3D5OF

Structural recognition and functional activation of fcrr by innate pentraxins
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serum amyloid P-component
publication title Structural recognition and functional activation of FcgammaR by innate pentraxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d5oF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d5oF02
3MFFA 5BZWA 3HE7C 4OKVB 3U79A 2V5TA 2BVUA 4DUWA 1T80A 1MRDH 5FA3B 1Q9LA 4XP9H 2VDMH 4LLQB 2CQVA 1AJ7L 5FB8A 1E0OB 1WVZA 3L3JA 3W9DA 3BN9C 4EOWH 2E7LC 3BQUB 3SDDB 1QFPA 1HSBB 2Y7QB 1Z5LA 2MMXA 3VFGL 4HS6A 2EH8H 3Q5OA 5HVWA 4F7TB 5JXED 3O9WC 4ZFZA 3OZ9H 1YEEL 3V7AE 3O8XC 4QHNA 2Z8SA 4NHCH 2KZ1B 4OQTH 4N8PA 1EO5A 3IYLW 4J3OC 2C3HA 4UT6L 5CEYA 3QP3A 3BP5B 2W0PA 3LKQA 4P23C 1P7QB 2AJZB 1CFTB 4KTDH 4Y4FD 3QG7H 1KACB 3V4UL 2QQLH 3HMXA 1SYSB 5MI0B 1OGAD 2VXVH 1A0QL 3GMRB 4JM4L 35C8L 1TTUA 3TJEH 2X41A 3AB0C 3SGDI 3D39B 1HKFA 4Z7QF 5GGQH 4K7PH 3UO1H 1UFUA 4XPBL 3RWGB 2DS4A 3KPSE 2HJFB 2XI9A 2NY1B 2A6JB 3V7AG 5C0DA 3KR3H 2APXA 3HG1B 3E6FB 3VGAC 4LSUL 1BJ1H 2E8ZA 2DQHL 2VN7A 5CLWA 5EC1A 3VJ6A 3VFOB 2GW5A 2H45A 1S78C 1VKXA 1FYTD 3X13B 4PJAB 5DK3A 3PDGA 4TNWF 3LN5A 1MRFL 2CLRA 4ZG1A 4WUUE 2HJKA 4PRNB 4UIMA 1A6VH 4Q0XH 5DD0H 1MLCA 5EBLB 5T5FH 3VD4A 3VDAA 4JJHA 3HC4H 1I8IB 3QEQA 3HZVB 1MAMH 4G9DB 1KPVA 5E2JA 3VXQB 5IFHL 1DQQB 4L8BA 1T3FB 3CAFA 2F5BH 4IRSC 1F45A 1FV1A 5F97E 2LVCA 3QIBD 3PL6C 5H8DA 3GKWH 1YJDH 2M26A 3WEXA 3RTQA 4RGMB 3MRNA 4HXBH 4LPTA 2EKSB 4D9RE 5K59F 5C9JA 3JZ7A 4KAQL 4MZ3A 5FDWB 3PWPB 5ITFA 1XGPA 2WIMA 4M7LH 4N0FB 2W9EL 2O5ZL 5F96L 3CGTA 4YHYB 1CI5A 2PYEA 1T5WA 4J8RB 4X6DE 3RWJA 3EJJX 4Z5RB 1S9KC 2NY3D 4JR9L 4NQVA 1A7NL 4PJFF 3RBGA 1MFBH 5I74C 1PKQE 1A5FH 4MDJB 1IL1A 1BIHA 3PWLA 3T04D 4JFEE 2R1WB 4GXVH 2CH8A 3RY4A 1U8NA 3ETBF 5MEOA 4RWHA 1MUJB 2XKSA 3EYSL 2R2HA 3VFUA 1TJHH 4WW2B 4WVRA 4KK9C 5GS0L 4PJ5E 3L5XH 3LPWA 2CJUL 3GI8H 2A9NH 3U2SB 4WJ5B 4HKBA 4QRQA 3MREB 2NLJB 5DQ9B 3MV7A 2BOCB 2A1WH 2VXTL 1IZKA 1K5NB 5BV7H 1EFXD 3DMMA 4DKEH 1YC8A 3LHPL 5EZIL 5DJAA 2DQEH 4JFDD 5C0CE 5DFWH 1EEUA 3IGAA 1KJ3H 2EH7H 3VDCA 5GGUA 5TQ2H 2OMNA 3QO1A 1EIBA 4XCFL 2WK2A 3RPIB 3NPSC 5KW9H 1PY4A 4MGXA 4PTUA 4Y16B 2E6PA 2WBJD 1ZKAA 1NSNL 1WZKA 1ORSB 1NFDB 2BVTA 4OFYA 5AYQA 3EOYG 3VXUE 2DQJH 1BBJA 1FFOB 4MLIA 4YHIA 4NUJA 4J1UB 4RMWA 4HKZA 1DE4A 5DT1H 4CN6A 4M7JL 3GDBA 3V4VL 4ZSOE 3DVGA 4I0PD 2IPKB 4ZS7L 5FO7B 4CNIA 4A6YA 3QHFH 5C8JA 3D3VE 3PWNB 4KUCF 1DEEB 3FOLA 1RUPL 3MCLH 5TE7L 2HTKD 5IEKA 5IR1B 2BC4B 5HHMD 1EX0A 2HT3D 1M71B 1E28A 1X6NA 1D9KD 5CSZA 3DXAB 4QNPF 3QDJB 5F6HI 4G9FA 3SEPA 1JRHI 1EO7A 2P24A 3Q3GB 1C08A 1RSFA 2DLEA 3BYTA 3K1KC 5B39G 2FZ3B 4YIQB 1S3KH 4G42B 2E9JA 3QQ3B 3FT4A 4GW1A 4ZAKD 3B9AA 5E2WH 2J8UB 1ZLSH 5A16B 3FQXB 5ICYB 5I8OL 5HI3D 2EXYD 2E8YA 4P4KA 1MCQA 2R56L 5DVKA 3MRDB 3AXLB 4HC1L 3UTPE 1I9RL 3GSXB 1QA9B 3OKNB 2D7OA 1MJ8L 5A3IC 1N5YL 1KXVC 3UTTE 1UWXK 4JCLA 1XCTA 2GSGB 2W65B 5D6CA 2NY0C 5F6IB 5JLZB 4XI5C 3LKNB 3MUHL 5EN2B 1QEWA 4JQXA 4ZUSA 3IXAB 5GGRB 4CUCA 4XNMB 3B9DA 1D5BB 2FATH 4HHAA 4M5YL 3TBTA 1MCPL 2GJZB 1IGFL 2R2CA 5GGSY 2AQ1A 2E9WA 3LQZB 5JORB 3VGFA 3DSFL 2DWEA 4ZXBB 1TJIH 3DBXA 1WBYB 3RNQA 5L88L 1XGTA 5C09D 1YUHA 3QUMH 5TE6L 4P0DA 1I3GL 3NCFB 4OZHB 1FFRA 4JKWA 3VXUB 3QIUA 5DLML 2IH1A 1MHEB 2BHUA 4QTHA 4XPTL 5IF0A 1GAFL 1RZGA 2VSDA 2X4RA 5L2KB 1J8HD 4DN3L 2EO9A 4DGIH 2HH0H 4BH7A 2AV1A 3D9AH 3DUSA 4LLUA 1Q9WB 1JPTL 3R1GL 4YBQC 5GHWH 2BX5A 4NQUA 4UNUA 3VXMA 4Z0BH 5HHNB 2XQBL 3X17A 1YJDC 2J8HA 1GHFL 1ZLWK 1UM4H 3LH2L 2P8PB 4PJCE 3OPZL 4YDVA 1IC7H 4IIQC 4WI3A 1XF4A 2ARWA 4GKNA 1CLYH 2FEEL 5EU7C 3S36H 4FFVD 3C8KA 3WO3B 1TCMA 3MLSH 4OZFG 4JREB 2FBOJ 5C2BL 2XNAB 4QLRA 2VLJA 2GK2A 1GZQA 1P5VA 5T1LD 1P1ZB 4MD0A 1JNHB 4MSWB 2NTFB 3HS0A 3ESVF 4MA3A 4TRPL 4ONHA 5I1IL 1FNSL 3RVWC 4KDVA 1UT9A 3G6AA 2JB5L 2CDFA 2GHWB 4XTRC 2DQTL 1LK3L 2A77L 3O6FC 2PYFA 1X7QB 4O4YL 1S7VA 4ZO8A 2FBJL 1ES0A 3C60D 4LL9A 2Q1EA 2NY2B 2BVOB 5HDQH 4ZFGL 3HI5H 2DTML 5DMKB 3H0TB 2PN5A 2UYLA 3PP4L 4XMKL 4C58B 3N85L 5C0FA 3ULVE 3BWAA 2IPUK 3MOAH 3WE6B 5BZWB 4XVSL 4CU7A 2ZPKH 1YYLH 4UTAH 4Q9RL 5JOEA 1I9IL 5D1QD 4KI5D 3SDCC 2AI0L 3VRIA 1KG0A 5IBTH 3PJSB 1Q9LB 2E7CA 1FZOB 4OFPA 4UB0H 1UWGH 1WT5C 5FB8B 5K9JH 3L3JB 1Z3GH 3TT3H 1AO7A 3VFSA 1FBIH 4HS6B 2X5PA 1TJGH 1S7SA 4HLZH 3WN5A 1F4XH 3IAGC 4QHNB 1QBLL 1N26A 5DS8A 3PDOA 3G04A 1UQSA 5CEYB 5KSBF 4JZJC 2YPLE 5EU6D 1DQLH 4IDJH 4OV5A 3ZKNC 5IMLA 3LV3A 4JEGB 2MCPH 2EC9T 2PW2A 5ECJE 1MJ7H 4Z7UF 1SBBA 4ZOCA 1K8IB 3CMOL 2JKXA 4HKXA 3ARDD 4G6AC 4PJCB 2WANA 4P2OA 3TH3T 2D4FA 3QQNA 1AKJA 2D7TL 2WP3T 3MO1A 4H1LG 1DBML 5C0DB 4U7MA 1R5VA 5DDHA 1BZ9B 3GK8H 4YZFF 3T8XB 3T0VA 4K8RH 5HVHB 1RU9L 1YDPA 5IB3A 3ZDYE 5EC1B 2FX8L 4HUVB 4XCNB 1FNAA 1T7VA 3C5ZA 3WNKA 1R3KA 2CR6A 2NY4D 4L8SC 3RI5F 5GISH 4BKLA 12E8H 1CDUA 1UCTA 2Y6SC 5D7IE 5I17A 1WC7A 4U1MB 1DVFA 3QBTB 5I8CB 2HJKB 2R4RH 5FHBL 3N1FC 4O9HL 4CKVX 4B41A 5B8CC 2G2RA 3RZWA 2CRYA 1KPVB 1EZVY 3ARFD 4HEPG 4NWTL 5I1LA 5AYUL 3MLPA 4XC3L 5IT2H 3ZE0E 1P84J 4XWOC 4PJDE 5CSBA 3FO2A 4NSKB 4JRWA 4MB5A 