3D5RA

Crystal structure of efb-c (n138a) / c3d complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
297
structure length
297
Chain Sequence
b'GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 115
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3d5rA00
1O79A 2XWJB 1MZCB 2B39A 2ZIRB 3C72B 3HXEB 2WY7A 2WY8A 5JPNB 1O1RB 1SQCA 1H3BA 1N95B 1W6JA 2XWBB 3KQ4A 4D94A 4M76A 3DRAB 3PZ4B 3DPYB 4BOKA 2A73B 1TN6B 2XQWA 1W6KA 4EHMB 1N4QB 2R2LB 3OXUA 4LNGB 1JCQB 2G02A 4D4CA 5AGDA 3E32B 1GXMA 1TNUB 2NOJA 4MBGB 1KZOB 1JCRB 4ONTA 4ZH1A 2BEDB 1QQFA 2ZISB 1N4RB 1H36A 4C1SA 4ZRQA 3RJ3A 3K7XA 1O6HA 1D8EB 2H6GB 3Q7FB 4GTQB 1LD7B 3E34B 1D8DB 4GTRB 4ZRPA 3HXDB 3PZ2B 2SQCA 1N4PB 3DSWB 3E30B 4BOJA 3HXBB 2WIIB 1H3AA 4L9PB 4V1RA 3KLSA 1R76A 3DSSB 1SA5B 4GTMB 1TN8B 3D5RA 4GTTB 3SFYB 3G6JB 2I07B 4GTSB 5FO7B 4D4AA 5FO9B 3Q7AB 1TNBB 4GTOB 1N94B 1QSJA 2BBCA 2V3PA 1S64B 3DSVB 1GXOA 3Q75B 1FT1B 2H6HB 4KKIA 1FT2B 3KSLB 4YDOB 1TN7B 2H6IB 4KKJA 3PZ3B 2PN5A 3PZ1B 1NL4B 2V8KA 2PMVA 1O1SB 1O1TB 1GSZA 1DCEB 1LTXB 5FO8B 3SFXB 1GXNA 4FXKB 1UMPA 5JPMB 2F0YB 3CU7A 1NI1B 3D5SA 3SQCA 4MU9A 1H3CA 1QBQB 4GTPB 4LNVA 4D4DA 3OEDA 4YDEB 3DSUB 1TNYB 3HXFB 1GHQA 2BB5A 2H6FB 1TNOB 5FOBB 4GTVB 1S63B 3Q79B 3Q78B 3Q73B 4FXGB 2BB6A 1X81B 2IEJB 2G0DA 2V3NA 1TNZB 1KZPB 4LNBB 3E37B 1HZFA 2V8JA 1H37A 1C3DA 2V8IA 3HXCB 1JCSB 1FPPB 1H39A 3E33B 3EU5B 1O6RA 2GOXA 3EUVB 1LD8B 2WINB 1N9AB 4D4BA 3DSXB 4V1SA 3DSTB 1O5MB 1N4SB 1O6QA 1SA4B 1H35A 3KSQB
chains in the Genus database with same CATH superfamily
1O79A 1C82A 1MZCB 3C72B 5GW7A 2JF4A 2XWBB 3P5PA 3KQ4A 1OJMA 1RWGA 1L1YA 3VXDA 2XQWA 2D8LA 2EADA 1WU4A 5KKBA 5AGDA 3WUXA 1AYXA 4CE7A 4WU0A 4MBGB 4ZH1A 5ILDA 2BEDB 2D5JA 1VD5A 4DOEA 3W7SA 1V7VA 3WKFA 4C1SA 3SDVA 1L2AA 5EAUA 2SQCA 2WYNA 3DSWB 5DHIA 1GA2A 3W7UA 1F9OA 4TXTA 1KRFA 3WKGA 3D5RA 5EASA 4GTTB 1TF4A 2Z07A 3GZKA 2I07B 1NXCA 5M7IA 1TNBB 3M73A 3QDEA 3SDQA 4YDOB 3VSNA 2H6IB 1WU6A 1N24A 1DOGA 3M74A 2V8KA 2PMVA 3M78A 2DRQA 1O1TB 3SDTA 1DL2A 1GSZA 1J0MA 1K72A 1GAIA 1XWQA 3M71A 2X03A 1LF6A 4KTPA 4FXKB 1KREA 3QXQA 4DI5A 2F0YB 3CU7A 5ILZA 3K11A 4Q88A 2DRRA 3RRSA 3W7WA 4GTPB 3W5NA 1XWTA 3ANJA 4JJJA 1V5DA 1RW9A 4FNVA 2DRSA 4OK4A 1V7WA 4GTVB 1S63B 4YCRA 3Q73B 1X81B 3WIWA 2F6DA 2G0DA 1KZPB 3CIHA 2V8JA 3N0GA 1LXKA 1JCSB 1O6RA 3ANKA 2BRPA 3M01A 1N9AB 5DGQA 5IKHA 1H54A 4J5TA 1O6QA 3QT9A 4FJQA 5IK0A 5CD2A 5ILKA 3S4DA 