3D5QA

Crystal structure of 11b-hsd1 in complex with triazole inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
269
structure length
264
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinctive molecular inhibition mechanisms for selective inhibitors of human 11beta-hydroxysteroid dehydrogenase type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 92
structure length 264
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3d5qA00
4WNIA 3SLGA 1KY4A 1YS4A 1TT5B 3FNHA 4BHTA 1YXMA 3GEDA 2G5CA 4IDEA 3WGZA 1UXHA 2OO5A 4XJTA 2EGHA 3OECA 4XR9A 1WW8A 5COAA 1UP7A 1PJSA 1MGOA 2X9NA 4L75A 4CV3A 3ROQA 5COQA 2B35A 3NGXA 3CXRA 3ZWWA 2VT2A 4MVJP 2CD9A 3EC7A 1UZNA 4J6FA 3W8FA 1PR9A 4R5MA 1LBEA 1BDMA 3D0OA 1K6XA 4BV9A 1N7GA 3S2IA 1G1AA 4MKZA 4LN1A 4A5OA 3RSHA 2UUPA 4CMKA 1D1TA 4E0BA 2DBZA 3NDIA 4GWKA 3JQFA 4RF4A 3BMOB 3SEFA 4JK3A 1UXIA 1QG6A 1VM6A 2V6FA 4NJMB 4DBZA 4IDCA 1D7OA 3KRTA 3E8XA 3BMCB 1Z7EA 1MV8A 1NQTA 2DPHA 2AG8A 1Z74A 1AN9A 2DQ4A 3H9EO 3AW9A 4OQZA 2F00A 3G79A 1LC0A 1B3BA 5BNTA 3EZLA 3A28A 4PZCA 2H5LA 1E6WA 4HWKA 1CYDA 3I5MA 4YR9A 2P68A 4Q3AA 1YJQA 3CKYA 1PGOA 3HSKA 3Q1LA 2ET6A 3ZHZA 1R4MA 4AICA 4E30A 1LLCA 4QFDA 4A03A 4RV9A 4JP2A 1VJTA 4E32A 4ALIA 4BV8A 1OC2A 1PWXA 1LQTA 1PJCA 5FYDA 1F8GA 3D1LA 3F1LA 2IEDA 5CDGA 1G6KA 3HDHA 5TJHA 4B4UA 1PS8A 1YL7A 4BB5A 2GGSA 1TT5A 3BTOA 4LVCA 1U4OA 3W1VA 3ZWVA 3JQDA 5K9ZA 4FN4A 1TA4A 1F14A 1PU2A 4BNFA 1NAHA 3B1KA 4BNIA 1XELA 1I3NA 1ADFA 1I5RA 1HYHA 4D43A 2PTGA 1QR6A 3MOIA 5JPIA 2RIRA 2YFQA 4UEKA 1E92A 1N1GA 1R12A 1ULSA 3PPIA 2HSDA 1IPFA 2EG9A 5JFOA 1EDZA 1UZMA 1BTOA 5CPFA 3U0BA 2JAPA 1U2GA 1B8PA 3WX0A 3IJRA 3PDUA 4D41A 1LI4A 4BO7A 2VHZA 3SC6A 2Y0EA 2P2SA 1E3LA 1GL3A 1YOVA 3STHA 2ZB8A 4NIMA 4J91A 3E9MA 3LQFA 1OMOA 1VL6A 3GVHA 4P4NA 5KJ6A 4OIMA 4IINA 4RVHA 2XXJA 3KYDA 3TF5A 1P1JA 3RBZA 3DHNA 3BMCA 2ZTLA 2LDXA 3ETEA 5JC8A 1YRLA 2UAGA 3ZI0A 4NHEA 1KEPA 4KDEA 1PIWA 1ISJA 4XYLA 2O2YA 3D7LA 3GFGA 2WTBA 1SPXA 4BQRA 3S2GA 1O6ZA 4YEDA 3ZCXA 1CETA 1BXKA 1I8TA 2VZ9A 3NKLA 3WB9A 1TXGA 1XYGA 2ZB4A 2IODA 4FOSA 3KYBA 1P45A 4D46A 4EEZA 1C0IA 3R1IA 3ZNNA 1YJ8A 2X5OA 3DOOA 4J7UA 4K28A 1EZ4A 4IXWA 1E0DA 1MLDA 1LUAA 1EUCA 3DFUA 3RUAA 4ALLA 4B8ZA 4CPDA 5EJ2A 4OJNA 1K3TA 2CVOA 4E2XA 2FR0A 5ENDA 1JQBA 5GY7A 4WLEA 1P1FA 1GEEA 4HFNA 4DIFA 3QWBA 4XYEA 3V5NA 3N74A 3IAHA 3LSYA 4J1TA 5AYVA 4L0QA 1LDGA 4A2CA 5C3MA 4J43A 3JQGB 4W82A 5DULA 4YACA 1LLQA 3HZZA 3A06A 5IN4A 2TMGA 4ALNA 3V2UA 3ZWNA 3HUDA 2I65A 3B6ZA 1C1XB 4CLXA 4DLBA 2I6TA 1PL8A 2Y68A 4BNGA 5TGDA 4BO9A 4NBTA 3W8DA 1VKNA 1UDAA 2GYYA 4W99A 1ENPA 5F3RA 2V65A 3DZBA 4LMRA 2XAAA 2I76A 4XB1A 1D1SA 4E5YA 1HDZA 3WQQA 4DWVA 2GASA 3VPHA 2FPIA 1Q2XA 1YB5A 1SEPA 5KCZA 5U1PA 1YBAA 4R1SA 4DPMA 4LCJA 5B4TA 5T67A 4WASA 1EK6A 4GGPA 3GMSA 4UUMA 1IL0A 1WWKA 3BMNA 4D7AA 5DCUA 3B1FA 3PHHA 2AHRA 3ZW9A 2HU2A 5C7IO 2DFDA 1NQAO 3TL3A 2IDZA 3JQAA 2D3TA 4RF2A 2PA3A 2Z95A 5KVQA 5HA5A 5CDUA 3OSUA 4RORA 4OGWA 3WYEA 3DBRA 4D44A 3V1TC 1WMAA 4PLCA 4ZN6A 3PFFA 4AJHA 3BYZA 2LDBA 3AOGA 3H2SA 4Y8VA 4ZQHA 3G17A 3TJRA 4U8GA 1CQJA 3QSGA 2QX7A 3DB2A 3KYCA 1UAGA 2XPCA 4YT4A 3WICA 1GYRA 1ZSYA 1HE5A 4EJMA 2EV9A 4I5FA 1BG6A 4I1IA 1N2SA 2G76A 5DOVA 1ISGA 5A05A 2QRLA 4XJSA 4FFOA 3H7AA 1QYWA 4CV0A 2F1KA 5CDSA 1ZNQO 2RH8A 3RC2A 4CL3A 3DBVO 3RD5A 5DT9A 3E5RA 1LSUA 3GEMA 1VL0A 4DQXA 1LDEA 4IMRA 3PHLA 4M49A 2PNFA 4AJ2A 2Y1GA 4B7CA 4ID9A 1C0PA 4B4WA 1E5QA 2CY0A 2E82A 1UJMA 2NSDA 3CMCO 4EDFA 3TFQA 4PLFA 5F5NA 1HKUA 4CUJA 3VPSA 2RHCA 1KEUA 1B3RA 2EIHA 1U5CA 3JQCA 3NUGA 1DRWA 1DC3A 3O9ZA 4Y6SA 3DZJA 3JQ7A 1NXQA 3DO5A 2FSSA 4I5GA 3U4DA 4ONEA 2EW2A 4BO5A 4R9RA 4D79A 5CEEA 1OI7A 1RKXA 1U2DA 2YW9A 1VKOA 1YONA 2FPGA 3WGTA 4M1QA 4J4HA 1N92A 3JQEA 3TDKA 4EUEA 4BO1A 3RBVA 4AJJA 4WK6A 1U3VA 4XRGA 2OXIA 1GYQA 2JJYA 2ZTVA 3DFZA 2V6MA 3M6IA 1XDWA 4M8SA 5A9SA 4PZEA 2E49A 1U28A 5I8ZA 2Y67A 3UN1A 1O94A 2JD0A 3PRJA 3HN2A 5H83A 8ADHA 1O95A 1T4DA 1E7WA 2AEMA 3RFXA 4WCFA 2D0IA 2YHIA 3UXYA 2W2LA 3RASA 4HADA 4E5KA 3N58A 2NU8A 1U7TA 1TEHA 4URFA 5CHEA 4D45A 3DZKA 5IZCC 3GVXA 1PWZA 3AY3A 4CR6A 4I5DA 1B26A 1LRJA 2VOEA 3KLPX 2B4TO 3NTOA 1SBYA 3GAZA 1O9BA 2X58A 2EKQA 4R01A 2GERA 2DPGA 2CUKA 1Y8RB 5JO9A 2D59A 4CL8A 3S2EA 1NVGA 3Q2IA 3WGOA 4DGSA 3IL2A 3BIOA 2B5WA 3T4XA 3ABIA 4XGIA 2Q2QA 1P33A 2J3JA 4YAIA 1GZ6A 5AXDA 1JU9A 4UEJA 4IUYA 4CM4A 1MC5A 2P4HX 2VCYA 3NEPX 2NADA 5JAQA 5JW6A 4BMNA 5C5IA 3CZMA 9LDTA 4CLEA 4YT5A 3WDSA 1LJ8A 3GRKA 4Z9FA 1DB3A 1N5DA 2WM3A 5JBIA 3EK2A 4KZPA 1ZK0A 1H94A 1B7GO 4XA8A 1H9BA 2IXBA 3PTZA 4WUVA 4GKBA 2JFFA 3RJ9A 4B3JA 3NDRA 4WOJA 3JYOA 2HDHA 2A35A 4CM6A 2ZKLA 1E3IA 2E48A 2HJSA 3Q6IA 3WFIA 1NPTO 1ZJZA 3DTTA 4OXNA 5H82A 3JD4A 4AJOA 3UICA 5GZ3A 1A4IA 1HYEA 1RM0A 4GI2A 3AU9A 3D4NA 3FN4A 1B15A 2BH9A 4NFYA 4XYMA 1LDYA 3IS3A 1EUDA 1GR0A 3GUYA 2OP1A 4PZDA 4JJIA 4IM7A 4MVJE 2GZ1A 2RBEA 5DDIP 3IC5A 3NGLA 1OFGA 2BGLA 1IE3A 1H6AA 2AQKA 1B8UA 1BVUA 4YJGB 3ROMA 3LLSA 4B3IA 4CMIB 4K1LA 2DC1A 2PK3A 4A26A 1M6HA 4E21A 3DWFA 3HFSA 2JKVA 1SC6A 3IP3A 4AVYA 3V2HA 1QLHA 3QP9A 5A5EA 4MIYA 2AQHA 3ZU2A 1I3MA 4CMCA 2Q4EA 1NWCA 