3D5QA

Crystal structure of 11b-hsd1 in complex with triazole inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
269
structure length
264
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinctive molecular inhibition mechanisms for selective inhibitors of human 11beta-hydroxysteroid dehydrogenase type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 92
structure length 264
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3d5qA00
4RVUA 4D41A 4IY1A 4BNJA 3ONFA 3AM5A 1XU9A 3JCZA 2Z5LA 4WCFC 2PKRA 5G4KB 2B5VA 4F45A 2D2IA 1P1FA 1AHHA 4F46A 4E2WA 2G76A 3MWEB 3TSCA 3ZNPA 5TX7A 4TKMA 3HWRA 4A03A 1LU9A 2BF7A 1DIAA 1XQ1A 2VHZA 3G17A 3WQSB 3RI3A 2IXAA 5EQDA 3VDRA 3D3WB 4FJ1A 4GGPA 1CIVA 4E2YA 1E7YA 1HEUA 3EMKA 5A5EA 3DZKA 4WE3A 1U2GA 3Q6IA 1WXDA 2VOEA 3OJOA 1WDLA 3X2FA 4LVCA 4ZGWA 1QORA 4CLHA 2WSBA 2J3HA 1GDHA 1SOVA 1FF9A 2V6BA 1B8PA 5H81A 1G0OA 1TB4A 2GO1A 2ZIZA 4MVJM 4BMSA 1VKNA 4B3HA 1ZH8A 1B15A 4LSWA 1TT5A 2V65A 3CINA 3DWFA 3SLGA 3H2ZA 3OEWA 1L7DA 2PH5A 1OMOA 3I9JA 5L4SA 3EDMA 3GZNB 3L6EA 3WBBA 4DREA 4E2XA 5L9AA 3E82A 3AI1A 5G4LA 3GZ4A 3QSGA 4FC6A 4ALLA 3K30A 4TRRA 3JQGB 3AM3A 4A73A 1DHRA 3VPXA 3GMDA 5EESA 4BNMA 1H6BA 4Q3NA 4DA9A 3DR3A 4R68A 1GV0A 1KBZA 3TPCA 4BNWA 3VPFA 3Q1LA 3Q2IA 4MKRA 2FOIA 2VWGA 3NT5A 2BKAA 3PZBA 3I23A 3B1FA 4HUJA 5DNAA 4XD2A 1LDMA 3JQFA 4CQMA 4CM5A 1E3JA 4L9RA 4PLZA 1JVSA 3JQ8A 2JFGA 3OA0A 1ZO8A 2D1YA 5FI3A 1EK5A 2FSSA 4XYGA 2NLOA 2CUKA 4NHEA 2HU2A 2CVZA 1PGPA 4J2OA 4DXHA 1GCUA 5A3VA 1JKIA 4L75A 4R1NA 1XELA 3E9MA 4IIUA 5GZ3A 4Y6RA 5ITVA 3JD0A 1UXJA 4YPOA 5F5NA 5GZ6A 3FNEA 1SAYA 4YT8A 1ZSYA 1LDNA 1MG5A 1QYCA 1NBOA 3VH3A 2W2KA 4I5FA 3TNLA 5JLAA 1EUDA 1I2BA 4M89A 5KJEA 1PGNA 1ZIDA 5L3ZA 3UOGA 2O3TA 4R54A 2AA3A 1DC6A 4CMIA 1K89A 1PIWA 2X7HA 3ZNNA 4WLOA 3DBRA 3RKUA 1JU9A 3RROA 5HA5A 3RC9A 3MJEA 3Q11A 4BKQA 3ZDFA 2IODA 1HYGA 3P7MA 4TVOA 2IYPA 4FFPA 4CLXA 5JDIA 3QE3A 4XQCA 4GSKA 3MTGA 4GMFA 1HE3A 3BZUA 3KUXA 2VUTA 1SEVA 1KEVA 1D1TA 1IULA 1LSUA 2J5RA 4IXTA 4J1SA 3VZSA 3P19A 2GZ3A 3AU8A 2Y0DA 4NBVA 2V6GA 2WTBA 1P3DA 3VAZA 5G2OA 4GKVA 4YB8A 2NUAA 1HZZA 3VC7A 1T24A 3H2SA 5T8KC 1FXSA 2GN9A 3WR5A 2B69A 4DPLA 1AXEA 5A3JA 5JC1A 5A04A 4DQXA 4K6FA 1C1DB 4J49A 3U62A 4XGKA 1QP8A 3RUDA 1Q0HA 1DIBA 2IEDA 2NU8A 4XCVA 4B4OA 2C82A 1M66A 1NHWA 2HSDA 5T6BA 1PZGA 2WD7A 1E7RA 4HX5A 4HP8A 2AEFA 3DO5A 4JROA 4WNIA 2I3AA 5TLSA 3B1KA 3NJ4A 1P45A 2Q2WA 4CM1A 1J5PA 3F3SA 5L4LA 1DB3A 4NG5A 3EYWA 4HFNA 4D43A 1X7HA 4RORA 1E3LA 4RL6A 2X86A 4GX2A 3MOIA 1ZK3A 2GCGA 1PJLA 2FSVA 1GYPA 4PLYA 3Q3CA 1BW9A 4Z0HO 3HDJA 2O3SA 2X0JA 3WQRA 4IZIA 5FEUA 1PJBA 1NAHA 2UDPA 3KEQA 5A03A 1X13A 3H3FA 4CM3A 2JD1A 3UH1A 1V3TA 4MKXA 1T2CA 5ER6A 1D7OA 4CL3A 4BB5A 2B4RO 1MUUA 3MJTA 3E03A 2JCXA 4ALIA 2ET6A 2EGHA 3EAGA 4J4HA 3RC1A 3WFJA 5A9RA 4BKPA 5B12A 5KWEA 3Q2KA 4QO7A 1HTBA 2VYNA 5L45A 2R6JA 1Q7CA 2VYVA 4FBGA 2GRAA 4DQVA 3RBZA 2FWMX 4B79A 3QVXA 4UVIA 3SX2A 1LDBA 1PS0A 4OMUA 1RWBA 2OXIA 4ND4A 3RFXA 5HTOA 2A9FA 4K28A 2GF2A 3L9XA 1KOLA 3JQ7B 4MKZA 2I66A 4XR4A 3ZWBA 2D3TA 5I7EA 1IL0A 2AE2A 2DTXA 3WGZA 4WLUA 2P91A 3RUFA 3JYOA 1QMGA 1T1RA 4C7JA 4JQCA 4R01A 4U0KA 1LJ8A 4Y98A 4YTEA 4MP8A 2CY0A 1P74A 2O48X 4DYVA 2C54A 2XPCA 1R66A 3WLEA 5A9SB 1NAIA 2PK3A 3WMXA 2UUPA 3OFSA 5G0UA 4OXNA 2RH8A 3LU1A 2ZATA 2BGLA 4RZIA 4A26A 1BDMA 4GAEA 3F1LA 4ND5A 1GYQA 3GHYA 4UULA 2DT5A 3PTZA 5B4VA 1R4NB 1VJ0A 1VKOA 3IAHA 5JCJA 4PLFA 4HFJA 3BYZA 2PGLA 3DBLA 4L4RA 3UHAA 4PZDA 3S2GA 3JD1A 3Q0EA 3ZV3A 3AJRA 3I5MA 1U28A 4DLLA 4PRKA 5GZ1A 3PHGA 3HN7A 4KDFA 1R0LA 1ZW1A 1NX6A 4JJFA 6ADHA 1BVUA 3D3EA 2FR1A 1UP6A 2DBZA 4GBJA 2J5QA 3OQ6A 1DSSG 1FDVA 2VZ8A 3ZI0A 2B37A 1K5HA 1I3MA 1I3KA 2HAEA 1N7HA 3MJVA 5T5QA 4BOYA 4ONEA 2CF6A 2BH9A 4NR0A 3AM4A 3DZBA 3Q9NA 1G1AA 3DHEA 4FQ8A 3EW7A 4PLTA 3GVXA 3RVDA 4YBZA 2EHDA 3GY0A 4CM4B 2DPHA 3E5RA 2TMDA 3W8EA 4CLDA 2WYVA 3ZWNA 5I9MA 3ZU2A 5DP2A 4Z6KA 3ENKA 5IZ4A 4L73A 2BFPA 5C3MA 1YB4A 4YAKA 3TJRA 2NQTA 2RHCA 1A9YA 3W6ZA 4I5GA 3HADA 3OA2A 4BNTA 3C7CB 5IJZA 3AUUA 3PHJA 4E6PA 5AQ1A 4FC7A 3W8FA 3VKVA 1YWGO 4WCDA 3SJ7A 5JAZA 1KVSA 1W6UA 2ZJ0A 2A94A 1E7WA 2AQKA 4M54A 3DAPA 4YAIA 5A9SA 1IE3A 5CEEA 3AUTA 1EFLA 4ZVVA 1PEDA 2RH4A 3F5SA 3GFBA 4E12A 4BNNA 4EI2A 3JQ6A 5JE8A 3ZHZA 5AXAA 1PJQA 1E3EA 4XEHA 2E6UX 2VRBA 3JQAD 1V3VA 2PD4A 1ZMTA 2X9VA 4R1UA 4ZQHA 3QWBA 4PLWA 2Y05A 1U8FO 1DLIA 4IINA 2VWPA 1R4NA 3DFUA 4CQLB 1KERA 4JJGA 1YKFA 5KVSA 3S8MA 2WD8A 1LI4A 3GNQA 2P2SA 3FTPA 4IMRA 5U9CA 5GMOA 1W4ZA 1G6KA 3GUYA 3HQ4O 4YQYA 5KKCA 3KYDA 3ZU3A 5G0TA 2HLPA 3C85A 3CZMA 3K6JA 4Q9NA 1M2WA 3LK7A 5TIIA 3PEFA 2Y68A 4YRAA 3OQ1A 2CVQA 3ADOA 1KYQA 1GUYA 2PZMA 4OH1A 3NUGA 4OQZA 4R4JA 5LCXA 4CMGA 1HF3A 3GGGA 1PJ4A 1Z74A 4TROA 4XA8A 1DC5A 1DRVA 5K9ZA 3F5QA 4FOOA 1E5LA 4J91A 4CMEA 4UVGA 3R1IA 4DLAA 3WDSA 2HK9A 4RLHA 4W7IA 2O3QA 4N7RA 3DZFA 4ROSA 4YRBA 3DHNA 1GEGA 1R0SA 3LQFA 4GLOA 4AJOA 9LDBA 1LSJA 2PGDA 3ZV6A 5ENDA 3MJ4A 4BNIA 3QVSA 2I6TA 1N7GA 5HS6A 4PG6A 4W4TA 4E33A 1AHIA 5JXWA 5TF4A 4EBFA 1C14A 4MVJG 3GG9A 1O95A 4UEJA 3ZU5A 4FB5A 5A5FA 4GPD1 3WIDA 4O59O 2GNAA 1U7HA 4J43A 4OOFA 