3ANIA 2WY7A 1FBOA 5DHKA 1H3BA 1HV6A 4D94A 5IKAA 3DRAB 3PZ4B 2XFGA 1TN6B 5ILIA 3M7BA 4FUSA 4LNGB 1JCQB 4KTRA 1TNUB 1KZOB 5ILJA 4OJZA 2B4FA 3NFVA 1H36A 2ONHA 2EACA 4ZRQA 1IA7A 4AYQA 1O6HA 4GTQB 1LD7B 3E34B 1D8DB 3WIRA 1HXCA 1N20A 3HXDB 3QWTA 1OJNA 3PZ2B 1OJPA 1OJOA 3DSSB 2OKXA 2RI8A 3RENA 2FV0A 5IL3A 4GTSB 2E24A 3RX5A 3ACSA 5JMFA 5GY3A 3SDRA 1LOHA 1X1JA 4E1YA 4GTOB 1QSJA 1S64B 1GXOA 2RGKA 1FT1B 1FT2B 1LF9A 1TN7B 3S4AA 3EU8A 1G6IA 1H14A 1EGUA 3PZ3B 1IS9A 3EZ8A 4DODA 1G87A 4AYOA 1ULVA 5EATA 5IK6A 2GZ6A 3E80A 2P0VA 2FV1A 3GT5A 3D3IA 3E7JA 3SDUA 5FO8B 5ILHA 4F10A 3VW5A 5IL8A 1N7QA 1RQ5A 1KS8A 3A3VA 1NI1B 2ZZRA 4AYRA 3QFZA 3D5SA 1H3CA 4LNVA 1CB8A 3OEDA 2BB5A 1FO3A 1TNOB 1FO2A 3Q78B 2JG0A 3RSYA 2BB6A 1FAEA 4WVBA 4LNBB 1N23A 3QPFA 1H37A 1C3DA 3HXCB 3M72A 5CZLA 4ZG8A 5ILYA 2GOXA 3TF4A 1FP3A 1LD8B 4NEIA 1HMUA 5M7YA 4WVCA 1CEMA 3G4FA 1N4SB 3WC3A 1SA4B 1V7XA 1H35A 4CJ1A 2B39A 4Z4LA 2ZIRB 1J0NA 2WY8A 5JPNB 1O1RB 1SQCA 1N95B 2CQTA 3M7EA 1FBWA 4M76A 3DPYB 3S4CA 2A73B 4F13A 3P2CA 1RWAA 1N4QB 3OXUA 4OZVA 4D4CA 3LZ9A 1GXMA 1HXAA 2NOJA 4ONTA 2GH4A 2ZISB 3QG0A 1X9DA 3M7CA 3G4DA 3M77A 4ZRPA 1KSDA 4RNQA 5DGRA 2WDAA 4BOJA 3E30B 3HXBB 2WIIB 1H3AA 3KLSA 1SA5B 1TN8B 3M75A 3G6JB 2FBAA 1KWFA 1X1HA 4D4AA 5FO9B 1GLMA 1HX9A 5GZKA 1X1IA 3AFLA 4XUVA 2VN4A 3PYAA 4L0GA 3Q75B 3S4BA 3DSVB 4KKIA 4OZWA 2CQSA 4KKJA 3W7XA 1N7RA 2PN5A 3PZ1B 1NL4B 1XW2A 1O1SB 4AYPA 2DROA 2AFAA 1DCEB 2FUTA 1IA6A 3PYBA 3SFXB 4QT9A 5IM1A 3RX7A 1UMPA 3H7LA 2BRVX 2A8ZA 4LIXA 3WKHA 2FUQA 3ON6A 3QT3A 4MU9A 5MEHA 4D4DA 1N1ZA 4YDEB 1TNYB 3M7LA 2E22A 3HXFB 3M00A 3X17A 5CA3A 1AGMA 3H3KA 1HN0A 4FXGB 3S9VA 4L6XA 2V3NA 1JS4A 1TNZB 4ZH5A 3M76A 1HZFA 1H12A 3NNBA 1UG9A 1HM3A 1KFGA 3E33B 3EU5B 3EUVB 3N0FA 4TF4A 2WCOA 2WINB 5E2JA 4CJ0A 1N7NA 4V1SA 3DSTB 1O5MB 1RWFA 2ONGA 3GLYA 3QFYA 2RI9A 2XWJB 4Z4JA 3HXEB 2YIKA 3A0OA 1W6JA 5IK9A 4BOKA 4OK2A 1W6KA 3WIQA 4EHMB 1N7PA 2R2LB 2G02A 3P5RA 3E32B 2JJBA 3W7TA 1RWHA 1NC5A 1JCRB 1LXMA 1CLCA 1HM2A 1QQFA 4EL8A 1H13A 1N4RB 1F9DA 3RJ3A 3K7XA 1D8EB 2H6GB 1I8QA 3Q7FB 2AHGA 4GTRB 1N4PB 4L9PB 1N21A 1WZZA 4V1RA 1R76A 3WKIA 1RWCA 3AFJA 4GTMB 1KSCA 1HCUA 3SFYB 4MMIA 5FO7B 3Q7AB 1N94B 2BBCA 2V3PA 2H6HB 2VN7A 3KSLB 2EABA 2Q1FA 2BRWA 4Q2BA 1HMWA 1LTXB 2ZBLA 1GXNA 1N1BA 5JPMB 3H2WA 1G9GA 1QAZA 4GL3A 3SQCA 1UT9A 4MMHA 3QRYA 3W5MA 1QBQB 2QNOA 2AHFA 3T33A 1FCEA 3DSUB 3RX8A 3E6UA 1GHQA 2H6FB 5FOBB 1KKTA 3SAEA 3Q79B 1HXGA 1WU5A 2J5CA 2IEJB 2NVPA 1F1SA 1N7OA 3QXFA 2EAEA 3E37B 5C05A 3PMMA 1V5CA 1G9JA 3E73A 2V8IA 3ACTA 1FMIA 1FPPB 1H39A 4GAXA 3VSMA 1F9GA 3QSPA 3EQAA 5JMDA 4D4BA 1GAHA 3DSXB 1W3YA 3M02A 1N22A 4WVAA 2FUZA 3KSQB