1KC5L 3EO9H 5ITFB 1XGPB 1I3UA 1G7PA 3MGOA 2PYEB 3CPLA 5FUOL 4NC1E 3RWJB 3V4PH 1YA5A 1VEOA 4NQVB 2HLFD 4RMSA 4KKBC 3RWFB 4YXLL 3PWLB 1J0IA 4PLKC 4LCUA 2OL3L 4JKLA 4FQPA 3OG4B 4HCRA 1U8NB 3OAUH 4YAQB 4U05A 2FWOB 4PJEA 1XF1A 4LSVL 2V5MA 4AT6A 2GIYA 3UJIH 2UV3A 1NANI 2F5AH 1ETZB 5F1NA 3MYJA 3WFHA 1MF2L 1G9MC 1WFOA 1MH5B 4ZO9A 4FFZH 3RA7H 4EUPH 1YMHA 3VXSD 4L4VD 4N0CC 1PY9A 5AD0B 4ESKA 1NKOA 3RZCB 4HKBB 4NQDD 4QRQB 3W39B 4XVTH 4HJ0D 1A3LL 1FP5A 5BRZD 2LU3A 3MRMA 4GRLA 1YN6B 1G7MB 1K8DA 2ADIB 3MV7B 2CRZA 5C6WH 4PY7A 4EXKA 1HWHB 1NCTA 2BDNH 1ZV5A 1EXUA 3AM8C 4Y19D 1NMBL 5DJAB 5E2TH 3TO4D 4OCMC 2A74A 3P3YA 3C2AH 3IGAB 5GGUB 3HC3L 3MLXH 4ETYA 4OT1H 3LS5H 3VFWA 1DLHB 3O4LE 5CJQH 4PTUB 3IKCA 2BZDA 3L95A 5AZEH 2V5YA 1A7QH 4O02H 4YHIB 3MRHA 4NUJB 4TSCL 4BZ2H 4JHWH 3G6JE 2Z92B 2HFGH 4GMSL 4HKZB 4PJGA 1QOKA 2NZIA 2ZUQC 3SDYL 5DJDB 4X6CE 4MJ4A 4KKNA 3ZSSA 3MODH 4JAMB 4Q58C 4UMGA 1C5BL 4U1IB 5EZOL 4R8WL 4OM0H 3U46B 3G08B 1Q94B 3SCMC 2JIXA 3U6RB 2I60L 4FXGA 2HTLD 3BGFB 3SGEI 1MQKH 3AAZB 3SN6N 2B4CH 4MQ7B 4AMKL 4YHKH 4OF8A 4JM2C 1MREL 4G9FB 4GAJH 1G7IA 1G6RA 4HQQL 4OLXL 4NQSB 1LDPL 3QFDA 3V52H 4LQFL 1C08B 1F11A 3LEVL 4G5ZL 4KZDL 1U93A 1KPRB 3DI3B 4BUHA 4XXCA 3P4LA 2OP4H 2XKNA 3CFJA 4ZUUB 3UC0L 4W70A 1KB9J 3ULUD 4P46D 4D94A 3T0EC 4NFBA 4NP4H 4LRIC 5KVGL 4JPKH 4GRMA 1E4WL 4P4KB 1KB5H 4KK6D 1AXTH 1OQXA 1NCCH 3UBXG 2X9XA 3SBWA 1M7XA 4WI9A 2X4QA 1LD9B 1UB5B 3T1FB 4PFEA 1IAKA 4O2EA 2AV7A 2M2DA 1RPQA 5F93C 4AEHL 1JRHL 4KKAC 5FGCE 2BVEA 5EORH 3QJFA 1IT9H 3I84A 2RCSL 5T1KB 3CFCH 2VXUH 2IGFL 4ZUSB 4Z7OE 1RK0B 3DUUA 3WXVL 1TCRA 3GMNA 2X4SA 4HHAB 3GB7A 3TBTB 3MACH 5AG9A 5IW6A 2FCBA 1BJ1J 1XF3A 2Z31B 3DI2B 4K8RC 1NUFA 4PJHE 2DWEB 1BGXL 1HHIB 3I85A 1YEGH 5I1GL 3DBXB 3WCYA 1T1YA 3RNQB 1HDMA 1XGTB 4G8GB 3CK0H 4ZUTA 1EEZA 3VG0H 2WWKO 5F1OB 1LO4H 4LASH 3NCYS 3OJVC 5CGYC 3BT2L 3QIUB 1Q1JL 1LMKA 3HC0A 5GRWA 3O2WH 4QTHB 4FZEL 3VGEA 5D2LF 2QL1A 2X4RB 2CKBA 3TBYA 3DPBA 4RMTA 3EYVB 1KJVA 5DHXB 4BH7B 2AV1B 5FYJU 2DYPD 3GM0A 1FPTL 4B7IA 1W72L 1IAMA 3GSNH 1TIUA 5FUZL 4L9LC 5FHAH 2X1XR 5HPOA 4XCYB 2CO7B 1AQKL 1J1XL 1S7WA 1PQZB 4MA7L 3MRLA 3ZTNL 1IILE 3BKJL 2ZJSH 4JFXB 4N0UE 5JO5B 4MJIA 3IXTA 3W2DL 1S9YA 5D5MF 1AGBA 2VLRD 1JGEA 2IALA 2IAMC 3D2UB 4KDTC 1RIVL 2R2EA 4LRNL 1JGUL 4X98A 1BMGA 2HKHL 3QRFM 4JRXD 2VYRE 4NNPL 5AWNH 2NY6D 1NDMA 4E0RA 3T0DA 5ACZB 3VRLE 2W60A 5E9DA 2D0GA 5K9QI 3BX7C 4JVWA 3R0NA 4H5SA 1UZ8A 5KOMC 3D25B 4KUZL 4TQEH 5D71L 2CDFB 2F53D 4KJPD 1DBBH 3QUYA 2PYFB 1S7VB 5DEGA 3IFNL 4HPOH 4MYWB 1ES0B 4OD2A 4Y5XB 5ALCL 4OIAA 2NX5A 4R26L 3SKMA 3GRWL 3F7VA 3A6OA 2VAJA 1WITA 5C0FB 1YMME 1OGAE 1UKSA 4J7RA 2MQCA 4KKCC 1YQVH 1R3IH 4I5BA 4PJXB 1KG0B 4JZNB 1ZHNA 3KPLA 4CU8A 3GSQB 1S9WB 4AYFA 5GGSB 3T2NL 4X4ZA 3GNML 4K3HA 3MXVL 2PO6C 4LOUD 5IB5A 1AO7B 4WFGD 5HGAA 3VFSB 4IRZL 4Q9CA 3RP1A 2NW3B 5I8EA 1S7SB 4UUJB 4JFZH 2W9DH 2I5YH 5EG6C 4JG0L 3WUZA 1C8PA 4ZNCD 3F62A 4FZ8H 4LCIH 4UOJA 1KTKE 5HYFA 3G04B 1UQSB 5CIPA 1ZHBA 4HBCH 2R69H 1FYTE 1EPFA 3TBSB 2F8OA 2FJFB 4MAUH 3L5IA 4OFDA 4OV5B 1N64L 1N59A 2DBLH 1RV6X 2AAVA 3IDYB 5E5UB 3KPRD 4U6VL 4APQA 5CJOL 2Z93B 3MBED 1CGVA 3BZFA 3FFCA 3ULUL 3CVIL 1KJMB 1WEJH 3DO3A 3FN9A 3LDBC 5DWUL 1K6QL 1PEWA 4P2OB 5EPMA 1TLKA 4WV1A 5JA9A 5L7XL 4Z7WF 2Y36H 2B4CC 1FL5A 3MA9L 5IROC 1OTUC 3VD5A 3PIQA 3MLZH 3S8WA 1TETL 3THMH 2CO6B 3SDAD 1R3KB 5GJTL 5IVXA 4RX4D 3UYOD 3WNNA 15C8H 2BCKB 4KJQD 4BKLB 2BXYA 1U3ZA 4KTYA 4DQOL 1NBYB 5LG1A 5D70H 2IMNA 4OCNC 4OSUH 4DVRH 2FX7H 1DVFB 1S7RA 4YHOH 4OB5L 4NKIH 2A6IB 2VDNH 3LMJH 2F8XC 3QNZA 3KPSA 1Y6NR 3UTOA 3MJ9A 2EICA 5MI0C 1F3RB 1DL7H 4Y1AB 3IAPA 4NKDA 4U1GB 4M8VA 5I1LB 1OAKH 5EUOA 5ENWA 1QZ1A 3JWDL 1IGCH 1YMMB 1FL6A 3MUZ1 1PG7L 4WO4D 4TVPD 1GGBL 3IFPB 3MJ6A 4W4OA 2AP2A 2GEEA 4OZIA 1ED3A 3MZTA 2YK1H 1E27A 1XR8B 1G7PB 4LAJH 3NCJL 4WUUA 3ZKSD 5BS0D 5DA4A 1KT2B 2X42A 3QWOB 1U8MB 4JFDE 3I50L 4KMTH 1CL7L 1JV5B 1DQDL 2GTZA 1RUQH 5DRNA 2JJSA 4PJEB 5L6YH 1AH1A 3BJ91 1ACYH 4Z77A 2ZKHL 3FL7A 2X9WA 3HE6B 1X5KA 5JQ6L 2D31B 3IDNA 5I0ZA 1S8DA 1KPUA 1U3YA 1YMHB 1D6VH 3GIZH 3IDIA 1W8NA 1EMTH 1KIQA 3RWDA 3KPMA 4X6DA 5I1EH 1CD8A 1N6QL 3WHE1 4GRLB 4WCYL 1S7TB 1K8DB 1F8TH 1HXMB 4PY7B 1PKQA 2ICWJ 5KVEH 2AXGA 5IQ9B 2EYRA 3QG6B 4NJ9L 3LZFL 4Q9QL 4Z95H 4U0QB 3ZDZF 4JFEA 5EZJB 2EDLA 4FFWC 4PRHA 2ED7A 2R29L 2A74B 1IQWL 1CICB 3CVHL 3O0RL 3MCKA 3HAEH 3HB3D 3BAEL 3JUYA 5TPWL 5IFAH 3TESA 3NABL 4HGWA 4HFUL 4MJ2A 3IKCB 3MOQA 2D0HA 4LCCA 1MRCH 4PJ5A 1INDL 4JDVA 3EOTL 3VRJB 5D1ZA 5HHXH 1KELH 1IKNA 2EDQA 2YD7A 43C9A 2XWTA 3O3EB 3WSQL 5JHDD 3VXOB 4XNXH 1SJXA 4PJGB 4N5EC 4L4TD 2Y5EA 3MRGA 2IPTL 2GUOA 4WW2C 4LHUG 3MNZA 1TDQA 1MELA 1UVQA 1J0HA 3MQIA 4Z7VE 4YHPB 3SO3C 4P59H 4XVUC 3UCRA 3V6OE 5D8JH 5C0CA 1A6AA 3BDBA 3RDTC 5T5NF 5CILL 3RVTD 1OT1A 4UDTA 5DYOA 2JIXB 5ITBL 4FXGB 2VRAA 3FQNA 3EYOA 1G7IB 1MCDA 3KG5A 2YUWA 3QFDB 3HI6L 1F11B 3VWJD 5J3HD 5TDPA 2AK4A 4FFYH 1CTNA 3Q1SL 5GS3A 2XKNB 1T0NB 4L3EB 4ZSOA 4WUKH 3CFJB 2RQ8A 5E95B 2DQIL 3FB5B 5IB1A 4RFOH 4HG4J 1ZLVK 3MFGB 4OD1H 1LNUA 3O41B 2B2XL 5DJ0A 2FO4A 5TFSL 5I66A 1HNGA 4NRZA 