4BKRA 1ZCJA 3ZWCA 4CMCA 3EVNA 4RDIA 3S2FA 1OC4A 1E1MA 4J7UA 1HDZA 4XWYA 5IFLA 4GX0A 3X2EA 1H0KA 4J9UE 2Q1TA 3HZZA 4BIIA 1YS4A 3QQPA 1N92A 1Y7TA 3V2HA 1EFKA 1FDTA 1VE9A 3AK4A 1X14A 2AQIA 3L9WA 4K1LA 1IOLA 5I7FA 3DZHA 3GHHA 2EP5A 3TF5A 4EZBA 1A4UA 3I83A 3WWYA 4DYDA 1H6CA 2O2SA 4IDCA 4PVCA 4I9NA 4YWJA 3S55A 2ZCVA 1V0JA 4AJKA 5CDYA 4R3WA 4LSMA 5TT1A 2W98A 3TL2A 1W8DA 4B8ZA 4KTVE 5DBIA 5I7SA 1UXKA 1GL3A 4LISA 5L53A 2IYOA 3GZNA 1VC2A 3V1TC 4NU6A 1ZSVA 1R6DA 1YL5A 3PGXA 4FN4A 4LCEA 2YHUA 4EGFA 1P1JA 3VTZA 1GU7A 4DQUA 4CMBA 1MGOA 1PJSA 4M55A 1N5DA 1UUFA 3AI2A 2A4KA 1HDYA 3KVOA 4RVSA 4W9NA 3E48A 4NNJA 3UF0A 4YJFB 4EYEA 4YT2A 4IXWA 1CWUA 1FJHA 3KM0A 4UUPA 4X54A 3RASA 5MGBA 1WW8A 1SCUA 5ER9A 3ITKA 2VUUA 4E5YA 3H4VA 3VPSA 2BMAA 2JKVA 2P68A 3FSRA 3KBOA 1X0XA 1MXHA 1PZHA 1YB5A 3FWNA 4KQXA 4CL8A 2CDAA 2I67A 1AE1A 2EERA 5FFFA 1DC4A 3D3WA 4FDAA 1QV6A 1R15A 2VQ3A 4D46A 4OJNA 1H5QA 3IQDB 3IDSA 1LRJA 4CV0A 1CYDA 1E1NA 5BSFA 1GZ3A 4BO5A 4MVJD 3AW9A 4OGWA 1GZ6A 1SB9A 5FWNA 5I8ZA 1TVEA 1H93A 4GI2A 4Z9FA 3KLPX 4DIOA 1XSEA 4JCOA 3QHAA 4Z9YA 1PSDA 2QRLA 1IYZA 5FI5A 3LT4A 3ZCXA 3JYLA 2RHRA 4IM7A 4NK4A 2G1UA 3LC1O 3PHIA 4CMEC 2I99A 1OC2A 2O4UX 1U2DA 4CQMB 2OBNA 5IAAA 5JYEA 1MX3A 3PHLA 5THKA 1Q7BA 4FFLA 3KLMX 3INTA 4J1QA 3KZVA 3LT1A 1Y1PA 3CH6A 5F1PA 2HRZA 3CEAA 3GRPA 1DRWA 3LYLA 4HFMA 4YDRA 3A9WA 1WNTA 3UUWA 1C0KA 4AL4A 1K3TA 3U4DA 3GA0A 1B7GO 3BTUA 2QG4A 3ZWAA 1IPFA 4AJ2A 3WGGA 1Z6ZA 4JXKA 2AEMA 3KTDA 3M2TA 5DBFA 4N54A 1MC4A 1UZLA 4QXMA 5BNTA 1LLQA 3GK3A 4RO0A 4ZRNA 4BHTA 3T7EA 3HSKA 5KTKA 1P0FA 2NU7A 5ES3A 5EINA 2X5KO 2OGUA 1R37A 3UGKA 1H2BA 3VZPA 3PYLA 3INGA 5LC1A 4WECA 2IEBA 4WLVA 1KC3A 2POQX 1LLCA 3JD2A 5L40A 3PQFA 1Z7BA 2G5CA 4A0SA 3RD5A 3K2EA 3U09A 1BG6A 3WJ7A 4CM6A 1B14A 2VHVA 4FJ2A 2VRCA 1V3UA 4W7HA 5EIOA 2ZK7A 2AE1A 4CLRA 1BGVA 4R1TA 4INAA 4XX0A 1YGYA 4I08A 4DC0A 1QR6A 1CERA 2PA3A 1NWHA 1X7GA 4IDEA 1G0NA 1YBAA 1PZEA 4JX8A 1E6WA 2DU8A 3OJLA 3PFWO 1F12A 4IS2A 2PLAA 3ANMA 4E2ZA 2OP0A 1T2EA 3H9GA 5F1KA 4BQPA 1U4SA 1IHYA 4HKTA 4XYEA 4DBZA 4E4YA 3FI9A 4HNGA 2X9GA 4JLWA 4RVHA 1HLPA 1I0ZA 2NNLD 1UJMA 1J0XO 1FDWA 3H9UA 3ZGYA 3AOEA 1F8FA 3U4HA 5JFOA 1MP0A 3F47A 3ZWMA 2Y0CA 2EV9A 4MVJP 3WGTA 5A1TA 1U1IA 2OOSA 3DBLB 1LDGA 4IMPA 3H5AA 4DWVA 4AICA 1C1XB 4BKUA 1U5AA 4A7PA 3R0IA 3K2BA 5BSEA 3AUAA 3CMMA 3JTMA 5ADHA 2Q45A 2R00A 2NVWA 3QJ5A 1A71A 3RFVA 3DHYA 1KVUA 1E7SA 2B35A 3AY3A 3P5SA 4ALKA 3MCVA 2VWQA 2PFGA 3AY6A 3MWDB 3NDJA 5CEJA 4Q3DA 3GNSA 5BR7A 3ZWYA 1XLTA 2CDBA 4CM9D 1RKXA 2Y0EA 2GD1O 1ZUD1 1LC0A 1BTOA 3ROQA 1MXFA 3UCXA 3WJAA 1I24A 5A06A 1DIRA 1DIHA 3CMCO 4I5DA 1ENYA 3D4NA 1WWKA 4F6LA 5JDIC 4CM7A 1QG6A 1RM4A 1GR0A 3FPLA 1Z82A 1ORRA 4Z3KA 4XB1A 3NT4A 1XKQA 3RWBA 5COBA 2WMDA 4Q3AA 4IBOA 5BNIA 1E77A 5U1PA 1BRMA 3LLVA 4YACA 4NBRA 4QQRA 2J3IA 3UICA 4ZICA 3ZV5A 1LDYA 2C2XA 2GGSA 2NWQA 3GLQA 1YBVA 4RPHA 2B0JA 4D3SA 2ZYAA 3OECA 4CR7A 5B4TA 1LLUA 1UZNA 1YQDA 3DBHB 5G0SA 5HS4A 1NPDA 1QV7A 1RJWA 4HADA 4PVDA 4JJIA 4NK5A 4K6CA 2E48A 2BLLA 3PJGA 3F9IA 5ILGA 3GGPA 2O3UA 5EN4A 4QFCA 3W1VA 2FRDA 3VKUA 4RLSA 3QVOA 4YEDA 4NFHA 2CZCA 2QZZA 3JYNA 3WB9A 3GDOA 1P44A 4BNUA 2VYVD 2FPGA 1I30A 1LDEA 2VWHA 2FP4A 4D79A 3DEYX 4ZJUA 1RPNA 3WGOA 1ZK4A 4PG4A 4XJSA 1B8UA 5C7LO 5KCZA 2QW8A 1R4MB 1XWFA 3HNPA 3CE6A 1DXYA 4FGWA 4XJTA 4AJPA 4FFOA 1MFZA 2GR9A 3GOHA 4QEDA 3A14A 1GCOA 1T1SA 4J2HA 4R1SA 4B7UA 1YVEI 4KUEA 3VZQA 3KSZO 4RV9A 5IXYA 4H7PA 1WMBA 2AEJA 3EVTA 3GMSA 1EEHA 4ID9A 5COQA 4BV8A 2P4QA 1E7MA 5JO0A 3D4OA 3JQCA 5JS6A 1K6IA 1JWBB 1HXHA 3H9EO 1P1RA 4U0JA 4YAEA 3OEYA 3VPHA 1C1XA 1F17A 5I8WA 1QLJA 1ZVMA 2VT2A 3AOEC 4NIMA 2I3GA 1A72A 4E3ZA 3H9JA 3AFMA 1J4AA 2DLDA 4ND1A 3VH2A 2GPTA 3BMNB 1A27A 1GEEA 3M6IA 2NVUB 5HM8A 4QFDA 3ICCA 4B7CA 4MJLA 4MP3A 1DEHA 2ZQYA 3QY9A 3U4IA 4IJUA 1F8GA 4L0QA 2EKQA 1JWAB 3WNQA 2OP1A 3SC4A 2H63A 4EEXA 1BXKA 4AVYA 1SEPA 3NTOA 5I9NA 4D0RA 1VJTA 4OO3A 3WTBA 8LDHA 3SVTA 1HDRA 4RPGA 1O6ZA 5CFZA 1H94A 1UR5A 1PL8A 3D0OA 3UFXA 2YY7A 4A2CA 3DZJA 1GADO 3NRCA 1DIGA 1HDGO 3PJEA 2G82A 4UAGA 4WKGA 5IG2A 1X1EA 2ILTA 3K73O 4RCVA 3GVPA 1N1GA 1J6UA 2YV3A 1NR1A 1UDCA 3A06A 4YYZA 3IMFA 5IDWA 5EERA 4JIGA 5KVVA 3ZZNA 3QVWA 1I32A 3SLKA 4M86A 3AWDA 4G81A 5JYDA 1MFPA 3EC7A 2AQHA 4CV3A 2YHIB 3JSAA 4BO6A 1LSOA 2PWZA 5TT0A 3OP4A 4J0FA 2FPPA 3BA1A 3QWIA 4DGSA 4DVJA 4E5MA 5JAMA 5JY1A 1NWCA 1ZNQO 2X0IA 4GVLA 3RJ5A 3WICA 1B3RA 1PU2A 3K92A 3EGOA 2EWMA 2JL1A 3JQ8B 1E3WA 2C0CA 3AU9A 3HDQA 2D59A 3LF2A 4EITA 5BSHA 5IXSA 2BGMA 1PQPA 5C7IO 4WASA 4J90A 2RAFA 3ANLA 1S6YA 1OFGA 2GDZA 3U49A 1EQ2A 3IJRA 4FCCA 4CV2A 2VOJA 4Q3CA 2ZB7A 2GLXA 3JYQA 3TZCA 4DL9A 1E1LA 4YJDA 1O5IA 5ITWA 3E6AA 2H5LA 3I3OA 2GYYA 4YT5A 5DCUA 1QLHA 4IQ0A 1JA9A 5JMPA 1WZIA 1GD1O 2JHGA 1X0VA 4R9RA 4MP6A 1GAEO 3MZ0A 1H9AA 4AFNA 4BS9A 1NPTO 4GX5A 1T2FA 1XGKA 4IQGA 4UUOA 5JAIA 3C1TA 3ROPA 3TZHA 1F06A 3PYXA 2E37A 4IDBA 4BO8A 2EKPA 4E5PA 4CJXA 2NTNA 1DRUA 3HG7A 4O0LA 1O94A 1NFFA 3WS7A 3BAZA 3ZV4A 4WEOA 4BO0A 3ZN2A 1M6WA 4IDFA 1F14A 3BTSA 2EG9A 4CM8B 3NTQA 4XDYA 3DZIA 1XYGA 3GG2A 1OI7A 3PWKA 3VTFA 2Q99A 4TSKA 3IP1A 4GL4A 