chains in the Genus database with same CATH topology
1O79A 1MZCB 3C72B 5GW7A 2JF4A 2XWBB 3P5PA 3KQ4A 1L1YA 3VXDA 2XQWA 2D8LA 2EADA 1WU4A 5KKBA 5AGDA 3WUXA 1AYXA 4CE7A 4WU0A 4MBGB 4ZH1A 2BEDB 2D5JA 1VD5A 4DOEA 3W7SA 1V7VA 3WKFA 4C1SA 3SDVA 1L2AA 2SQCA 2WYNA 3DSWB 1GA2A 3W7UA 1F9OA 4TXTA 1KRFA 3WKGA 3D5RA 4GTTB 1TF4A 2Z07A 3GZKA 2I07B 1NXCA 5M7IA 1TNBB 3M73A 3QDEA 3SDQA 4YDOB 2H6IB 1WU6A 1DOGA 3M74A 2V8KA 2PMVA 3M78A 2DRQA 1O1TB 3SDTA 1DL2A 1GSZA 1K72A 1GAIA 1XWQA 3M71A 1LF6A 4KTPA 4FXKB 1KREA 3QXQA 2F0YB 3CU7A 3K11A 4Q88A 2DRRA 3RRSA 3W7WA 4GTPB 3W5NA 1XWTA 3ANJA 4JJJA 1V5DA 2DRSA 1V7WA 4GTVB 1S63B 4YCRA 3Q73B 1X81B 3WIWA 2F6DA 2G0DA 1KZPB 3CIHA 2V8JA 1JCSB 1O6RA 3ANKA 1N9AB 5DGQA 1H54A 4J5TA 1O6QA 3QT9A 5CD2A 3S4DA 3ANIA 2WY7A 1FBOA 1H3BA 4D94A 3DRAB 3PZ4B 2XFGA 1TN6B 3M7BA 4FUSA 4LNGB 1JCQB 4KTRA 1TNUB 1KZOB 2B4FA 1H36A 2EACA 4ZRQA 1IA7A 4AYQA 1O6HA 4GTQB 1LD7B 3E34B 1D8DB 3WIRA 3HXDB 3QWTA 3PZ2B 3DSSB 2OKXA 2RI8A 3RENA 2FV0A 4GTSB 3RX5A 3ACSA 5GY3A 3SDRA 4GTOB 1QSJA 1S64B 1GXOA 2RGKA 1FT1B 1FT2B 1LF9A 1TN7B 3S4AA 3EU8A 1G6IA 1H14A 3PZ3B 1IS9A 3EZ8A 4DODA 1G87A 4AYOA 1ULVA 2GZ6A 2P0VA 2FV1A 3GT5A 3D3IA 3SDUA 5FO8B 3VW5A 1RQ5A 1KS8A 3A3VA 1NI1B 2ZZRA 4AYRA 3QFZA 3D5SA 1H3CA 4LNVA 3OEDA 2BB5A 1FO3A 1TNOB 1FO2A 3Q78B 2JG0A 3RSYA 2BB6A 1FAEA 4WVBA 4LNBB 3QPFA 1H37A 1C3DA 3HXCB 3M72A 5CZLA 4ZG8A 2GOXA 3TF4A 1FP3A 1LD8B 5M7YA 4WVCA 1CEMA 1N4SB 3WC3A 1SA4B 1V7XA 1H35A 4CJ1A 2B39A 4Z4LA 2ZIRB 2WY8A 5JPNB 1O1RB 1SQCA 1N95B 2CQTA 3M7EA 1FBWA 4M76A 3DPYB 3S4CA 2A73B 3P2CA 1N4QB 3OXUA 4D4CA 1GXMA 2NOJA 4ONTA 2GH4A 2ZISB 3QG0A 1X9DA 3M7CA 3M77A 4ZRPA 1KSDA 5DGRA 4BOJA 3E30B 3HXBB 2WIIB 1H3AA 3KLSA 1SA5B 1TN8B 3M75A 3G6JB 2FBAA 1KWFA 4D4AA 5FO9B 1GLMA 5GZKA 4XUVA 2VN4A 3PYAA 4L0GA 3Q75B 3S4BA 3DSVB 4KKIA 2CQSA 4KKJA 3W7XA 2PN5A 3PZ1B 1NL4B 1XW2A 1O1SB 4AYPA 2DROA 2AFAA 1DCEB 1IA6A 3PYBA 3SFXB 4QT9A 3RX7A 1UMPA 3H7LA 2A8ZA 4LIXA 3WKHA 3ON6A 3QT3A 4MU9A 5MEHA 4D4DA 4YDEB 1TNYB 3M7LA 3HXFB 3X17A 5CA3A 1AGMA 3H3KA 4FXGB 3S9VA 4L6XA 2V3NA 1JS4A 1TNZB 4ZH5A 3M76A 1HZFA 1H12A 1UG9A 1KFGA 3E33B 3EU5B 3EUVB 4TF4A 2WINB 5E2JA 4CJ0A 4V1SA 3DSTB 1O5MB 3GLYA 3QFYA 