3SLKA 2G1UA 4IJVA 3VZSA 3GVCA 4WLVA 1JKJA 1XCBA 4GMFA 2PWZA 3LVFO 3SJ7A 1DAOA 1IOLA 4LMPA 5U4QA 4R3NA 5ITVA 4DPLA 3PP8A 4CV1A 2P9GA 3E9NA 5KIAA 3JCZA 1KBZA 3UHAA 3QA9A 4PVDA 1IUKA 4CUKA 3TL2A 4YDRA 2FP4A 3PQFA 1ISIA 1KERA 4YVFA 4MOWA 4XQ9A 4BL5A 1DFIA 1E7QA 5JDIA 4J90A 3QWHA 5EN4A 1QLJA 4TROA 2VOJA 3MJVA 1R16A 5I7VA 5DOZA 2O3RA 1P1RA 1OAAA 1QRRA 4FQ8A 4XIJA 4Y98A 5EQDA 5C7LO 2HK7A 4OKIA 4ZGWA 1Z82A 5GZ6A 1YGYA 3GNTA 1ULUA 4C4OA 3KB6A 3IDSA 2NTJA 5L45A 4DBVO 2AEFA 1TI7A 5KJCA 3DXFA 2WD8A 5BNIA 3M2PA 1YH3A 1GD1O 3K2BA 3K30A 3QWFA 1OOEA 1HRDA 3EY4A 2IZZA 4N7RA 2ZIZA 5KJEA 2HMWA 3AM3A 4CUZA 1P0CA 1M2WA 1HE4A 2ZYAA 3GGPA 2BD0A 2J8ZA 3H9JA 2Y0DA 3FR8A 3CTMA 1XU7A 2CF5A 4KOAA 4NU6A 3FD8A 2WE8A 4II2A 2C5EA 2BRUA 4Z3DA 4DLAA 4RPHA 5KKCA 1CEQA 4WLNA 4OSOA 3FPCA 1LRKA 1IZ9A 2Q2WA 3WOHA 5L40A 2UYYA 3LC1O 2P9CA 1U3WA 1WP4A 3GMDA 3ICPA 5ILOA 3KSUA 3WGYA 4YPOA 4QFCA 3V1UA 1MX3A 1SOVA 5K6AA 2O3QA 3F47A 1T24A 2B37A 2VRBA 3ZWAA 2OMEA 3DZIA 4J49A 2Z1MA 5FWNA 4UVDA 5HTOA 4MVJI 3TNLA 1QKIA 5IDQA 2YQ5A 1MC4A 1PL7A 1HSOA 4YQYA 1RJWA 4WGGA 2BFMA 4UVGA 2FZWA 2R6JA 3KYCB 4RVSA 3DBHB 5B4UA 1Y1PA 5HRUA 4MKXA 1YVEI 4XD2A 2EJVA 3GH3A 1EMDA 1E3EA 4BVAA 4QECA 3LK7A 4IDGA 1K2WA 2NNLD 3PEFA 1ZW1A 3JV7A 1DEHA 1K5HA 4NBUA 3ADOA 3TN7A 2PH3A 1HSZA 4IS3A 1QYCA 3INTA 1QORA 2J3IA 2DM6A 3MTGA 4PFJA 5FF9A 4NZ9A 1W4ZA 3ZV6A 3U4HA 1O8CA 3ZHYA 4JNKA 3R0IA 3PK0A 2TMDA 4RDHA 4MVJM 1NBOA 1LSSA 1XQ1A 2P91A 1C1DB 1BW9A 1Z45A 2R00A 1D3AA 1ONOA 4AJ4A 4TRJA 2PFGA 3D3WB 1T25A 3I83A 3AFMA 4NNJA 4Q3DA 3KBOA 4FBGA 4MIOA 1H6BA 1P0FA 3WQSB 3WBFA 4MP8A 4CM1A 4NU5A 4O63O 3PJDA 1NHWA 5EESA 3RUHA 3E18A 5EERA 3RU7A 4F46A 2EWMA 4ND3A 1Q1NA 1QV7A 2VHWA 4BO6A 2FY8A 5T8KA 1YQXA 4NQZA 3SBOA 4P8RA 2FR8A 5A3VA 3ZZNA 4WKGA 4Q39A 1HDRA 1T2FA 4P22A 3RBXA 1KC3A 1SCUA 1TB4A 3OJLA 3UGKA 5BR7A 2HK8A 4Z0HO 3DAPA 4QT0A 2ZCVA 4R4JA 1GY8A 4O59O 3ZV3A 4MVJA 1LX6A 4FIZA 5DNAA 1NWHA 2Q99A 2VWPA 2Y93A 3ROPA 4DQUA 9LDBA 1V0JA 1GFSA 2O23A 4QXMA 3ZV4A 1NVTA 1G0NA 3C1OA 4CMIA 4CM3A 3LF1A 2Q50A 3DQPA 1LXCA 1WXDA 1Y81A 1YDEA 4L76A 2HMSA 3K31A 4HNHA 4GVLA 5JMWA 2A4KA 3T7CA 1U8FO 3OM9A 2X0NA 1BSVA 3HN7A 4MDHA 4YWJA 4ALKA 1AHIA 3DOJA 3GZNA 2ZQZA 2RCYA 4CLDA 3LDHA 5IF3A 2OBYA 1T2CA 1X15A 1WMBA 1LTHR 3A14A 2YDXA 3LU1A 4BUCA 4ZHSA 4D0SA 3ONEA 4A7PA 4MINA 2CDCA 3OA0A 3GRPA 3ST7A 1HLPA 3DL2A 3AY7A 1N1EA 4PLZA 4JJGA 3KYDB 2E4AA 1A72A 2AQ8A 4H16A 3VTZA 3U09A 3HB5X 1GQ2A 4Y6RA 3KO8A 4ZICA 4KQWA 1YQGA 5IXSA 1ONPA 3FR7A 5BSGA 3ZN2A 1ZH8A 3M2TA 1PGJA 1EFKA 2WDZA 1GPJA 2EERA 3PLNA 3G1UA 1PS0A 1B0AA 3WGQA 1CJCA 3RUEA 1UDCA 1HEUA 4HBGA 4Z0PA 3W4IA 2X1HA 3EVNA 1I3KA 3GOHA 3DMTA 1YB1A 4LK3A 5JLAA 5F21A 3HADA 3I9NA 4FFLA 1E3WA 4ND2A 1V8BA 2X23A 3DBLB 2BFOA 2D8AA 3JQAB 5JCJA 5TQVA 2EJWA 2P5YA 4MJLA 4GX1A 4HUJA 4X54A 4MP6A 2HMTA 1GEGA 3TZQA 2PZMA 1PSDA 3GN1A 4ZQBA 3U49A 2VRCA 4E5MA 2IXAA 3MCVA 4AJ1A 5F1KA 5G2OA 3F4LA 4KWIA 1HF3A 1E6EA 3BZUA 1UDBA 1E7SA 2FZEA 2B83A 2VYVA 5CG1A 3TZHA 2O7QA 4YAJA 4Z6KA 4L4RA 1H5QA 1D4FA 2EEZA 2CF6A 5JE8A 1P3DA 1ADBA 4IJWA 4O6VA 4YJGA 2VHXA 2GUGA 3EDMA 1JKIA 2O3JA 3ANMA 3NYWA 4JROA 2UDPA 4JQCA 4KTTE 1FMCA 5K6AC 1H6CA 4YRAA 1QYXA 2VHYA 5JMPA 4MP3A 3WNQA 3HJAA 2X86A 3G0OA 3E1KA 4XX0A 4M55A 3WIDA 3CIFA 3RUDA 4EJ6A 1CQIA 2OGUA 2QHXA 1E3SA 5H81A 1C1XA 4IXTA 2RHRA 4LRTB 4FJ1A 1BXZA 1ADGA 1I32A 4OOFA 2PZKA 4BNHA 3ZWMA 3VH1A 3A4VA 3Q9NA 4E3ZA 1K0UA 2Z5LA 3ONDA 3EW7A 4BO0A 3BTUA 2C20A 4EITA 3OJ0A 1BXGA 3G1TA 1MG5A 1E3WB 2FSVA 3PJEA 4ND4A 3H4VA 1FDSA 1V35A 2WWRA 4JBGA 1DC5A 3GLQA 3JQ8B 3ETDA 3JSAA 3ZV5A 5JO0A 1TT7A 2VT3A 4W9NA 1CRWG 4UVIA 5T5QA 5A03A 1JA9A 1HE3A 3WS7A 1A9ZA 4PG6A 1P74A 3JQFC 4CJXA 3MTJA 2J3KA 3LT2A 3C7CB 2CDAA 3ZDFA 3H3FA 5L4LA 2ZYDA 3UFXA 1SB8A 5FEUA 3ZWPA 4O5OA 3Q2KA 2GO1A 3JQ6A 4DA9A 5JCXA 4IGFA 4E4YA 4RLSA 4HFMA 4OOEA 4CLRA 1SEVA 3FNGA 4O0LA 1ZMTA 3W6UA 1M6WA 4O1MA 2VYVD 1ONNA 5J23A 1J5PA 2X5KO 5CDYA 4L73A 2AA3A 2FRDA 1ZK2A 3GAFA 4J7XA 3NT4A 2ZB7A 4K26A 4KTVE 5TT0A 1AUPA 1A4UA 2PR2A 1PJ2A 1HXHA 1PX0A 2GDZA 4ZQFA 3V2GA 2WMDA 4WCFB 3AM4A 3P2YA 2JCVA 3KOUA 4QSMA 2JD1A 4YQZA 5TNXA 7ADHA 4YXFA 2YV3A 1E1LA 4BNLA 4L4SA 1NQ5A 1YO6A 3EYWA 4P4GA 5KJFA 5JNLA 5K0ZA 1O5IA 1T2DA 3WWZA 3BHJA 3KV3O 4H7PA 3L6EA 1YE3A 5T8KC 1ZIDA 2YUTA 5A04A 1KETA 3TPCA 2I5PO 4IIUA 2GNAA 4J1SA 4QUKA 4IDBA 1R37A 2Q2VA 3NTRA 4YCAA 1H6DA 3KZVA 5EMHA 3FTPA 1JN0A 3QQPA 3GNSA 1M67A 5F5LA 3VDRA 1NPDA 2BI7A 3PZBA 3WXBA 1JDJA 1ZUD1 3F6YA 4PLVA 3P2OA 4XQCA 4XZ3A 2PD4A 2Q45A 3RUCA 3U4IA 5L7YA 3WLEA 2W8ZA 4B79A 4PG7A 1YBMA 3FNEA 5AXAA 1V6AA 2B5VA 4GH5A 1E1MA 1T2EA 4K6FA 1R4MB 3FI9A 3PZRA 3L6OO 1YB4A 5A4DA 2BLLA 4IDAA 1J4AA 2HUNA 2GN4A 4N18A 1XIVA 4YT8A 4RGBA 2OBNA 3K73O 3AOEC 1PJBA 2DUUA 3F5QA 3F4BA 4Z9XA 3ZGYA 2BGKA 5IN5A 4Q3CA 2B69A 3JQAD 4ROSA 1A27A 2VZ0A 1HDXA 1VC2A 2WE7A 3VDQA 2QIOA 5L7WA 1DOHA 4XIYA 3EHEA 2QYTA 2JD2A 3PGXA 2C2XA 3QW2A 1XEAA 4GSLA 4WOKA 4J4TA 3JD0A 1U3UA 4AJEA 2C5AA 4B3HA 1IY8A 4Y6PA 3NDJA 4LGVA 3VH3A 3AY6A 1R0KA 3AUAA 1V9LA 2BMAA 4U7WA 2PGJA 1P9LA 1EK5A 4RPKA 1SOWA 4YB8A 1PJ3A 1EDOA 2H63A 3D3EA 4PLHA 5TC4A 