2X9NA 3H5RA 3NGLA 2B83A 4BGVA 5GY7A 5JBIA 2IDZA 5CG1A 4LRSB 4BO9A 4CLRB 2F1KA 1LX6A 2DPGA 3PJDA 4ZQEA 3TWOA 2VUSA 1NPYA 1ONPA 5I9LA 4CR8A 3BIOA 3ROMA 3G0OA 3C7AA 4E21A 3MJCA 4MO2A 1M6HA 1S7CA 2VHWA 1ISJA 3IJPA 2HKIA 4YJFA 3DL2A 1TLTA 1GPDG 4PLCA 3CZRA 4LK3A 5J23A 3KETA 2FHSA 3JQ9A 3E18A 5EL0A 4O63O 3LF1A 1NQOA 5JMWA 5KJ6A 4WOKA 2P9EA 3TFQA 1KEUA 4BNFA 8ADHA 2YFHA 5ENVA 4NDNE 2WJPA 4KDEA 4UVHA 1O8CA 1P1KA 1I33A 1ULUA 1WMAA 2VZ0A 1V6AA 3ROKA 2W8ZA 2LDXA 3PHHA 4Y67A 4JK3A 3I4CA 2X5OA 3H5NA 1M76A 1XU7A 2QYTA 3B6ZA 3LSYA 1NFQA 1YH3A 2CD9A 3BHIA 2Y1FA 4OOEA 2Z95A 3EZLA 2G17A 4BNZA 1ID1A 1I2CA 5BQFA 5BSGA 1BMDA 2NU9A 2YV2A 3O8QB 4L4XA 3BMOA 4BO2A 4DIBA 3GEDA 5FF9A 3WX0A 3ZNOA 1XQ6A 2PZLA 2Y1EA 2WYWA 2DBRA 4A10A 4DMLA 2SCUA 1YXMA 1LRKA 5TS3A 3H7AA 3QWHA 4Q3BA 3KV3O 3G1TA 2PH3A 1NQ5A 3L07A 4YAJA 1PJTA 4TRJA 5K6AA 2ZYDA 3DBHA 4LGVA 4OYRA 4PLVA 2UV8A 3L6DA 1MV8A 1UDBA 1ZKMA 3ITDA 1JTVA 4E5NA 2BGKA 1E1KA 4DPMA 1HWYA 2D4AA 3P2OA 2DBVO 3PYMA 5JW6A 3RBXA 4ALNA 1SC6A 1GUFA 3DDNA 4YR9A 4Z0PA 3R3JA 4I8XA 4WCFB 3M1LA 4KUGA 3WWZA 1ARZA 3VH1A 3DFZA 3IOYA 4YQZA 1RYEA 2DTEA 3DQPA 1Y9EA 3CTMA 3TRIA 4MDHA 1AXGA 2Y1DA 3ZHXA 1ENPA 2VNAA 3BHJA 5A9TA 4CMIB 3L0DA 5DOZA 1ULSA 3WXBA 2YUTA 1HSOA 1VJ1A 3EZYA 2HRBA 3OJFA 3V5NA 4BNYA 4LMPA 2IXBA 4H15A 4MIEA 1KIFA 1MLDA 1VLLA 1D4FA 4EEZA 3GQVA 3IS3A 1XIVA 4N5MA 1JW9B 3RCBA 4RVGA 2Y67A 3RAJA 3EHEA 3PIDA 2OMEA 4II2A 4L8VA 3DMTA 2CSUA 2DFDA 3DAFA 3WYEA 3I9NA 1SBYA 4JBGA 4IS3A 1ZEMA 3ST7A 1YB1A 1E0DA 2QX7A 3IC5A 4OXKA 4PG7A 5EPOA 1B3BA 3V1YA 5DBGA 4DPKA 1I3NA 1ADFA 3GVCA 1HZJA 3WFIA 1Y6JA 4IJWA 2YQ5A 4TWRA 5DN9A 3RC7A 2Q4EA 1K0UA 1HDOA 1LNQA 1ZXBA 3RU7A 3PGJA 2V6MA 4CUZA 1E3IA 4URFA 2VCYA 1P9LA 1U4OA 1OBFO 1K6XA 2X8LA 1C0LA 1XDWA 3HDYA 3K8ZA 5DDIP 3BTOA 3LC2O 4CMAA 2ZTLA 1DJNA 1Y8RA 3KYCA 4D3FA 1VL0A 4YJHA 5KIAA 3FN4A 4NBWA 3BMCB 1ZSNA 4NU5A 4HV4A 1BXZA 4KUHA 3WSWA 4DIFA 4FFNA 2BRUA 4BNKA 2WDZA 2I9PA 3DZGA 3K31A 5HRUA 5TJHA 5HBRA 4DRYA 3ADPA 2C29D 2JHFA 1JKFA 4M49A 3T4XA 4WCFA 3QV1A 2AG5A 7ADHA 4IGFA 5KJFA 4WPGA 3FR7A 4BB6A 3LZ6A 1EZ4A 1GV1A 1E3SA 1ZXLA 3O38A 4CMJA 4B4WA 2NACA 2ZJ1A 1DJQA 4ZQGA 1MC5A 1YQXA 2GASA 4HNHA 1BSVA 3WGHA 2O7SA 1UXIA 3FCOA 1NVTA 4KQWA 2ZB8A 4W82A 3WGYA 4JBHA 1A5ZA 2DKNA 4ZRMA 4H16A 3KRTA 5AVOA 4FFMA 4W9NC 4BUCA 1TEHA 1N9GB 1ADCA 1CEQA 1ADBA 3RQSA 2A92A 2UAGA 4KP7A 5AXDA 1GYRA 4J3FA 1NM5A 1LUAA 3G49A 4RVDA 1KY4A 1Z75A 2O3RA 3KYDB 3ONEA 4XRGA 3ORFA 1NASA 1I10A 3I9KA 4PZCA 1A4IA 1DBVO 3BHMA 2O50A 4B7XA 1MB4A 2F00A 4U7WA 1O89A 4NBTA 3G3EA 1E3WB 5A4DA 4BNXA 1EMDA 3FBGA 2AHRA 3INRA 4Y6PA 4EUHA 2P9GA 3OIFA 3ZHYA 3VZRA 4MVJA 1JAYA 3OMLA 4JN6B 2OZPA 5L7TA 2QQ5A 3TOXA 4IJVA 5BNFA 2J3KA 1YL6A 4BO3A 4XYBA 3IKTA 4WLNA 1GPJA 2VNSA 4MIOA 1SB8A 4EW6A 5CPFA 4WK6A 4YAGA 4BO4A 4OL9A 3GFGA 4L4SA 3L6OO 4MIYA 4BQRA 4PG5A 2C07A 3ASVA 1XHLA 2C2YA 3T4EA 5KVCA 4WLEA 1E6UA 3PK0A 3PIIA 5DCWA 3UCFA 1NVGA 1P0CA 4ALMA 1ZJZA 4R9SA 3D1LA 1IB6A 4GKBA 2FMUA 5AXCA 4JBIA 4NFYA 1XEAA 5THQA 4B3IA 1PQUA 2EIHA 2X5JO 4ZA2A 4J1TA 3WNVA 3ENNA 4YJGA 3GPDG 2CNBA 6LDHA 3PDUA 3D5TA 3DMYA 2RBEA 1BXGA 1BXGB 3ZWWA 4TVBA 2Q49A 3DOOA 3FNHA 3LC7O 4NMHA 3FTNA 5JCJD 2YDXA 3JD3A 3SJUA 1X1TA 3DONA 4BKOA 2I76A 5I7VA 3ONDA 4NBUA 4XR9A 4CUJA 5JNLA 5F3RA 4KWIA 1DAPA 2HMUA 4K26A 4CQLA 3A1NA 4XZ3A 2UYYA 2NU6A 2Y1CA 4CPDA 2JJYA 3N74A 4D44A 4O5OA 1H6DA 2QYSA 1V35A 1WDMA 1XR3A 3U3XA 3LT2A 2Q2QA 3GC6A 3LDHA 4BNHA 1EE2A 4R51A 2VRCD 5L7WA 1ISHA 4BGIA 4R41A 4RF3A 1EDOA 3F46A 3GN1A 3PFFA 5G0WA 3W4KA 4MINA 3BMNA 3ZWXA 3U4CA 2HUNA 3FF4A 4FSHA 3TZQA 2C59A 2YYYA 4BVAA 4EUFA 2GZ1A 1HDXA 4R5HA 2X58A 2X4GA 1K2WA 4OM8A 1BWSA 4QTZA 3U9LA 1VSUA 4JNKA 1C0PA 1ONNA 3BMQA 2NQ8A 3HDHA 3D4PA 3V1UA 3JQEA 3VPGA 3WYCA 2XAAA 1HKUA 4GSLA 3KSUA 5ILOA 3IKVA 2HMWA 2YFQA 2ZB3A 1UP4A 3H3JA 3HHPA 3NEPX 2GN4A 4PN3A 1QYXA 1AN9A 3T7CA 1GFSA 4IQ8A 5TRTA 3FPCA 3TZ6A 5CG2A 1ENZA 5DF1A 4TMFA 3DTYA 4E5KA 3C24A 2IZ0A 2OO5A 3PI7A 1DDOA 1E5QA 4XYMA 1PWZA 2VHYA 5CHEA 4DBVO 1MG0A 4L76A 2Q1UA 4BO7A 2IRWA 3BTVA 2ZCUA 3P2YA 5TJ9A 4EDFA 1I01A 3RFTA 1JQBA 3GAFA 1YDEA 2P5YA 1YJQA 1LA2A 3DAGA 3RUAA 5MDHA 3GPIA 3PRJA 4NJMA 4XRRA 4B4UA 4YRDA 1T2DA 3OSUA 3TFOA 2VZ9A 4DC1A 1GQ2A 2WM3A 3JQ7A 1L7EA 2HK8A 3PVZA 5JAQA 5CAEA 3GRKA 2ZTMA 4OQYA 4LW8A 1BHSA 2D5AA 2P5UA 2RIRA 1ONOA 2JCVA 2PNFA 4DLBA 3GDGA 2AW5A 3CIFA 4ZD6A 4OAQA 3LVFO 4N5LA 2W2KB 2X22A 3QW2A 2Q50A 5IN4A 3QRWA 1C3VA 1N1EA 5DT9A 4HFRA 3ZU4A 4W99A 4B8WA 1HDCA 5ICSA 4RQTA 5COAA 1PR9A 3FD8A 4YCAA 4KWHA 1Z73A 1NR7A 2X6TA 5T57A 2PZKA 3DXFA 3PJFA 3OETA 4FOSA 1JN0A 5F21A 2HMTA 2UVDA 3JQBA 4FPXA 1WP4A 4RQUA 1M67A 2ZTVA 1T4BA 2BHLA 3PWSA 3H6KA 1IPEA 4FGSA 4YXFA 1YRLA 3R3SA 1XG5A 2VYND 1Y81A 4R69A 3I1JA 3RIHA 1E6EA 1P77A 2YV1A 3AOGA 2E49A 4QSMA 4CODB 4GLLA 2JAPA 4I1IA 4OSPA 1KETA 2O3JA 1YDWA 5CDSA 2DBQA 2P9CA 1HT0A 3GAZA 2C7GA 4LMRA 1LC3A 1FK8A 1GY8A 1CDOA 5TNXA 1EDZA 5AYVA 5T67A 1TI7A 2V7PA 3GVHA 1PL6A 2VHXA 3NT2A 2CF5A 4I9HA 4XQEA 1KVRA 2GZ2A 3CKYA 3V2GA 4AJ4A 3SEFA 5IDYA 3WGQA 2OORA 3ZW9A 2Q1WA 1CQJA 1RM5A 4NQZA 3STHA 4CM4A 1U3UA 1DFIA 2FR0A 1NVMB 4AJIA 