3D5RA

Crystal structure of efb-c (n138a) / c3d complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
297
structure length
297
Chain Sequence
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 115
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3d5rA00
1H35A 2BBCA 3Q79B 4D4CA 4GTOB 1FT1B 1O1SB 2V3PA 1KZOB 1S64B 4C1SA 1LD7B 1LTXB 2XWBB 1N4QB 2IEJB 3DSWB 1C3DA 5FOBB 1LD8B 4ONTA 4YDOB 3Q7FB 1MZCB 4MU9A 2XQWA 3DSXB 1SQCA 4D4BA 3HXEB 4LNBB 2V8JA 1N4SB 1TNYB 2PN5A 4YDEB 1FT2B 3SFYB 2H6FB 4MBGB 3PZ1B 1QQFA 3E32B 4KKIA 1R76A 1O6HA 1O1TB 4LNGB 3EU5B 1S63B 3HXBB 1KZPB 4L9PB 5JPMB 2H6HB 4D4DA 4EHMB 2WIIB 1N4RB 1O5MB 3C72B 3CU7A 3KLSA 2BB6A 1O1RB 1O6RA 1NL4B 3SFXB 1H39A 1GHQA 2B39A 1DCEB 2WY7A 3HXFB 2V8KA 3OXUA 4ZRPA 2V8IA 1TNZB 2ZISB 1TN7B 4GTRB 2H6IB 2R2LB 5AGDA 3Q75B 2XWJB 3OEDA 4M76A 5FO8B 3RJ3A 1GSZA 1H36A 1X81B 1GXOA 2SQCA 2WY8A 1GXNA 2ZIRB 3KQ4A 5FO9B 3E30B 1GXMA 3EUVB 4LNVA 4ZH1A 1O79A 4ZRQA 1TNBB 3E33B 3KSLB 2I07B 3DRAB 1N95B 4V1RA 3DSTB 2G02A 5JPNB 2H6GB 3DSVB 1H3CA 1NI1B 3Q78B 4GTMB 1W6JA 1FPPB 3DSSB 3PZ3B 4BOKA 1SA5B 1TN6B 4BOJA 1JCQB 2GOXA 1D8EB 4D94A 1W6KA 2PMVA 2A73B 1TNOB 2F0YB 3DPYB 1N4PB 1D8DB 1H3BA 3E37B 3DSUB 1SA4B 3D5RA 4GTQB 3KSQB 2NOJA 4GTSB 4KKJA 4D4AA 1QSJA 3Q7AB 1HZFA 3K7XA 1N9AB 4GTTB 3PZ2B 4V1SA 2G0DA 1H37A 5FO7B 1QBQB 1JCRB 1JCSB 4GTVB 2BB5A 2WINB 1TNUB 1N94B 3SQCA 3Q73B 2V3NA 4FXKB 3G6JB 1TN8B 3HXCB 3D5SA 4GTPB 1UMPA 3E34B 3HXDB 3PZ4B 1H3AA 4FXGB 2BEDB 1O6QA
chains in the Genus database with same CATH superfamily
3A0OA 1HXAA 5ILYA 1FT1B 1S64B 3E80A 2XWBB 2YIKA 1FAEA 3GLYA 4WVCA 5M7IA 3ACSA 3QT9A 2XQWA 3M7CA 3AFLA 4Q88A 4FJQA 2AHFA 4YDEB 3TF4A 1X1HA 1RQ5A 1QQFA 2E24A 3RSYA 3LZ9A 3QXQA 2FV1A 4KKIA 4RNQA 2RGKA 3HXBB 2NVPA 2H6HB 1RWAA 3QXFA 1O5MB 1N20A 3C72B 3CU7A 2BB6A 1O6RA 1N7PA 1DCEB 2WY7A 1WU6A 4CJ1A 1TN7B 5IKHA 2WDAA 