5C09E 4LSPL 3H9SD 3MRFA 4JHBA 3TJHD 1HH6B 4P2RA 1T83C 5B4MD 3ZLQC 5ACLA 1IGYB 3C5JA 5EO1B 1GGCL 3HMXH 4OGZA 2IFGA 5E4IA 3ET9F 5CD3A 1BD2A 3U82B 4OGXH 1J8HE 5EC2A 1CU4L 2NZ9C 3SE8L 3M8OH 3DUUB 3TIEA 1TCRB 1PLGH 4YQXH 3G5VA 3PWVA 1JNLL 1BOGA 3HTLX 4LLMA 3SGKC 3VFPA 3CXHK 4ORGA 1XF3B 4U3CA 4Z76A 3PGFH 4PJEF 3NAAH 5KVDH 3DIFB 5CGTA 5GRJL 3TN0D 2PXYD 1DTUA 3CSPA 3L3HA 1HDMB 5DFTA 5BO1H 4KGLA 4X7TA 1WQVT 4ONGL 1E4KC 4ZUTB 1EEZB 4HWZA 5FYLD 1KTRL 3L9RB 4D0CB 4DGVH 4D0BA 5DJCA 1ZHKB 4GW5A 1GOFA 3HC0B 5ICXA 3UAJC 4NC0B 5IV2A 5IHBA 4OZ4A 3QWRD 2CKBB 5KVMC 4MJ6B 3UPAA 1JPST 2AJVH 4K2UL 4TTDD 2P8LA 3QUZC 1HE7A 5I75C 5TF1H 4GKOA 4ZUWB 4XNUL 3LCYA 3H3KA 1PDKA 5F70A 1WK0A 3DECA 1KEGL 4XH2A 2HRLA 3NN8B 1E6JH 4GMTH 1CDJA 1S7WB 3NIFE 3PABA 4IRJD 3H9HB 5ILTL 3GO1H 2H6PB 4ZFOA 1YNTB 5EU4B 1C7SA 1KGCD 4NQCD 3D85A 4MJIB 4XMPL 4NUGH 2O61A 1I85A 4MQSB 3LS4L 1JGVH 2HT4D 2IQ9L 3WFZA 4DGYH 4OZFA 4X99B 3OKKA 4XAKD 1FL3A 3NH7H 4KI5E 4OCYL 4X98B 4HH9B 4I9WD 1NDMB 3I6KA 3JUZA 4ELKA 4E0RB 3RWCA 5CP3A 5E9DB 4TULH 5JHLL 3HZYA 3L5WB 2W0FB 2Q7NA 1R0AL 1IAOA 1QSEA 2X4OA 4B5EA 3M07A 3QXAA 4ODBD 3PUCA 2DAVA 2EDNA 1GPOL 3QUYB 1IEHA 2RHEA 4XNYH 4H20H 4EI5A 5DJ8A 3HZMB 5T3XL 3BD3A 5DSCA 4H8WC 2FHFA 3EFDL 4AENA 5EU6E 4OLUH 3HUJE 1BVLB 5DQDL 4F15C 1L9NA 3F7VB 2XZZA 3N9GH 1KCRH 2DD8H 5J12B 1PGRB 1HHKA 1XIWD 5E4EC 3MLTA 2X89A 4NM8L 5CBEA 3RL1B 1KTLB 4LEXH 3KPLB 3U0PB 4LCYA 1CDYA 4UU9B 2X1WL 5HYIA 5HPMA 1QFUL 5ANMA 4YDKL 3UTQB 5F7DB 1FJ1B 3H7LA 5HGAB 2CRMA 2QR0A 4GH7B 2WZPD 5I8EB 3FB8A 3MRIB 3FN3A 2HKFL 5KS9E 1IM3A 3TNMA 1MHCB 2FJHA 3JV4A 1CFQA 3ARZA 1MCOL 5DRWB 4MX7A 2XA3A 5LVEA 3OX8B 5CAYB 1AGDB 3BMWA 4PY8J 5KZCD 2YRZA 5C0BD 3MLWH 4PG2C 5D7SL 1U8JB 2YD3A 1X5AA 3GI9L 4JG1H 3IDUA 4PJ9A 4EQ3A 3KPTA 1GOHA 5ETUA 2GYSA 4WI2A 4PV8A 3PGDB 1Q9OA 5FKPA 3W82A 4A6YH 3FFCB 4HUWA 4M1DH 4ZTPL 2KL6A 5HY9B 3GSOA 3V5DB 3HPLB 3S98A 3BYYA 4E5XA 2VH5H 1XAUA 4RBPH 4CN1A 2E7HA 2FH8A 1OW0C 4H1LA 1FL5B 3FO9B 4NQEB 1N3NB 1T0PB 4Y7MA 1KCUL 3MMEA 4ENEC 4G43A 2MKLC 1BWMA 3GMLB 3Q6GL 3IF1B 3RWEA 5EOQL 2J6EL 4W68A 2BNRA 2CGRL 2IAND 3WXWL 5IVXB 2VDQH 1I1AB 3FHAA 4UV7H 2CDGA 3WFDL 1OTTD 5SV3A 4HIXL 4HJGA 4P2QD 1M7DA 4UT9H 5I1AA 1OHQA 3N06B 4RAVA 4K3JH 3WYRA 1QLRA 1WLHA 4S2SA 2FNBA 3TWCL 1BBDL 4P3CH 2PR4H 4HSQA 1BM3L 3SPVB 1CGSL 2AJSH 1MIEL 2DIJA 5EUOB 1T66D 3NFNA 1HHJB 2YD5A 2C3XA 5IHLB 1DUYA 4AJ0A 1K4DA 3IDXL 4OZIB 4QTIH 5FF6B 3B6SA 4NQDE 3QA3A 1BOYA 3RKDC 1ED3B 2DLGA 5BRZE 2FR4A 2VLKD 1E27B 2X2YA 3HI1B 2B0SH 1R3HA 4QF1A 2FX9H 4K9EH 1TVBA 2J2ZA 5K9KA 3FAXA 4Y19E 2BFVL 3AROA 4LVHC 1RJZA 5D6DA 2UY7A 3LEYL 4M1GL 3MRKB 4P4RA 25C8H 4PJ8A 5F7MC 5DVMA 4P9MH 5FYKH 3V4UH 5DRNB 2EECA 3TV3L 3TVMD 1CLZL 1UEYA 2YUXA 1JN6A 1BF2A 4TUOA 2VOTA 4FNLL 1OARL 1U8IA 1WICA 4M02A 3NBNA 4MXQD 2B1HL 4J4PD 3KJ4B 3IDNB 1KPUB 3IDIB 1KFAH 1KIQB 3RWDB 1LE5A 3QCUH 1FAKT 5DI8B 3D18A 4Z7NE 5GQBA 3RTQC 4Z6AT 4MA1B 2AXGB 3NCYP 4P5TA 4PRHB 1WBXB 4XVJL 1IKFH 3TGXA 4OGYL 2QADC 3U7WL 3MCKB 4PJIE 4NOFA 1KLUA 2APBA 2R0WH 4HGWB 1CDCA 4OZGA 3HMWH 2Q8AH 4JDVB 5D1ZB 3NGBC 4OM1H 1OP9A 5D7JA 5DA0B 4X8XA 3KJ6L 5JOFB 2C1PA 4HT1H 3M45A 2XWTB 2XTLA 2MQ3A 2XFXA 4NO3B 5FGBA 1W72B 3BPNB 3ULUE 5GRUL 3QHTC 5B3NA 3MNZB 4DFIA 1UVQB 4MA8L 4DW2H 3BESR 3WUWG 4RIRA 1A6PA 1V3MA 3OAZH 4X7SH 2ERJB 3F7RA 2BMKA 1E6OH 4GS7C 4OLWH 4X4XA 5TDNA 1WBZA 3A6CL 4RAUA 5LWYH 1IC5L 3BH8B 4ODSH 3BIAX 4KY1H 3QDMD 1MPAL 4L4JA 2BHYA 5JUEL 2MJWA 4D0DA 3DMMC 3U4BL 1EV2E 2PNDA 2DQGH 3RGVA 3U0TA 2W0LA 3EYQD 2N7AA 4N8VG 4NQXB 5DURB 3RHWK 4U3HA 5ESAA 2Y5TA 4YC2B 4JQIL 3G6JA 4H25B 2P8MA 5TDPB 4LLVB 1HEZB 4LLAA 1X5HA 1YEHH 2DQDL 2A83A 2Q87A 1KF9B 3VH8B 3OQ3B 4PRAB 4YBQD 1P4IH 4CMHB 1QKZH 4FG6D 5C07D 3T4YB 1LNUB 1E4XL 4UOW0 2ICWI 3MV9D 5I66B 1KYOJ 2P5WB 3LKRA 4PJ7B 2PCPB 3UBXA 4E41A 3F8UB 5EOTA 4OZIF 3RY6A 1NMCB 4KVNL 3HRZA 4FRWA 2X4PA 3MZGB 3WS6A 5KJRH 2IJ0C 4WY7L 1BD2B 3PV7A 4HWEH 3U7YH 2VWEC 4UILH 3O6ML 4PD4K 2ESVB 3FN0H 4LKCA 5KTEL 2XN9B 5T3ZH 1ZHLA 1EEYA 4KGJA 1J88A 2R0KL 3PWVB 4K3EH 2ARJQ 1BOGB 4LCWD 3VFPB 5BJTA 4MQXC 4K23L 4ORGB 1NUDA 1DQTA 5CEZL 3F7YA 3LQMA 4NM4H 3MV01 3QCTH 2OJZL 4J6RH 5CD5D 3GSVB 5K33A 2VLRE 3CDGA 3BKYH 4G6KH 4UQ2B 4PBVC 4XP5H 4HWZB 2NMSA 2P42B 1S5IH 4JRXE 4M7JH 5SWQA 3FRUA 4X6DF 2JF1A 5ICXB 4PLJC 4AEIL 1YY8B 5IV2B 1KIRB 1I8MB 4OZ4B 3KLHC 5E5MA 1UEMA 1RUPH 4S1SL 3SDCD 1RUKH 3O11A 4QHUA 2F53E 1OGTB 2CLVA 3ARGA 2DLIA 4XPFH 4ZMAT 4BK4A 1A7OL 3G6DL 5EUKB 1FC1A 3B9VA 5FA4A 1PZUB 4PJHA 3TYGL 5BVPL 3PABB 3PQYD 2VISA 4JQXC 2OTUB 2XY1A 4UQ3B 1A3RH 2BK8A 1NGXA 4XNZC 4UAOC 4OD3H 4PRPD 3TT1H 2O61B 2RBLA 4XP9L 2VDML 4K9EC 4OZFB 3OKKB 1J11A 1CLOH 4EOWL 4OCXH 5CINH 1DLFH 5F9DC 4ELKB 2EH8L 2ICEA 1JI2A 1U95B 5I8OH 3QCVH 3E6HA 4JN1H 3OZ9L 1AQDA 1JF1B 3BZ4B 4WFGE 3MNVA 1IAOB 3MV8D 4JFOB 1QSEB 4XX1E 2X4OB 4NHCL 4OQTL 2V7HA 4HCRH 3QXAB 2G75A 3UYPA 5FECA 3QIUC 3V5KA 4G6AD 5FYJH 1UXWA 4JFHE 5ID0B 4EI5B 4KTDL 3QG7L 3WMSA 2VZOA 2QQLL 4KDWA 4F80A 4AL8H 4DAGH 2VXVL 4AENB 5HXMA 4G6JH 3TJEL 2HFTA 1VENA 3UO1L 5GGQL 4K7PL 3L3KB 2XPGB 5CSGA 5KN5A 3EKCA 1QFHA 1MCPH 3FRPG 3KPRE 