2RI9A 2XWJB 4Z4JA 3HXEB 2YIKA 1W6JA 4BOKA 1W6KA 3WIQA 4EHMB 2R2LB 2G02A 3P5RA 3E32B 2JJBA 3W7TA 1NC5A 1JCRB 1CLCA 1QQFA 4EL8A 1H13A 1N4RB 1F9DA 3RJ3A 3K7XA 1D8EB 2H6GB 3Q7FB 2AHGA 4GTRB 1N4PB 4L9PB 1WZZA 4V1RA 1R76A 3WKIA 3AFJA 4GTMB 1KSCA 1HCUA 3SFYB 5FO7B 3Q7AB 1N94B 2BBCA 2V3PA 2H6HB 2VN7A 3KSLB 2EABA 4Q2BA 1LTXB 2ZBLA 1GXNA 5JPMB 3H2WA 1G9GA 4GL3A 3SQCA 1UT9A 3QRYA 3W5MA 1QBQB 2QNOA 2AHFA 3T33A 1FCEA 3DSUB 3RX8A 3E6UA 1GHQA 2H6FB 5FOBB 1KKTA 3SAEA 3Q79B 1WU5A 2IEJB 2NVPA 3QXFA 2EAEA 3E37B 3PMMA 1V5CA 1G9JA 3E73A 2V8IA 3ACTA 1FMIA 1FPPB 1H39A 3QSPA 3EQAA 4D4BA 1GAHA 3DSXB 4WVAA 2FUZA 3KSQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O79 A;  2XWJ B;  1MZC B;  2B39 A;  2ZIR B;  3C72 B;  3HXE B;  2WY7 A;  2WY8 A;  5JPN B;  1O1R B;  1SQC A;  1H3B A;  1N95 B;  1W6J A;  2XWB B;  3KQ4 A;  4D94 A;  4M76 A;  3DRA B;  3PZ4 B;  3DPY B;  4BOK A;  2A73 B;  1TN6 B;  2XQW A;  1W6K A;  4EHM B;  1N4Q B;  2R2L B;  3OXU A;  4LNG B;  1JCQ B;  2G02 A;  4D4C A;  5AGD A;  3E32 B;  1GXM A;  1TNU B;  2NOJ A;  4MBG B;  1KZO B;  1JCR B;  4ONT A;  4ZH1 A;  2BED B;  1QQF A;  2ZIS B;  1N4R B;  1H36 A;  4C1S A;  4ZRQ A;  3RJ3 A;  3K7X A;  1O6H A;  1D8E B;  2H6G B;  3Q7F B;  4GTQ B;  1LD7 B;  3E34 B;  1D8D B;  4GTR B;  4ZRP A;  3HXD B;  3PZ2 B;  2SQC A;  1N4P B;  3DSW B;  3E30 B;  4BOJ A;  3HXB B;  2WII B;  1H3A A;  4L9P B;  4V1R A;  3KLS A;  1R76 A;  3DSS B;  1SA5 B;  4GTM B;  1TN8 B;  3D5R A;  4GTT B;  3SFY B;  3G6J B;  2I07 B;  4GTS B;  5FO7 B;  4D4A A;  5FO9 B;  3Q7A B;  1TNB B;  4GTO B;  1N94 B;  1QSJ A;  2BBC A;  2V3P A;  1S64 B;  3DSV B;  1GXO A;  3Q75 B;  1FT1 B;  2H6H B;  4KKI A;  1FT2 B;  3KSL B;  4YDO B;  1TN7 B;  2H6I B;  4KKJ A;  3PZ3 B;  2PN5 A;  3PZ1 B;  1NL4 B;  2V8K A;  2PMV A;  1O1S B;  1O1T B;  1GSZ A;  1DCE B;  1LTX B;  5FO8 B;  3SFX B;  1GXN A;  4FXK B;  1UMP A;  5JPM B;  2F0Y B;  3CU7 A;  1NI1 B;  3D5S A;  3SQC A;  4MU9 A;  1H3C A;  1QBQ B;  4GTP B;  4LNV A;  4D4D A;  3OED A;  4YDE B;  3DSU B;  1TNY B;  3HXF B;  1GHQ A;  2BB5 A;  2H6F B;  1TNO B;  5FOB B;  4GTV B;  1S63 B;  3Q79 B;  3Q78 B;  3Q73 B;  4FXG B;  2BB6 A;  1X81 B;  2IEJ B;  2G0D A;  2V3N A;  1TNZ B;  1KZP B;  4LNB B;  3E37 B;  1HZF A;  2V8J A;  1H37 A;  1C3D A;  2V8I A;  3HXC B;  1JCS B;  1FPP B;  1H39 A;  3E33 B;  3EU5 B;  1O6R A;  2GOX A;  3EUV B;  1LD8 B;  2WIN B;  1N9A B;  4D4B A;  3DSX B;  4V1S A;  3DST B;  1O5M B;  1N4S B;  1O6Q A;  1SA4 B;  1H35 A;  3KSQ B; 