4ZH5A 3Q75B 2Q1FA 2GH4A 1LF6A 1H36A 4OJZA 3H2WA 1GXMA 1LXKA 4LNVA 1UT9A 3G4FA 1TNBB 2P0VA 1N95B 4F10A 1W3YA 3DSTB 2G02A 3H7LA 1V5CA 1XWTA 1FMIA 1W6JA 1LF9A 4J5TA 4BOJA 3N0FA 2DROA 3QPFA 3E7JA 1CB8A 2B4FA 2BRWA 2XFGA 5DGQA 3E37B 4XUVA 3EQAA 1F9OA 3WUXA 1N7QA 1QSJA 3S4DA 3WIRA 3W5NA 1N9AB 3M76A 1V7WA 3QDEA 1HM3A 4Z4LA 1LXMA 3E73A 4V1SA 3VSNA 1QBQB 3RX7A 3GZKA 4GTVB 1JS4A 3CIHA 1TNUB 3Q73B 1V7VA 3G6JB 5DHKA 1H3AA 4ZG8A 4FXGB 2H6FB 2E22A 4C1SA 1H35A 5JMFA 4YCRA 3VXDA 4D4CA 5IK0A 3M01A 4Z4JA 1H54A 1LD7B 1LTXB 1OJMA 2IEJB 2X03A 4ONTA 4FNVA 4YDOB 4MU9A 4L6XA 3DSXB 3S4CA 1RWGA 3HXEB 4LNBB 4AYOA 1N4SB 4F13A 4OZWA 2J5CA 1FT2B 2DRRA 2F6DA 1F9GA 1HV6A 1X1IA 2AHGA 2WCOA 3E32B 1HCUA 1G6IA 3G4DA 1O6HA 1O1TB 4LNGB 4D4DA 2A8ZA 1N4RB 3WKHA 1NL4B 3W7UA 1KRFA 1H39A 2B39A 1KSCA 1J0NA 3HXFB 3OXUA 3M71A 3A3VA 2Z07A 1EGUA 4AYPA 2R2LB 5IK9A 1GLMA 5AGDA 3P5RA 3RJ3A 1L1YA 2ZIRB 1G9GA 5FO9B 3E30B 3RENA 2RI8A 3EU8A 5IK6A 4ZH1A 1IS9A 2BRVX 4V1RA 5M7YA 4DOEA 3NNBA 1H12A 1FPPB 3PZ3B 4BOKA 3SAEA 1SA5B 1NC5A 1TN6B 4TXTA 1V7XA 1X9DA 1HM2A 2CQSA 3SDTA 1JCQB 2GOXA 3AFJA 4D94A 5EASA 3ON6A 2PMVA 5IM1A 1D8DB 3WKIA 3NFVA 3RX5A 3PYBA 2DRSA 3M7LA 3PMMA 3KSQB 4WU0A 5GZKA 4D4AA 5ILKA 3Q7AB 3ANJA 1FO3A 2FUZA 4WVAA 3M74A 4CJ0A 2JG0A 5FO7B 1JCRB 1JCSB 3D3IA 3QSPA 3X17A 5ILIA 1GA2A 3M72A 2EADA 3QWTA 1OJNA 1UMPA 2EAEA 3SDQA 2BEDB 1FBOA 1XWQA 3S4AA 2BBCA 5EAUA 3Q79B 4TF4A 3H3KA 2V3PA 1KZOB 1IA7A 1DOGA 1N21A 1X1JA 3W7SA 1WZZA 1N4QB 5ILHA 1C3DA 5FOBB 1LD8B 1KS8A 1MZCB 1N22A 1N7NA 4D4BA 2V8JA 4OZVA 1TNYB 2FV0A 3M00A 1XW2A 3SFYB 1CEMA 3PZ1B 3M73A 2D8LA 4KTRA 5ILDA 1HXGA 1N23A 1R76A 3WKFA 1F1SA 3EU5B 3VSMA 4L9PB 5JPMB 3ANIA 3WIWA 4MMIA 2WIIB 1HMUA 3M78A 5ILJA 3QT3A 2V8KA 4ZRPA 2ZISB 3VW5A 3PYAA 3WKGA 1RWCA 4GTRB 2H6IB 1FBWA 2QNOA 1AYXA 1K72A 3OEDA 1WU5A 5GY3A 1GSZA 1GXNA 3KQ4A 4DODA 2VN7A 1V5DA 5KKBA 3EUVB 3N0GA 5CA3A 2FUQA 4ZRQA 3P5PA 2I07B 1KSDA 4E1YA 1GAIA 3P2CA 4LIXA 3M7EA 2ZZRA 4AYRA 4GTMB 1HN0A 4CE7A 1UG9A 1HX9A 4AYQA 1D8EB 1L2AA 3SDUA 2A73B 3DPYB 2F0YB 1N4PB 1OJOA 5CZLA 1H3BA 3S4BA 3W7TA 5MEHA 2ONHA 1H14A 4GTQB 3SDVA 2NOJA 4GAXA 4KKJA 5E2JA 3M75A 1AGMA 3PZ2B 1H37A 3EZ8A 2BB5A 3SQCA 5DGRA 3RRSA 2V3NA 4FXKB 1H13A 1TN8B 3K11A 3D5SA 5IL8A 1KWFA 4FUSA 3E34B 3PZ4B 4MMHA 1RWHA 1NXCA 1G9JA 1TF4A 2JJBA 3S9VA 4GTOB 1I8QA 1RW9A 3W5MA 1WU4A 1O1SB 1N1ZA 2DRQA 1FP3A 1VD5A 5CD2A 1OJPA 1HMWA 1RWFA 2EABA 3QFYA 2FBAA 3DSWB 1FO2A 3Q7FB 1QAZA 4NEIA 1SQCA 2GZ6A 3QRYA 3W7WA 1FCEA 2PN5A 1KKTA 5C05A 4MBGB 3SDRA 1N1BA 2JF4A 5ILZA 2AFAA 4OK2A 1C82A 1S63B 1KZPB 4EHMB 1KFGA 1G87A 3KLSA 1O1RB 2VN4A 3SFXB 2OKXA 1GHQA 4OK4A 2V8IA 1TNZB 1J0MA 1DL2A 5DHIA 5EATA 3W7XA 1IA6A 4GL3A 2BRPA 5IL3A 3M02A 2XWJB 4M76A 5FO8B 1N24A 2D5JA 1GXOA 1X81B 2SQCA 2WY8A 4L0GA 4JJJA 3RX8A 2EACA 1CLCA 1O79A 3GT5A 3E33B 3KSLB 3DRAB 1KREA 5JPNB 2H6GB 3DSVB 1H3CA 1NI1B 2FUTA 3Q78B 3T33A 3DSSB 2ZBLA 4EL8A 1W6KA 1TNOB 3E6UA 4WVBA 2WYNA 3QFZA 3DSUB 1SA4B 4Q2BA 3D5RA 3WC3A 4GTSB 1HZFA 3K7XA 4GTTB 1LOHA 1F9DA 2CQTA 4QT9A 2G0DA 2ONGA 5IKAA 2WINB 1N94B 3M77A 1HXCA 1ULVA 1N7OA 1GAHA 3ACTA 3M7BA 4DI5A 3HXCB 3QG0A 3WIQA 5JMDA 4GTPB 5GW7A 3HXDB 2RI9A 1N7RA 4KTPA 3ANKA 1O6QA
chains in the Genus database with same CATH topology
1FT1B 1S64B 2XWBB 2YIKA 1FAEA 3GLYA 4WVCA 5M7IA 3ACSA 3QT9A 2XQWA 3M7CA 4Q88A 2AHFA 4YDEB 3TF4A 1RQ5A 1QQFA 3RSYA 3QXQA 2FV1A 4KKIA 2RGKA 3HXBB 2NVPA 2H6HB 3QXFA 1O5MB 3C72B 3CU7A 2BB6A 1O6RA 1DCEB 2WY7A 1WU6A 4CJ1A 1TN7B 4ZH5A 3Q75B 2GH4A 1LF6A 1H36A 3H2WA 1GXMA 4LNVA 1UT9A 1TNBB 2P0VA 1N95B 3DSTB 2G02A 3H7LA 1V5CA 1XWTA 1FMIA 1W6JA 1LF9A 4J5TA 4BOJA 2DROA 3QPFA 2B4FA 2XFGA 5DGQA 3E37B 4XUVA 3EQAA 1F9OA 3WUXA 1QSJA 3S4DA 3WIRA 3W5NA 1N9AB 3M76A 1V7WA 3QDEA 4Z4LA 3E73A 4V1SA 1QBQB 3RX7A 3GZKA 