2DVMA 2GN9A 4F45A 4J4BA 2IEBA 3CMMA 1T2AA 2P5UA 4QX6A 2EHDA 1XKQA 1PS9A 4E6PA 1Y7TA 2QZZA 2QRJA 4BB6A 1OBFO 3COSA 4JGBA 4AJLA 2BGMA 1CWUA 4B4OA 3IKTA 3LT1A 4XDZA 2G82A 2I67A 1DXYA 4FR5A 1VRWA 2NTNA 3H5AA 2FMUA 3O03A 1N7HA 3KSZO 3NAQA 4BNMA 5A02A 1XA0A 3E03A 4TRNA 1I36A 4YBZA 1B14A 2E37A 1ZXLA 3I9LA 4GL4A 2PKRA 1A7KA 4DPKA 1BRMA 4YYZA 3JTMA 2ZTUA 4DYDA 2YHUA 5ILGA 2YJZA 1B8VA 2B36A 5KVSA 3PWSA 2JHGA 3KM0A 5BSFA 2EGGA 4CM8B 4XQGA 4E2ZA 2X9VA 3AWDA 1PZFA 2WYUA 4W7HA 3AU8A 5KVCA 1KVQA 3KXDA 2JFGA 2GD1O 3PI7A 3SXPA 4CMBA 2CSUA 5ES3A 3GDFA 2GSDA 3MJTA 2FPPA 3OJFA 4D3DA 3JYQA 2AQIA 1EFLA 4Z9YA 2NLOA 1F12A 3K9QO 4HKTA 1DAPA 5EL0A 3DBLA 4CMJA 3C1TA 4U0JA 4G5HA 1X13A 3L6DA 1W0CA 5AQ1A 4I9UA 1P31A 4RDIA 5DN9A 5B37A 2EP7A 1HDYA 5L3ZA 3C7DB 1CDOA 1HT0A 4D0RA 5FI5A 4MVJD 3DAGA 2Q3EA 5IAAA 3D4PA 3WMWA 3MEQA 3ASVA 1UR5A 3B1JA 4E12A 3E6AA 5HS4A 2Y1FA 3MJSA 5G0WA 4G81A 4E13A 3PYLA 5F1PA 1MB4A 3GNQA 3UF0A 3ZWOA 3WGIA 3GA0A 2W4QA 3WBBA 4GMGA 2O48X 1H9AA 4M87A 5F1OA 2J6IA 5A06A 1AXEA 4R51A 4EZBA 3QVWA 2DT5A 3ZU3A 4II3A 1U1IA 4RPJA 2EP5A 1WDKA 1I2ZA 1IHYA 1GDHA 1C14A 1ISMA 2HO5A 1X1EA 4FPXA 3E82A 2Y66A 1GV1A 4U5QA 1UAYA 4NFHA 3GZ4A 5KKAA 3GZNB 3SX2A 3WTCA 1X0VA 4IZIA 3BTSA 3F5SA 4E2YA 4BKPA 3RJ5A 3UH1A 4IDFA 3VZPA 4EUFA 4WEQA 5AXCA 3GQVA 3W4KA 3H2ZA 4S3MA 1Q7BA 3D64A 3VH2A 3AM5A 4GLLA 4BO3A 1ZJYA 4CR8A 4KWHA 2GF2A 3JQ8A 5G0SA 4FW8A 3N7UA 2WYVA 3VZQA 4AFNA 3DZHA 3IIEA 4ZU3A 1LEHA 4ND5A 3RKUA 2ZJ0A 3V8BA 3GVPA 3UCXA 1Q0LA 3A9WA 5T6BA 2OP0A 5ADHA 2BELA 1DIHA 1GCOA 2X0JA 4MVJG 3PHIA 5DBIA 1I24A 3PFWO 3QVXA 3AUSA 1ARZA 3KEQA 1NAIA 4RQTA 1JKFA 3HDJA 4NI5A 3LF2A 2B0JA 2CVZA 4BNUA 1NYTA 3CINA 3GDOA 4IIVA 4ALJA 1KVSA 1X1TA 3OBBA 2Q49A 1O0SA 3Q0EA 3QHAA 2Y1CA 3H3JA 4HP8A 5I9MA 1LNQA 1XHLA 3QIVA 3HDYA 5BNFA 3ZU5A 3PLRA 3AOEA 4YJFB 4JX8A 3UKOA 4BS9A 2X4GA 3PIIA 3DAFA 1Y8RA 1WAMA 2FOIA 1R0LA 4GVXA 2HAEA 2Y99A 3M1AA 2OL4A 2JAHA 3DEYX 5AOVA 1LC3A 1BDBA 4NR0A 1I01A 3H5NA 5DP2A 4CMEC 2Q4BA 4BNJA 4DRYA 1M66A 2A94A 4CQMB 2VNSA 3FSRA 3IP1A 5JSFA 2AW5A 2EXXA 1KYQA 2O3SA 2NTVA 4NJMA 4BGVA 3ASUA 1W8DA 4JXKA 3I52A 3WNVA 4QEDA 3ITDA 4AL4A 5IJZA 4DIBA 1CF2O 3MOGA 4GGOA 4OMUA 1E3JA 3C85A 3ICCA 1NFFA 1LRLA 1QSGA 2DTXA 1L7EA 3O8QB 4ZD6A 3WTBA 1DLJA 1KC1A 4FGWA 4BNTA 2C54A 4AJNA 3DMYA 2W98A 1FJHA 1J6UA 3O4RA 3Q11A 3LZ6A 1W73A 4BOYA 3O38A 5EIOA 3TOZA 2BF7A 4WPGA 1GTMA 3OJEA 4YAEA 4IDDA 4NFSA 4TVOA 5DF1A 4XGNA 4OO3A 1BVRA 2I9PA 3ZW8A 1E7MA 1GU7A 1X7DA 3JD3A 3QJ5A 5G0TA 4PLPA 4N5NA 5CPBA 3UVEA 1R15A 4TMFA 3MJEA 1MXFA 2IYOA 4GKVA 4RJTA 4ALMA 1QP8A 5CAEA 2P9EA 4CV2A 1PJQA 1XWFA 2GR9A 5A9TA 4BNYA 3DDNA 3KEOA 3F46A 4CM4B 2ZATA 3GR6A 3I6QA 4JLWA 3C7AA 1QMGA 3NX4A 3UCFA 4KUEA 4A27A 4B7UA 3OP4A 1Z6ZA 4MKRA 5BSEA 5HBRA 2OFPA 3OIGA 3E5MA 1XU9A 3INGA 1I30A 3OA2A 4GX5A 6LDHA 3HQ4O 2HCTA 2IZ1A 4J16A 1PQUA 1NM5A 1XQ6A 2AG5A 3PJGA 4ZA2A 3RIHA 3ENKA 2QZ9A 2JCYA 4IY1A 4RQUA 2W2LD 1Y5RA 3JQ9C 2VTDA 5HM8A 3OQ1A 1XGKA 1C1DA 4CMAA 1DPGA 2JHFA 3TSCA 3DZFA 4YJHB 4CM9A 4YTEA 4Y67A 1HL3A 4K9DA 4XKJA 3C8MA 1H0KA 3EUWA 1ZO8A 4KMSA 3C3XA 4XYBA 1DRVA 1PJ4A 2VQ3A 4YRDA 3U3XA 1I33A 3G3EA 3VPXA 3K5PA 4RO0A 3TFOA 1R66A 4PLTA 3OH8A 3X2FA 3DBRB 1E7RA 2AEJA 1WDMA 5COBA 5FFFA 1DFGA 3RC1A 3KETA 4BMVA 4TZKA 4IS2A 4CQLB 3NJ8A 3ZU4A 3HDQA 1DIBA 1ZVMA 4OXYA 3GG2A 1VSUA 3A1NA 1LSJA 2NVUA 3JD2A 4R16A 1R6DA 3JYNA 4WLUA 2HLPA 1AHHA 3MJ4A 3FWZA 1EVJA 4ND1A 1IULA 1P44A 4DXHA 1RM4A 1NR7A 1FDTA 1DHRA 2O2SA 3I9KA 3NJ4A 4L4XA 3WG9A 1BHSA 4NDNE 3ROKA 3RVDA 3ANLA 3JQ9A 4F6LA 1DC6A 5TJ9A 4P4LA 2A92A 2VYNA 4TRRA 4RVDA 3PXXA 3VKUA 4BKOA 2VHVA 4KQXA 5JCJD 2JL1A 1I2BA 1HDGO 2V6GA 3NRCA 1EE2A 1FDVA 3KSDO 1WZIA 3IOYA 4GSKA 2BKAA 4NBVA 3W8EA 2X7HA 3AUUA 2EF1A 2X0RA 4UUPA 1R4NB 3FBTA 1UUFA 2OOSA 2C59A 3B20A 3WLFA 4BKQA 1N8KA 2DFVA 4LW8A 1U3TA 4LVUA 4YT2A 2GPTA 4RZIA 1C3VA 1DHTA 2UV8A 3ORFA 3ZHBA 2XOXA 5A5FA 5TSDA 1E7YA 1P1HA 1T4BA 1UXJA 4MIEA 1WPQA 3BMQB 5C7OO 2V7PA 3EMKA 5T64A 5TF4A 4DUPA 5BSHA 4FFPA 3PYXA 3FF4A 2C2YA 1T1SA 3OICA 4LCEA 2UUOA 1SAYA 5JDCA 3L4BC 3D4OA 1JLLA 3S2FA 3QY9A 4NBWA 1EUZA 1DLIA 2HK9A 5ER9A 4GX2A 1HTBA 3AUTA 4JJFA 4IMPA 4J7CA 4DC1A 1V3VA 2GLXA 4YAKA 1GPDG 1MA0A 4XEHA 3RUIA 2C7GA 3W4JA 5G4KA 3L4BA 4R1TA 2Q1SA 4FCCA 3GPIA 2X5JO 3G49A 5TIIA 5IG2A 3IMFA 3ZNQA 3ZNPA 5LDGA 1BGVA 1KVUA 2C0CA 4EW6A 4IJUA 3Q3CA 5TLSA 4BGIA 2DBRA 4BNZA 3VTFA 1KEWA 3GF4A 4OQYA 5MDHA 4Y9DA 1ML3A 5TS3A 1OZAA 2DBVO 1PEDA 4DLLA 5CFZA 2VWQA 1RM3A 4DC0A 3WSWA 2I3GA 3SC4A 3C24A 4RLHA 1ZK3A 3FRJA 3PHGA 4R9SA 3D5QA 3D3WA 4NMHA 1HZJA 3GGOA 5JDCC 1EBFA 4E5NA 4OHUA 2PLAA 3ETGA 3C1AA 4EGFA 2EKPA 2VUUA 5L53A 3S1LA 1AE1A 4YJDA 1UH5A 2D5CA 3ZHXA 3ONFA 1EQ2A 3L9XA 5G0UA 5TX7A 1MUUA 4OSPA 3S55A 4TVBA 2I66A 4F3YA 2O3UA 1I0ZA 1G0OA 2NQTA 3I23A 2JFHA 4XB2A 3HE3A 5I7EA 3DC2A 3QWAA 1PZEA 4R1NA 3RUFA 3ZWXA 4CLOB 4JCOA 4R5HA 2YQ4A 3INRA 1YBVA 4R69A 1ZSVA 2W2KB 4I9NA 3P7MA 1SMKA 3I9OA 3DBHA 4W7IA 1BXGB 1U7HA 3BMQA 4DMMA 4BKRA 4RPLA 3LLVA 5LCXA 5I7FA 4B7XA 4LSMA 1Z7BA 2NV6A 3RKRA 3MJCA 2PKQO 4IJKA 3PYMA 4ZQEA 3RROA 3CSDA 4OAQA 3ZWCA 5I7SA 2Y1DA 2PD6A 5I9NA 1P1IA 