#chains in the Genus database with same CATH topology
 1O79 A;  1C82 A;  1MZC B;  3C72 B;  5GW7 A;  2JF4 A;  2XWB B;  3P5P A;  3KQ4 A;  1OJM A;  1RWG A;  1L1Y A;  3VXD A;  2XQW A;  2D8L A;  2EAD A;  1WU4 A;  5KKB A;  5AGD A;  3WUX A;  1AYX A;  4CE7 A;  4WU0 A;  4MBG B;  4ZH1 A;  5ILD A;  2BED B;  2D5J A;  1VD5 A;  4DOE A;  3W7S A;  1V7V A;  3WKF A;  4C1S A;  3SDV A;  1L2A A;  5EAU A;  2SQC A;  2WYN A;  3DSW B;  5DHI A;  1GA2 A;  3W7U A;  1F9O A;  4TXT A;  1KRF A;  3WKG A;  3D5R A;  5EAS A;  4GTT B;  1TF4 A;  2Z07 A;  3GZK A;  2I07 B;  1NXC A;  5M7I A;  1TNB B;  3M73 A;  3QDE A;  3SDQ A;  4YDO B;  3VSN A;  2H6I B;  1WU6 A;  1N24 A;  1DOG A;  3M74 A;  2V8K A;  2PMV A;  3M78 A;  2DRQ A;  1O1T B;  3SDT A;  1DL2 A;  1GSZ A;  1J0M A;  1K72 A;  1GAI A;  1XWQ A;  3M71 A;  2X03 A;  1LF6 A;  4KTP A;  4FXK B;  1KRE A;  3QXQ A;  4DI5 A;  2F0Y B;  3CU7 A;  5ILZ A;  3K11 A;  4Q88 A;  2DRR A;  3RRS A;  3W7W A;  4GTP B;  3W5N A;  1XWT A;  3ANJ A;  4JJJ A;  1V5D A;  1RW9 A;  4FNV A;  2DRS A;  4OK4 A;  1V7W A;  4GTV B;  1S63 B;  4YCR A;  3Q73 B;  1X81 B;  3WIW A;  2F6D A;  2G0D A;  1KZP B;  3CIH A;  2V8J A;  3N0G A;  1LXK A;  1JCS B;  1O6R A;  3ANK A;  2BRP A;  3M01 A;  1N9A B;  5DGQ A;  5IKH A;  1H54 A;  4J5T A;  1O6Q A;  3QT9 A;  4FJQ A;  5IK0 A;  5CD2 A;  5ILK A;  3S4D A;  3ANI A;  2WY7 A;  1FBO A;  5DHK A;  1H3B A;  1HV6 A;  4D94 A;  5IKA A;  3DRA B;  3PZ4 B;  2XFG A;  1TN6 B;  5ILI A;  3M7B A;  4FUS A;  4LNG B;  1JCQ B;  4KTR A;  1TNU B;  1KZO B;  5ILJ A;  4OJZ A;  2B4F A;  3NFV A;  1H36 A;  2ONH A;  2EAC A;  4ZRQ A;  1IA7 A;  4AYQ A;  1O6H A;  4GTQ B;  1LD7 B;  3E34 B;  1D8D B;  3WIR A;  1HXC A;  1N20 A;  3HXD B;  3QWT A;  1OJN A;  3PZ2 B;  1OJP A;  1OJO A;  3DSS B;  2OKX A;  2RI8 A;  3REN A;  2FV0 A;  5IL3 A;  4GTS B;  2E24 A;  3RX5 A;  3ACS A;  5JMF A;  5GY3 A;  3SDR A;  1LOH A;  1X1J A;  4E1Y A;  4GTO B;  1QSJ A;  1S64 B;  1GXO A;  2RGK A;  1FT1 B;  1FT2 B;  1LF9 A;  1TN7 B;  3S4A A;  3EU8 A;  1G6I A;  1H14 A;  1EGU A;  3PZ3 B;  1IS9 A;  3EZ8 A;  4DOD A;  1G87 A;  4AYO A;  1ULV A;  5EAT A;  5IK6 A;  2GZ6 A;  3E80 A;  2P0V A;  2FV1 A;  3GT5 A;  3D3I A;  3E7J A;  3SDU A;  5FO8 B;  5ILH A;  4F10 A;  3VW5 A;  5IL8 A;  1N7Q A;  1RQ5 A;  1KS8 A;  3A3V A;  1NI1 B;  2ZZR A;  4AYR A;  3QFZ A;  3D5S A;  1H3C A;  4LNV A;  1CB8 A;  3OED A;  2BB5 A;  1FO3 A;  1TNO B;  1FO2 A;  3Q78 B;  2JG0 A;  3RSY A;  2BB6 A;  1FAE A;  4WVB A;  4LNB B;  1N23 A;  3QPF A;  1H37 A;  1C3D A;  3HXC B;  3M72 A;  5CZL A;  4ZG8 A;  5ILY A;  2GOX A;  3TF4 A;  1FP3 A;  1LD8 B;  4NEI A;  1HMU A;  5M7Y A;  4WVC A;  1CEM A;  3G4F A;  1N4S B;  3WC3 A;  1SA4 B;  1V7X A;  1H35 A;  4CJ1 A;  2B39 A;  4Z4L A;  2ZIR B;  1J0N A;  2WY8 A;  5JPN B;  1O1R B;  1SQC A;  1N95 B;  2CQT A;  3M7E A;  1FBW A;  4M76 A;  3DPY B;  3S4C A;  2A73 B;  4F13 A;  3P2C A;  1RWA A;  1N4Q B;  3OXU A;  4OZV A;  4D4C A;  3LZ9 A;  1GXM A;  1HXA A;  2NOJ A;  4ONT A;  2GH4 A;  2ZIS B;  3QG0 A;  1X9D A;  3M7C A;  3G4D A;  3M77 A;  4ZRP A;  1KSD A;  4RNQ A;  5DGR A;  2WDA A;  4BOJ A;  3E30 B;  3HXB B;  2WII B;  1H3A A;  3KLS A;  1SA5 B;  1TN8 B;  3M75 A;  3G6J B;  2FBA A;  1KWF A;  1X1H A;  4D4A A;  5FO9 B;  1GLM A;  1HX9 A;  5GZK A;  1X1I A;  3AFL A;  4XUV A;  2VN4 A;  3PYA A;  4L0G A;  3Q75 B;  3S4B A;  3DSV B;  4KKI A;  4OZW A;  2CQS A;  4KKJ A;  3W7X A;  1N7R A;  2PN5 A;  3PZ1 B;  1NL4 B;  1XW2 A;  1O1S B;  4AYP A;  2DRO A;  2AFA A;  1DCE B;  2FUT A;  1IA6 A;  3PYB A;  3SFX B;  4QT9 A;  5IM1 A;  3RX7 A;  1UMP A;  3H7L A;  2BRV X;  2A8Z A;  4LIX A;  3WKH A;  2FUQ A;  3ON6 A;  3QT3 A;  4MU9 A;  5MEH A;  4D4D A;  1N1Z A;  4YDE B;  1TNY B;  3M7L A;  2E22 A;  3HXF B;  3M00 A;  3X17 A;  5CA3 A;  1AGM A;  3H3K A;  1HN0 A;  4FXG B;  3S9V A;  4L6X A;  2V3N A;  1JS4 A;  1TNZ B;  4ZH5 A;  3M76 A;  1HZF A;  1H12 A;  3NNB A;  1UG9 A;  1HM3 A;  1KFG A;  3E33 B;  3EU5 B;  3EUV B;  3N0F A;  4TF4 A;  2WCO A;  2WIN B;  5E2J A;  4CJ0 A;  1N7N A;  4V1S A;  3DST B;  1O5M B;  1RWF A;  2ONG A;  3GLY A;  3QFY A;  2RI9 A;  2XWJ B;  4Z4J A;  3HXE B;  2YIK A;  3A0O A;  1W6J A;  5IK9 A;  4BOK A;  4OK2 A;  1W6K A;  3WIQ A;  4EHM B;  1N7P A;  2R2L B;  2G02 A;  3P5R A;  3E32 B;  2JJB A;  3W7T A;  1RWH A;  1NC5 A;  1JCR B;  1LXM A;  1CLC A;  1HM2 A;  1QQF A;  4EL8 A;  1H13 A;  1N4R B;  1F9D A;  3RJ3 A;  3K7X A;  1D8E B;  2H6G B;  1I8Q A;  3Q7F B;  2AHG A;  4GTR B;  1N4P B;  4L9P B;  1N21 A;  1WZZ A;  4V1R A;  1R76 A;  3WKI A;  1RWC A;  3AFJ A;  4GTM B;  1KSC A;  1HCU A;  3SFY B;  4MMI A;  5FO7 B;  3Q7A B;  1N94 B;  2BBC A;  2V3P A;  2H6H B;  2VN7 A;  3KSL B;  2EAB A;  2Q1F A;  2BRW A;  4Q2B A;  1HMW A;  1LTX B;  2ZBL A;  1GXN A;  