4GTVB 1JS4A 3CIHA 1TNUB 3Q73B 1V7VA 3G6JB 1H3AA 4ZG8A 4FXGB 2H6FB 4C1SA 1H35A 4YCRA 3VXDA 4D4CA 4Z4JA 1H54A 1LD7B 1LTXB 2IEJB 4ONTA 4YDOB 4MU9A 4L6XA 3DSXB 3S4CA 3HXEB 4LNBB 4AYOA 1N4SB 1FT2B 2DRRA 2F6DA 2AHGA 3E32B 1HCUA 1G6IA 1O6HA 1O1TB 4LNGB 4D4DA 2A8ZA 1N4RB 3WKHA 1NL4B 3W7UA 1KRFA 1H39A 2B39A 1KSCA 3HXFB 3OXUA 3M71A 3A3VA 2Z07A 4AYPA 2R2LB 1GLMA 5AGDA 3P5RA 3RJ3A 1L1YA 2ZIRB 1G9GA 5FO9B 3E30B 3RENA 2RI8A 3EU8A 4ZH1A 1IS9A 4V1RA 5M7YA 4DOEA 1H12A 1FPPB 3PZ3B 4BOKA 3SAEA 1SA5B 1NC5A 1TN6B 4TXTA 1V7XA 1X9DA 2CQSA 3SDTA 1JCQB 2GOXA 3AFJA 4D94A 3ON6A 2PMVA 1D8DB 3WKIA 3RX5A 3PYBA 2DRSA 3M7LA 3PMMA 3KSQB 4WU0A 5GZKA 4D4AA 3Q7AB 3ANJA 1FO3A 2FUZA 4WVAA 3M74A 4CJ0A 2JG0A 5FO7B 1JCRB 1JCSB 3D3IA 3QSPA 3X17A 1GA2A 3M72A 2EADA 3QWTA 1UMPA 2EAEA 3SDQA 2BEDB 1FBOA 1XWQA 3S4AA 2BBCA 3Q79B 4TF4A 3H3KA 2V3PA 1KZOB 1IA7A 1DOGA 3W7SA 1WZZA 1N4QB 1C3DA 5FOBB 1LD8B 1KS8A 1MZCB 4D4BA 2V8JA 1TNYB 2FV0A 1XW2A 3SFYB 1CEMA 3PZ1B 3M73A 2D8LA 4KTRA 1R76A 3WKFA 3EU5B 4L9PB 5JPMB 3ANIA 3WIWA 2WIIB 3M78A 3QT3A 2V8KA 4ZRPA 2ZISB 3VW5A 3PYAA 3WKGA 4GTRB 2H6IB 1FBWA 2QNOA 1AYXA 1K72A 3OEDA 1WU5A 5GY3A 1GSZA 1GXNA 3KQ4A 4DODA 2VN7A 1V5DA 5KKBA 3EUVB 5CA3A 4ZRQA 3P5PA 2I07B 1KSDA 1GAIA 3P2CA 4LIXA 3M7EA 2ZZRA 4AYRA 4GTMB 4CE7A 1UG9A 4AYQA 1D8EB 1L2AA 3SDUA 2A73B 2F0YB 3DPYB 1N4PB 5CZLA 1H3BA 3S4BA 3W7TA 5MEHA 1H14A 4GTQB 3SDVA 2NOJA 4KKJA 5E2JA 3M75A 1AGMA 3PZ2B 1H37A 3EZ8A 2BB5A 3SQCA 5DGRA 3RRSA 2V3NA 4FXKB 1H13A 1TN8B 3K11A 3D5SA 1KWFA 4FUSA 3E34B 3PZ4B 1NXCA 1G9JA 1TF4A 2JJBA 3S9VA 4GTOB 3W5MA 1WU4A 1O1SB 2DRQA 1FP3A 1VD5A 5CD2A 2EABA 3QFYA 2FBAA 3DSWB 1FO2A 3Q7FB 1SQCA 2GZ6A 3QRYA 3W7WA 1FCEA 2PN5A 1KKTA 4MBGB 3SDRA 2JF4A 2AFAA 1S63B 1KZPB 4EHMB 1KFGA 1G87A 3KLSA 1O1RB 2VN4A 3SFXB 2OKXA 1GHQA 2V8IA 1TNZB 1DL2A 3W7XA 1IA6A 4GL3A 2XWJB 4M76A 5FO8B 2D5JA 1GXOA 1X81B 2SQCA 2WY8A 