5AVOA 4UVEA 4PRLA 2O3TA 2PV7A 3JYPA 3RFTA 5IDXA 1Z75A 2YY7A 2GN6A 1DRUA 3TZ6A 3LT4A 4WECA 1ZK1A 1E5LA 3GPDG 1E1KA 3Q9UA 2NUAA 2AMFA 4TQGA 5FI3A 1FK8A 4IQ0A 1LU9A 3P19A 4JBHA 1IYZA 1PJTA 3WJAA 4L74A 5BQFA 2DAPA 2HJRA 1YL5A 4J1QA 1D8AA 1PGQA 1NP3A 1Y9EA 1FXSA 3L77A 4TZTA 5KWEA 3HHPA 3LC7O 3PJFA 5KJ1A 3L9WA 4Q3EA 4IZHA 2ZYGA 3FBGA 1PGNA 2YV1A 4XQEA 2DU8A 4U6QA 5JYEA 2O4UX 4P38A 1NTOA 1LDNA 4GPD1 4LSWA 1LLUA 4RPGA 5EQFA 1KY5A 1ZFNA 4BO4A 2H6EA 4I08A 5HS6A 1C0LA 1U5AA 3PIDA 3AJRA 3EVTA 3OQ6A 1LDBA 3NTQA 1QV6A 4ILKA 3IJPA 4PG8A 2WEKA 4OL9A 5IXYA 2QQ5A 3RC7A 1LDMA 4J0FA 1VLLA 3QRWA 2PH5A 4WJZA 1JVSA 1YL6A 2BI8A 3W6ZA 3I9MA 5IZCA 1LA2A 1NX6A 5DCYA 1RYDA 2R00C 4FS3A 3BAZA 3I4CA 3U9LA 4BMSA 3ZH2A 1BW9B 4INAA 4R1UA 3JQ7B 3WSVA 1GUZA 4UREA 1IB6A 3LT0A 3U62A 3H9UA 5B12A 1AXGA 5JAMA 5MGBA 4NG5A 3H65A 1HE2A 4N5LA 3AI1A 1DBVO 3TZCA 1JVBA 2O7SA 3JD1A 4CR7A 2C29D 3K6JA 1RYEA 5DBGA 1PQWA 3KTDA 3TRIA 3CUKA 4CM5A 4NBRA 1ZSNA 1NFRA 2D4AA 3CPSA 3BA1A 1R4NA 3KVOA 4NPCA 1WNTA 4J2OA 3JQBA 1PZHA 1X0XA 1ZXBA 3OIDA 2WYWA 1VJ1A 1YWGO 1ENZA 1GUFA 5BT9A 4FJ2A 1LLDA 2IRWA 1XR3A 5JDIC 1J0XO 5G4KB 4W4TA 1A9YA 1EEHA 1SZJG 1J49A 3VH4A 4A10A 3WGHA 3QVOA 2PZJA 4ZQGA 1H2BA 4UAGA 3BMOA 4XCVA 3SJUA 1VE9A 4EYEA 4ITUA 5KVVA 3EZYA 4S1VA 2B4RO 4XDYA 2QYSA 1Q7GA 3ADPA 5DBFA 3ITKA 4R54A 3K8ZA 2NVBA 1M76A 2WSBA 2AXQA 2RH4A 4HFRA 4QQRA 2NVUB 4GLOA 1DDOA 2H1SA 1PTJA 2VWHA 2O50A 2OHXA 1P77A 4GX0A 4M54A 4ZJUA 1GQQA 3PQEA 1F06A 4I9HA 3IUSA 4Q3NA 2WJPA 4PG5A 4CQLA 1UXKA 4NK5A 1S7CA 3H5RA 4OKNA 2QW8A 1JAXA 4GBJA 2GZ2A 1ZCJA 4WCFC 5A9RA 1Q0QA 5GMOA 5LC1A 1NVMB 2J5RA 4N54A 1ZKMA 5G4LA 2J5QA 2I3AA 3BMNB 3DR3A 4DYVA 1E1NA 1H2HA 5DCWA 5DZSA 1R0SA 1ORRA 3AFNA 4GQAA 4RF3A 3UAGA 1QYDA 3NV9A 3T4EA 4FC6A 1ISHA 4MPDA 1ZMOA 1VPDA 1KEVA 3EAGA 3WYCA 1UZLA 1ZEMA 3GUCA 4RZHA 1DSSG 2B4QA 1GADO 1EVYA 1U8XX 1KVRA 3LC2O 3ULKA 4CLHA 4UEOA 3TZKA 1F17A 3AK4A 5DP1A 2IZ0A 3OMLA 3OIFA 4W6ZA 4WNCA 1KIFA 3HNPA 4BQPA 3OQBA 3B70A 2OORA 3GDGA 1MFZA 4M89A 1VI2A 2NU9A 4H3VA 1NHGA 3WIEA 1ISFA 1NPYA 1EBUA 2POQX 2NVWA 3RAJA 4D3SA 2GN8A 1XLTA 3FHLA 4J0EA 1NASA 5ICMA 4PCVA 1P1KA 2XXBA 4J9VA 1UP4A 1LQUA 2YV2A 3EGOA 1UXGA 3FNFA 5ITWA 5B4VA 5CG2A 2DLDA 2E6UX 3I4FA 3PGJA 3DHYA 3UOGA 5HWSA 4R68A 3E9QA 4JBIA 4WLOA 4BNXA 4U0KA 2NU7A 4XWYA 3VPFA 3UCEA 3PVZA 4L9RA 3GT0A 4GWGA 4WLFA 3I6IA 4FB5A 1M75A 8LDHA 1Y9AA 5A3JA 2VTEA 2W90A 2GZ3A 2QRKA 5ER6A 3VC7A 4EI2A 3ZWYA 5IDYA 2GCGA 4HY3A 4OH1A 3DMTC 4R3WA 4MVJH 3NT5A 3ZWBA 2CVQA 4CM9D 1Z73A 1PGPA 3GC6A 3D5TA 5L51A 2CZCA 3GHHA 4PVCA 4UVHA 4LISA 4RF5A 1CIVA 4HFJA 3U5TA 3FPLA 3PDJA 1DIGA 2DUWA 1JAYA 4BNKA 5I8WA 3TWOA 3KLMX 3TOXA 4CLRB 4E2WA 2C7VA 1I10A 3GG9A 3AI3A 2VN8A 4M86A 3RC9A 2YFHA 2BFPA 2ZK7A 1GZ3A 4LRSB 4TRMA 5TT1A 4C7KA 4CQMA 5L95A 4PRKA 2Y1OA 3IUPA 2NU6A 3BTVA 5L9AA 3CZRA 4FGSA 1YOVB 3GK3A 4TWRA 3VAZA 1TLTA 2EKLA 3OF2A 4ESOA 3H9GA 3L4SO 3WFJA 4G2NA 3QVTA 2Q1TA 4EJ0A 3RI3A 3H9QA 5LDHA 4NK4A 1I2CA 2SCUA 4I8XA 4QTZA 4YJFA 4FD3A 2CFCA 4HNGA 4W9NC 2Y05A 3P5SA 4WEOA 2XF8A 3VZRA 4RCVA 1PZGA 1A5ZA 1FF9A 2HMUA 2BFAA 3VVCA 4PLYA 1ZZEA 2X6TA 1H93A 4D3FA 4Q9NA 3VOSA 2Q1UA 3PWZA 5ENVA 1PR3A 2VYND 2X9GA 3O8QA 1YQDA 2ZB3A 5GZ1A 4E31A 1Y8QB 4BNVA 5CDTA 4AG3A 4CODB 4PIVA 1WLYA 2OUIA 2Q1WA 5EPOA 1LSOA 1GYPA 3NT2A 1EVZA 3OHSX 3K2EA 2VRCD 3S8MA 1GZ4A 2YZ7A 3ZNOA 1Q0HA 4CMEA 2Q46A 4CM8A 4DL9A 5A1TA 2RAFA 4AJPA 4XRRA 2GRAA 1QXSA 3QVSA 1GAEO 2D1YA 3RQSA 1DIAA 5JC1A 3AI2A 1I3LA 4IQ8A 3VVBA 2ZQYA 4QO8A 1L1FA 3I3OA 4DVJA 4OM8A 4CM7A 1O89A 5KNLA 4ZRNA 4RVGA 5L4NA 1KOLA 2P4QA 3CH6A 3WGGA 3OEWA 1TVEA 2HQ1A 1GCUA 3CE6A 1ZBQA 2PKQP 4BIIA 1E6UA 4DIOA 4GAEA 4TKLA 1A71A 1DJQA 1HDCA 4Z0TA 1N9GB 4IPTA 1UP6A 5THKA 3WYBA 4YA6A 2NWQA 1ID1A 3MWEB 1HDOA 1DFHA 2HKIA 6ADHA 4NH4A 2Y1EA 2YYYA 1A7AA 2AE1A 4RL6A 4CMHA 1DC4A 4C7JA 1FDUA 2FN7A 1V3TA 4E5PA 4KUGA 3QE3A 2W2KA 1B2LA 2QG4A 5B1YA 4JIGA 1BMDA 4CLOA 4JP3A 4N5MA 4BO2A 1Y5MA 1DO8A 4IGEA 1WZEA 1L7DA 4R41A 1RWBA 2DKNA 2X8LA 4DMLA 4RVFA 4F6CA 1WVGA 2DBQA 3F9IA 1U4SA 2VUSA 3PQDA 1B16A 3I1JA 2PZLA 3QV1A 2DTEA 3WWYA 1YKFA 3GGGA 4BNNA 4UUOA 3ANNA 3BXXA 4L8VA 5JY1A 1WDLA 4RVUA 1ZK4A 4A0SA 1MXHA 2HRBA 3UW3A 4Q3BA 2IYPA 2UVDA 4KDFA 2H9IA 3MWDB 4EUHA 2WD7A 1DIRA 2J3HA 1ENOA 1MP0A 5TRTA 5U9CA 5JAIA 1Y6JA 4TSKA 3VHRA 4FFNA 4AJIA 4PN3A 1F8FA 5G0VA 1HYGA 3GN2A 4ZVVA 4YRBA 1ADCA 3ENNA 2PY6A 2ILTA 2X22A 1F0YA 1IZ0A 1JWBB 1W6UA 2PD3A 4NJOA 5ICSA 2JCXA 4E33A 2C07A 1AGNA 2FWMX 2YHIB 4FDAA 3GEGA 3VKVA 1IHXA 1VSVA 1BWSA 1T26A 4J2HA 3OFSA 3F3SA 4EEXA 3H8VA 4EBFA 1XG5A 3WR5A 5THQA 4CMGA 3RWBA 1U9JA 1YDWA 4DQVA 3KHUA 2CMDA 2R2GA 3V1YA 3BHIA 3DHEA 2OZPA 4BGEA 5JY6A 3FTNA 4FJ0A 5A9SB 1RPNA 2HRZA 3L0DA 4FFRA 4YAGA 1PL6A 1EVIA 3SVTA 4UUNA 2G0TA 1KVTA 3FCOA 4KP7A 4D42A 4A73A 5KOIA 1XSEA 3M1LA 4WE3A 3HFGA 2C82A 2CNBA 1HETA 1Y8QA 3VPGA 3TQHA 4FC7A 3IKVA 2Y0CA 3KUXA 1NQOA 3UUWA 5IZ4A 2FR1A 4FSHA 1SNYA 4BO8A 1SO8A 1HLDA 3LYLA 4PGFA 4G65A 4IBOA 3R3SA 4FFMA 4KUHA 5L7TA 1JW9B 1K89A 3DZGA 5IFLA 3F1KA 1MFPA 2CDBA 5L4SA 2ZTMA 1T1RA 1VL8A 5CEJA 1HWYA 3U4CA 1GQYA 4MO2A 2AE2A 3R6DA 1NR1A 4FOOA 1E77A 