4RDHA 3OF2A 4QO8A 3I6IA 5CP8A 1LXCA 3D7LA 2D0IA 2V6FA 5LDGA 3OH8A 3PP8A 4JGBA 1N9GA 3NGXA 1P31A 3PDJA 4YJGB 4CMHA 3WOHA 3GNTA 2X0NA 3DC2A 4BL5A 1EE9A 1YOVA 1PGJA 3GF4A 3WQQA 4DTIA 1IZ0A 2Y1GA 3NKLA 3JQAB 4PLGA 3DB2A 4R5MA 3ASUA 3WYBA 2PV7A 2AQ8A 1Q2XA 2NSDA 4YVFA 2C20A 3H9QA 3WSVA 3QLJA 2NM0A 4A27A 1V8BA 5JPIA 1KC1A 4PZEA 5A05A 3SXPA 1E92A 3GUCA 9LDTA 4BNGA 1PS9A 2HJSA 3W6UA 1PJCA 4J0EA 4TZKA 1NQTA 3NX4A 4FIZA 3C7DB 3ETEA 3DOCA 3O4RA 4II3A 4JP3A 1YL7A 2Z1MA 1YJ8A 3JQGA 3QWAA 4IJKA 4J9VA 3GEGA 4OIMA 3TZKA 4H3VA 4BGEA 4FR5A 4Y6SA 1DC3A 2E4AA 3UXYA 2JAHA 4MPDA 1SZJG 4UEKA 1EVZA 4J7CA 3C8MA 1UAYA 3W8DA 1VL8A 3OJEA 2R00C 2GUGA 5TSDA 1FMCA 4BO1A 1UXGA 1PGOA 1C1DA 3PQEA 1R16A 2DTDA 5DOVA 1CJCA 1ZEJA 4E30A 1AGNA 2YQ4A 3FWZA 3SBOA 4NI5A 5KJCA 5H83A 1CRWG 3PPIA 3JQBC 5C37A 2B36A 2Y66A 5F1OA 1UDAA 2O4CA 1ZBQA 5K0ZA 4Q3EA 4RF5A 4G2NA 4Z3DA 2C7VA 1I5RA 2W2LD 2PD6A 3WBFA 3V8BA 4TKLA 4AG3A 1UZMA 5LDHA 2FR8A 3DBRB 4KOAA 5K6AC 3U0BA 3JQAA 4RJTA 1Q0QA 3FRJA 1R0KA 1WLYA 1HYHA 3RKRA 4G5HA 1QRRA 1EBUA 2Q46A 4P22A 1WAMA 2J8ZA 1DFHA 4CM8A 4XIYA 5BT9A 2DUUA 2PZJA 3NJ8A 1VPDA 1P1IA 4KMSA 3SC6A 1SO8A 4ESOA 5TQVA 1PS8A 3I9OA 3PQDA 3VOSA 5L4NA 4S3MA 3ZNQA 2QIOA 1KEWA 4ND3A 3UKOA 5JY6A 4FW8A 3JD4A 3EK2A 4UUMA 1Y8RB 3KYCB 2EXXA 4MVJF 4QUKA 2HJRA 2CMDA 3JV7A 3AUSA 5C5IA 3BMOB 1I3LA 1XCBA 3E8XA 5G4KA 1DOHA 4PFJA 4KZPA 2FZEA 1YQGA 4L74A 1RM3A 4BMNA 3UN1A 1I2ZA 4GWGA 3N7UA 1B2LA 1A7AA 1EUZA 1MA0A 4IDGA 4D0SA 1TT5B 3FR8A 5T8KA 2QRKA 2WE8A 4AJEA 3OBBA 4UUNA 2B5WA 2YW9A 4OKNA 3RSHA 4BV9A 1Q1NA 3NDIA 2P4HX 3CSDA 1U3TA 4B3JA 2FZWA 5CEFA 3FBTA 4IPTA 1DPGA 3GR6A 4U6QA 2WYUA 4RPKA 2HMVA 2CFCA 2DFVA 1RM0A 2B4TO 5IF3A 4BMVA 3AFNA 1WVGA 4QX6A 2BFOA 3PLRA 4UREA 1EVIA 1U8XX 3IIEA 4LRTB 3IL2A 2EJVA 1VRWA 3QIVA 4PIVA 4FFRA 4U6SA 1DO8A 4UEOA 3G1UA 4M1QA 1U3WA 3PXXA 3F1KA 3S2EA 5B4UA 3ZH2A 1YONA 4G65A 5L7YA 4CLEA 5B1YA 1H9BA 2CDCA 4OKIA 4J7XA 3E5MA 3B20A 3F6YA 1J49A 1SNYA 3OHSX 2J3JA 2DC1A 3EUWA 4TQGA 1ISMA 1H2HA 4MOWA 4CLOB 2H6EA 1IZ9A 4GVXA 1ZZEA 3K5PA 1DAOA 3KXDA 5TGDA 5IDXA 2YDYA 3WTCA 1WZEA 1U5CA 2GSDA 4NPCA 4W6ZA 1PGQA 4IGEA 1PWXA 4J1NA 3ZWOA 3DTTA 1N8KA 3KYBA 1KY5A 2C5AA 2DUWA 4P38A 5JC8A 2BD0A 5AOVA 4EJMA 4RVFA 1VM6A 2C5EA 4YJHB 1B0AA 5IN5A 1NHGA 1D8AA 4P8RA 4TRNA 4LVUA 1KS9A 1TXGA 4ZQBA 3WGIA 2PTGA 7MDHA 3CXRA 5KKAA 3OICA 3JQFC 1ZMOA 2X1HA 3OQBA 2AG8A 1Y5RA 2ZB4A 4MVJI 1T25A 1ISGA 2DVMA 2W4QA 3WG9A 4E0BA 4FS3A 1V9LA 5FYDA 1HETA 3ZW8A 1HL3A 1T26A 5T64A 3ZWVA 3B70A 1GQQA 1T2AA 4PRLA 2XOXA 3S2IA 5CDTA 1LTHR 1X15A 3W4JA 5CDGA 1NP3A 3IP3A 3O8QA 4CR6A 1JKJA 2B4QA 1Y8QA 2FPIA 1KVTA 4WNCA 3FHLA 2PR2A 3A4VA 3F4LA 1NNUA 2OHXA 4OXYA 3I9MA 3E9NA 4LN1A 4WEQA 5KOIA 4TRMA 5C7OO 3QVTA 3KEOA 5DULA 3U5TA 3JQ9C 4HXYA 2R2GA 1IHXA 3H65A 3I6QA 2I65A 1WPQA 4BNVA 5JO9A 4Z9XA 2BELA 5KNLA 4UVEA 3C3XA 4C7KA 4QECA 2GERA 3EY4A 2ZYGA 3WMWA 3IUPA 4M8SA 1PZFA 4XYLA 3I4FA 4O6VA 1FDSA 2BI8A 2H1SA 1P1HA 1LRLA 3OIGA 5TC4A 3CUKA 3M2PA 2HO5A 2NTVA 4IDDA 3V2UA 4CMKA 2W2LA 4XGIA 1SMKA 2BFAA 4NJMB 4UVDA 3E1KA 5CDUA 1IUKA 1EBFA 1HRDA 2WEKA 1YOVB 2NVBA 1NXQA 2XXJA 4ZHSA 4FD3A 4IUYA 2EF1A 3RUCA 4IZHA 3E9QA 3GDFA 1LQUA 3NV9A 2JD2A 3FNFA 3B1JA 3KHUA 2HK7A 1EK6A 4A5OA 1A9ZA 4AJLA 2OUIA 2VT3A 4BNLA 5A02A 2NADA 3ICPA 2VN8A 1B8VA 1ISFA 1NQAO 1QXSA 1R12A 2Y99A 3O26A 3K96A 5U4QA 3C1OA 1ZK2A 1E7QA 5B37A 4B4VA 1F0YA 3NTRA 3TQHA 4DUPA 2VTEA 4C4OA 4I5EA 2QZ9A 2IZ1A 3NAQA 2IE0A 1QKIA 1T4DA 4XQGA 3LT0A 5DP1A 4HBGA 1QSGA 3DBVO 3S1LA 1PJ3A 2NVUA 3QA9A 5AXBA 2NV6A 4RPLA 1I8TA 2CVOA 1GQYA 4EJ6A 2HDHA 1YE3A 5EQFA 4IDAA 3PWZA 4XB2A 1ADGA 1ZJYA 4GWKA 2ZTUA 4XIJA 3RU9A 5DCYA 4NH4A 2Q4BA 1UP7A 3NYWA 4U8GA 2AMFA 1OOEA 3OJ0A 3GGOA 2EGGA 4R16A 3WIEA 1SOWA 4RF2A 1U7TA 4ND2A 3VDQA 3O03A 5G0VA 3DMTC 4U5QA 4ZU3A 2BFMA 3UVEA 1JVBA 1JLLA 4K9DA 1Q0LA 2Q3EA 4M87A 2EEZA 4WUVA 2W90A 3FNGA 1NTOA 1HE5A 1HSZA 3A28A 4QT0A 4S1VA 4ZQFA 5JDCC 1O0SA 2A35A 2J5KA 2OL4A 2UUOA 3VHRA 3UAGA 1LEHA 2PKQO 3R6DA 1LBEA 1BVRA 2D8AA 3TDKA 3L4BC 4RZHA 2PD3A 4WLFA 1EQUA 2YHIA 3RUEA 3RBVA 2I5PO 3ZWPA 4DMMA 1DFGA 5JDCA 1ML3A 4YA6A 2H9IA 1U3VA 2DAPA 3MEQA 2J6IA 4N5NA 5CPBA 5EMHA 3H8VA 3HB5X 1LLDA 1W73A 4PGFA 2EW8A 5IZCC 1PTJA 1QYWA 1HE4A 1CF2O 3RC2A 2Q1SA 2BI7A 3W4IA 3D5QA 2EW2A 3QWFA 1GZ4A 1CETA 2YJZA 1HYEA 3K9QO 4XDZA 4WGGA 4D45A 3F4BA 2HCTA 2HMSA 5ICMA 1YBMA 1EVYA 3PZRA 3DOJA 1UXHA 2GN6A 4RF4A 4JP2A 1RYDA 3RUIA 2OBYA 1NFRA 2O23A 1VI2A 4GX1A 4NFSA 1K6JA 1M75A 3I52A 2PKQP 3BMQB 2NTJA 1BW9B 4J4BA 4O1MA 3G79A 4D3DA 5KVQA 4D7AA 1NYTA 4E31A 1PR3A 1PX0A 2JFHA 2PY6A 3BMCA 3HJAA 4J16A 4ZN6A 3KO8A 1HE2A 1ZK1A 3MTJA 3HFGA 4D42A 3KB6A 5DZSA 3TOZA 2X0RA 3GT0A 4EUEA 1VSVA 4J6FA 4Y9DA 3PLNA 2IZZA 4KTTE 1Y5MA 3MJSA 3WLFA 3GEMA 2G0TA 2Y93A 4E13A 3O9ZA 2JCYA 3TN7A 1W0CA 2EKLA 4CV1A 1PJ2A 1Y8QB 5H82A 4EJ0A 3I9LA 4HY3A 2LDBA 3JQDA 1Y9AA 2O7QA 1GTMA 3N58A 1QYVA 3ZHBA 3MOGA 3CPSA 1R4MA 1EVJA 1N2SA 4YT4A 2VTDA 2ZQZA 2DQ4A 1C0IA 4PLHA 1L1FA 3D64A 1B16A 1IY8A 1VL6A 1PQWA 2AXQA 1XA0A 1LSSA 3VVCA 1CQIA 1AUPA 2GN8A 3VVBA 4AJNA 1OZAA 4AJHA 2EP7A 3M1AA 4Q39A 4F3YA 2FN7A 1H6AA 2EJWA 3LLSA 