2XOTA 3MLTB 5GSVB 4WTZG 2H32B 3MA7B 3ARED 2OQJA 3OKLA 4LCYB 4XX1G 3KR3L 1RVFL 3LB6D 5ANMB 3MJ7A 5JXEA 3U7AA 3O9WA 2XWJB 3LQAC 4JFFD 4MAYB 3O8XA 5LAXA 1U8OA 1Y18A 2GJ6B 4WEMB 3DSNA 3I3DA 3FB8B 2CRIA 3JV4B 1CFQB 3C09C 1QRKA 3IKKA 4MX7B 2FLBT 1CIUA 1A6VL 3LD8B 2RFXA 4OIIH 4Q0XL 5DD0L 5T5FL 1J5OH 3ZMRA 3HC4L 4PJ9B 5L9DL 1MAML 2NXYC 1RD6A 4K94C 5ETUB 4PV8B 3CH8A 5FKPB 4GKZA 2F5BL 4HUWB 3GSOB 3K7UA 3GKWL 5IJKA 1KLGA 5DC9B 2H2PD 1YJDL 2E9BA 3V9FA 4CMMA 4HXBL 4JPIB 4LF3A 1TPXB 1FZMB 3UTSA 1NAMA 3CVHB 1WCQA 3E2HB 4TVPE 5DXWA 5EIIA 3DO7B 2Y9RT 1G6RH 1XF5A 4KRPC 2FEDC 4JDZB 3UJTH 2DLHA 4RFNC 1LO3H 2WSKA 2BNRB 4TRPH 5SWZD 4V2BA 3IJHA 1AFVH 1YEDA 1MFBL 4QHKJ 3WN5C 1LWRA 4KKLC 1A5FL 5BS0E 2WWMC 4PREB 4O4YH 2Z9TA 5DTFB 1G9EA 4GXVL 2AEPH 5J1SC 4PTTB 4N5UA 3FQRB 3MYZA 2W1NA 1MVUA 4BQ9A 5ISZD 3QIBA 4BFBD 1TJHL 4G3YH 2VABA 4LLYB 3DGGA 4D8PB 3GI8L 2A9NL 4TYUA 4K7PX 1YNLH 5H37H 3OJ2C 3UDWA 4R96A 1DUYB 1MFAH 2A73B 2A1WL 3OAYK 2NCMA 1K2DA 4PY8I 5BV7L 1RK1A 1IQDB 4NCC1 4DKEL 2AJ3A 3QXWA 4HZLA 5IVNA 2DQEL 1TVBB 4U1LA 1UENA 5FOBA 3VW3H 1KJ3L 1QBLH 2EH7L 4BQ6A 5TQ2L 1I7ZA 2GY7B 3C5ZC 4RGND 1KENH 5DO2C 5KW9L 3TZVD 1H3TA 2VXSL 2VUOA 4X0KB 2UUDK 4R4BA 5ESVA 1F02I 4XPHH 5AAMA 4IEFB 1NGQH 3E3QE 3QPQC 1DVFC 3OHXA 1OP5K 2DQJL 3FB7A 4YJZL 1U8IB 1K4CB 5HBBA 5JZ7D 3O45B 5AUMB 5IIEA 1EVUA 5E56A 1L4IA 1M4KA 4Y4KC 2CKBH 5F9JB 5JHDE 3BUTA 3PNWA 2YD8A 3QHFL 5DVNA 1CF8H 4L4TE 2D7TH 2X1PA 3MCLL 1DBMH 3HPJA 4IMLA 4RNRA 1UWXH 2GCYA 4K7FA 2YZ8A 4F9LA 2Y07H 1NC2B 3ULVF 4YWGH 1UH2A 5GZND 2WBJA 4JANA 4L9DA 5FFLA 1HH9B 1JK8A 1BEYH 4O2CA 4N90D 4QOKD 3MRCB 1S3KL 4ZQKA 4OZGB 3RUGA 1MCIA 4QXTB 5K9QG 1F4AA 1Z0NA 3OKDB 5D2NA 5D7JB 5HI5C 1G7LA 2C1PB 5E2WL 4M1CD 1ZLSL 4ZFFB 1IAII 3WL9A 4I18A 2Q76A 1QLFB 1N8ZB 2YD2A 2V2TA 4XC3H 4LHUA 2W07A 2FSEA 1I3RB 3H9SE 4GBXD 4RIRB 3UX9B 4X4XB 3RVUD 2BMKB 1G7HB 1D9KA 4HUKB 4LARH 2CR3A 5E0QA 4RAUB 1OB1B 1UWEH 4QEGA 5FIEA 4AH2B 5CWSA 5F9WC 3IDJB 1F4YH 3SQOH 2FATL 3NA9L 1S9VB 4KXZH 4XZUA 3U0TB 3B9KA 4S1RH 2X05A 2V2XA 4AG4H 5ESAB 4J3VA 5E1HB 3C6SB 5HHVH 2V9RA 3MROA 4ZAKA 2VB5A 2A83B 4Z7VA 4G6MH 5DJYB 1VEMA 5I6XB 4NO0D 4OCRH 3QUML 1JPFA 5C7XH 4NYLA 3ZDYF 1SJHA 5CIPH 3INUH 1HI6B 3LKRB 1IC1A 5IB2B 1WV7T 5GRXG 4E41B 1I9JH 3I2CH 4YK4B 5D7IF 3QIWB 3HRZB 3K8KA 4NWUH 4DGIL 3D9AL 5GHWL 3GHBH 3JTSB 1FG9C 3VGDA 4Z0BL 1T2QH 3PXJA 1YPZE 2ADFH 1ZK9A 1UM4L 4MVBC 3VFVA 5F1IA 1IC7L 4LKCB 1NBZB 1ZHLB 1EEYB 2YHGA 1CLYL 2R0ZH 1MHPH 3S36L 3KAAA 1AD9B 1KGCE 4NQCE 1MFNA 4H88H 5E8EB 4FXLA 5DZNA 4OLYH 3MLSL 2DKMA 5C09A 1P7HL 3CNKA 4PJDF 5I71B 4XXCC 2GFBA 3QXTA 4U1HA 4R97C 2FGWL 5IQ7H 1BQSA 4PJBB 4XAKE 5GIRB 1A9BA 2AS5M 3SDYH 2MQ0A 4I9WE 1J8HA 5C08A 4Y4HD 5CZXC 3SBWC 1GOGA 1LE9A 1U8KA 2IADB 4M6OH 5E5MB 1T22A 4JDTH 5C0JA 4NNYA 1YEFL 5EZOH 5C0AD 4ZDHA 1FLRH 3MJ9H 1QO3A 5HDQL 3HI5L 3P9LA 2D7NA 3S9DB 2WBKA 3VXTB 2ITDB 1QSFE 4L8CB 2NXZC 4RGOH 3VCLA 4XHJC 3MOAL 1EUUA 4RA0C 4U2ZA 2ZPKL 1YYLL 2M1KA 4UTAL 4EDXA 4TNVK 1J0JA 3BZEA 5HHOA 5IBTL 4QRTA 3DX8A 2BRQA 1UWGL 4UB0L 4U33A 5K9JL 3QISA 3KNBA 4V1DA 1Z3GL 2R2BA 3TT3L 1NBVL 1FBIL 2DL2A 3P9MA 2ICEB 4ZS6C 2Q7YB 1TJGL 3D5OF 3TA3C 1AQDB 2OJEB 4S0TD 4XBGA 3O6FA 5BOZG 4BYHA 1U3HD 4M7LT 4M93B 1XH3A 4NBZB 2G75B 5FECB 3PDDA 4NN7C 2AQ2A 4AEHH 1HOCA 4IDJL 4MWFB 1X5XA 2XT1B 2R1XA 4YHZH 1QFOA 3CXDH 2MCPL 3ARBA 3RIAK 1XGRB 3HE7B 1OTUD 2G9HA 1MJ7L 5D1QA 3G6JF 3DETC 3BQUD 5HI4C 3SDDD 3LEXB 2IMMA 4TN9A 1I1FA 2BSRA 1UG9A 4GQ9H 5FCUH 5HHPA 4X6CF 5J6HB 3T4AA 3WHE0 2OQJB 1VERA 4HIEA 3K4ZA 3L3IB 3S36X 3GK8L 3O9WB 5LJYH 3FFDA 1L0QA 4K8RL 4GG6B 4HBQA 1T21A 3O8XB 1P7QD 5LAXB 2YN5A 1U8OB 3RVXC 2DBJA 2CK0H 3BW9A 3BMVA 4LVEA 5EU6A 5GISL 4P23B 1NKRA 3DV4B 12E8L 3D39D 2IANE 5IBUG 2A2QT 3GMPA 1A14H 2XZAH 2YD6A 2EKJA 2R4RL 2KUTA 3NVQA 2GJJA 4PBWD 5DK2A 3AB0B 5T1DH 2RFXB 4P2QE 3ARPA 1BQHG 1GH7A 2NY1D 4HS8H 1R24B 1AQKH 1F4HA 3ARDA 3KXFA 1W0VB 2P5EB 3CZFB 3HG1D 5EA0H 3CU7A 3R06A 4L29B 4YUEH 1QSFB 2NY7H 3OB8A 1F3JA 1ND0A 5IT2L 3V79C 2HFEA 5CEZE 3DRTB 5JNYB 3W9EB 1EGJA 2R0LH 3VGAB 4LF3B 5F7UA 3UTSB 3X3GH 1NAMB 3GGWA 2JCCB 4FQQA 3DLQR 4OLZH 1AHWA 4LGSB 3FCTA 1QP1A 2BY1A 3EO9L 3P4OA 3L3OA 3MR9A 1XF5B 4EVNA 2UZYB 4Z7OF 1BFOB 5J11C 3V4PL 3IJHB 1YEDB 4KUZH 4OF5A 3VA6A 4BFIB 2YPKA 2JELH 4PJHF 3T77A 5ALCH 1QFWI 1A1NA 3OAUL 3CXHJ 2GAZA 2UZIH 1YN7B 4IRSB 3ARFA 3UJIL 1JFQH 3MPCA 1INQA 3PL6B 2F5AL 4U2YA 2VABB 2BXZA 4APQC 4FFZL 4JY6A 1LVEA 3PWPD 3RA7L 3X14B 4WWKC 3B2UC 2ADJA 3OV6A 3ILQD 4XVTL 2I25N 3T2NH 4R96B 4XCCH 2PUQT 3EJZC 4KK5D 4WV1C 4ZPTB 1GRWA 2BVPA 2BDNL 4JKMA 2K7PA 3VD9A 1KCLA 3SKNB 2AJ3B 4LBEA 32C2A 5I74B 5E2TL 4U1LB 5FOBB 3TNNA 3C2AL 3CLFH 3MLXL 4OT1L 3FZUD 3LS5L 4KQ3L 2R1YB 1UM6H 4IDLA 2ZUTA 5CJQL 2GT9B 3PHSA 4X7FC 5T1MB 1T7XA 1M05A 2HMIC 5SWSE 4XPGH 1CXEA 3OHXB 5AZEL 3FB7B 4O02L 4BZ2L 3NFSH 4JHWL 2HFGL 3VXSA 4L4VA 3VRLF 2DIBA 1MFCH 2EYSA 4YO0B 2CDEB 3BIBX 4NQDA 4OCWH 3QH3B 5BRZA 1RUAH 2VXQH 3QRGH 3MODL 1VGKA 4QHKI 2BVYA 5E2VL 4IMLB 4OM0L 4F7MA 4Y19A 2R23A 2GCYB 3AM8A 4K7FB 4LLWA 4W4OC 3IFOA 3TO4A 3QEGH 4Y16D 4NHUB 1N4XH 1MQKL 2B4CL 4QHLB 1TNNA 