1NFQA 3FWNA 2PGLA 3MZ0A 2BHLA 4K6CA 3CEAA 2VNAA 3OJOA 5T57A 4OXKA 3DONA 5JAZA 1GV0A 2FHSA 4UULA 5CP8A 3BHMA 4XR4A 2Z1NA 3HG7A 4TKMA 3DTYA 1C0KA 1CERA 2I99A 2VWGA 2A9FA 1V3UA 2D2IA 3RU9A 4H15A 4J1NA 4DTIA 2V6BA 1K6IA 1X14A 3DOCA 4BKUA 4CQMD 7MDHA 2NM0A 1S6YA 4J3FA 2NACA 4OYRA 1EQUA 3GHYA 4BNWA 3PHJA 5JXWA 1PQPA 4XYGA 3WJ7A 2VUTA 4IQGA 3PWKA 4XGKA 3OEYA 2DTDA 1IPEA 3I9JA 3RCBA 5IDWA 4PLWA 1K6JA 3ON5A 3E48A 4JN6B 4Z3KA 2PGDA 1ZEJA 3R3JA 4B4VA 1QYVA 1JWAB 1OC4A 2HMVA 1HZZA 3HWRA 3O26A 1SB9A 1NNUA 3GVIA 3K92A 1N9GA 5JS6A 1EE9A 3RFVA 4PLGA 5I9LA 4AJKA 4B8WA 4YJHA 2O4CA 3H6KA 1PJLA 5EINA 2D5AA 3GFBA 4I5EA 4QO7A 1ENYA 4HX5A 4MVJF 4HV4A 2G17A 2J5KA 4U6SA 1MG0A 1KS9A 3IQDB 3WQRA 5KTKA 5CEFA 1DJNA 2YDYA 3L07A 4PG4A 5C37A 2IE0A 1GUYA 1X7GA 2ZJ1A 4HXYA 4J9UE 4BGUA 5AXBA 3GY0A 2X0IA 3QWIA 4ZRMA 4DREA 3X2EA 1JTVA 3JYLA 2VZ8A 3JQBC 3QLJA 1VJ0A 3HB4X 3K96A 2WD7B 2ZCUA 3OETA 3JQGA 3WMXA 3T7EA 1Q7CA 1FDWA 2NQ8A 1X7HA 4WCDA 2EW8A 5JYDA 1RM5A
chains in the Genus database with same CATH superfamily
4AW9A 2F4VB 2C7QA 1YS4A 3S68A 3TMYA 4BHTA 4D98A 1QKJA 5EIBC 4KCGA 1Y1TA 1KIMA 3EF3A 2SICE 2W0SA 2H7CA 4QPNA 1FYWA 3OM8A 4IDEA 1OI3A 3A6DA 3K9GA 3WGZA 4WFKA 4P5DA 3ZDQA 5K5EA 1C30B 1OU0A 3PF8A 4CHGA 5KYUB 5IS2A 1E5TA 1WW8A 3HDGA 5COAA 2JC3A 4FXOA 1UP7A 5EIEA 1MGOA 4L75A 3THWB 2OPHA 1BHQ1 4MV3A 4R8MA 3NGXA 3P2EA 2EKDA 1NN0A 1U1GA 4HB3A 1PR0A 1CNFA 3EC7A 3BGSA 4BP3A 1UZNA 2ACKA 4DQLA 5F52A 4DDVA 5IWCA 2NQ2C 3W8FA 1V11A 2P2ZA 4CIAA 2OV3A 3CZPA 4OHFA 3D0OA 1B6RA 4G0VA 1LH0A 2PQ6A 2ZTSA 3MWYW 1X9HA 3R4CA 4LN1A 1D2GA 3ED5A 4BC1A 4CMKA 1VLHA 4DV6B 1DXHA 4GWKA 1UKAA 1G20E 3BMOB 3JQFA 4CKXA 2E4XA 5JAOA 3KPWA 3TEFA 4DBLE 1QG6A 3CU5A 3E7FA 4JUIA 5GJVC 4AWAA 1N6KA 2DYKA 3PPVA 3CZ9A 4KQ6A 3CWZA 5BR8B 4NJMB 3A6EA 3KRTA 1LV8A 1QGUB 1XNGA 1YDMA 4E70A 2A9PA 1BQEA 1PX2A 2VF5X 2P0AA 3IP8A 5TS3A 4FLEA 2AG8A 1Z74A 1UPBA 6YASA 4WA7A 5FV4A 1CB0A 1J7KA 2F00A 3G79A 4Y2QA 3OJXA 4IFIA 5BNTA 3ZVKA 4P6VF 1V2GA 4C7OB 1F6DA 3EZLA 2CW5A 3NOOA 3LX4A 2JAWA 4TXNA 4NBNA 4KOEC 1RIFA 5ED0A 3UHPA 1U04A 1MR3F 1CYDA 4OHXA 4BBAA 2CV1A 3ZJVA 1PGOA 1VIYA 2CNWA 3BS4A 3IQHX 1JNYA 1DADA 1LLCA 2QRMA 2IYLD 3STVA 4A03A 4OHOA 2NZWA 1YD7A 3FWPA 1ZLYA 2GPNA 2DF8A 1YZGA 3QG1A 2NXCA 3HYCA 1U7UA 5TJHA 1FP4B 1KO1A 2GGSA 5GGYA 3IJEB 3ZWVA 3JQDA 2YV5A 5K9ZA 1J0CA 5I7RA 1TA4A 1PU2A 5IK2A 4QHSA 3B1KA 4BNIA 1XELA 3I12A 2ZG6A 3IVGA 1VSTA 4ZKEA 4V1CI 1BGWA 3H5WA 1W48A 4I9FA 3SQNA 1M10A 3S8YA 3QEKA 3UGQA 4K05A 5AVTA 1JEDA 1YTLA 1QR6A 2HF7A 2HNAA 3DVSX 1KO7A 4KK3A 4MLZA 4UEKA 1UFQA 3UK0A 4AUNA 3K6RA 4ZJPA 5CDFA 1R12A 1XNHA 4I81A 2JLWA 1I4TD 4V0KA 3CY6A 3U0BA 1A5AB 3OM1A 3H4IA 2Q4RA 3O3CA 2CCGA 2VP3A 2BDTA 4PGMA 2KW5A 4RS4A 1E3MA 2W2PA 2K4MA 2VHZA 1AUXA 3PQ4A 3OC0A 1BDHA 1ZA1A 4LC0A 4V0OA 1GL3A 2IELA 4TMTA 2ZB8A 3N8GA 4J91A 4KXUA 5FUQA 1CZLA 1OIVA 2OGTA 3LQFA 5MF6A 3RAEC 4P4NA 5KJ6A 4OIMA 3QBTA 2MR5A 3LCRA 2VRWA 1PD0A 3E15A 4JOCA 3VBCA 4YCCA 1QQ7A 5FDFA 2LDXA 3BEDA 1QGZA 3EXHC 1HE8B 3N5CA 5JC8A 3TQSA 2VAPA 5BV2P 1B8OA 3L40A 1EFPA 1N1DA 2B2XA 3ZI0A 1NBHA 4AAYA 4OLJA 5FO0A 4XYLA 1L4KA 4ETIA 1JHZA 2YTZA 3GFGA 2AH5A 4RJKA 5BUCA 5I4KA 2I8CA 3FDZA 3S2GA 4YEDA 3DLIA 1CETA 4HNRA 3ZCXA 5AW0A 2BV3A 3VZCA 1HG1A 1DG9A 4PYNA 2D1QA 2AOTA 2FOXA 3DB1A 5ADVA 2JW5A 2CFIA 4PSCA 4YV2A 1C0IA 2VJAA 2FZKA 2OFFA 3PNMA 2O9JA 3R1IA 3UWMA 3VXKA 1H8ED 2REQA 3G7NA 1RYMA 2CFRA 4K28A 4ZOLA 3ZUGA 4MUBA 4JT2A 3ME5A 1C9EA 4Q93A 1P80A 1T5LA 3R75A 4IWXA 1H65A 4M9ZA 1LUAA 2ZIFA 1W7AA 2RB4A 4N7BA 1VCOA 1JYFA 3JASA 4ZZ3A 3BCRA 2W2MA 1V95A 4CPDA 4IIBA 1EA5A 2QVBA 4OJNA 1ZINA 4X1YA 5HF6A 3HCPA 2CVOA 1E1CA 2WPDA 2ZE6A 4S1OA 4ZVNA 1R3DA 4E2XA 3HZHA 2N75A 1JQBA 2RH9B 3K1AA 1P1FA 2GK7A 4GOOD 4QREA 4HFNA 3SQWA 4H1HA 1DX6A 2PIAA 4R40A 1PW5A 3PRKE 1K08A 1H4SA 1XQWA 1S7GA 2F2TA 3N74A 3G2LA 4IDNA 1RC8A 3AVUA 3LSYA 5C3MA 4F84A 5IMBA 1E2DA 2P79A 3D2CA 2ATVA 5DULA 3GRCA 2JGNA 3N2LA 3NKFA 3DL0A 2BT4A 2X77A 1RCUA 2BWJA 5B53A 5IJXA 2WWVD 2GPYA 1J1UA 1GGFA 3OOHA 1S9DA 4PC7A 1QE0A 3P9XA 5JQGB 4L5JA 1PD1A 4U2FA 4XI9A 1EFRA 4KQ9A 1C1XB 4OHKA 3DCIA 5EHGA 1ZM7A 4IHAA 2JKZA 2WV9A 3G0DA 3NWJA 4MUNA 2PJRA 3AP1A 1Z38A 1PG2A 1QOZA 2XUPA 3UJNA 4NOJA 1UKCA 5KO2A 1DXQA 1BS9A 3EXEA 2G06A 4LMRA 2I76A 1WCIA 1ODFA 3K1ZA 2WYIA 3VNSA 4I3FA 3ZGVA 1HDZA 1P2FA 3LRXA 5DSZA 3DTVD 4JASB 5ALUA 3GQBA 2GASA 2OCKA 3M7IA 4C3ZA 1YB5A 2EX1A 1ZNXA 1RRVA 1R7RA 5U1PA 4RMNA 2GZSA 1PG5A 3B51X 1QS0A 3I0NA 4JFRA 2YWXA 5T67A 4MGYR 5B4TA 2Q3FA 2PTHA 3R3ZA 1VKHA 2FW1A 1EK0A 4D4HA 1E2JA 2QN6A 4UUMA 3R3HA 2Q3CA 4FI3C 3OZGA 1NLFA 1WWKA 2HSWA 1FRVA 2KQUA 3OESA 1FFXA 3B1FA 2KLHA 4NYIR 1YBFA 2D0DA 4DT1B 2HCBA 3PA6A 1RBMA 2WF7A 3HJHA 4X7MA 2R7LA 2DFDA 3DV0B 3L0SA 3O73A 5TQ0A 3JQAA 3GLUA 4DIDA 1G16A 4IWYA 3T9AA 3QUBA 4L1KA 4QU9A 2R4TA 4GOKA 2BEVA 3OFKA 2GCPA 4OGWA 5KVQA 3T3HA 3V1TC 5DEOA 1YKGA 1CFZA 1XMOB 4ZN6A 5JNSA 1GM5A 3H5LA 1KKMA 2Z57A 4ZQHA 1Q77A 3TJRA 4BEJA 2O1XA 3QSGA 3KYCA 5HK9A 2CLFB 1UAGA 2G25A 3K16A 5DIZA 1AQ6A 1LK0A 1GYRA 2R8ZA 3FLAA 2EV9A 4I5FA 5JQGF 5DOVA 2G76A 5CXQA 4X8LA 3WRYC 2YIJA 1G8MA 2HPVA 