1N1B A;  5JPM B;  3H2W A;  1G9G A;  1QAZ A;  4GL3 A;  3SQC A;  1UT9 A;  4MMH A;  3QRY A;  3W5M A;  1QBQ B;  2QNO A;  2AHF A;  3T33 A;  1FCE A;  3DSU B;  3RX8 A;  3E6U A;  1GHQ A;  2H6F B;  5FOB B;  1KKT A;  3SAE A;  3Q79 B;  1HXG A;  1WU5 A;  2J5C A;  2IEJ B;  2NVP A;  1F1S A;  1N7O A;  3QXF A;  2EAE A;  3E37 B;  5C05 A;  3PMM A;  1V5C A;  1G9J A;  3E73 A;  2V8I A;  3ACT A;  1FMI A;  1FPP B;  1H39 A;  4GAX A;  3VSM A;  1F9G A;  3QSP A;  3EQA A;  5JMD A;  4D4B A;  1GAH A;  3DSX B;  1W3Y A;  3M02 A;  1N22 A;  4WVA A;  2FUZ A;  3KSQ B; 
#chains in the Genus database with same CATH homology
 1O79 A;  1MZC B;  3C72 B;  5GW7 A;  2JF4 A;  2XWB B;  3P5P A;  3KQ4 A;  1L1Y A;  3VXD A;  2XQW A;  2D8L A;  2EAD A;  1WU4 A;  5KKB A;  5AGD A;  3WUX A;  1AYX A;  4CE7 A;  4WU0 A;  4MBG B;  4ZH1 A;  2BED B;  2D5J A;  1VD5 A;  4DOE A;  3W7S A;  1V7V A;  3WKF A;  4C1S A;  3SDV A;  1L2A A;  2SQC A;  2WYN A;  3DSW B;  1GA2 A;  3W7U A;  1F9O A;  4TXT A;  1KRF A;  3WKG A;  3D5R A;  4GTT B;  1TF4 A;  2Z07 A;  3GZK A;  2I07 B;  1NXC A;  5M7I A;  1TNB B;  3M73 A;  3QDE A;  3SDQ A;  4YDO B;  2H6I B;  1WU6 A;  1DOG A;  3M74 A;  2V8K A;  2PMV A;  3M78 A;  2DRQ A;  1O1T B;  3SDT A;  1DL2 A;  1GSZ A;  1K72 A;  1GAI A;  1XWQ A;  3M71 A;  1LF6 A;  4KTP A;  4FXK B;  1KRE A;  3QXQ A;  2F0Y B;  3CU7 A;  3K11 A;  4Q88 A;  2DRR A;  3RRS A;  3W7W A;  4GTP B;  3W5N A;  1XWT A;  3ANJ A;  4JJJ A;  1V5D A;  2DRS A;  1V7W A;  4GTV B;  1S63 B;  4YCR A;  3Q73 B;  1X81 B;  3WIW A;  2F6D A;  2G0D A;  1KZP B;  3CIH A;  2V8J A;  1JCS B;  1O6R A;  3ANK A;  1N9A B;  5DGQ A;  1H54 A;  4J5T A;  1O6Q A;  3QT9 A;  5CD2 A;  3S4D A;  3ANI A;  2WY7 A;  1FBO A;  1H3B A;  4D94 A;  3DRA B;  3PZ4 B;  2XFG A;  1TN6 B;  3M7B A;  4FUS A;  4LNG B;  1JCQ B;  4KTR A;  1TNU B;  1KZO B;  2B4F A;  1H36 A;  2EAC A;  4ZRQ A;  1IA7 A;  4AYQ A;  1O6H A;  4GTQ B;  1LD7 B;  3E34 B;  1D8D B;  3WIR A;  3HXD B;  3QWT A;  3PZ2 B;  3DSS B;  2OKX A;  2RI8 A;  3REN A;  2FV0 A;  4GTS B;  3RX5 A;  3ACS A;  5GY3 A;  3SDR A;  4GTO B;  1QSJ A;  1S64 B;  1GXO A;  2RGK A;  1FT1 B;  1FT2 B;  1LF9 A;  1TN7 B;  3S4A A;  3EU8 A;  1G6I A;  1H14 A;  3PZ3 B;  1IS9 A;  3EZ8 A;  4DOD A;  1G87 A;  4AYO A;  1ULV A;  2GZ6 A;  2P0V A;  2FV1 A;  3GT5 A;  3D3I A;  3SDU A;  5FO8 B;  3VW5 A;  1RQ5 A;  1KS8 A;  3A3V A;  1NI1 B;  2ZZR A;  4AYR A;  3QFZ A;  