA 3QIWD 3T3PF 3FB6B 1OAKH 3WLWC 2B4CL 3GSNL 3MBEA 1YEKH 2NNAB 2YPLD 1U95B 4JY4A 4RWYH 4EUPA 1JNNH 3GIZH 4XXDA 3RPIA 1T7ZA 4WU5B 3OKEB 1YEGL 2DMKA 1C12A 2ITDB 2A73A 4OLZL 3TV3L 3OXSB 3LQZA 1LE9B 4IMKC 4JM2F 2EE2A 1FLTX 2BSSA 3VGHA 3U0TA 1J1OH 4LNVA 3IJYA 4JR9L 2A38A 4ZQKB 1F5WA 3G04A 1CE1H 4UINH 1MHHA 3SDCB 3ES6A 1X5KA 4KUCF 4WUUE 2B0SL 5FCUH 3VFGL 1QEWB 4F8TA 4RX4A 2LAGB 3D3VE 4I3RL 3B8SA 5GSRA 5SWSB 5CINH 2A6KA 4LLVA 5ICXA 2X4SA 1WVZA 4U1HB 4MA1B 3LKNB 5HYSG 1C7SA 2J4WH 3T1WA 4RGMC 4JFEE 1QSFE 2APXA 4HMCA 2QJDA 2XN9E 4XMPH 1WWBX 3EYQC 4PD4J 1G7MA 4ONFL 1KCUL 4Y16D 2DTML 5D6DA 2VQTA 2EYRA 4BH8B 4YO0A 4ORGB 3QUZC 1NGQH 5C08A 1G9NC 1A1NA 1T5XA 2HT4C 3QJFA 3SE8L 2RR3A 5EIVA 4HDIB 3VXSA 1JNJA 2DIBA 2DWDA 4AL8L 4QYOB 3V6OE 4R7NA 3K4AA 1AKJA 3DRQA 1TTUA 4PRBA 3VWKA 3BT2L 2XT1B 4XNXL 4MJIA 5F1IB 5J0BA 1NEZB 2NXZB 1FVDB 4PGDB 1FL6B 2ED9A 1M7DB 4DCQA 1MI5B 1Q72L 1PSKL 4X80L 3VXPB 4CNIB 1ODAA 5DSCA 3VFTA 1WFTA 1BQHG 1AO7D 3SDXF 2VXVL 3QIBC 4C56E 2AI0H 3MXVL 4POZD 1R3JA 1S7VA 3MJ9H 3VXMB 2EIZA 5HDBF 4WIQA 2HVJA 4U4BA 1HHIA 4G7YL 5F89A 1IEHA 4P59H 1NGZB 1CF8H 4L4TB 1BFOB 3VMPA 5LWYH 1QNZH 3MRHB 1A6VH 2PXYB 4FNLL 5MEOB 4ALAL 3SKJL 3MV01 3QB7C 2BNUA 4NQCE 4OZFB 2EE9A 2BVYA 3SE4C 2HJLB 3JWOC 4JHWH 4OV6F 5IB3A 1S7XA 4NKMB 5DTFB 1TDQA 1FFRA 1TZIB 4HGWB 3WN5C 3CFEB 4JREB 2VLKE 4MDIA 4RRPG 3WV0A 1JMXA 4LAJH 2WP3T 3MV11 1KOAA 1UVQB 2ID5A 1ND0B 3MLTB 4X7SH 3VGEA 4WTWA 1EJOH 3FOMA 4YK4B 4I0KA 4L8CB 1PLGL 5DMIL 1OSZA 4YDVB 1UZ8B 3SGDI 43C9A 4R3SB 1LK3H 4TSBL 3MRJB 2LTQC 1F8TH 4L1HA 2YPKA 4M93C 1R3IL 3GSWB 1XIWA 4S1DC 4DQOH 4M1GL 3BW9A 4ZPVB 3NIFF 4YHYC 1QO3A 4UTBH 3KLHD 1L7TH 5JMRA 1PKQB 1OAKL 3BZEA 1S7UB 1TMCB 1YEKL 1K8IA 2DLGA 4RWYL 4HT1H 1JNNL 1NCWH 3GIZL 5DHYA 2L7JA 5LKNA 4WDIB 2K1MA 5L2KB 2WBWB 3S35H 3HI5H 2Q7YB 1J1OL 2MKWA 2NY3B 3VFSB 1CE1L 4UINL 5FKPB 4M7KH 4U6HB 5JIIA 5FCUL 2EEBA 2AEPH 4XCEA 1FL3A 3ZSSA 4Z78A 3BMVA 3GMRA 5CINL 4Z18A 3FL7A 1P69B 3QI9A 4L3EB 3S6CA 2WBJD 4NJAH 2PYED 1VFBB 4RGNC 2GTWA 2J4WL 5JR1H 4H0GA 4YHIA 4PLKD 1WZ1H 4APQD 1G7IB 5J1AB 4XRCA 1CBVH 4XMPL 1RHHA 4X0KB 4HWEH 4QRRA 3V6ZB 2WLZA 4NOBA 3DROA 3BESR 2FZ3B 5A2FA 1NGQL 4OQ1A 3EO0A 4Y4FA 1MRDH 3DSNA 3MCKA 3PDOA 4N9OB 4YGVB 4A6YH 3D2UA 3CAFA 1QPXA 1IRAY 4JQVC 1IAMA 4I77H 4M6AA 5IFAH 1UZ6F 3REWB 3OKDA 4YWGH 1FVEB 4FQ2H 4X5LA 1JZ6A 1ZVSA 5C6WH 3PXJA 4R90H 1L4IA 4QRUA 3UMTA 3C2SA 4P2QE 3IETA 5JTWA 4BZYA 1INQA 1DQMH 1ZLVH 1G84A 1RIHH 4F7PA 4GRLB 1FG2B 3WXWH 4QGYA 5GGQH 4JAMA 2AI0L 3V4PH 3MJ9L 4XAKD 1Z0MA 5DC4B 1DLHB 2VH5H 2IFGA 2P46B 1MREH 2I9LA 4JY6A 1E6JH 3OKMA 3TPKA 3G5XA 4OD2B 1KTKE 2VLLA 4P59L 1CF8L 3BXNB 4NQSA 3EYFB 1N7MH 4F80A 5LWYL 2GUOB 4UQ3B 1I8IA 1QNZL 1T2XA 4X98B 1A6VL 1KG0B 2YKLH 4U1SB 1DCLA 3TNNB 4LASH 3QQ4A 1S3KH 3RUGA 3T77B 3V6OC 3ARTA 3F7YB 5DRWB 1HQRB 1Y6KR 3V8OA 5GS0D 4I2XE 4RAUB