2QWXA 2F3QA 4HWRA 5A05A 5LUBA 1COWD 1UM9B 3LQYA 3ZIAA 4AUKA 5ALYA 4FFOA 2C42A 2XKAA 3D2LA 1ULZA 2V3WA 1P2GA 1YRYE 4H0NA 5LQRA 3DBVO 3RD5A 4B3DA 2NN3C 5DT9A 2WJZB 3OCXA 1LSUA 1R74A 1VL0A 3V32A 4EDHA 1JP7A 1KJNA 1Z07A 3E05A 2QSJA 1NN5A 2R3SA 3NTUA 3PHLA 4IMRA 4AJ2A 9MHTA 5EWLB 3E58A 3W3ZB 5IVDA 3Q8LA 3H2HA 1OHHA 4M1OA 3RLFA 3U7FB 1S96A 1N4DA 5KOHB 3PFBA 3Q7PA 3TFQA 1FTQA 1U31A 2I6GA 2CBZA 3P8ZA 3THOA 3ZGNA 2CNNA 3TBFA 2FZLA 5M3BA 4NMLA 1XPUA 1NUPA 2I3ZA 3KD2A 3FVRA 4FYJA 3VPSA 1EWQA 4LXUA 3NUGA 4R8LA 3MLAA 3O9ZA 4U7DA 3AI7A 1GHTA 1K7SN 2E1PA 3DO5A 1KAQA 3CBGA 4J8PA 3C3JA 2EW2A 2KPOA 5IW8A 4D79A 3R77A 4YMIA 4L5BA 3GLHA 4CWAA 2XWQA 1U2DA 3DDUA 3IOCA 1QBGA 1VKOA 3MBIA 3OTWA 3W3AA 3U7JA 1CUDA 1N92A 3JQEA 4CZ2A 4FEAA 4OHCA 4BO1A 1MN6A 4NV0A 5TARA 3TLYA 1U3VA 2BUAA 1N2GA 2ZUSA 3MBKA 3I9V6 1O94C 3DFZA 4X3PA 5FNZA 2V6MA 1G6HA 4M7WA 5EE1A 4HGQA 4DSUA 1VHQA 3DL7A 1C7IA 1UQRA 2ZUBA 4LX8A 4UHEA 4A0FA 1M83A 1C3LA 3H1EA 4PZEA 3UWPA 4L8FA 2E49A 1OIXA 3PF9A 1U28A 2ZXFA 1TCAA 2HWXA 4JH0A 5I8ZA 5D2CA 5IX8A 5BO5A 2C95A 2JD0A 3PRJA 5H83A 2BSQA 3OTGA 2MSDB 2RFLA 2OXTA 3RT7A 3UXYA 1NZJA 2FPKA 4U7JA 3MRVA 1O8BA 1QHIA 5C1DA 1IAVA 1PDOA 1YMUA 4GXRA 1YQWA 4R98A 2NU8A 1BE8A 5DTEA 1TEHA 1THMA 5CHEA 1NYQA 5B3KA 3WYAA 5D87A 5IANA 3QLUA 5K3BA 4FFSA 1PWZA 4CR6A 3AM1A 1ITZA 1FQWA 1LRJA 3CX8A 3KLPX 4OHMA 1PKXA 4MMZB 4OHBA 1SBYA 2EKQA 3B6EA 1FFYA 4XASA 3QVMA 1Z4OA 1Y8RB 2QN7A 5JO9A 2D59A 4CL8A 5JD5A 4PC2A 3V3KA 2F9MA 3WGOA 1ZZGA 3G0CA 2F9LA 4IIXA 1S3IA 4KG7A 3QE9Y 3MA0A 4IHJF 5FO1A 4MARA 1LF5A 1AGRA 3KYIB 3M5WA 2AHOA 3D9QX 4EHBA 1F5NA 1Y8CA 3CNNA 4L4YA 4Z7JA 1MC5A 1UKBA 3NEPX 4R81A 4JD5A 2ZIVB 3K8OE 3AZQA 4CF6A 1AHNA 5JW6A 4FNAA 3CZMA 5FV7A 4NAVA 1E79A 3GRAA 3I4LA 1LW7A 4RDCA 4OFXA 1Y9DA 2Z6UA 3PPYA 2G4LA 3WDSA 4QTXA 4Z9FA 1DB3A 4OFWA 1SUAA 2WI8A 4XEUA 1Z2NX 5PGMA 5JBIA 5DM2A 3GLHB 1BX1A 4WNAA 1AKQA 1H94A 1ZK0A 2VIIA 3DE1X 4FYMA 4OREX 4Y7CA 3TBKA 3TXXA 3ICQB 1H9BA 1YCGA 2IXBA 3LL7A 1DVRA 3PTZA 1NW8A 1X8JA 2RGNC 2ZJ4A 4O4IA 4WOJA 5JSZA 3JYOA 4LRXA 2A35A 3HYTA 1JLHA 5K0CA 1NPTO 2HADA 1XXLA 2QX6A 4JKIA 1MHPA 5DJ5A 5IT0A 1HYEA 5LD2C 3RC8A 1RT9A 4RLFA 1FYVA 4GI2A 3WIVA 4M9CA 3AU9A 3E2IA 4MQEB 5EWJB 5DYNA 1II9A 1J8DA 1QYRA 5K3SA 4CFYA 3CR8A 3Q12A 1N1MA 4RA9A 3SFTA 1GR0A 2HRCA 2OP1A 3AMVA 4PZDA 3LCCA 2YY6A 2ICAA 2RBEA 1XOIA 4O5AA 1A5BB 2QT1A 4Z51A 2AZ4A 3O5AA 1IE3A 4ZOEA 3QYAA 3KC2A 4FMCB 2AQKA 1BVUA 3WFZA 3FKSA 4OYLA 3IR7A 3ROMA 3ITNA 3L7BA 4K1LA 1WB9A 4DJDC 1NU8A 2DC1A 2PK3A 1Y6GA 4WZBB 3HFSA 3FOEC 3IP3A 1SC6A 1MBZA 5KNCD 1QLHA 1U9CA 4QULA 3QEBZ 1X9IA 4V0RA 1I2DA 5H9VA 1Z25A 3WLNA 3AJDA 4FSDA 1MH9A 3EUFA 4FXPA 2ZEJA 3GVCA 4OBBA 2PLFA 4KRXA 4B6SA 4BVBA 4GMFA 1VYTA 2HI0A 1IOLA 2IUTA 2WZBA 5GAJA 1JZSA 5U4QA 3DOFA 5K8TA 2CXRA 3PP8A 4CV1A 4KE6A 5B36A 3FOFC 4MXDA 3KJXA 2XZOA 1KBZA 3ESYA 1ISPA 2ZFUA 4PVDA 1JFSA 1P9NA 4H77A 2WUWE 3EGVA 4MOWA 3GELA 4BL5A 2R84A 4ER3A 1GCGA 1ZPDA 3PDIB 2GSWA 2WICA 1GZVA 1E7QA 1P91A 3IKMB 4PGAA 1E2UA 3VR5A 1QLJA 3FTDA 5F4ZA 2BE7A 4JKYA 3MJVA 4QATA 4KLZA 5I7VA 3K0AA 1P1RA 2JI4A 4HSGA 4Y98A 5EQDA 5IT4A 3GNLA 4ZGWA 1EB8A 5DVZA 3OTQA 1EP2B 1QK3A 3W06A 3IDSA 1TQ2A 3NCTA 4L5IA 5L45A 4HH4A 1T34A 1KFEB 2ZJ3A 1SCDA 2XLBA 2ZSBA 3M9LA 4HDNB 4WFJA 1NVVR 3FDIA 3I45A 2HV9A 4ZQCB 3K2BA 4OATA 5FA8A 2QRPA 3NCHA 1P3JA 4B85A 1HOXA 2Y4OA 4NESA 5K3CA 1UKZA 1J0EA 4HI0E 4DWWA 2IJGX 3A2KA 2F1IA 3BGVA 4LDAA 4U00A 2J8ZA 3H9JA 3RHFA 9GPBA 3CNOA 4QGHA 3VO8A 3AVVA 5EZYA 4KOAA 3V34A 1H66A 4II2A 4MKIA 1XO1A 2C5EA 4Z3DA 5CUQA 4A92A 4UMVA 3TQTA 1CEQA 1QO0A 3THRA 2GHQA 4Q15A 3FPCA 1IZ9A 1L5LA 2ATEA 2ZYWX 3EMVA 1WP4A 3GMDA 2XTMA 3KEFA 4BJ5A 4HN2A 3J7TA 1UADA 3KLBA 4A4DA 4TMWA 4YPOA 3JWIA 3HFJA 4KKXB 3H2KA 2BJHA 3GUZA 3HV0A 1T3GA 1YUNA 5LU9A 2BGGA 1DRJA 2B37A 2IY9A 2QR5A 3A25A 5FWYB 4J49A 3VZDA 3ZWAA 5HTOA 4XWWA 5IDQA 2GRJA 2P6UA 2YQ5A 4HBZA 1MC4A 4QEZA 1GFIA 3AB8A 5KBYA 1HSOA 1RHQA 5M5BA 4WGGA 2FZWA 5KYNA 3HDTA 2R6JA 3OU6A 2WAXA 3CZQA 3I5YA 2HA2A 4QRHA 3SYNA 3DBHB 2FUCA 3H19A 4MK4A 1TD1A 2P6PA 1WKCA 5GINE 2QLBA 4LDZA 1ZM9A 1YVEI 2QMOA 2XUIA 4EW2A 3GWGA 4ZDWA 3RTGA 1AS3A 4IDGA 5LZ4A 4KXXA 5CJ2A 4D3ZA 4X84A 1F8UA 2CUNA 1JT9A 2SKDA 2W8BB 3FNQA 2VDOB 4Q37A 1DEHA 1K5HA 1TIKA 2JIOA 3K0HA 4G5XA 1NVUQ 1OFUX 2PH3A 4LYDA 3QFCA 1E2LA 1QYCA 4KR7A 3GBSA 3MTGA 1A9QA 3DE7X 2MSWA 4NZ9A 4PFJA 3SBXA 4E7OA 2ZRQA 1FFCA 2Z9BA 3OLVA 1ZD1A 2IYWA 3CVWA 5FYQA 3ZHYA 3HXKA 1RRGA 4H17A 4CDGA 5BNWA 3C3PA 1T4MA 5ITZB 5B1IA 3R9IA 3PFHA 1D6SA 3AILA 4BECA 4XJXA 3PTAA 2GM4A 4LSZA 3QU9A 4G63A 3F0TA 1SBNE 1JBEA 1R6TA 1XQ1A 2P91A 2VS1A 2WWWA 3IUNA 5E1OA 3RHTA 1CZUA 1YQQA 3WLHA 4F12A 5HHTA 1D3AA 3LBAA 2IYTA 3D3WB 1T25A 1OBVA 3I83A 5B1EA 3SZUA 1JT2A 1IJBA 1OTHA 1S9HA 4CTKA 1JI0A 3U56A 2KM1A 1JKMA 1UK9A 2OESA 4LYEA 1DBPA 3DDWA 3L7IA 2Z6AA 4X64B 3WBFA 4MP8A 1J20A 4O63O 1BXRB 2RGXA 2WIFA 3PJDA 1NHWA 3G5LA 5EESA 3UJ3X 4G4IA 4QAQA 1QG4A 3RUHA 3E18A 3LBHA 5L3VA 2IUSA 2XHEA 3EIUA 3PR1A 4ND3A 3CH4B 4URHA 1Q1NA 2K87A 1W1IA 2VHWA 4QFMA 1QX4A 1XB2A 1JDPA 3W2TA 5E9JA 1YIDA 1M0EA 1JAIA 3O93A 2FR8A 5A3VA 5JHGB 2W83A 1NNLA 