4L0GA 4JJJA 3RX8A 2EACA 1CLCA 1O79A 3GT5A 3E33B 3KSLB 3DRAB 1KREA 5JPNB 2H6GB 3DSVB 1H3CA 1NI1B 3Q78B 3T33A 3DSSB 2ZBLA 4EL8A 1W6KA 1TNOB 3E6UA 4WVBA 2WYNA 3QFZA 3DSUB 1SA4B 4Q2BA 3D5RA 3WC3A 4GTSB 1HZFA 3K7XA 4GTTB 1F9DA 2CQTA 4QT9A 2G0DA 2WINB 1N94B 3M77A 1ULVA 1GAHA 3ACTA 3M7BA 3HXCB 3QG0A 3WIQA 4GTPB 5GW7A 3HXDB 2RI9A 4KTPA 3ANKA 1O6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H35 A;  2BBC A;  3Q79 B;  4D4C A;  4GTO B;  1FT1 B;  1O1S B;  2V3P A;  1KZO B;  1S64 B;  4C1S A;  1LD7 B;  1LTX B;  2XWB B;  1N4Q B;  2IEJ B;  3DSW B;  1C3D A;  5FOB B;  1LD8 B;  4ONT A;  4YDO B;  3Q7F B;  1MZC B;  4MU9 A;  2XQW A;  3DSX B;  1SQC A;  4D4B A;  3HXE B;  4LNB B;  2V8J A;  1N4S B;  1TNY B;  2PN5 A;  4YDE B;  1FT2 B;  3SFY B;  2H6F B;  4MBG B;  3PZ1 B;  1QQF A;  3E32 B;  4KKI A;  1R76 A;  1O6H A;  1O1T B;  4LNG B;  3EU5 B;  1S63 B;  3HXB B;  1KZP B;  4L9P B;  5JPM B;  2H6H B;  4D4D A;  4EHM B;  2WII B;  1N4R B;  1O5M B;  3C72 B;  3CU7 A;  3KLS A;  2BB6 A;  1O1R B;  1O6R A;  1NL4 B;  3SFX B;  1H39 A;  1GHQ A;  2B39 A;  1DCE B;  2WY7 A;  3HXF B;  2V8K A;  3OXU A;  4ZRP A;  2V8I A;  1TNZ B;  2ZIS B;  1TN7 B;  4GTR B;  2H6I B;  2R2L B;  5AGD A;  3Q75 B;  2XWJ B;  3OED A;  4M76 A;  5FO8 B;  3RJ3 A;  1GSZ A;  1H36 A;  1X81 B;  1GXO A;  2SQC A;  2WY8 A;  1GXN A;  2ZIR B;  3KQ4 A;  5FO9 B;  3E30 B;  1GXM A;  3EUV B;  4LNV A;  4ZH1 A;  1O79 A;  4ZRQ A;  1TNB B;  3E33 B;  3KSL B;  2I07 B;  3DRA B;  1N95 B;  4V1R A;  3DST B;  2G02 A;  5JPN B;  2H6G B;  3DSV B;  1H3C A;  1NI1 B;  3Q78 B;  4GTM B;  1W6J A;  1FPP B;  3DSS B;  3PZ3 B;  4BOK A;  1SA5 B;  1TN6 B;  4BOJ A;  1JCQ B;  2GOX A;  1D8E B;  4D94 A;  1W6K A;  2PMV A;  2A73 B;  1TNO B;  2F0Y B;  3DPY B;  1N4P B;  1D8D B;  1H3B A;  3E37 B;  3DSU B;  1SA4 B;  3D5R A;  4GTQ B;  3KSQ B;  2NOJ A;  4GTS B;  4KKJ A;  4D4A