4YHKL 4YHMH 1A1OA 3NPSB 2CIIB 4GAJL 3ULSA 3QDME 3AS2A 4JANB 4OZFH 3V52L 4XCEA 3D1MC 1AD0B 5KBNC 2OP4L 2VAAB 3RUGB 5CP3H 2VLME 4PRDA 3SQBA 3VMPA 4DCQB 4M8QA 5IG7A 2CLZA 2WINB 5D2NB 4BQBA 1N6VA 2JJSC 3WNPA 3D0LA 5DJ6B 2WAHA 3WDIA 1NFKA 4JPKL 1KB5L 2Q76B 1AXTL 1SYVA 1NCCL 5C07E 3B8YA 3DXAD 3OTTA 1PEZA 4PV9A 3QDJD 1KJ2A 3DX6A 4LHUB 5IKCA 5JIIA 2O93L 1CXIA 3MV9E 3EIFA 3WUWA 4R2GC 3FMGH 1H3XA 3LKSB 5EORL 1IT9L 1SVZA 5EU7E 3CFCL 4PJIA 2VXUL 4QY8A 1JPGB 2PF6A 1URLA 5CWSB 4JM2A 5F7EH 5F72S 3C9NB 4RDQG 3MACL 3B9KB 4LHJB 2ZUWA 1AI1L 2V2XB 1M7IA 5BXFA 2WWKT 3DHMA 1OM3L 2EDYA 1F90H 1TZGL 3M17B 4LCWE 1YEGL 4P46A 4F58H 1XMWA 4PRIB 4PPTA 1JNNH 4LCCC 4LRIA 5H2BA 5TDOA 3CK0L 3VG0L 1CTOA 2VDKH 1JPFB 1IKNC 1LO4L 1NLDH 5SWSB 4LASL 1SJHB 1A64A 5JQ6H 4P2CG 2ZNXA 4ZOEA 4IM8A 4JE4B 1F42A 4HIIA 5TH2A 3BEWA 3IETB 1IM9A 3O2WL 1RZJH 2NY0B 4YR6B 2EDTA 3V8OA 4TUKH 5I16A 4DOHB 1SEQH 3WD5H 3T65B 3A0OA 5C0RH 3GSNL 2GKIA 5FHAL 4S1DC 2BSSB 1UM5H 1UH4A 4Q9QH 4ZXBD 3IDGA 3VFVB 5F1IB 3TPUA 2ZJSL 5DD6A 4OAWA 4H1LH 3PQYE 1P69B 4IJ3C 4HUMB 5GZOD 3WS3B 1CZ8H 3VXUD 3WIHA 3D6GA 4X6FA 1IVLA 3EFFB 4PRPE 2SEBA 3V6FA 2GFBB 3KDMA 3QZWG 5C86A 4OJFH 5AWNL 5L2KD 4YNYB 3P11H 5MEQA 3KPNA 4U1NB 2WUCH 1NQBA 3WFBL 5EIQA 2OI9C 1DSFH 4TQEL 5C08B 4CVXB 1DBBL 2P1YA 1LE9B 1NGPH 1U8KB 4QKXB 3MV8E 3ABZA 5IB4A 1DN2A 5C0JB 4NNYB 4HPOL 1NMCC 2X09A 5DRXB 1JL8A 4ZDHB 1JGDB 4YDJA 2R8SH 1HHHA 1NDGA 4N9GA 3MOBH 5EU5B 4W6XB 4IIQB 3HKFA 3SDXE 3N1MC 2D9QB 4JO4H 3O3AA 4EDXB 1YQVL 1R3IL 3GSWB 5FKAB 1IGJA 3BEVA 3HR5B 5HHOB 4QHMA 4QRTB 5HDOA 2Y25A 1FN4A 3AU1A 3KNBB 2DQIH 4V1DB 1IRAY 1OP3K 3KHOA 2EE6A 3VXRA 4POZC 1TVHA 1S5HA 4XNQA 1P84K 1VCAA 4JFZL 2W9DL 4QXWA 2NY2D 3EOAA 9CGTA 2I5YL 4JFFE 3O6FB 4NDMB 4LCIL 4FZ8L 4U6XB 1OPGH 5CJXA 1XH3B 3H6JA 4HBCL 1JZ2A 2FJGA 2H8PA 2R69L 5MERA 5J06A 1VHPA 5KAQG 4MAUL 2X4TB 3FONA 2R1XB 4XAWH 2DBLL 2COQA 5IP4A 2ZUYA 3ARBB 1IFHL 4L1HA 2YC1A 2C3VA 2G9HB 4OGAC 3V7MA 3FRPA 1WEJL 4X9GA 2EIZA 5J9PB 2XZQH 1NEZG 4WTZA 4FP8H 1CE6B 4Z7VF 3VWKC 4PGDB 2ED9A 2Y36L 4JFPA 1QRNB 1HSAA 4ONGH 4YFEA 1T21B 3HR6A 5DMIH 3MLZL 1YY9C 2ZUVA 4F2MB 3THML 3OSKA 1IBGH 3BW9B 4JZJB 5IBLD 3QEUA 1JIBA 1FHGA 5SWZE 3QAZC 1T1XA 3H7BA 5D70L 1JZ5A 1R5WB 3LKPB 4DVRL 2FX7L 4PJFA 2BSTB 4YHOL 3QR2A 2L7JA 1F3DJ 4M7KH 3MBEA 4ISVA 3EO0A 4NKIL 3G9AB 3LMJL 3QUXC 1GZPB 3KXFB 3GMQB 1DL7L 4KMQA 3RWHA 1BX2A 5ISZE 3R06B 5F1SA 1S7XB 3GHEH 1OAKL 4P9HH 1IGCL 4CU6A 3RHWF 1P2CB 2IFFH 1HKLH 3KPPA 3GGWB 3IJSB 1AHWB 5GRVK 3QSKB 3FCTB 1G0XA 5DHVA 3SDAA 3MR9B 4RX4A 2YK1L 3GBLA 4L8SB 2OTWA 4O5LH 2GSIA 3WFEH 5L8KB 1TNMA 1FFNB 4QYOA 3IS0X 5E03A 1CD1A 3GJEA 3GSRA 5B8CB 4NOBA 4J12A 4KMTL 4DTGH 2W92A 4OLEA 1RUQL 1A1NB 3ULVC 5FM8A 2H1PH 3QFJB 1IEBA 4FQ2H 2DRUA 1TQBC 2GAZB 5L6YL 4QRRE 2MSPA 3L1OH 1RZJC 1U6AH 5DZLA 1A21A 1INQB 1MAJA 4XRCA 2OSLB 2Z91A 4CVZB 4WO4A 1P7KA 4GRWF 1D6VL 1KB9K 5F88A 1BVKB 3GIZL 2ADJB 3QXDA 2PYED 5I1CH 3U1SH 4EQ2A 5I1EL 2YS4A 5HGGS 2QQNH 1F8TL 5FM5M 2BVPB 4Z95L 1FIGH 5CP7A 5T5NG 3UXFA 3MUJA 32C2B 3NIFF 4I2XE 1Q9KA 2AGJL 5ADOH 5HYSG 4F8QA 2XXMB 5DUMH 2NR6D 3U0WH 5IFAL 1J10A 3IU3B 2FL5A 1EHLH 1WFNA 4LSQH 1MRCL 3MLUH 1M05B 5HHXL 4N90E 1Y0LB 4KI5F 4QOKE 3X3FL 3RZCD 4Y2DC 3U9UA 1C5CH 3BSZH 2OCFD 2YWZA 4XNXL 1ZLVH 3MV7D 4ZTPH 3EJYD 4YEEA 5DFVD 4Q2ZB 1BQUA 5FO9A 3X12A 1CG9B 3ZKXC 2HJLB 4HDIA 5I1HH 4I0KA 4ODTH 1QBMH 2PW1A 3BOVA 4P59L 2EXWD 1X5YA 1VGKB 2KKQA 2R23B 3F6IA 3IFOB 1HZHH 4M03A 2JK5B 3D69B 1JBJA 3HUJF 3O3BA 3T0AA 1TZIA 4W6WB 5C0GB 1N5AA 1CE1H 4XP6H 1VSCA 1CFVH 4ONOA 1ZGLM 4XCEB 4GLRI 4J2XA 4FFYL 4UNVA 4CGTA 1OD7A 1F6FB 4PJ8C 4WUKL 4PRDB 4M8QB 3DRQB 5IG7B 4RFOL 3EOBB 5CHNB 4L4TA 2F8VA 2ZUQB 4OD1L 5AG8A 3D0LB 1MEXH 5TQ0H 3W81A 4F7EA 3ZYIA 4QRRB 4XGZB 5D72H 2XTJC 1KJ2B 3DX6B 3S3PA 1MQ8A 2UVFA 3HMXL 1F4WH 4MQXD 1JYNA 2H2SD 3ALXA 2AABH 3BP6B 4G9FD 3SCMB 3KPOA 4HWBA 4MD4A 1LP9A 5GGVY 3IDXH 3ARWA 1OL0A 4L3CB 4NC1C 4OGXL 4KK8D 4I4WA 3MRPA 4QY8B 4JM2B 4UBDD 3VFTB 3ZKMC 1XCQA 3M8OL 1VFBA 5AZ2H 1PLGL 1T5XA 3VWJA 4YQXL 4P5TC 1UKQA 3P0VL 5BXFB 5E6YA 5I15H 2QQKH 1RZ7H 3PGFL 3NAAL 4P4KD 3GMOA 5KVDL 1MHHA 4JPWH 4BSWA 3T0EB 4P99A 4M7ZC 5BO1L 5TJWK 2QTEA 4CVWA 3H9SA 1T2XA 4IOFD 5D7JC 4JY4B 5IGXH 4DGVL 5T1KD 1KCKA 5IOPA 4JVUA 5FGBC 3QDGE 3BEWB 2HT2C 3MUGA 3VA2C 1I1YB 1IM9B 1L6ZA 2DB8A 3OKOA 4X8JA 3NTCH 3STLA 5I16B 5CBAB 1FQ9C 5MENA 4RQQB 1PX4A 2AJVL 2AERT 5GSRB 2Z31D 4BUGA 5TF1L 5JMRA 4V2CB 4P9HC 5C0AE 4HAFA 1E6JL 5EBGA 4GMTL 4C57C 5ESQA 1Z0MA 3GO1L 5DMGD 4XVJH 3O4LD 1GGTA 4L5FH 4G8GD 2HG5A 5DD6B 4DZBA 4OAWB 1NAMH 2PXYA 5FYKD 2P46B 3RGVC 2AEIT 4HFWA 2WLZA 3CH1A 4PG9A 1JGVL 1VFAB 3QIUD 1A6TA 4DGYL 1BPVA 1E4KA 1KOAA 3NH7L 3H3BC 2SEBB 3VE0A 5J89A 3CFDA 3KDMB 1BF8A 3EGSA 4D2NA 5CFHA 4Z0XB 4TULL 3OB0K 5H35A 1J0YA 1D6EA 3QWRA 3V0WH 4RZCA 4OF3A 4ZNEE 1LEKA 2JJUA 3OXSA 3CDYA 1YPZA 4XNYL 3RY6C 4L9LB 2YN3A 2BVQA 4TUJA 1RY7B 4IRJA 1HHHB 2X1QA 4NQCA 3OR6A 3WS6C 3IRZA 3D2UD 3W0WB 3N9GL 1KCRL 1MCLA 4QCIA 3B9EA 4KZEH 3FO0H 2IAMB 4X4ME 2NYYC 4LEXL 1B4JH 1QACA 1D5XA 1U36A 3LIZH 1FN4B 2F54E 3U4EA 3AU1B 4IHOB 3DX7A 4Z7NF 1ERNA 