3D5S A;  1H3C A;  4LNV A;  3OED A;  2BB5 A;  1FO3 A;  1TNO B;  1FO2 A;  3Q78 B;  2JG0 A;  3RSY A;  2BB6 A;  1FAE A;  4WVB A;  4LNB B;  3QPF A;  1H37 A;  1C3D A;  3HXC B;  3M72 A;  5CZL A;  4ZG8 A;  2GOX A;  3TF4 A;  1FP3 A;  1LD8 B;  5M7Y A;  4WVC A;  1CEM A;  1N4S B;  3WC3 A;  1SA4 B;  1V7X A;  1H35 A;  4CJ1 A;  2B39 A;  4Z4L A;  2ZIR B;  2WY8 A;  5JPN B;  1O1R B;  1SQC A;  1N95 B;  2CQT A;  3M7E A;  1FBW A;  4M76 A;  3DPY B;  3S4C A;  2A73 B;  3P2C A;  1N4Q B;  3OXU A;  4D4C A;  1GXM A;  2NOJ A;  4ONT A;  2GH4 A;  2ZIS B;  3QG0 A;  1X9D A;  3M7C A;  3M77 A;  4ZRP A;  1KSD A;  5DGR A;  4BOJ A;  3E30 B;  3HXB B;  2WII B;  1H3A A;  3KLS A;  1SA5 B;  1TN8 B;  3M75 A;  3G6J B;  2FBA A;  1KWF A;  4D4A A;  5FO9 B;  1GLM A;  5GZK A;  4XUV A;  2VN4 A;  3PYA A;  4L0G A;  3Q75 B;  3S4B A;  3DSV B;  4KKI A;  2CQS A;  4KKJ A;  3W7X A;  2PN5 A;  3PZ1 B;  1NL4 B;  1XW2 A;  1O1S B;  4AYP A;  2DRO A;  2AFA A;  1DCE B;  1IA6 A;  3PYB A;  3SFX B;  4QT9 A;  3RX7 A;  1UMP A;  3H7L A;  2A8Z A;  4LIX A;  3WKH A;  3ON6 A;  3QT3 A;  4MU9 A;  5MEH A;  4D4D A;  4YDE B;  1TNY B;  3M7L A;  3HXF B;  3X17 A;  5CA3 A;  1AGM A;  3H3K A;  4FXG B;  3S9V A;  4L6X A;  2V3N A;  1JS4 A;  1TNZ B;  4ZH5 A;  3M76 A;  1HZF A;  1H12 A;  1UG9 A;  1KFG A;  3E33 B;  3EU5 B;  3EUV B;  4TF4 A;  2WIN B;  5E2J A;  4CJ0 A;  4V1S A;  3DST B;  1O5M B;  3GLY A;  3QFY A;  2RI9 A;  2XWJ B;  4Z4J A;  3HXE B;  2YIK A;  1W6J A;  4BOK A;  1W6K A;  3WIQ A;  4EHM B;  2R2L B;  2G02 A;  3P5R A;  3E32 B;  2JJB A;  3W7T A;  1NC5 A;  1JCR B;  1CLC A;  1QQF A;  4EL8 A;  1H13 A;  1N4R B;  1F9D A;  3RJ3 A;  3K7X A;  1D8E B;  2H6G B;  3Q7F B;  2AHG A;  4GTR B;  1N4P B;  4L9P B;  1WZZ A;  4V1R A;  1R76 A;  3WKI A;  3AFJ A;  4GTM B;  1KSC A;  1HCU A;  3SFY B;  5FO7 B;  3Q7A B;  1N94 B;  2BBC A;  2V3P A;  2H6H B;  2VN7 A;  3KSL B;  2EAB A;  4Q2B A;  1LTX B;  2ZBL A;  1GXN A;  5JPM B;  3H2W A;  1G9G A;  4GL3 A;  3SQC A;  1UT9 A;  3QRY A;  3W5M A;  1QBQ B;  2QNO A;  2AHF A;  3T33 A;  1FCE A;  3DSU B;  3RX8 A;  3E6U A;  1GHQ A;  2H6F B;  5FOB B;  1KKT A;  3SAE A;  3Q79 B;  1WU5 A;  2IEJ B;  2NVP A;  3QXF A;  2EAE A;  3E37 B;  3PMM A;  1V5C A;  1G9J A;  3E73 A;  2V8I A;  3ACT A;  1FMI A;  1FPP B;  1H39 A;  3QSP A;  3EQA A;  4D4B A;  1GAH A;  3DSX B;  4WVA A;  2FUZ A;  3KSQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...