A;  1QSJ A;  3Q7A B;  1HZF A;  3K7X A;  1N9A B;  4GTT B;  3PZ2 B;  4V1S A;  2G0D A;  1H37 A;  5FO7 B;  1QBQ B;  1JCR B;  1JCS B;  4GTV B;  2BB5 A;  2WIN B;  1TNU B;  1N94 B;  3SQC A;  3Q73 B;  2V3N A;  4FXK B;  3G6J B;  1TN8 B;  3HXC B;  3D5S A;  4GTP B;  1UMP A;  3E34 B;  3HXD B;  3PZ4 B;  1H3A A;  4FXG B;  2BED B;  1O6Q A; 
#chains in the Genus database with same CATH topology
 3A0O A;  1HXA A;  5ILY A;  1FT1 B;  1S64 B;  3E80 A;  2XWB B;  2YIK A;  1FAE A;  3GLY A;  4WVC A;  5M7I A;  3ACS A;  3QT9 A;  2XQW A;  3M7C A;  3AFL A;  4Q88 A;  4FJQ A;  2AHF A;  4YDE B;  3TF4 A;  1X1H A;  1RQ5 A;  1QQF A;  2E24 A;  3RSY A;  3LZ9 A;  3QXQ A;  2FV1 A;  4KKI A;  4RNQ A;  2RGK A;  3HXB B;  2NVP A;  2H6H B;  1RWA A;  3QXF A;  1O5M B;  1N20 A;  3C72 B;  3CU7 A;  2BB6 A;  1O6R A;  1N7P A;  1DCE B;  2WY7 A;  1WU6 A;  4CJ1 A;  1TN7 B;  5IKH A;  2WDA A;  4ZH5 A;  3Q75 B;  2Q1F A;  2GH4 A;  1LF6 A;  1H36 A;  4OJZ A;  3H2W A;  1GXM A;  1LXK A;  4LNV A;  1UT9 A;  3G4F A;  1TNB B;  2P0V A;  1N95 B;  4F10 A;  1W3Y A;  3DST B;  2G02 A;  3H7L A;  1V5C A;  1XWT A;  1FMI A;  1W6J A;  1LF9 A;  4J5T A;  4BOJ A;  3N0F A;  2DRO A;  3QPF A;  3E7J A;  1CB8 A;  2B4F A;  2BRW A;  2XFG A;  5DGQ A;  3E37 B;  4XUV A;  3EQA A;  1F9O A;  3WUX A;  1N7Q A;  1QSJ A;  3S4D A;  3WIR A;  3W5N A;  1N9A B;  3M76 A;  1V7W A;  3QDE A;  1HM3 A;  4Z4L A;  1LXM A;  3E73 A;  4V1S A;  3VSN A;  1QBQ B;  3RX7 A;  3GZK A;  4GTV B;  1JS4 A;  3CIH A;  1TNU B;  3Q73 B;  1V7V A;  3G6J B;  5DHK A;  1H3A A;  4ZG8 A;  4FXG B;  2H6F B;  2E22 A;  4C1S A;  1H35 A;  5JMF A;  4YCR A;  3VXD A;  4D4C A;  5IK0 A;  3M01 A;  4Z4J A;  1H54 A;  1LD7 B;  1LTX B;  1OJM A;  2IEJ B;  2X03 A;  4ONT A;  4FNV A;  4YDO B;  4MU9 A;  4L6X A;  3DSX B;  3S4C A;  1RWG A;  3HXE B;  4LNB B;  4AYO A;  1N4S B;  4F13 A;  4OZW A;  2J5C A;  1FT2 