5LBSH 3VXRB 5DR5H 4WDIA 1R3LA 2VDOH 3WNLA 2FEEI 1TVHB 4XNQB 2VE6A 3EOAB 4DUVA 2DMKA 1DEDA 3EDEA 1AXSA 4D9QD 3MSPA 4JRYA 2OK0L 3ZL4H 1XGUA 4PJIF 4WFHD 1S7UB 2FJGB 1PG7W 3U36A 5MERB 3BP4A 3MLWL 4WY7H 3D39E 3FONB 2IF7A 4E42B 1RIUH 4LMQE 4Y8DC 5IEHA 1ZGLA 3BKCH 3B8SA 3ARGC 4NJAL 2D7QA 2QHRH 1U8QB 2YC1B 1XIWA 2C3VB 4G8EB 3S3JA 4A6YL 3QI9A 1MVFA 4M1DL 1AO7D 4PYHA 3ULUF 5GS2D 2VH5L 2EIZB 3HG1E 1JWSA 1N2RA 1BZ7A 2PO6B 1CFNB 3ORJA 4JN2A 2A6DB 4WU7A 2CMRH 5FCSH 4ZO7A 4YHLH 4JO1H 4JCMA 1HSAB 5GS0D 4JLRA 1CYGA 3OGCA 4QNPE 4PJAE 3QXUA 2ZSVA 2CUHA 4NCC2 1F6AA 5E8PA 3AGVA 3MJ8B 2VDQL 1KCVH 5IW1A 4QT5A 3QEUB 1KIPB 2P43B 5C0BA 3L3DB 3ROLA 4S1SH 4UT9L 5KG9B 2BRRH 4GKSB 4K55A 4J3XA 4PJFB 4P5KA 3WLWD 5JQHC 5IMOB 5ID1A 4KRMB 4K3JL 4P2OD 5E5RB 4ODXA 2VIRB 4UDUB 3N50A 4YBLC 3STZA 4S0SD 3A6BH 3UPRA 1BQHA 3IVKA 3RX7A 2IBGA 3LDBB 3MGAA 2PR4L 4P3CL 1K3ZA 3UROR 1A9EA 2AJSL 3LSOA 1OW0A 3MRQA 4ZYKB 4LNRA 2H3NA 2Q3ZA 3PWPE 5DO2D 3KPPB 4QTIL 1QYGH 1C7TA 2IANA 1V7MH 2F54B 1DVFD 1IMHC 5JXEC 2B0SL 2FX9L 4K9EL 1JTPA 5DF0A 1OAXH 3OKMA 1KTDA 2GSIB 5JIHA 2FB4H 3MGTA 4U6TA 1CD1B 3GJEB 1KB5B 25C8L 5E24E 4Y1AD 3TO2A 4R4ND 1J1OH 1DBKH 4P9ML 5DGRA 4Y4FC 1TFHA 3P77A 5FYKL 1IEBB 3ZT5A 3FO1B 1YMMD 3G5YA 2C3WA 3RX5A 1BFTA 2D0FA 5JOPD 5EB9A 1MCBA 2Z91B 1RAMA 1T04B 2EEBA 4HG4K 5F88B 3SGDH 2IQAB 1KFAL 4HF5H 2O5XH 2IPUG 4X6BA 5DD1H 3QCUL 5E6IA 5IJKC 2VLKA 2XKUA 4XP4L 6CGTA 1RVFH 5D7LB 2HFFB 2F74B 2JLLA 4KVCH 4H0HB 4YXKH 4MS8D 3F58H 2KQMA 1EO8H 4HIHA 1IKFL 2F15A 1Q9KB 3BGMB 3S34H 5EH1A 3OKEB 3LQAL 1NFDE 5ADPH 1FZJA 5F7KC 3HE6D 2PTUA 4U1JA 1NGWA 3TVMA 2J5LC 2FL5B 2R0WL 3HMWL 4OF0A 4KJWD 2Q8AL 5IM7B 3S88H 1ZA3A 4OM1L 3QJHB 5L9DH 1MCRA 3RWIA 2Z4QB 4HK0A 4HT1L 4R4FH 2J7LA 4GRLD 2FDBP 3GBMH 3GIVA 2ICES 2YEZA 3GSNB 1T6VN 3QIBC 1NC4A 3PWJA 3X12B 4Y5YA 5FO9B 4C56A 2R4SH 4K94L 3EYFB 4DW2L 4CADA 4F57H 4TNVF 3NCCB 4X7SL 3DXAE 4HS3B 1CICD 1E6OL 3KS0H 4OLWL 5BZDB 3QDJE 5E7BA 1C12A 5LWYL 4HUXB 3UDWC 4WW1A 4LAQH 3SHSA 4ODSL 3SKOB 4KY1L 4PGEB 1X5IA 1MCWM 3MX0A 2J12B 2FYYA 2NY3C 4MJ5B 3AVEA 5CGMA 1JNJA 2DQGL 4GRWH 1WCBB 1NMAL 1CS6A 2HN7A 4DVBB 3QNYA 4LPWA 2J8UE 1FIEA 5F7WC 1YEHL 1P4IL 1QKZL 4QRPA 5SX5K 2BNUB 1JWMA 1VEPA 3CSBA 3RIAF 4F7EB 2AJYH 3SO3B 1RHFA 2JIXD 4J3SA 3WJJA 4WU5B 1DQML 4DUXA 3AS3A 3RDTB 3IJYB 2M8XA 4WNQB 3KPOB 1LP9B 1B9ZA 1UYWL 5KJRL 3QDMA 3RIFF 4MD5A 5D2LA 3WIIL 1HILA 4HWEL 5F21B 3U7YL 4I4WB 3MRPB 5JDSA 4U6YB 2ATPB 4UILL 1WFUA 3S96A 4I48A 3DX9A 4L3ED 4HEME 1A6ZA 1CLCA 5DRZB 3FN0L 1VFBB 5T3ZL 1T5XB 2CXKA 3N1GC 5DJXA 4F9LC 4K3EL 1R5IB 4Q6IC 3ZYOA 5I73C 3G9VA 2VXSH 4TNWK 2WBJC 5CZVH 4AK1A 4QRUA 1J1PH 3OR7A 4BSWB 4NM4L 5C07A 3QCTL 4J6RL 5D5MA 3W11D 4OZHE 3BKYL 4DKFH 4G6KL 3MV9A 1CD0A 2YR3A 4XP5L 3ZKQD 5M95B 4JFYB 3REWB 5A2KH 5D2NC 2IWGA 1S5IL 1QR4A 3C08H 5L2KE 4I0PC 3HZKA 4HPYH 2OS7A 2VL4A 4X4YA 4I18C 2DI7A 5JW3H 1FNGB 2DLFH 1AIFA 2VC2H 3STLB 2HTKC 4RMQA 1EBPA 4O2FB 4UV4H 4MCZB 1RUKL 3GJFA 5M7QA 5MENB 2HT3C 3K2MC 4XPFL 2MPAH 1NGYB 1D9KC 5E00A 2W91A 1NLBH 3SKJH 4LCWA 1U8HB 5ESQB 3IAQA 5I76B 1EGJH 1WIUA 1A3RL 1DDHA 1C16A 1LO2H 4FTVA 4OD3L 3TT1L 5EBMB 3B9KC 2I9LA 2A0LC 3KGRA 3CH1B 1G1YA 3JWNC 4PG9B 1U8LB 1A6TB 1FG2A 5F89A 5SV4A 2PTTB 1P4LB 1CLOL 4OCXL 4FQXD 1HQ4B 4ZAKC 5CINL 1DLFL 3QZWA 5E94A 5HI3C 1A1MB 5J6GA 2D03H 2EXYC 3DTXB 3QCVL 5LCVH 1TZHB 4JN1L 5C0EA 3DV6A 1RZIA 5F8QC 1PKOA 4MNQE 2VUYA 4RZCB 1T1ZB 4HCRL 4GAYA 3QUZB 5FYJL 5I75B 3UZEA 2HA1A 1H0DA 2AQ3A 1JHKH 5IVZA 2Y4SA 4MJID 4TUJB 1SBSL 3PQYA 5KSBB 4U4BA 2BNQA 4AL8L 4DAGL 4NZUH 2P49B 4G6JL 4BK5A 5INCB 5C0IA 4LSTH 1VADA 2GI7A 5FM4A 3NA9H 3UYRH 2GQHA 2OR7A 3V95A 2F58H 5EOCH 2J3SA 4G8FA 2V9TA 4JGMA 5E9DD 4Z7UB 4IBLT 2B8OT 3C5SA 4N1CA 2ZCHH 4OFVA 5D1XA 5TE4H 3Q6FA 2CUIA 4N8CH 4EIGB 3QUYD 4FMFA 5C1MB 5DEFB 3MV8A 4WDIB 4Z7WA 2YMXH 1FVDA 1RJYB 43CAA 4BFEA 4NC2B 5FO8A 2VE6B 1F58H 4LDEB 1J8KA 1MIMH 3O2VH 1B3JA 1JHTA 3SJVA 3ZZ1A 1OWRM 4NKOA 1LP9F 2C1OB 5E8OA 4JRYB 4AEFA 1A7PH 3SDXA 1XGUB 1CXLA 1G9MH 1O7VA 1PVHA 4F15B 4OIIL 1J5OL 2K1MA 1C1EH 1EVTC 5K9OA 1FFPA 3HLAB 5E4EB 3QI9B 2WQ8A 5L0QC 4L1DA 3CUPB 3AREA 4FFVC 1KN4H 1QQDA 2FIKA 4HMDA 1BZ7B 1NEZA 3DJ9A 4WU7B 1JE6A 2E3VA 3BZDA 3KYOB 4JFFA 4AZ8A 1AE6H 2N56A 3HAEB 1ZMYA 1I7TA 5MHSD 4I3RL 2HP4A 2FGWH 2E6JA 1CFSB 3PHOA 4KRLB 4DZ8A 1G6RL 3OAYH 4JZOA 3UJTL 4DJMA 1LO3L 2ZSVB 5CKGA 1RJLA 4U1SA 4M9OA 5D7KD 1AFVL 4QT5B 4GUPA 5EBWA 3PGCA 3FQTA 4YHNA 4JO3H 1FO0A 3FFCD 1S7QB 4MNQB 4DKAA 1YEFH 2DI8A 5IBUB 1DANT 2YSSA 2AEPL 3R8BB 2UUDH 3STZB 2EDFA 3O6LH 1H8NA 3LN9A 2DICA 2P7TA 3OJDA 3I02B 5IFJA 3UPRB 4NQED 1KJ2H 3QULB 4G3YL 4RFEB 1B2WH 3DOSA 1H15A 2X70A 3IVKB 3KLAA 3MFFB 3ARBC 3L7EA 1A9EB 3MLVH 4PGBA 4HZAA 2JJWA 5D1QC 4N0RA 4KI5C 4LNRB 2H3NB 1JPSH 2NNAA 3MCG1 4HX1A 1YNLL 3NZ8A 4ONFH 1I1AD 4X7DC 1MFAL 3W9DB 2PYEE 5JXAH 1KN2H 1NBVH 4DK3A 1Z5LB 1I9EA 1FRGH 1YPZF 4ZFZB 1KTDB 3VW3L 3MGTB 4GG8A 1VB9A 2ZOKA 1FVEA 1KENL 5D96C 3V0VA 5HYQA 1T1WA 3TO2B 1RZ8A 3LKQB 3FOMA 5ISZA 3P77B 1BFVH 4XPHL 2FD6H 1NGQL 2V6HA 2ICWA 4H0GA 3UP1A 1W2KT 4PR5A 4JFQA 4NIKB 1B6DA 1MWAA 3G5YB 4HULB 1PYWA 4FOMA 2CKBL 