2ZKLA 1ISIA 1JAXA 2OFPA 4PCVA 2FY8A 1DHTA 1B26A 1X7DA 4HWKA 5F5LA 3C1AA 4IIVA 4RPJA 4OSOA 3AI3A 4CM9A 1JDJA 3GH3A 3HN2A 5HWSA 4OHUA 3NDRA 3GN2A 3ANNA 3HFSA 3L4BA 3L4SO 3Q9UA 3COSA 4CLOA 4P4LA 3GVIA 4J4TA 5IZCA 2RCYA 2D5CA 1D1SA 3AY7A 3KSDO 4GGOA 1EUCA 1KVQA 1I36A 1OAAA 2JFFA 3ON5A 1PL7A 3ETGA 1Z7EA 4P4GA 5IDQA 3ETDA 4GQAA 3OM9A 2WD7B 1ZFNA 4CUKA 1A7KA 4WJZA 1ENOA 1Q7GA 2O2YA 2QHXA 3ABIA 4BGUA 2XXBA 5EJ2A 1Z45A 2WE7A 4XKJA 5JCXA 1BDBA 4GMGA 4WOJA 1SPXA 1TT7A 1YO6A 4NZ9A 1KEPA 1U9JA 2PGJA 4TZTA 4Z0TA 3HE3A 4GH5A 2Y1OA 3KOUA 4PLPA 4E32A 4PG8A 2QRJA 4ITUA 3TL3A 4ALJA 3L77A 3HUDA 3OIDA 2HQ1A 2JD0A 3RUHA 2WWRA 2X23A 3HB4X 4Y8VA 1DLJA 1TA4A 2E82A 1D3AA 2YZ7A 4FJ0A 3VH4A 1UAGA 1WDKA 2Z1NA 1LQTA 4I9UA 1HLDA 3BXXA 3RJ9A 3UW3A 2Q2VA 1P33A 2DM6A 2TMGA 1QYDA 1ZK0A 4AJ1A 4XGNA 4N18A 3ULKA 4RGBA 3IUSA 3UCEA 1FDUA 4LCJA 5KJ1A 5L51A 5L95A 4P4NA 1GUZA 4MVJE 4CQMD 1UH5A 4NJOA 4AJJA 4R3NA 4MVJH 1O9BA 4ILKA 4XQ9A 5JSFA 3QP9A 3JYPA 2XF8A 4F6CA
chains in the Genus database with same CATH superfamily
3EF1A 4RVUA 4A16A 5ALHA 1GLNA 4BNJA 3AM5A 2X77A 4O02B 5IKXA 2E18A 5FHRA 2FEXA 1PG0A 2RIPA 4F45A 1P1FA 1UFRA 1X19A 3BGWA 2ZJBA 2HU7A 1W35A 2G76A 8ATCA 1NN5A 1XL1A 4KODA 2ZT6A 3ZNPA 3FDJA 5BSVA 1YACA 2C98A 4PIPA 3R20A 2Q3HA 3CNEA 2VHZA 5FO1A 3G17A 2ASVA 3B9PA 2P2GA 3CCCA 4R2IA 1E7YA 2QD2A 1KJIA 5B2FA 2FW7A 2WABA 2UUAB 1SHUX 2A5JA 3Q6IA 2P6NA 4AMVA 2VOEA 1WDLA 3IO3A 3O1IC 3DDZX 1VTKA 1GL7A 3F5MA 4HZUB 2WSBA 4OFWA 2GUWA 1SOVA 5BNZA 2C7PA 1KJNA 2V6BA 4HEJA 5EE1A 2ONJA 4QOJA 3F67A 2GAOA 4Q01A 1HDEA 1MPXA 1G0OA 2JRCA 2FX2A 3BGOS 2PYIA 4NBSA 3VZDA 5KOHA 2F8TA 3M34A 3P26A 4RHYA 4R0MA 4MTCA 2MU1A 2E1PA 3TR5A 3CF4G 1YS6A 3DUWA 3DWFA 5M5BA 2IT1A 2XI4A 3QPWA 3BFVA 2AOTA 4MUJA 3N2NA 1DO2A 2PH5A 5TQ2A 4DDWA 3I5XA 2J41A 2AW3A 3L6EA 4ZV4A 3WBBA 4A0FA 1E2JA 1V3QE 1UL1X 3AI1A 2GNOA 2QP9X 5BMVA 1NMYA 1VRVA 4M6WB 3IA7A 1ITZA 3A7DA 4M0UA 1GNQA 1WDTA 3TLKA 4CDGA 1C3XA 3VPXA 4QNMA 5EESA 5BRJA 2H1OA 2WM9B 3T9FA 1XRPA 1IBCA 3VFDA 4OSEA 4F3RA 2GN0A 4PBRA 5DLPA 4M0CA 5EHIA 4B6GA 5AVQA 2HT6A 3QIAA 2WWHA 4CQMA 1J0AA 2DJ5A 1Y3CE 2GTPA 1OXTA 3HBLA 1FFBA 2ZYIA 4Y1FA 2JFGA 5FWYA 1ZO8A 1JBEA 1RHQA 2LV8A 3LPAA 1DZIA 2D1YA 3H84A 5FI3A 1RHRA 8AT1A 1JX6A 1EK5A 1FNNA 4ZPXA 4V0RA 4ZAVA 4NHEA 2HU2A 4BNDA 3H19A 4Z99A 3K8QA 2QMUA 4KV9A 3IQWA 4TTRA 1PE0A 1NDQA 4L75A 1BMQA 1JXQA 1KSGA 2ZUFA 2MSLA 4KQ9A 3RS9A 4Y6RA 5ITVA 1DBRA 3OIVA 2Z58A 3P0HA 3MAAC 3FNEA 5J59A 4YT8A 3KFVA 1ZSYA 3CLRC 3P2JA 3VH3A 2AVDA 4I5FA 4F0JA 2CFSA 3QBTA 2AZ4A 5JLAA 4P7FA 3MT9A 5KJEA 2AYYA 1ZIDA 2WU3A 4L78A 2XVZA 3LCRA 3OQVA 5DK6A 4CMIA 1WKCA 5DYNA 3IDQA 2W2NA 1QIFA 3QK7A 1PIWA 3MBIA 3RROA 1T36A 1C9KA 3OCWA 2OZLA 5DHAA 2IK8A 3MJEA 1RVV1 2WAOA 3QXHA 4GKAA 3HKEB 3W6OA 3BN3A 1QH9A 3T9DA 2IODA 1HYGA 4CEJB 2REBA 4LZWA 4NWIA 4FFPA 1FRVA 2XUDA 4XQCA 4GUAA 1C5KA 1QUEA 4YXWA 3HVIA 4G4SO 4JLSA 2LUOA 3DXYA 1ABBA 5KU1A 1VJ5A 1GKUB 2GAJA 3HXOA 4X00A 1PBNA 1RQ2A 2VUTA 3D02A 1OJLA 2VIIA 2WNSA 3HU2A 4MR7A 4MPPA 4IXTA 5FHQA 3VZSA 3P19A 3AU8A 1Z0DA 3WWOA 1TDJA 2YW2A 2IV7A 3WLMA 4O2LA 3ER8A 3UMBA 3PNYA 3VAZA 1N5IA 5A6SA 3L0OA 4PCUA 4HAUA 4NE9A 2FAXA 2BMVA 4MPRA 2YICA 4EF6A 1HZZA 1TYZA 5KHAA 4L9AA 3VI3B 1T24A 4AG5A 4IRXA 5KDOA 3WR5A 2GN9A 3MT7A 2YWRA 5FDFA 2TMKA 2W6JA 5KBYA 3EGWA 2MINA 4GMKA 4Q00A 5CVDA 5A04A 4J49A 5H80A 4D26A 1QP8A 5F7ZA 5LP6B 2IEDA 4B40A 5M2QA 2QMHA 4XCVA 2E21A 2C82A 3W5JA 2VH5R 3IT1A 2B9VA 1E64A 4AULA 3FDIA 1E7RA 2Q0QA 4HX5A 2AEFA 1T6NA 1F6WA 1URPA 4Y2QA 3I1FA 3CLKA 4WNIA 1U28C 4W5RA 2XB4A 3AB8A 4RIHA 4U7JA 1Z5ZA 5TLSA 3BCHA 2QVYX 1SC1A 3NJ4A 4CM1A 1MNAA 3UMSA 3UBTA 1J5PA 3F3SA 1H2WA 2DGDA 3JZMA 4IJQA 1RRGA 1UOPA 2PLRA 4C6RA 5IRCD 1X7HA 3ABQB 2B0CA 1LK0A 4BFYA 2PMCA 3P0EA 4GX2A 1XCMA 2C2MA 3E9DA 4H1TA 2FSVA 2YN4A 1U2DC 2HRRA 4PLYA 3TW6A 1Z35A 3NNDA 1BW9A 1QU2A 1J22A 2EX4A 3IUMA 4I2NA 4ZZ2A 3LYHA 3WQRA 4HMPA 1ZM3A 3D6TB 4AU1A 5FCDA 5DX1A 4DR2B 1QO9A 1PJBA 1NYLA 2DY1A 2O9JA 4ZALA 2I1WA 421PA 4A23A 4BRZA 1GLGA 3H3FA 4R8LA 3UH1A 4ERNA 2QVZX 1UPUA 1OTHA 2AR9A 1D7OA 5ER6A 2FXVA 4H77A 5BP7A 4AQYB 3KTFA 2HSEA 2EFYA 2JCXA 4ALIA 1R6VA 5EZYB 5A9RA 5B12A 4X41A 3OO1A 1U63A 2Z57A 3GFPA 4KPUB 3ZGOA 2UZ0A 3RYIB 1HTBA 4D0LB 1Z29A 5AK4A 3ZK8A 3ZQJA 2MTBA 4ETMA 2PYDA 2XD4A 2E4XA 4G0XA 1Z5WA 3WRXC 4DQVA 3GJ7A 1T91A 3W2EA 1E9EA 2FSVC 1KFBB 2X0FA 3T1TA 2P3SA 1PS0A 1Q6ZA 3RIXA 5HTOA 1W5SA 2WSLA 4RK7A 2GF2A 2QVCA 4MKZA 3LCCA 4LJSA 4N8DA 5LP6C 1GKKA 3RHSA 1N7JA 2B21A 3BX1A 4FONA 3ICEA 1JEQB 2GBIA 2Z30A 5A3SA 1Z34A 1QG0A 2WPDD 4RIEA 3JYOA 3RUFA 3AHGA 2P79A 3A3YA 2P78A 4C0BA 1UDWA 2C3OA 3UV3A 4Y98A 3ESCA 1RE1A 4YTEA 4Q21A 3T95A 2CY0A 3TKLA 1P74A 3G0HA 3IR7A 4HSGA 4DYVA 2C54A 4JFAA 2RGDA 1R66A 2ID7A 5JALA 3BIFA 4G0MA 2VF5X 4CXMA 3KQOA 4K3UA 1ESNA 2Q07A 1OI4A 1R0WA 1Z9BA 2VS1A 5FOTA 1N6HA 1WO8A 3OFSA 1N0HA 3F2VA 5G0UA 2GHQA 3LU1A 1F4LA 1SD2A 2OAQ1 3B5JA 3CM0A 2VNHA 3W1EA 1KTVA 4UULA 2DT5A 3SIWA 4BFVA 2SBTA 1CBUA 2YXDA 3FPEA 3URMA 5ITZB 1VJ0A 3O8CA 3IAHA 3T7KA 5JCJA 2IV3A 1RXVA 3LY7A 5CVUA 3NMUF 4HFJA 3U13A 4PZDA 3S2GA 1E1CA 4ZU1X 3AJRA 3I5MA 