B;  2DRR A;  2F6D A;  1F9G A;  1HV6 A;  1X1I A;  2AHG A;  2WCO A;  3E32 B;  1HCU A;  1G6I A;  3G4D A;  1O6H A;  1O1T B;  4LNG B;  4D4D A;  2A8Z A;  1N4R B;  3WKH A;  1NL4 B;  3W7U A;  1KRF A;  1H39 A;  2B39 A;  1KSC A;  1J0N A;  3HXF B;  3OXU A;  3M71 A;  3A3V A;  2Z07 A;  1EGU A;  4AYP A;  2R2L B;  5IK9 A;  1GLM A;  5AGD A;  3P5R A;  3RJ3 A;  1L1Y A;  2ZIR B;  1G9G A;  5FO9 B;  3E30 B;  3REN A;  2RI8 A;  3EU8 A;  5IK6 A;  4ZH1 A;  1IS9 A;  2BRV X;  4V1R A;  5M7Y A;  4DOE A;  3NNB A;  1H12 A;  1FPP B;  3PZ3 B;  4BOK A;  3SAE A;  1SA5 B;  1NC5 A;  1TN6 B;  4TXT A;  1V7X A;  1X9D A;  1HM2 A;  2CQS A;  3SDT A;  1JCQ B;  2GOX A;  3AFJ A;  4D94 A;  5EAS A;  3ON6 A;  2PMV A;  5IM1 A;  1D8D B;  3WKI A;  3NFV A;  3RX5 A;  3PYB A;  2DRS A;  3M7L A;  3PMM A;  3KSQ B;  4WU0 A;  5GZK A;  4D4A A;  5ILK A;  3Q7A B;  3ANJ A;  1FO3 A;  2FUZ A;  4WVA A;  3M74 A;  4CJ0 A;  2JG0 A;  5FO7 B;  1JCR B;  1JCS B;  3D3I A;  3QSP A;  3X17 A;  5ILI A;  1GA2 A;  3M72 A;  2EAD A;  3QWT A;  1OJN A;  1UMP A;  2EAE A;  3SDQ A;  2BED B;  1FBO A;  1XWQ A;  3S4A A;  2BBC A;  5EAU A;  3Q79 B;  4TF4 A;  3H3K A;  2V3P A;  1KZO B;  1IA7 A;  1DOG A;  1N21 A;  1X1J A;  3W7S A;  1WZZ A;  1N4Q B;  5ILH A;  1C3D A;  5FOB B;  1LD8 B;  1KS8 A;  1MZC B;  1N22 A;  1N7N A;  4D4B A;  2V8J A;  4OZV A;  1TNY B;  2FV0 A;  3M00 A;  1XW2 A;  3SFY B;  1CEM A;  3PZ1 B;  3M73 A;  2D8L A;  4KTR A;  5ILD A;  1HXG A;  1N23 A;  1R76 A;  3WKF A;  1F1S A;  3EU5 B;  3VSM A;  4L9P B;  5JPM B;  3ANI A;  3WIW A;  4MMI A;  2WII B;  1HMU A;  3M78 A;  5ILJ A;  3QT3 A;  2V8K A;  4ZRP A;  2ZIS B;  3VW5 A;  3PYA A;  3WKG A;  1RWC A;  4GTR B;  2H6I B;  1FBW A;  2QNO A;  1AYX A;  1K72 A;  3OED A;  1WU5 A;  5GY3 A;  1GSZ A;  1GXN A;  3KQ4 A;  4DOD A;  2VN7 A;  1V5D A;  5KKB A;  3EUV B;  3N0G A;  5CA3 A;  2FUQ A;  4ZRQ A;  3P5P