3ARDC 1QBAA 1QR1A 3L6FA 3MV7E 5F3HA 2UWEA 1CF8L 4BJLA 5GS1C 1KXQE 4X6BB 1EZVX 5E6IB 2DL9A 3ARYA 1KYOK 5JPMA 1L0YA 4XXDA 2QSTA 5DD3H 1FE8H 1AHWC 5J0BA 3VJ6B 4HIHB 3TBVA 2Y07L 5IWLC 3FT2A 4LVHB 4YWGL 2MOVA 2NY4C 1VKXB 3WIHH 3VFRA 5HYSA 1BEYL 4X5WA 2YD9A 1A22B 3LN5B 2CLRB 1NCUA 5HJ3A 4UIMB 3TIDA 4JQVA 1MLCB 2APFA 3QEQB 4Y4KA 1ONQA 2YEZB 4L8BB 4U31A 1U2HA 5C3LD 3ARFC 4Y5VA 1FV1B 1U8PA 1CL7I 1NC4B 4KQ4H 4C56B 1G84A 3WEXB 3RTQB 4PRHD 1CR9H 3MRNB 3NA4A 4I2XA 1RURH 3KVQA 1ZSDA 4LARL 1UWEL 5C9JB 1MNUH 4WW1B 1CCZA 5I19H 4G9FE 3U83A 1GSMA 1U91A 2QADB 1F4YL 1LDSA 5D1ZD 1T5WB 3SQOL 2AXJA 3TP4A 1EJOH 2HLFC 2VITA 3ARSA 4S1RL 4AG4L 3T2QA 3AY4A 1IL1B 1MJJA 5HHVL 3NGBB 3QNYB 4N0YH 1X44A 1OSZA 1JYWA 2AKRA 4WWID 3SE3A 5MEOB 4ELMA 4G6ML 4GFTB 4OCRL 4QRPB 3VG9B 4H26A 1N6UA 5C7XL 2R2HB 3VFUB 3B2VH 3BPLC 3INUL 1FGNH 1PSKH 1NGZA 3NFPA 4M6AA 2FHBA 3DYMA 5CKAA 4GS7B 5HHQA 5INDA 1I9JL 3FKUS 3I2CL 3P40A 3UMTA 4HJ0C 5D4QA 4R3SA 3MRRA 4NWUL 2E9IA 5GXBB 5DURD 3GHBL 4MD5B 5D2LB 1EBAA 1HILB 5J4MA 2XICA 1T2QL 3DMMB 2ADFL 4I48B 1M6OA 3DX9B 3TO4C 1A6ZB 3TBWA 4ERSH 2FO1A 1NL0H 1IAIM 3RI5K 3QO1B 3PE9A 4K07A 2R0ZL 1MHPL 4KQ3H 4U7KA 5C0ND 5DJ2A 4H88L 4G8GE 2P5WD 4OLYL 3TFKD 5FYKE 5D5MB 5EO0A 3ARUA 5J1AA 1BBJB 5IQ7L 1DE4B 1QUNA 1BD2D 3DVGB 1TTGA 4CNIB 3P73A 4A6YB 5C8JB 1FH5H 3ARVA 2W0KA 3NZHH 1A02N 1DUZA 1AIFB 2ESVD 3Q0HA 4M6OL 2XN9D 3FOLB 4YDLC 4JDTL 1I4FA 5IEKB 1ZT7A 3GJFB 5E2VH 5FGSA 1FLRL 3MJ9L 2ENYA 1Q72H 1UZ6E 1E28B 1M1SA 5CSZB 4HH8A 2HTLC 1Q8MA 3WIFA 4RGOL 4EZMA 4R9HA 4MNGA 2P24B 1C16B 4X9FA 3MNWA 4FTVB 2VLJE 1JF6A 3GSUA 3SGEH 3KPQA 2I9LB 5DHVH 3FT4B 4GW1B 4P46C 4N1EA 1BJ8A 5J8OA 5I1KH 5J6GB 4IOIA 2XQYG 4BQ8A 4KK6C 5C0EB 3DV6B 1H8SA 1UH3A 4P3DA 2VO5A 1Q0YL 2OMBA 4QXUH 3QO0A 5C0AA 4GAYB 5IW3A 1DQJA 1X4ZA 3T1WA 1XCTB 5D6CB 3B43A 1H0DB 2WLYA 3L5HA 4D9QE 5C3TA 1QEWB 2VR5A 4YHZL 4WFHE 1EAJA 2BNQB 1PAMA 3CXDL 2VLLA 4TVPH 3G5XA 4CJ0A 5HYJA 1LEIA 3QDHA 1WUNT 4PJXE 4XNZB 1VADB 4XB8A 4UAOB 2DQCH 3RJDA 4KHXH 1NFIA 1AI1H 4G8FB 1ZOXA 1WF5A 4GQ9L 5FCUL 2NQCA 1OM3H 3C5SB 1AO7E 3NIGE 1TZGH 3MRBA 4XP1H 4LP4A 1DFBH 1QSED 2C7UA 4NT6A 5D1XB 3HFMH 2DJ4A 2Y06H 3TA3A 1B0RA 3CFBA 1YUHB 4Z7WB 3CDFA 1QVOA 4EI5D 3VI3E 1FVDB 3ZDZE 2EIBA 2OR9H 2CK0L 2YKLH 1JHTB 2IH1B 3SJVB 4N68A 1OTSD 4NKOB 4OKVA 4UIKH 5IF0B 1RZGB 4RWYH 4S11A 5FA3A 1MI5A 4CRPA 3ZO0A 1A14L 3DUSB 2XZAL 4LLUB 4LLQA 3TCLA 2X89D 5CJBA 4GQPH 5T1DL 1DR9A 3VXMB 4X4MA 1II4E 3HNSH 4RDQF 5MP6H 4ETQA 3BQUA 1RMFH 4KI1A 1HSBA 1MCFA 4HS8L 5DC4B 4YDVB 4F7TA 5T3ZE 1D5IH 5EA0L 1NAKH 1XF4B 4GKNB 4YUEL 2NY7L 4MAYD 3C8KB 1QQDB 2GJ6D 3IRPX 3QNXA 4HK3N 2BY0A 2R0LL 1G9NH 5E2UH 3X3GL 2KPNA 5KANI 2VLJB 5KOVC 7FABH 1P7QA 2AJZA 1GZQB 1I7TB 4OLZL 3QQ4A 2FH6A 2NY6C 3QYCA 4NN5B 5I9QC 4DZ8B 4MD0B 5GRZA 3HS0B 2ZUUA 1CGWA 1RJLB 3C09B 4MA3B 4U1SB 3WFBH 1CGYA 1AGFA 3D39A 4ONHB 4PJ9D 3G6AB 4F37K 4HV8A 4KJPC 3K8LA 1FORH 4B7LA 3CSGA 3PGCB 3RWGA 3FQTB 4YHNB 2MNUA 1ZEAH 3FAWA 5JDJA 1FO0B 2HJFA 2JELL 5CJXC 2YA2A 3C8DA 2NXYB 4ZD3H 3ZT7A 3RAJH 4KU1A 4Y1AE 2UZIL 3T3MF 2UYLB 4KTEH 5IFJB 2VSCA 1JFQL 3B3IA 3BWAB 1CVRA 3VFOA 3L7EB 1MCWW 3S3SA 4HWBH 1PX3A 5GPRA 1OLZA 2ORBL 4FQ1H 4PJAA 3VRIB 3X13A 5JOPE 5KVFH 3GBNH 3WHXA 2YUZA 2BNRD 4HX1B 3NZ8B 4N1HB 3O3DA 4XCCL 1JF5A 4MHHI 4KRPB 4LOUC 4PRNA 4RFNB 3CX5J 2C26A 5E99H 1I8IA 1WWWX 5AEAA 3BGAA 3HZVA 4PB0H 3VXQA 2AJUH 3WN5B 1DBAH 2DM2A 5JTWA 1T3FA 5DS8B 4P2YA 4JFHD 3CLFL 3PDOB 4O51A 1FVEB 2EDEA 1AY1H 1UM6L 2X10A 4PJEE 3PP3K 1ADQA 3FOMB 4PB9H 2EKSA 4XPGL 5IMLB 4JHAH 3LV3B 4PR5B 1IFHH 3PWPA 3MBEC 3NFSL 1MJUH 2NPLX 2PW2B 4N0FA 1MFCL 1PYWB 4WWKA 1WFTA 4HKXB 4OCWL 1ZTXH 4Z5RA 1RUAL 3L6FB 2VXQL 3QRGL 2UWEB 2Y23A 5SX4H 1I1RA 1AKJB 1NCDH 2B7DT 3MO1B 3IT8D 1R5VB 5GGTA 5JPMB 3JWOC 2O5YH 5DDHB 3KYKH 3C87A 4ZFOL 3QEGL 1U92A 4XHQA 1QFWM 1YDPB 5IB3B 2XZCH 5JR1H 1N4XL 4WENB 3SDXF 3TBVB 3C5ZB 3SDAC 2A38A 3FT2B 4YHML 1TENA 1HIMH 2I26N 2VDRH 4KJQC 1AR2A 4P48A 3VFRB 4RBPK 5KAQF 5TF0A 5FYLH 5I17B 5E70A 4WJ5A 1WC7B 3MREA 5JPNA 4GAGH 5GGRY 2OXHA 5DQ9A 2G2RB 2X44D 4PJGE 1QD0A 2BOCA 1FCGA 4Y4KB 5A43C 4QGYA 1YEIH 2AJXH 4Y5VB 2YWYA 2MFNA 5B22A 1CN4A 2IC2A 3O3UN 3RPIA 4WO4C 1NC2D 1JHLL 4GO6B 2JJTA 1HCVA 4LK4A 4QWWD 5GGVH 1CQKA 4WHTA 3FO2B 3FMGL 2I9TA 1ORSA 1NFDA 4LSRH 3REVA 1SY6L 5F7EL 3RRQA 1CIDA 1MLBA 1U91B 3MGOB 3CPLB 1N7ML 3NCEB 5D7JD 5HYEA 4L3EE 1OAQH 4ZTOH 5F3BA 5DD5H 5FO7A 5A2IH 5B38G 4LCUB 1F90L 1CXFA 2R9HC 4F58L 1TQCC 5IR1A 2AKRB 2BC4A 2EDHA 4LDOB 1JNNL 1M71A 4CBPA 4AT6B 3QQ9D 5AAWA 2VDKL 3SO5A 3QUKA 1NLDL 1RULH 5F1NB 3QDJA 3MYJB 3WFHB 2BHZA 3ULVL 1A4JA 3E0GA 3NFPB 4H8WH 5H94A 3K0WA 1RZJL 1XFPA 1HINH 4TUKL 4R3SB 1NCWH 2FZ3A 3KYMA 1SEQL 2XRAH 3MRMB 5CCKH 4W81A 2ICCA 3WD5L 3F65A 4Y8AA 5F9WB 2VL5A 1J0KA 5T33H 4G42A 4I3GA 5C0RL 1QPPA 3X11A 1UM5L 4ALAH 2VDPH 4UTBH 4JPVH 1EXUB 1VACA 2J8UA 1KBGH 3TBWB 5A16A 1G9NC 1O7SA 5ICYA 2AGJH 5HD8D 3L5JA 2E27H 3HB3C 5T3XD 3VFWB 3MRDA 5C9KA 3E3QC 1CZ8L 4NNXA 4CJ1A 2V2WA 4TTGA 2XQYK 3L95B 4E41D 5I8KH 2GSGA 2W65A 5JLZA 3X3FH 3LKNA 1DN0A 3OL2A 3TM6A 3QIWD 4OJFL 5H37G 1QPXA 4BZ1H 3MRHB 2BP3A 