3PFHA 4PRKA 2F3TA 1U2GC 1ULZA 4EUKA 3PC6A 2IV2X 4DFDA 1TKRA 4NCKA 1ZW1A 4JJFA 1IH8A 3GRFA 4JC8A 4YJ2A 4HAXA 2JI8A 1RC0A 2DBZA 5KX5B 4D9BA 3EPHA 1IEVA 1VP9A 4P92A 5D6OA 1ZD9A 3OQ6A 4ZCQA 5J1TB 1N6RA 1C7RA 2IFTA 4HPWA 1UBMS 3ZI0A 1WKVA 1P5JA 3GNLA 3G2KA 4JOBA 1N7HA 2W2OA 2J09A 4LWQA 4BOYA 4A8JC 4S1OA 3AUKA 3CONA 2JASA 4LNUB 4R9NA 1ZCFA 4BEWA 2OAEA 1D6NA 3DZBA 1LNZA 3Q9NA 4OGFA 5EJ7A 3DHEA 4BUJA 1W48A 2Y92A 4I1PA 3ZBUA 3RPEA 3AHCA 3GZJA 3QXCA 5JATA 2K7FA 3H2IA 2IP2A 4YBZA 1NJ5A 5F7XA 2RHOA 4ZT6A 3FB4A 3K9CA 4MUIA 1GKIA 3WVNA 3BG5A 4QGFA 1IAVA 1I7DA 4DF3A 2WYVA 3B6EA 1CJUC 2RHHA 4IH1A 2MSDB 5D1HA 1MAAA 2PWBA 5BSUA 4RFLA 2W9XA 3UKJA 5DP2A 1KQ3A 4BFLA 3ANXA 4FP9A 5KMGB 3SYMA 2ECKA 3Q10A 2PSJA 4JBYA 4JC0A 4A2PA 2ZM5A 3FKSA 3ZVMA 1CRPA 3TJRA 2NQTA 1A9YA 3DEIA 3W6ZA 3DVSX 3UIEA 4FYPA 1FTQA 1V6CA 4UD2A 5ESWA 1TJ4A 3ZLBA 5IJZA 1TMGE 3PHJA 3R5JA 4E6PA 1I51A 2GAAA 1H4VB 1YWGO 4WCDA 2I2XB 5BWMA 5K0GA 5ED4A 1E2BA 1A3CA 1Z4PX 1W6UA 2ZJ0A 2A94A 5A9SA 3PGKA 1ZH0A 2FPIB 4EW2A 1EFLA 4G0OA 5KREA 1PEDA 3GFBA 2O14A 4EI2A 1TEZA 3COYA 3PS9A 3VOTA 1AKRA 3FCSB 5JE8A 5AXAA 4XEHA 4UTZA 2FG7C 4Y2XA 5E0KB 1ECBA 4Z4QA 2ECOA 3TKYA 2O8BA 3IUYA 3E81A 3QWBA 1VKRA 2E0IA 3HGQA 4RD2A 4KAAA 4D56A 1P29A 1DLIA 2I87A 1RWVA 5EEHA 1O5OA 3D6VA 4O4LA 4AO8A 2A88A 3DKIA 5IKMA 3ONWA 4Q9DA 4N4AA 3Q8XB 3JASA 2CL0X 4MQEB 1V5EA 3IHWA 3S8MA 1CUUA 1RCFA 1XC7A 1I4EB 3GNQA 2P2SA 1T10A 1V37A 2IPMA 4O4JF 4QYIB 2YMQA 1GTSA 1V4VA 3U1BA 1E6MA 2D2VA 1ZOOA 4UHJA 3P9IA 3KYDA 2EQAA 4M8LA 1G3IA 1I5EA 1IY9A 1EYZA 4P84A 3CZMA 3ZZ0A 3K6JA 1K8ZB 1M2WA 4Q9NA 2V6JA 4WX2B 5B58T 4E70A 1XRMA 1TO2E 5LLSA 4H18A 2Y68A 3RV3A 1RWKA 4NENB 2CVQA 4FFVA 2PZMA 4II7A 3CPJB 4R4JA 1M8FA 1AV6A 3VMMA 2CNKA 4PONA 3D7KA 4MV7A 4XM0A 5H59A 4JLVA 4YY3B 2FHPA 1SHTX 4JD5A 1AUQA 4GOKA 2Z3ZA 1Z74A 1SIOA 2IEZA 3HWSA 4GC9A 3A0UA 1DC5A 3EW9A 3E3OA 1THGA 5K9ZA 1ISRA 4NZZA 5JCPA 4UVGA 4BMYA 1G7TA 3R1IA 1XRQA 4DLAA 4XM1A 5KHOC 4W7IA 1QK3A 4LE0A 2LKCA 2O3QA 1VKZA 2OBMA 2VDLB 1WVIA 2PMKA 3LLMA 4HQ0A 4KBFA 4ROSA 2BFEA 3GCZA 1R0SA 4GLOA 5C31A 3LQ4A 1LSJA 4DWWA 1VBMA 3OCYA 1CLUA 1MO2A 2FOLA 1JIIA 3EXFA 2I6TA 3M0EA 2P90A 5HS6A 4BNIA 2C97A 2QU7A 3BWYA 5TF4A 4E33A 3GG9A 3H18A 3ZU5A 1PD0A 1H65A 5A5FA 4X1IB 5AQEA 3U3DA 2GZHA 4O59O 4NS4A 2PRSA 1U7HA 4FMBB 4IP0A 3V8VA 3DMNA 2IYSA 4BKRA 1MD9A 4CMCA 3SR4A 3EVNA 4LYEA 5LQNA 1G8MA 3GDHA 1U0LA 5K3AA 1E1MA 4MO9A 4IIXA 1LGYA 5CLGA 1T3LA 1C50A 1W96A 4XWYA 4E5UA 3X2EA 1YQQA 1QHEA 5M3BA 1D1QA 2Q1TA 4BIIA 2JGJA 1WULS 2JJ2D 1U4NA 4UU1A 4HAVA 3M3PA 1ES9A 2Q7XA 1UKZA 3AK4A 1X14A 1ODTC 3L9WA 4AMUA 1KFJB 5TPZA 2XWSA 2NO1A 4MW5A 3S28A 4PFKA 1JXMA 1E5VA 1FTGA 2HXYA 1U9IC 2M2IA 1U1GA 3EG9B 3OT1A 3WWYA 4RD6A 4DYDA 4YV1A 2BGJA 4IDCA 4OQEA 4PVCA 3UJ3X 1V0JA 1KZ1A 4MJXA 3R0JA 3PUWA 4E22A 1BHQ1 4G4IA 4XTRA 1M8JA 4UMFA 2N3ZA 4X1YA 3AB3A 3FY4A 3SIRA 2ZJ7A 1NN3A 1ESCA 1U8AA 3IT3A 1UPBA 4GZ5A 1AQIA 4B43A 6ABPA 4KTVE 2WWYA 5DBIA 5I7SA 3A9VA 4BMXA 3LIPA 4FOLA 3PRHA 4AUNA 4BMZA 4EMTA 1Z7YA 4N7JA 4NU6A 3CLUD 1QKJA 1RQRA 2GA8A 3GAMA 1ZM9A 4K6KA 5H3CA 3O3OB 4DEVA 3ESBA 2C57A 2Q3CA 3LOQA 3PGXA 1RYFA 3ZIDA 1G3QA 1PJSA 3AIMA 2VTBB 1UUFA 2TECE 3CJRA 3U37A 3WJ1A 4W9NA 3V33A 3E48A 4MLCA 4NNJA 1JMKC 3UF0A 1E9RA 1OXVA 3OWXA 3RVBA 3T35A 2F9FA 2HTEA 1CWUA 2ZJ3A 1DV1A 1X7YA 4UUPA 3BB4A 6CHYA 1R50A 1C4WA 1KNXA 3FSEA 3NBMA 3O2SB 5MGBA 2YN0A 3ITKA 4BEJA 1KSHA 4HZGA 2XA2A 5K3CA 4FNGA 3TIGA 1FTWA 5LB2A 5LBIA 2W43A 3PE6A 1XQXA 2BMAA 1TF5A 2P68A 10MHA 4PW0A 2HR1A 4Q4JA 3KBOA 4CL8A 2W37A 3EARA 2EFCB 3FZGA 3N2EA 4CIDA 4C29A 1XDBA 3CV3A 3K1AA 4AZVA 1AE1A 4C4PA 3BKXA 5FFFA 1DC4A 4X44A 5DW3A 3D3WA 4ZV7A 4RTRA 1RNLA 1DBPA 5A3QA 1VLQA 1QV6A 2ZRCA 3QEOA 4FDAA 2MCFA 1R15A 2OFXA 4D46A 1GTZA 1QQAA 2C2HA 4O4HA 1OYWA 2KMLA 3IDSA 1AQ6A 1K7FB 2O0HA 3QJYA 2DR2A 2IXEA 4CBVA 3K7EA 1A77A 3E7XA 1VDZA 3RNLA 5FWNA 3TINA 2JBHA 1GVHA 3CSUA 3RADC 3LOUA 2HGZA 4M9XA 5CX1B 4Z9FA 3ADKA 4EUNA 1XSEA 2EFDB 2G1JA 3OOWA 5HCIA 3G7SA 4NICA 4AB1A 1W34A 1ADJA 4H17A 2HRDA 2XEXA 1P17A 3C3BA 3JYLA 4NK4A 4J0CA 4XVCA 2G1UA 3LC1O 1X80A 1DQPA 2I4MA 3WLKX 4CMEC 2B20A 3KDAA 4PZUA 4ENVA 2KS6A 4EKDA 4NX2A 4KNWA 2X4IA 2OBNA 5FWDA 4C3UA 3WLOA 2ISQA 1SD1A 4F5DA 3GFQA 5BQPA 5BT8A 1KIMA 2Z09A 4ZTZB 1RP1A 3EG9A 3OT1B 4I55F 1P62B 2XWPA 2NV0A 3INTA 1EWTA 2PMEA 3KZVA 3LT1A 2HDWA 2RC6A 3DCNA 4HFMA 3HYLA 1MRZA 4LKOA 3WNCA 4C5AA 2IVFA 3A1CA 4XGQA 4BATA 2UVQA 2VSYA 1YHYA 3E1GA 5DEOA 3WL7A 3RTCA 1U2PA 4EG6A 2BGRA 5I5EA 4FDUA 4YC7A 1EUYA 4BGDA 5IWCA 1J8QA 2E4UA 3MLAA 1UANA 2XQJA 3FPJA 4NY1A 3DLHA 5ALRA 1LX7A 2GH1A 2WB4A 1G7RA 4QE3A 4RSMA 4XUGB 3BTUA 4AJ2A 4B4DA 1RWOA 2ZROA 1S4MA 2ANBA 3ADCA 3C15C 3CW8X 3PUHA 5AOBA 2QSZA 3VI4B 4TT3D 5BNTA 1XTVA 3Q5DA 4Y9TA 5E1OA 4RO0A 1J25A 5HQTA 1UT6A 1R64A 1XZBA 3RC8A 1IDOA 2NZUG 3RODA 3T7EA 3HSKA 2ZAOA 4Y1RA 4NECA 2PRIA 3O8DA 4ND7A 5EINA 1DKOA 3VJLA 2OV4A 1SUPA 1XRLA 3UGKA 1Y7LA 2VUHB 3VKGA 1EK2A 1KI8A 1T8TA 3NYRA 1IG3A 1F60A 4MQBA 3B3GA 1D9XA 3LS2A 1T5TA 1LLCA 1JXAA 4EVRA 2OXFA 3AETA 5L40A 5HP4A 4RKFA 3SF8B 1J23A 4BZXA 5KNCD 5T4BA 3BSFA 5JT1A 3RD5A 5EUMA 5E4JA 