1N2OA 3AIOA 5EXEA 1FTYA 4QPDA 1V8FA 3JARA 2HHCA 1AV6A 3O3OB 3HBFA 2Z6QA 1TB4A 3C6ZA 3QV2A 1NW6A 1SIBE 3DAPA 3HKDA 4G25A 3P2IA 2IV7A 3OU7A 4LJRA 2HU7A 4UUAA 1V6CA 1WKVA 2H3HA 4FIZA 3U5ZB 3OT4A 1NG1A 2PU5A 3ROPA 2IHZA 3OIVA 4UBLA 1NU6A 9LDBA 1V0JA 2I2DA 1GFSA 2CYCA 4CIYA 4KPYA 3ADBA 4BQEA 4LGCA 2PUEA 4ND7A 5TQJA 5I45A 1LXCA 3RVRA 1WXDA 1J8QA 1GL7A 2AMJA 2HMSA 2Q0HA 1QF6A 5AW5A 3VYTB 3NBFA 4GVLA 3VSBA 5JMWA 1H8HA 1QNFA 4L9SA 3AZPA 1UBMS 1AHIA 3DOJA 1D4AA 3GZNA 3T9FA 1X80A 2R8XA 4J2TA 5C4MA 3LDHA 1BQ4A 2OBYA 3EF1A 1M3SA 1XDZA 1W49A 2YWBA 4P3KA 3AHDA 4UTPA 2ZXUA 2Y0PA 3ONEA 4D0SA 3FDXA 4PN7A 5A3QA 3IEVA 2YCLA 2V3VA 1HLPA 1KH3A 1JI3A 4WW0A 1YVPA 3PUJA 1TIBA 3VTZA 3N0TA 4DUYB 3ISVA 2ZI5A 3R6LA 1LCIA 1UK7A 4ZICA 1E9VA 3ECAA 1YQGA 2XV1A 3VI4B 2E89A 5IXSA 2P30A 2KJQA 2E4WA 2QRGA 2QMEA 3ZN2A 4P3PA 1B0PA 3M2TA 5LB2A 1IQRA 1EFKA 4NPAA 5H3LA 4ZCRA 2OQVA 3DUWA 1I6WA 3ORQA 3R9KA 2LNDA 2OZKA 4RTPA 1B0AA 2LRHA 2ZVDA 4HEQA 3JTEA 3ORYA 5IJ9B 5K99A 2GO7A 2X1HA 2C57A 5AKXA 4PFSA 2QTLA 3GOHA 5LQJA 3DMTA 3TRFA 3TD9A 1XZJA 4LK3A 3D8SA 1XKLA 3HADA 1I94B 3AVXA 3BAFA 2WTEA 2FP4B 3TR5A 2X23A 3DBLB 5I9BA 4UCFA 2BFOA 4P7FA 3JR3A 4X54A 4LYHA 3S81A 3VKGA 4LBZA 3U7EB 1XEWY 2XR1A 1FBTA 2P1RA 3NKVA 1T8UA 1PSDA 2PZMA 4FHGA 3GN1A 1AQLA 3L0YA 4PXAA 3GD5A 1Z5UA 3U9TA 1MVOA 4KN8A 4AP9A 4CW7A 4E5MA 2XA1A 4HEJA 1NJ2A 5JNUA 2XEDA 3HBJA 1J07A 4X91A 4B34A 3BJZA 3ZHUA 2PAAA 5L3SA 2NUPB 4KYIB 4JC0A 1EP3B 1QF7A 3ESZA 1E6EA 4B3XA 4DE5A 2VI5A 3TRHA 3IBSA 5G3YA 1E7SA 3SSOA 2BZSA 1XDUA 5DMHA 3SXJA 5C52B 3NMUF 2EX0A 4OHWA 1KFJB 3EEQA 2QGZA 1JHDA 3KUCA 2AK2A 2CF6A 2F1OA 5JE8A 3EODA 4IJWA 4O6VA 2PX8A 1RQLA 4MPRA 1A9PA 2GUGA 5K01A 2NUAB 3U81A 4KMOA 1GDTA 1H6CA 4YRAA 3LBIA 3BX1A 5G1NA 3UANA 3A9TA 2A8YA 2G8LA 1ZP6A 1Y3IA 1ZI6A 2J6BA 3E1KA 4M55A 4PCUA 3UTDA 3WIDA 3JZAA 3O1IC 3P0JA 5AK4A 3PUYA 5EXTA 5AVJA 3T5PA 2VG8A 2QHXA 1RMQA 4HLCA 2F1JA 1WDWB 3EWAA 3HABA 1L3CA 4LRTB 1FBNA 3P20A 2WP0A 4R7ZA 3RS2A 2D2EA 1XDSA 1PJAA 4XIIA 1ADGA 3ETLA 1TTPB 1I32A 1V16A 2HXYA 4BTEA 3T1TA 3HC7A 3ZWMA 2Q0XA 3Q9NA 1Z2EA 4Q6WA 4HNVA 4L6AA 2XA9A 4BO0A 4EITA 1NUQA 1WXEA 1P7WA 3NH6A 3OJ0A 3AONB 1NV9A 1BXGA 3NDPA 1GG2A 1QTRA 2FSVA 1Z0SA 4M0PA 3A1SA 4X92A 4OBWA 5AI5A 1W9HA 3H4VA 2P9QA 1KMHA 4UATA 4Y6QA 2DFTA 3D8NA 4JSRA 4WOBA 2FLKA 2FEOA 1VE6A 2FSUA 3RK4A 4E51A 1YMQA 2QROA 3ZV5A 1T4CA 4V1CB 5LOVA 3SWWA 2IA5A 5BYAA 3D7SA 3EGIA 2B6NA 2VNKA 1IH8A 4G1BA 4UVIA 5CXXA 4J6EA 5H8WA 1XD2B 2AJ8A 1GRNA 3GFQA 3WS7A 3ZY3A 1FE8A 1BU8A 4DZRA 1IEVA 1W9MA 3JQFC 1Q95A 2LCIA 4EHHA 4I1YA 2J3KA 3LT2A 2B0CA 4B31A 4HN9A 3H3FA 1D1QA 3K0EA 3C87A 4QDOA 4DB4A 1LJUA 4C14A 3OMXA 4K9NA 2GT1A 3WGVA 4LF6B 4N01A 3Q2KA 1OAOA 2D1RA 1XCJA 4IKOA 1KEEB 3MQ2A 5JCXA 1VIMA 3KXKA 4MNTA 1FDIA 1RAFA 2QNBA 1UKEA 2HQOA 2O2ZA 3JVIA 4OOEA 4DN6A 1SEVA 2FW6A 3FNGA 2A33A 2PZ8A 5CNIA 1SXJE 4FOTA 3W6UA 1V5IA 4WY8A 5CDYA 4L73A 1OXSC 3ZCSA 1HT1E 2FR8C 5A2GA 2ZB7A 4K26A 4KTVE 1U6JA 5E6RA 3GIDA 1A4UA 1K7YA 1QIEA 2IHKA 2OT3B 2YHSA 3HP7A 1EK1A 5HZGA 1PJ2A 2HEGA 4TV9A 3COYA 4EA9A 1ZQ9A 3AM4A 4Q21A 4WCFB 1E2PA 4QSMA 4YQZA 7ADHA 4BQIA 4F4IA 4I5IA 4YXFA 1OJ7A 4GPZA 4KX3A 4UAJA 4UHJA 4YQEA 1XD8A 1RJ9B 5EI5A 1NQ5A 4L8GA 5AUQA 2J33A 4N3CA 2ZYUX 1OZFA 2BKVA 4G5FA 5LN1A 3BHJA 4I55A 1N6IA 1B73A 1ZN2A 2IEIA 4NHOA 3TLBA 2WF9A 4POAA 4DVGA 3I62A 3LUFA 5A04A 1KETA 1QRTA 1D9ZA 3AKZA 1LTQA 5CLQA 1IATA 3GUHA 1ESZA 2ZWOA 1KI3A 2KYRA 2VAXA 3NTRA 3USZA 1H6DA 2V5AA 3CLTD 3HKBB 4Q4JA 3FJOA 2F8TA 1T8RA 3QQPA 3FYDA 3GNSA 4K1XA 3VDRA 4A2QA 5T4EA 3CC8A 1NPDA 2BI7A 2W4IA 3IAXA 3WKBA 2NP6A 2UZ0A 3W0LB 4PLVA 4BFXA 1LBIA 2C7RA 4CIXA 5LL6P 5IABA 3INNA 2O5VA 2C2OA 2NXJA 4PG7A 1Q12A 1E0SA 1RHJA 1RRMA 1UBOS 1KJIA 4HTAA 5F76A 5AXAA 4DAOA 4ZDKA 10MHA 4RK6A 2AWNA 1E1MA 3DWIA 3QYFA 4MV4A 2RGRA 4K6FA 5F64A 4ZCPA 4WTOA 3LKBA 5B1DA 1G8SA 1MB3A 4IHKA 3SU8A 1AGYA 1RWQA 2FPOA 3KBBA 1YB4A 1VE3A 2ZVPX 1KZ4A 3KPJA 4UNNA 2HUNA 2P6NA 3BQMB 5BWMA 3TL6A 421PA 1PJBA 3PWTA 4XAQA 3STYA 1GUAA 2AFHA 2YOGA 4ZOCA 4Z9XA 1FXUA 1Z28A 4D9CA 5JSHA 3NHPA 2PANA 3BRQA 3PUZA 1MOZA 2ZULA 3QTTA 3D7NA 3ZQ4A 1VC2A 1W47A 4K8OA 1KYZA 1X7YB 1VPVA 2WE7A 1GNTA 1E98A 4ZGGA 2PXHA 2F3TA 3X0DA 1DI0A 4EJ6A 4O2AB 4JBXA 3CCFA 3PGXA 4WOKA 3SZOA 4C0WA 1N34B 2P0YA 5BYJA 4L28A 2CFTA 4B3HA 2DEUA 2DKFA 4Y6PA 2JFPA 4BMOB 5EJMA 3ILHA 1Z4NA 3WIBA 4HDOB 1FPMA 4F8YA 1V9LA 2BMAA 5DNDA 1U3DA 3WRWA 1RJEA 3KJHA 1EK5A 1LVHA 3ISTA 5HXAA 4ZHQF 3D3EA 2VPYA 4YXWA 3K0SA 2PVCA 2DVMA 3PUVA 1QHYA 1ZM2A 2GN9A 3EF0A 3THXA 1U3GA 1ZVQA 4A82A 5AUPB 3TK1A 1EAYA 2IEBA 2OCPA 2G71A 4AI6A 2ATXA 2B98A 4QX6A 1XKQA 1IJKA 1WRBA 2VXBA 4E6PA 1Y7TA 2KHZA 2QRJA 2XVAA 5TR9A 3OX4A 1I7LA 1OYOA 4JGBA 1P5RA 5AESA 2PUFA 2CHVA 2VBGA 1BKSB 2JZOA 4M0EA 3SQLA 3WMFA 3PIRA 1XRRA 3IKTA 1F1BA 1W44A 1FNNA 3F3YA 2BBOA 3LUPA 1WP9A 4MV0A 3VR4A 5CURA 2FMUA 1UMCB 4CTNA 2FPPB 2HCFA 3NAQA 2D00A 1E3QA 4JP8A 1IVSA 2ARKA 2V4ZA 4JELA 4YBZA 4AQYB 1JEQB 1N3BA 1QAOA 3AR2A 4Y1EA 1Z83A 3HSSA 1ZBDA 4GL4A 4RADA 1VKJA 2RH5A 3P9QA 4DPKA 3EZ2A 3B1VA 3N8HA 4YYZA 5CB4B 4BIMA 3ADCA 1D03A 2W2XA 2FI1A 2ZTUA 4LRYA 2H92A 