4LIQH 3IXAA 5GGRA 4NGHH 5M94B 3P11L 1OP3H 2UWEF 2WUCL 1D5BA 1DSFL 1BQLH 1YQ2A 2GJZA 1NGPL 5ICZA 5JMOC 5JORA 4YFLI 5E7FA 1V8HA 1CK0H 4ZXBA 3RVTC 1E4XI 1WBYA 2R8SL 1GIGH 1T89C 3MOBL 3Q5TA 4MJIE 4HUNB 4MNGB 4JO4L 1MSPA 4PP1C 1XGYH 1IC4L 4OZHA 4M62H 1G6RB 5DMJB 3VXUA 3CC5A 3MNWB 4RA3A 5J3HC 3VWJC 1JJUA 1SHMA 1U93B 5B39A 4N9OB 1UGNA 4R97B 5JW4R 5E9DE 2EZ0D 1Q9WA 3D3VA 1IE5A 1ZT1A 5HHNA 1HYSD 4GRMB 2APWA 1JVKA 2VZSA 3TJHC 3LRGA 1NEUA 2X4QB 1OPGL 2D4DA 4OF7A 1IAKB 1OAYH 4O2EB 2AV7B 3BXNA 1DQJB 4G6FB 3T09A 1JCKA 3QJFB 1AR1D 1B90A 2NXZB 2XNAA 4XAWL 2Q6WA 3ARRA 1MFDH 2VLLB 5HYJB 1LEIB 2WV3A 3GMNB 4MSWA 2X4SB 1QBBA 3GB7B 2NTFA 5IW6B 3P0VH 4K71C 1UJTA 5CZKA 3D87B 2XZQL 4ELMF 4FP8L 3TN0C 3MRBB 2PXYC 3CIQA 3RBSA 1X7QA 1LK2A 1T1YB 5J13C 2FIRT 2LAGB 1CWVA 4G7YH 3TA3B 1B0RB 2BVOA 3CFBB 3UTTA 1A6UH 1QVOB 5DMIL 1ORQA 5MHSE 1IBGL 3MLYH 4Q6YA 3WE6A 4NN7B 1LQSR 1RZKH 2GTWA 4KPHH 3HE7D 4NZRH 5FXCH 4BH8A 3TBYB 5D7KE 1MI5B 1KJVB 3PJSA 1L9MA 3BKMH 1VDGA 1FZOA 4TTDC 3TCLB 3FFCE 4M7KL 4J3TA 1A6WH 4ETQB 1J87A 2DJUA 3VFNA 3BN9D 4OBSA 3WNOA 1SVCP 4IRJC 4C4KO 3M1BA 3MRLB 5B3JE 1WAAE 3O9WD 1F6LL 3VWKA 1B88A 3GHEL 3IXTB 4P9HL 4NQEE 3O8XD 1S9YB 4OKDA 1AGBB 1UJ3A 3S5LG 3QNXB 1JGEB 2YA1A 3P30H 2IFFL 2HT4C 2CK2A 2IALB 1H3UA 1HKLL 4HK3J 2AXFA 2R2EB 1D5ZA 1EHAA 4P23D 1RJCA 3CSYA 3QQ4B 3WLBA 2ZUXA 5IVXE 5DC0A 1H5BC 4ZOBA 2W60B 1GXEA 4O5LL 2H9GA 4H5SB 1AGFB 1UZ8B 3WFEL 1K8IA 4HV8B 2P5ED 4PJCA 4DTGL 1BLNA 5DEGB 4FMKA 4OD2B 1QSFD 2VMFA 3QUXA 2DQUL 3JBG7 1MCHA 2H1PL 4FQ2L 2ARJA 2NX5B 1BZ9A 4I77L 4LNVA 3T8XA 3L1OL 1U6AL 3SKMB 3UTSD 3BE1H 5EUOE 1YEJH 3B3IB 4HUVA 4XCNA 2L4OA 3NIDF 1SY6A 3BDYH 1XIWC 2CXGA 3QI9C 4I5BB 1S78D 4OZIE 4PUBH 4EN3A 3WHXB 5I1CL 1ZHNB 3U1SL 5E8NA 3O3DB 4M5ZH 4WTWA 2QQNL 1YEKH 4U1MA 1JUFA 5I8CA 3FT3A 5IB5B 2VKXA 3UPCA 5FM5O 5J11B 3DARA 1FIGL 1OAUH 4XBPA 5IHUH 5LQBL 2JB6A 3S35L 3EAKA 5BVJA 4IRSD 5ADOL 5IESH 5KSAA 2NY5H 4O51B 5DUML 5CIPB 2OK0H 3PL6D 1ZHBB 3U0WL 3UZQA 4EBQH 1EHLL 2DKSA 2RR3A 4LSQL 1U9KA 3MLUL 4AIXA 4NSKA 1N59B 5CJ5A 4K3DH 1C5CL 3BSZL 4NJAH 4UT7H 4APQB 1EJ6A 4KC3B 3BZFB 3F6LA 2VDLH 4WWKB 1FVCA 2QEJA 1RZFH 3GJFH 4KROB 5I1HL 4ODTL 1QBML 3RWFA 5EPMB 5E08H 1NCNA 4WV1B 4OQ1A 2A6KA 1B0GA 3FB6A 3MRJA 1J7VR 4RMRA 4PRHE 3P2TA 1P5UA 4YAQA 1U92B 1HZHL 2FWOA 2YPLA 3PIQB 4OIBA 3U30C 1JTTA 3C6LA 4LPYA 1G7JA 1ETZA 1CE1L 2ZG3A 4XP6L 4UI2A 5FUCE 1MH5A 4KK9D 1CFVL 1OTTC 4KHTH 2W59A 5AD0A 2UVEA 3RZCA 6FABH 1X9QA 4Y2DA 3W39A 1S7RB 5JPNB 3PF2A 1YN6A 2B1AL 1G7MA 2ADIA 3ALPA 3QWQB 3QB7C 1ULVA 3QNZB 3KPSB 2OZ4A 4OUUA 1MEXL 2WUBH 5TQ0L 5CEZD 3FJTA 2FLRT 4NKDB 3O6KH 1YECH 2EDBA 5D72L 1T66C 1FNLA 5ENWB 2G5RA 3CU1A 1FL6B 1F4WL 4FQJH 2AABL 1DLHA 2AW2A 5HVFB 1Z9SA 4WHTB 2I9TB 1UC6A 4HGKC 5E6IC 3VXPA 3REVB 5D7IA 4YE4H 1T03H 5I18H 2YBRA 3H2WA 1MLBB 5F44A 4WUUB 2Z92A 3BWUC 5AZ2L 1MAKA 2AK4E 5ACMA 1KNOA 1JYVA 3SE9H 4MXWH 2D7PA 5DJDA 2QQKL 5I15L 5BOPA 5F3BB 1RZ7L 1L7IH 3TPKA 2UZXB 4AIZA 3KWWA 4JAMA 1X5ZA 3ISWA 4JPWL 4TPRH 3S35X 2GTZB 3WDHA 3TVMC 4U1IA 5HDBE 4LHUD 1CGTA 2J8OA 4QO1A 1RZKC 2P5WE 3U46A 4PJ7E 4Z77B 3G08A 1Q94A 4P2RE 4MXQC 5K93A 3U6RA 3QUKB 4PJDA 3OF6A 4FQCH 4PJAF 4URTB 5IGXL 2OXGA 3AAZA 4J4PC 4MQ7A 4C83A 1LO0L 1A4JB 1DBJH 1S8DB 5H94B 5D93C 4GAFB 3OB0H 4R2GB 4RRPG 3J8F7 4NQSA 1BD2E 2VQTA 3KPMB 4X6DB 4M43H 3NTCL 2QBWA 3KYMB 4LGRB 1NUNB 4Y5YC 1KPRA 3B9KD 4XP4H 2A0LD 1HHGA 2VL5B 2AEWA 2ESVE 1PKQB 3VH8G 2XN9E 3X11B 4ZUUA 2MCG1 2EYRB 2EC8A 4QXGH 4JFEB 1VACB 1IGIH 3O2DA 4PRID 2HRPH 4L5FL 4BSJA 3MV11 1NAML 3C2SA 3LQAH 3WFCH 1LD9A 1UB5A 4KWUA 4RSVA 3VDBA 5SWSD 3T1FA 4NNXB 3WKNA 5A3ID 4LCCB 3IU4L 4PJ5B 2V2WB 1NCBH 2NY0D 4XI5D 1DN0B 5T1KA 4XMLH 1YYMH 43C9B 4PRBA 2KDGA 2AEQH 5EWIL 1QHOA 1MY7A 5DQJA 1FO0H 1RK0A 5E1AA 3VG9C 2R39A 3MRGB 3V0WL 2GUOB 2ZCLH 4K94H 5ICZB 2Z31A 2VKWA 5C0CB 3WJJC 2X1OA 4Q9BA 1A6AB 3B4NA 1HHIA 4UDTB 4WW2F 5DYOB 4ODVH 3O4LA 4LFHD 5EIVA 4G8GA 2VQ1A 3H8NA 5KSVA 4IJ3B 3FQNB 3EYOB 3CFIC 3FO0L 4KZEL 3EYQC 3CC5B 3PG2A 2VLMD 5GJSH 1B4JL 1NMAH 5B39B 2AK4B 3LIZL 4ZSOB 3ARTA 3EYVA 5C08D 4X6CA 5DZOA 3ARXA 5IB1B 2NY5C 3D3VB 4FG6C 5LBSL 1QSEE 1ZT1B 5CLTA 2ZG2A 4MQTB 5DR5L 2VDOL 2OI9B 5DJ0B 2FO4B 4XCYA 2ZSWA 1ZS8A 1PQZA 2HVKA 4NRZB 3MBXH 3MRFB 4P2RB 2RIKA 3S4SG 2E6QA 4JFXA 4WFFD 5JO5A 3U9PH 1DQMH 3WO4B 1NFDF 3BXNB 3C5JB 3BIKA 3UJJH 3ZL4L 1OCWH 3MC0A 1AGCA 5CD3B 1CQYA 1UYWH 1MWAH 2EDKA 3KLDA 5ALBH 4WFED 3D2UA 4GSDH 1L7TH 5HHOD 3WIIH 1QTYT 2Q6WB 1RIUL 5ERWA 3BKCL 5EC2B 4FQIH 4YX2H 2Z8RA 2QHRL 4WTXA 1I75A 3TIEB 5ACZA 5FV1L 4V1DD 4LVNC 3G5VB 4LLMB 1A7RH 3D25A 3RVWD 4Z76B 5ANME 5F8RC 1CBVH 4XTRD 4HJJL 1HYRC 3O6FD 2CMRL 5CD5C 3L3HB 4YHLL 1LK2B 4MMZC 2GJ6E 3CFKA 2C4FT 1H3WM 4JO1L 1WIPA 3ME0A 4Y5XA 4X7TB 4Q7DA 3NCBB 3W5MA 3UTTB 3BUYA 2Q8BH 4MDIA 1ORQB 4R90H 1JZ6A 4D0BB 5DJCB 1C5DA 4GW5B 1KCVL 2GTWB 3ARBD 1BHGA 4BH8B 4WI5A 4PJXA 5BV7C 2BRRL 4JZNA 4NZTH 3GSQA 2P8LB 1S9WA 2J8UF 5GGSA 4HW6A 3VFNB 4XH2B 1OLLA 3A6BL 4JGJA 2ATKA 3M1BB 4ZFOB 1QRND 2NW3A 2EE9A 3D85B 4UUJA 4UOW1 3VWKB 2VN4A 2BOBA 3BPCA 1UJ3B 4DN4H 1QNZH 3DROA 3K2UH 4JKPH 4RISH 1U0QA 1SM3H 2J4WH