1TIBA 4DR4B 3LXRA 4A8HA 3PX7A 3WJ7A 2CLHB 2XOEA 4EVSA 4CM6A 3E8SA 4XCQA 2B3DA 1WF3A 4CNQA 1D0VA 5EIOA 4L3OA 1BH6A 1JQEA 2AE1A 1DQYA 1Q6YA 1YGYA 4I08A 1BCRB 1XP8A 3CFYA 4RTOA 4BFCA 3D9QX 4KQHA 4IDEA 4AP9A 2HN9A 4EI7A 4JUAA 1RQGA 2CYBA 4JX8A 3JR7A 1M1YB 3OJLA 4ZC1A 3UEOA 2GBLA 2OP0A 1N2XA 4E2ZA 1JRLA 1S0UA 3H9GA 3V7NA 4BQPA 3S81A 1U4SA 2JPDA 4F7DA 3FGNA 5J4LA 3QF7A 4E4YA 1MENA 4HNGA 5F98A 3WY9A 3H17A 4UUQA 2NNLD 2B2NA 2JKZA 4PZ9A 4BMDA 3ETNA 3O75A 4HF7A 1DT5A 4JLUA 4W5QA 1OXBB 4JUBA 4JI3B 4I9FA 3WL8A 3WLTA 2CVFA 1P4HA 5IBRA 1GT6A 1PR4A 2DHRA 1RAIA 2Y0CA 5A6VA 2CMKA 3GCGA 3ZHQA 1PK7A 2HUPA 5A4KA 4GXRA 4JVMA 1E2FA 3K8YA 3M9WA 4LRUA 4HAZA 2P67A 4IIHA 1ZD2P 2OFOA 3LWZA 4BKUA 4WKCA 4IIEA 3VNQA 3RF7A 5KTMA 3CMMA 4MSUA 4IUDS 5ADHA 1TM1E 2NVWA 2H2DA 3QJ5A 3RFVA 3EVDA 2OQ2A 4KQMA 1RCTE 4LXHA 2IU0A 3AY3A 4QPNA 3WAGA 2MOKA 3VTAA 4DMGA 5BMOA 3AY6A 1RBYA 1RLUA 2R4QA 2CVPA 4JX9A 3C87A 5BSRA 3HYRA 1XLTA 1H05A 2BBOA 1JJVA 3HCBA 5JYBA 3RKSA 3TQIA 4PYJA 2DWOA 3COPA 3UXEA 2HC9A 4C87A 4I46A 1FU4A 1BTOA 3ROQA 1MXFA 3O0DA 3EGVA 3TCKA 1W49A 4DWOA 1ZD8A 2QNRA 4U8HA 4MI3A 1RJ9A 1JAHA 4ZQCB 2JJQA 5A06A 1I80A 4IAOA 4W8OA 2OC9A 3N3BC 3VDMA 1BFUA 2ODPA 1NW5A 3D4NA 4F6LA 4KPYA 4CM7A 1TCCA 2ZRKA 3PNPA 3HSYA 1NONA 4XB1A 2CNNA 3NT4A 4N5IX 4CN9A 2HA2A 2NAFA 1H3FA 1M1YE 3A6HA 5COBA 4CNBA 5LDDC 2WMDA 1VFNA 1Q7TA 1UBFA 4IBOA 4YROA 1KO5A 4U2DA 3TTYA 5DXJA 1BRMA 1WCXA 3LLVA 4NBRA 4YACA 5U1PA 3CA8A 2OK8A 1SIWA 2IYNA 1OLSB 1L5HA 1A04A 4F5WA 3DBHB 4AC9A 4Z3OA 4PV7A 2G5GX 1IG0A 4JBNA 4KO4S 5H70A 1FA9A 5HS4A 5JZVA 3ZEAA 3CX8A 4EFLA 5T6MA 2BGNA 3CKMA 3D8HA 1PD1A 5E2BA 3UPTA 3HABA 3VZBA 1Q19A 2E48A 1GFIA 3PJGA 3R9IA 4CKBB 3EVCA 2VP9A 2OFFA 2RJ3A 5EN4A 1MMFB 2FZVA 1DBSA 1V2HE 4QFCA 1AM4D 3W1VA 1KOFA 4QAQA 1UPAA 2FRDA 2VYFA 3UWPA 2G77B 2R6ZA 4KXWA 4RLSA 4YEDA 4FZVA 1AKMA 1Q74A 2QZZA 4HWOA 3E9EA 4KE7A 1I4TD 3GDOA 1P44A 3WB9A 4BNUA 1NA5A 2BUAA 3Q85A 2O8BB 2UZ1A 3EZXA 2FP4A 1KMHA 1O4WA 3DEYX 3K9LA 4DM4A 2IU4A 4ZJUA 1Q77A 3QGMA 5FH9A 1B8UA 1FB5A 3KJXA 1FFCA 3HFRA 5IAGA 1YE8A 1E1CB 2G1KA 2IHYA 4REOA 3RABA 5EJ8A 3OKFA 3PTAA 2VJCA 2A14A 1CZNA 3K35A 2PKCA 1G60A 3MD0A 4B3BA 2VQSA 4GLJA 1FS5A 1T1SA 3HM9A 3QEMB 5ALDA 2XOKD 3KSZO 4JEUA 3H0EA 2ID8A 1WMBA 2AEJA 4MCAA 3OQIA 3FHOA 1UMDB 2VLIA 3QYAA 5SY4A 2P4QA 3ZHOA 4F84A 1OLOA 4PX2A 5JS6A 1K6IA 2A0KA 1P1RA 2H2GA 3L8DA 1M8PA 4JR2A 1XMJA 2G9VA 3HXLA 4NMMA 3V9AA 3VPHA 1MHPA 2LKDA 4UHHA 1F17A 3EBOA 3M81A 3C3EA 4X84A 2VO1A 5FKJA 1U2EA 4NE2A 5TQ0A 4NYMR 3IH5A 1SZCA 1PJ8A 3AOEC 2I3GA 2WTMA 1A72A 4I3HA 3H6HA 3A4IA 1NSYA 2QN7A 1FPMA 4FHEA 4J8PA 4WHMA 3H9JA 1XVLA 4BU0A 2GPTA 3BMNB 3IVGA 3OESA 2NVUB 4Z86A 1YULA 3W9UA 1B73A 5TXGA 5HM8A 4QFDA 2O52A 3ICCA 5AKYA 2R8OA 2BM1A 1XK6A 3CWCA 2JC3A 2Q4DA 3H5LA 3LBYA 4FZRA 4P7GA 2R1VA 4IJUA 1JFFB 4M1EA 4QZVA 1HE8B 3ILYA 4CIYA 1A7UA 4M8IA 5ENZA 4NCAA 3UOWA 2JIZA 4YPVA 1BXKA 4AVYA 2VATA 3Q40A 4G0PA 1T9GS 2HBYA 3QLVA 5JQGB 1RLMA 5FPSA 3MF4A 4HVCA 4POAA 3IQIX 2QRQA 1VI6A 4KR0A 1YRAA 4I50A 4OEHA 4O4LF 4M46A 5CFZA 3R9XB 3EWNA 1H94A 1PL8A 4HX2A 3UFXA 3DZJA 3DF9A 3RG2A 2VAMA 2G82A 3LTEA 5IG2A 2V1UA 3K73O 3H1FA 3GVPA 3U4QA 1CP3A 1NV9A 2PZBA 1VYVA 4YMSA 3A06A 1VYTA 1SCQA 5IDWA 1XAGA 4LHZA 5D6NA 5KVVA 2EQBA 3PXDA 3ZZNA 1RMQA 1I32A 1RPJA 2FN9A 4P31A 2JLUA 2N9UA 1G5RA 3S2ZA 2AQHA 2YC4C 1J07A 4G56A 1W2HA 3KKOA 4QUDA 1IK4A 4BO6A 4WN9B 1LD3A 3V3TA 4FN5A 2FPPA 3QWIA 4J0FA 4RA6B 3L8GA 4GYJA 5LQSA 4DABA 4DGSA 4LOLA 4E5MA 3OM0A 4QU9A 5C4MA 2PU5A 5JZ9A 1UKCA 4D9JA 2PUBA 2FRVA 3K92A 2FPLA 3P9PA 3TI7A 3UJAA 1X3LA 3AF6A 4RH1A 2RK3A 5FWYB 2C0CA 3AU9A 4D74A 5BSHA 5LMZA 3FJ1A 3VJKA 2WPNA 4LTDA 4WASA 2NO4A 1K5DA 3G5AA 1BH2A 1DAEA 4LFAB 5CT4A 3ZBPA 3Q3EA 3LKVA 4PTYA 4XX1A 2GZDA 3IJRA 2BZSA 4GKJB 1U8TA 4Q3CA 2ZB7A 1QONA 3FZQA 2GLXA 3RVLA 4HDCA 1E1LA 4YJDA 2PANA 1FUUA 1O5IA 4AZWA 1O58A 4DIEA 1AOXA 1BE0A 1T4CA 4BAGA 2P41A 5KYGA 3K0AA 1UKAA 2QVXX 1U99A 4LOHA 4YLGA 1OIWA 1IJFA 4GM4A 5DCUA 4IXMA 4ZOLF 4MI6A 5K3DA 4HNQA 4QGAA 1JLHA 4HWPA 4EZIA 1VG9B 1JKJB 2FDRA 3OAAD 4MP6A 4DAOA 2JI6A 1KR5A 3ICVA 3PUKA 4AFNA 4B48A 1Y5IA 4BS9A 1NPTO 1T36B 1FVFA 2WQ7A 4YJKA 1G8FA 3C1TA 1ETHA 3ROPA 4ARCA 1F06A 2H9YA 3B5IA 4FMPA 3WXMA 2JFQA 2YVUA 3E22B 3L01A 1DRUA 4PHTA 1TRKA 2SKDA 4YLYA 2QJOA 1UEXC 2WILA 3G0GA 3TD9A 3WS7A 3BAZA 2PVCA 4G85A 3ZV4A 4LWOA 4M1TA 4WEOA 2OQRA 4RJLA 3ZN2A 4BO0A 2R1UA 3BE4A 1G21B 2VR1A 2HJGA 3QEJA 3BTSA 4IDFA 3HZOA 5TB5A 2O8CB 3NTQA 2O5CA 4HLQB 4XDYA 2WK1A 4DLZA 1CQPA 2DERA 3VHQA 4D4IA 2CLSA 4G41A 4B6EA 4KQKA 3QVUA 4HMOA 3G6WA 4RNDB 3MGBA 1D2CA 2BP7B 1E1RA 5BN5A 3HVUA 3IVAA 1ECLA 3RV4A 4LRSB 4HGPA 1B6RA 5FFMA 1UJ2A 2F1KA 1LX6A 2DPGA 3DKKA 4GM0A 3GFFA 1MX1A 3FOZA 2WSYB 3BD7A 1P60A 2JGDB 4K9MA 1AC5A 4Z4GA 1C8BA 1D2HA 3JATB 1NPYA 5AM1A 5EWJA 5KB3A 3ROMA 2ZBFA 3MJCA 5F77A 1G20E 4P33A 5DSTA 1AKYA 4AQDA 1HNNA 1PTKA 3H5TA 3RRNA 4EG7A 1S7CA 3PKZA 3BWCA 1VLJA 1J42A 2HKIA 3HY4A 4YJFA 3EIHA 2BGWA 5J23A 4WOCA 1OAOC 4LK3A 5C2JB 3KETA 4D4HA 3MRVA 3FTQA 5EL0A 3HCOA 4O63O 3GLFA 3UT5A 3I8OA 1OBOA 2XB9A 3KOXA 4CCSA 2RI6A 5FUWA 3K6SB 1XAJA 2P9EA 