2R62A 4X20A 5TPZD 2IEAA 3DEIA 1I1OA 4EOGA 4FSXA 1T6XA 5DHTA 4YUVA 4MKHA 2OMKA 1R6AA 1B8VA 4DBLC 1R0WA 5KVSA 2A1TR 1JHYA 3KM0A 5FTKA 5LQDA 1PZFA 3LYAA 3AU8A 5KVCA 4O4LB 2PBFA 3BE8A 3NHJA 2CSUA 4BWVA 2HREA 5YASA 2R7NA 4LYGA 4CMBA 1VG9B 2F90A 4DV7B 2WM9B 4BDTA 2VPTA 2WA2A 3Q85A 4TL9A 1EFLA 3ER8A 2NLOA 1F12A 2P40A 3UK6A 1ND5A 2AT1A 4PPYA 4IIJF 5BWLA 1XQXA 1DQYA 2XQGA 3G2OA 5AJXA 3QKTA 4Q00A 4U0JA 4GPEA 5IUNC 1W0CA 3JRXA 2J41A 4G5SA 4TV8B 1MAVA 3SVZA 1CDOA 1HT0A 1PBNA 3HXPA 3N87A 4XWKA 4PTLA 4MVJD 2YMMA 1NVAA 3DAGA 3F4KA 3ROTA 2EIXA 1FFAA 4PYKA 3SYLA 4B4DA 2I9KA 3GJZA 2GBFA 3D4PA 2N42A 5K0JA 4W5HA 1F5SA 3B1JA 4HAZA 3E6AA 3BD6A 1O7JA 2Y1FA 3M34A 4H6XA 3AERB 4ZT5A 4E13A 3O8BA 4I4TA 3T0IA 3GNQA 4ZDJA 3PXUA 3PKJA 3NPMA 3WL4A 3WGIA 4OCZA 4M98A 4YUYA 4EPTA 3GA0A 1XZPA 1RBZA 5G41A 2BFFA 2W6OA 4KEAA 2XYRA 3A9RA 1A8UA 1Z26A 4LY0A 3SR3A 4EJ2A 2GTIA 1W2HA 3N0XA 1T9DA 3Q10A 5F1OA 5B2EA 3VKHA 3C8UA 1AXEA 4NONA 2AXPA 4WGFA 3QLEA 1R1DA 3CE9A 5JBNA 3UMGA 3ZU3A 4II3A 4C1BA 1U1IA 4XM0A 1D04A 2EP5A 4A1OA 2V74B 2V6IA 4YH1A 1GDHA 1M7GA 1U2TA 1YVRA 1FDOA 5CYGA 4L8YA 3AF6A 3QI2A 1JU4A 2Y92A 3FUVA 4U5QA 2OKCA 2Y6VA 4AO6A 2AN4A 4AG5A 2Q3MA 3HCEA 3UC5A 4JQSA 1X0VA 3D6NB 4EI9A 5KYGA 5JPIA 1E2FA 3G8CA 3U4GA 4RULA 2XCRB 1R6BX 4RKWA 3OCYA 3RJ5A 2YQZA 3UH1A 3ZY2A 4CIWA 4YIHA 2FSVC 1NKVA 2ZRDA 3NONA 2PV0A 4AZ3B 4MAMA 5JPDA 3HBLA 1T36A 1PR4A 1IOWA 2C2ZA 5DBEX 4PICA 4KITB 4YI3A 3VAYA 5DMXA 4ZCSA 4M0KA 1Q7BA 3D64A 2A1TS 3VH2A 2C92A 3I01M 4NCKA 3VOBA 3C41J 2BGTA 4MLPA 1D6NA 2X9QA 1MO3A 4U2CA 1OH6A 4R2LA 4G1FA 4NV3A 1HGXA 4HC4A 1KQ3A 3JQ8A 4FW8A 1RXUA 4LG1A 4XW2A 5G0SA 1EVKA 4F5YA 3ESDA 1AK9A 3DLCA 1BQ3A 1YS1X 4HDNA 3MRTA 1XAGA 2R1UA 2GA9A 3ST7A 1ZH6A 4L0CA 3UCXA 1T0IA 4LYAA 1AQUA 1Q0LA 4FHZA 5T6BA 1ZRNA 2OP0A 5HG0A 2FWJA 4D57A 4E88A 4QARA 2HWYA 3PHIA 2AB0A 3PFWO 2CT8A 3ACDA 3O2JA 3DCYA 4HNAA 4X1IB 4AX8A 3KEQA 3W5DA 1YHYA 1NAIA 1A9SA 4H4EA 5IEJA 2BHRA 3FCXA 4AY2A 4JP1A 4XE5A 3MM4A 2JG3A 2CVZA 2O57A 2A0KA 3GDOA 3QGMA 4KLRA 4BNUA 1X1TA 1G5IA 2GHTA 4IMJB 1R4ZA 1IBCA 4HP8A 4BE7B 2JBAA 3KWMA 5BNFA 3KDPA 1IZYA 3QBDA 1OXMA 2CDNA 3A70A 3UKOA 4LZPA 4BWYA 3QU4A 4C04A 1VE5A 3L8GA 2DG2A 4KK4A 2EWWA 2JBWA 4YGYA 1RWMA 1V8PA 3IKLA 2Y99A 1WE2A 3CRNA 2IWRA 1EIWA 5GGXA 3DEYX 2HRRA 3TD6A 3KUDA 3GGCA 5EE9A 3W05A 4FCVA 4QUEA 1HNZB 1I01A 3RYFA 3FNIA 2FTKE 3H5NA 4WFIA 5K4GA 3QFTA 3TINA 2Q4BA 4MR9B 3VVMA 2IH4A 1M66A 4FWBA 2EXXA 3H86A 3HHEA 3C5VA 4RHFA 4RSHA 3T41A 2PXCA 3BB4A 2R751 3WNVA 2V54A 3ITDA 4KX5A 4DIBA 3IO5A 1L6RA 1RADA 5HMMA 5IC5A 1XN1A 2BIFA 4GGOA 2AN5A 2QTFA 2OEPA 1KQOA 4Y9TA 1TVKA 2C83A 2QL7A 1YI0A 3WIOA 1KFKB 2XCLA 3VO9A 4ZD6A 3H1AA 5A7HA 1YRBA 3W6NA 3BVPA 4DSNA 2CV0A 3R3VA 4AJNA 1WO8A 1QZTA 5E8JA 4GEGA 4JC4A 1Z16A 4GM0A 1VXOA 3O38A 1WCYA 1SH7A 3LNCA 1TQDA 3CVJA 1BMTA 4GOMD 4RCYA 4X6LA 5KWIA 1N33B 1QFZA 1TZCA 2GYUA 2IW3A 1GLVA 2H54A 3DP7A 1DP4A 2OXFA 1KZ6A 1GG9A 1J2EA 2WRZA 1E1QD 1AKVA 3OF5A 2WAMA 4PYRA 1BMQA 4XGNA 2F43A 3ZW8A 1E7MA 1GU7A 3DDSA 3LBYA 3JD3A 3DKKA 5G0TA 4MX8A 3Q15C 4PLPA 1Q44A 4AKHA 1IEXA 4KWTA 5F23A 2VYFA 3UVEA 1JHAA 1PG0A 1O96B 1UKYA 4CKEB 4POOA 2HM7A 3TX2A 3H1BA 3Q98A 1VBMA 1QP8A 4AMUA 2WDPA 3ROXA 3FX2A 3SKYA 3HB7A 5B64A 2PKEA 1PJQA 4KZKA 4QM6A 3C8ZA 2GR9A 4JZYA 1ZNYA 2ZBEA 3DDNA 4BNYA 2HSGA 4MGEA 3F46A 3A36A 4M21A 3F74A 3GR6A 3H75A 3G23A 4GMHA 3CLRC 3Q0TA 1QMGA 2C4KA 4JODA 4JT4A 4FDMA 3U37A 4B7UA 1RTKA 1Z6ZA 4MKRA 1GNPA 5ALOA 4AXXA 1EX9A 2WTNA 2ZS7A 3E5MA 3F98A 1P4GA 5IM4A 4L8LA 2Q5JA 2J3MA 4PNZA 1EHIA 1SHKA 2VDNB 1YB2A 1S1MA 1L4MA 1XYVA 2HCTA 2IZ1A 1T2UA 1MPXA 2H4FA 4LCBA 3ZJ5A 3M1IA 2W6ZA 1ZIPA 4BN0A 4HK4A 4QBHA 1DMRA 1QRAA 3PJGA 3TPFA 2D5IA 3E0QA 3ENKA 1XRNA 4F4JA 2JCYA 1PWEA 1S2MA 2JJQA 3QENA 1RE0A 3KZMA 4HH0A 4OX9B 3JQ9C 1Y1LA 2VTDA 3OQ1A 3L0BA 1B93A 1PYOA 4YJHB 3WHIA 4CM9A 4NX2A 2WJYA 3REOA 2PUHA 2C9OA 4K9KA 3RGGA 3WKCA 4ZO9A 4Y67A 2C9YA 2KWIA 1FLAA 4NEQA 4F21A 1H0KA 3DT8A 1YQ9A 4I1RA 4OUDA 3DMFA 1JXAA 3HWX1 3EQ7A 5CVTA 2H2HA 3K5PA 3RIXA 4RO0A 4RIFA 1QJ4A 4CLRA 2V45A 1DXOA 2I2XB 2P3SA 2D74A 2I34A 2AEJA 3ER9A 5COBA 3RC1A 1TZBA 4OQNA 3TNJA 1RCFA 4TZKA 3ESRA 4O2BF 1GL9B 1N2IA 3ZOKA 3HDQA 1DIBA 2QLTA 2P27A 3M4YA 4GP9A 1AF7A 1UC5B 1UJNA 2NVUA 5P21A 3SJCA 2B7CA 2EWVA 5G1PA 4W8GA 1EFRD 1WXXA 5AJHA 4KR6A 2R8BA 2ZSFA 3N2KA 3LA8A 2WHQA 2Z3WA 4JLNA 3QE4A 4ND1A 4PGGA 4DXHA 3H99A 3IHLA 4Z9AA 1FDTA 2O2SA 5SICE 3I9KA 1J42A 1CQXA 4ZO7A 1K7CA 1T5TA 2V98A 5KPJA 1KRHA 2BJWA 2HA5A 5C3UA 1BHSA 1WR8A 4TYMA 2O2CA 4FGZA 1NLUA 3SNKA 1E99A 4JYPA 8AT1A 3ANLA 5KYWB 1K8YB 1FP6A 2FYTA 3C74A 4F06A 4JLPA 3UAOA 3CS3A 2GKOA 4DR4B 2MHCA 3N8NA 1NVKA 3ZQ6A 3DVQX 3RVSA 2VHVA 5JCJD 1I2BA 3NM5A 3S27A 1QO9A 4GSKA 2BKAA 2IZOA 5ADUS 4EPYA 4E7PA 4QHYA 4UTZA 2Q3JA 1MJ5A 3G2MA 4LBVA 1JSCA 5KOHA 4UUPA 1Q17A 4KFUA 4GQIA 5IAOA 4D9IA 4LVUA 4LW8A 1EGHA 1JJVA 2J6CA 3T06B 2A9QA 1RD4A 4RZIA 1BFUA 3LLCA 3A4LA 3H0CA 3MFQA 1NUAA 1P5FA 1U2QA 4YJ2F 1F6BA 4Y9UA 4KPFC 5A5FA 2XSZD 5CB0A 5K0SA 1E7YA 2PO5A 1T4BA 2Z4TA 2M6SA 1VRCA 2CNLA 1WPQA 2XSZA 3BMQB 3I2KA 4LOHA 3KQVA 4LV8B 3RRBA 4DUPA 5TF4A 1KU6A 3K9NA