3V2IA 1I1OA 3NC0C 2D62A 5ENVA 4JV5B 5J4HA 2WJPA 4KDEA 2VAWA 5I48A 1RIFA 1EJ0A 2NU8B 1P1KA 1PEKE 1I33A 4PRYA 2VZ0A 3V1MA 3ROKA 2YV4A 2W8ZA 4ND8A 1H3EA 4Y67A 1S9DA 1KDRA 3X43A 2V8OA 2IHTA 1OXKB 3D8UA 3H5NA 3L79A 3CY6A 4MRAA 5I3ZA 2TYSB 1M76A 1XU7A 5AHKA 3B6ZA 2K2WA 3LDFA 2DUNA 2JGEA 3DNPA 1SVMA 5EE9A 2IS6A 2G17A 1E89A 2BR4A 1KQPA 4BX2A 5BQFA 3L7MA 4DIBA 4HNUA 1PNVA 1SUSA 2YX1A 3PIRA 4DN6A 1EFRA 4LC1A 3KAJA 3CZ5A 3A6FA 1VHWA 2WYWA 2DBRA 1CW2B 4JYPA 4YYEA 5ADVA 5H3HA 4E3WA 3SNHA 2W6CX 4A10A 2WJ4A 2YNMA 3OPYA 4K86A 4WIAA 1TYCA 1JHPA 1IUOA 2BUCA 1WV1A 3UTDA 2HIGA 4ZO9A 1Y8CA 3NALA 2WTEA 3UWDA 2PH3A 3L07A 1XKXA 4GHWA 2QJRA 1QTRA 4PSVA 5K6AA 3LIIA 4LGVA 4OYRA 3U17A 2I9KA 4UEWA 1SFRA 3NASA 5IK2D 2HRCA 4X60A 1B0UA 1UDBA 1ZKMA 3FPAA 3Q2OA 4E5NA 2H3EA 3OQJA 4HH1A 4EWLA 2BGKA 3A9RA 3MUNA 3QX3A 3AVUA 4P08A 1HWYA 2D4AA 5A3RA 4W9MC 1AGRA 2R8ZA 2ZRJA 4DCNA 1Z17A 3MGKA 4IDQA 3D6FA 4ALNA 1YUMA 2L17A 4ES6A 5LZ9A 2E4VA 4V39A 4Z0PA 1J0EA 5CB6A 1XTTA 4L15A 3GJ5A 1DKUA 5IVIA 3WWZA 4YRCA 2ONCA 1PFVA 2PHZA 3DFZA 3L43A 1A0OA 1DEAA 2QA5A 4LNAA 1Y9EA 2ZETA 2B7LA 3BXHA 4KQGA 1T6YA 4MDHA 4U9HS 3T5GA 1XKTA 1FIUA 4G09A 3HTXA 3ROEA 1D6SA 2PWPA 2XTJA 1JQDA 2Q5CA 3AUFA 3L0DA 5A9TA 5I9IA 1ZHOA 4CIXA 2J31A 2YUTA 3B52X 4JCCA 4K0KB 1XZNA 1Z6YA 5L6LB 1RACA 3NHFA 3SYLA 3TQCA 2FJ0A 4HN2A 4DWJA 1NOJA 1RT9A 5KQPA 3B51X 5CFNA 2SHKA 3IKJA 3RCBA 3HJHA 1CNEA 2OM6A 2RG7A 2Y67A 2QQFA 1Q21A 3PIDA 3QTTA 5E7JA 4IX9A 4X20B 4Z4IA 1RYZA 4R1PA 1W581 1GZHB 4N6NA 2CSUA 1KI6B 4GXQA 4XCXA 3DV0A 1DKQA 4QRHA 1MC1A 4R3UC 3KX2A 2FMIA 4U3JB 4N03A 1UKEA 1X7ZB 2RJOA 3Q6MA 5AI8A 2ECQA 3GFTA 4BE7B 4NMWA 4DT1A 1E0DA 1UC8A 3FOFC 3T8YA 4PG7A 1N2IA 2XUAA 3V1YA 2QNBA 4CGZA 2B4KA 3WB2A 2I7XA 1ADFA 1XHFA 1OPXA 1Y34E 2CHFA 5CYOA 3RC7A 3ZKAA 4KXUA 2Y6VA 2G36A 3P2EA 2P2CA 5DN9A 1V8PA 3CS3A 4RV5A 4NATA 4BP9A 4ECEA 4JI2B 1MZVA 3DFFA 3EDRA 5DVZA 3PGJA 2V6MA 3EUFA 1AMNA 4CUZA 1JJ7A 2BWJA 3R2JA 4ZHQF 2B6NA 2F3SA 5EP3A 2V97A 3B9QA 3ZDDA 3QBVA 2HW8A 1XDWA 2AN1A 4ZYXA 4F85A 3HM2A 1ZBDA 3KWLA 3TLCA 3B1WA 4Q12A 2NP7A 2NN3C 1Y8RA 5M29A 1NJ1A 1P9RA 3IGFA 4C0HA 5L3VA 1IVNA 3CLTC 5JS1A 4PS1A 1ZSNA 4B3CA 5LZ2A 1R8JA 4JMLA 4FLMA 4KV7A 3FJYA 2Q8PA 3LP6A 3E3MA 2K6GA 4XX0B 4A8JB 2PUGA 3HS3A 5CFRA 5EIXA 5BUCA 4C9BA 5B2ZA 5TJHA 5HRUA 3QUBA 5B1HA 1XPOA 2OWDA 4DRYA 1PV1A 2XNDA 2QUAA 2JHFA 2WSIA 2ZITA 1JKFA 2H0AA 3AEUB 3ROXA 3RIMA 5JH7A 4FFBA 4OX9B 2Y8EA 2IYVA 4LRQA 4WPGA 3ZDXB 3LZ6A 1RKVA 2EZ8A 1CRZA 3K20A 4E1VA 1Y4AE 4OHZA 1JU3A 1ZU4A 3RVRA 4UMDA 3DE7X 4HAIA 1UKYA 3MHTA 2GASA 4NXMB 5HTKA 4LXIA 1UM9B 3A6EA 4F1WA 4YUZA 4HNHA 4ZJYA 1QZTA 3DTVA 4WFKA 2O7SA 1UXIA 1L7MA 4M9ZA 4OJQA 2ZYVX 2I6QA 3AFIA 3H87A 3TXAA 5KPJA 2ZAIA 1YRWA 2MMCA 1GCAA 1EM8B 3OT5A 3HXMA 1WW3A 3BK2A 5P8WA 3KSRA 3KRTA 2J9YB 3QKRA 4MR8B 5AVOA 1RXCA 3H13A 2QENA 3KBBA 3KKKA 4QYIA 4ZVUA 1E2PA 4KXNA 2RGEA 2WA2A 3OLWA 3KC2A 4MLDA 1XPJA 3AR5A 4PYLA 1JPUA 5AXDA 1GYRA 4D9CA 1ZUNA 4OJMX 5D2CA 1V9CA 4IHJA 1Z75A 2O3RA 3K0CC 1FNMA 2R7NA 4UATA 2NXEA 5JUWA 3TYXA 1AS2A 1A4IA 1DBVO 1SBTA 2FF5A 5HKKD 4B7XA 3WRVA 4FHDA 2C2GA 2A9RA 2VHJA 3FUWA 4NBTA 1JA0A 4IH4A 1KDZA 2BI4A 3SHQA 3WMFA 3H5OA 3NBZC 4W9RA 3PEWA 2YWCA 1RAHA 3IP8A 3SE7A 2XA1A 4Z7NB 3VZRA 1UODA 4F3NA 4M9SA 3LM8A 4RJKA 2IDJA 1P0PA 5HGXA 3TB4A 1P9WA 3KTAB 2OZPA 4JN6B 1N6OA 5REQA 5L7TA 2AX4A 4IUBS 2XSZD 4GYKA 1E1YA 3LPLA 2J3KA 1OZHA 1YDGA 3L06A 4IJVA 4NSNA 5CRIA 3VAAA 2ROQA 3MM4A 1PF7E 3DVAA 1VPWA 3IIKA 2I2FA 1C3LA 4UBNA 1D4AA 4F4JA 3ESDA 4M3NA 4WACA 4MLZA 1YZTA 2ODEA 1JDUA 4U7HA 5DWDA 4OL9A 1F6BA 3EGIA 4L4SA 4BVLA 4YAGA 5BNWA 3OD5A 1JEOA 3MG9A 1DNPA 1FTSA 4KKVA 2WWWA 3OU6A 4TL8A 2GM4A 2BFEB 1QNLA 4PG5A 1CVRA 1VG0B 1Y3HA 1I0IA 2VHEA 3N07A 4JJZA 2DP4E 1NU6A 1AT1A 5IBQA 4US2R 3AFGA 1TAUA 3PIIA 3CH7A 5DCWA 3L0PA 1MR3F 1EJBA 4DYHA 4WWHA 4R81A 1ZJZA 1HFEL 2F6RA 3HP1A 4LJYA 1JBKA 1IM8A 2CDNA 4GKBA 4PPFA 1G8GA 4Z9BA 4JBIA 2VSQA 4QREA 1Y6FA 1QVVA 3EF0A 1KI2A 1CP2A 1PQUA 4B3IA 5LXTB 4PYKA 4Y2SA 3VPDA 3HJTA 5AVKA 2J6BA 4RPIA 3GPDG 2CNBA 1L4LA 4NYIQ 2XIQA 3IQGX 5A0VA 1Q1QA 2G09A 1Y0BA 2P2ZA 3D5TA 3GBVA 1NULA 3RLIA 3THYB 4P36A 2JNWA 1I9CA 1T1EA 1TGYA 1E18A 1BXGB 4OHWA 1WBBA 1EQAA 2XMZA 2BEVA 2Q49A 5C8YF 1INLA 4IJ5A 3ENVA 4KFRA 4WQMA 3KKZA 3MUEA 1FP2A 1THTA 1ZHHA 4NMHA 4URVR 1N3LA 3KLOA 1MQ8B 6REQB 5EJEA 5JCJD 5K0TA 4KQ1A 3SJUA 1KO4A 1ESEA 1X1TA 3TUJC 2ZI5A 3DONA 2O8NA 1F9EA 1LF5A 4XR9A 1IEXA 1TCUA 2ZUCA 3GWGA 4Q3LA 2IYWA 1CF4A 4KWIA 2QUBA 1BFDA 1J8DA 3ED1A 3T7DA 2HMUA 2QM0A 3U26A 4O4LB 3E61A 4RETA 2H0QA 1UZAA 4DA0A 4RDXA 3ZIAA 4F12A 2FH5B 2IOYA 1SWWA 4CPDA 2P4SA 1CKEA 4K9OA 5HE9A 5KC9A 4D44A 2ZB2A 5EC8A 3I04A 1R10A 3LLCA 1NIJA 1XR3A 4WJLA 3DHWC 3U3XA 5HJ2A 5EY5B 2IOQA 3HPRA 3LDHA 1N0UA 2R1VB 3EDCA 2HL6A 3G0DA 1N6NA 3I53A 3R9WA 5KTNA 5LA6A 3MJFA 1SVNA 1UMCA 3I28A 1TUBA 4RF3A 3VNUA 2P69A 3BMNA 3D5EA 3MWDA 4WESB 2D54A 3LPMA 5EWMB 4EUFA 4BVFA 1E61A 2XDWA 2FZ5A 2FF7A 1NBME 1RMTA 1YQ9A 1HZZC 3G5TA 3HKCA 5REQB 2HGSA 3U9LA 4JNKA 3OE1A 4DUGA 5LKAA 4K9QA 3Q7IA 3SYKA 3KU1A 1T1JA 1Y1SA 2P30A 1QGYA 4JDPA 2X76A 4KLRA 4LYGA 1AO3A 4FHZA 3L0CA