A;  2I07 B;  1KSD A;  4E1Y A;  1GAI A;  3P2C A;  4LIX A;  3M7E A;  2ZZR A;  4AYR A;  4GTM B;  1HN0 A;  4CE7 A;  1UG9 A;  1HX9 A;  4AYQ A;  1D8E B;  1L2A A;  3SDU A;  2A73 B;  3DPY B;  2F0Y B;  1N4P B;  1OJO A;  5CZL A;  1H3B A;  3S4B A;  3W7T A;  5MEH A;  2ONH A;  1H14 A;  4GTQ B;  3SDV A;  2NOJ A;  4GAX A;  4KKJ A;  5E2J A;  3M75 A;  1AGM A;  3PZ2 B;  1H37 A;  3EZ8 A;  2BB5 A;  3SQC A;  5DGR A;  3RRS A;  2V3N A;  4FXK B;  1H13 A;  1TN8 B;  3K11 A;  3D5S A;  5IL8 A;  1KWF A;  4FUS A;  3E34 B;  3PZ4 B;  4MMH A;  1RWH A;  1NXC A;  1G9J A;  1TF4 A;  2JJB A;  3S9V A;  4GTO B;  1I8Q A;  1RW9 A;  3W5M A;  1WU4 A;  1O1S B;  1N1Z A;  2DRQ A;  1FP3 A;  1VD5 A;  5CD2 A;  1OJP A;  1HMW A;  1RWF A;  2EAB A;  3QFY A;  2FBA A;  3DSW B;  1FO2 A;  3Q7F B;  1QAZ A;  4NEI A;  1SQC A;  2GZ6 A;  3QRY A;  3W7W A;  1FCE A;  2PN5 A;  1KKT A;  5C05 A;  4MBG B;  3SDR A;  1N1B A;  2JF4 A;  5ILZ A;  2AFA A;  4OK2 A;  1C82 A;  1S63 B;  1KZP B;  4EHM B;  1KFG A;  1G87 A;  3KLS A;  1O1R B;  2VN4 A;  3SFX B;  2OKX A;  1GHQ A;  4OK4 A;  2V8I A;  1TNZ B;  1J0M A;  1DL2 A;  5DHI A;  5EAT A;  3W7X A;  1IA6 A;  4GL3 A;  2BRP A;  5IL3 A;  3M02 A;  2XWJ B;  4M76 A;  5FO8 B;  1N24 A;  2D5J A;  1GXO A;  1X81 B;  2SQC A;  2WY8 A;  4L0G A;  4JJJ A;  3RX8 A;  2EAC A;  1CLC A;  1O79 A;  3GT5 A;  3E33 B;  3KSL B;  3DRA B;  1KRE A;  5JPN B;  2H6G B;  3DSV B;  1H3C A;  1NI1 B;  2FUT A;  3Q78 B;  3T33 A;  3DSS B;  2ZBL A;  4EL8 A;  1W6K A;  1TNO B;  3E6U A;  4WVB A;  2WYN A;  3QFZ A;  3DSU B;  1SA4 B;  4Q2B A;  3D5R A;  3WC3 A;  4GTS B;  1HZF A;  3K7X A;  4GTT B;  1LOH A;  1F9D A;  2CQT A;  4QT9 A;  2G0D A;  2ONG A;  5IKA A;  2WIN B;  1N94 B;  3M77 A;  1HXC A;  1ULV A;  1N7O A;  1GAH A;  3ACT A;  3M7B A;  4DI5 A;  3HXC B;  3QG0 A;  3WIQ A;  5JMD A;  4GTP B;  5GW7 A;  3HXD B;  2RI9 A;  1N7R A;  4KTP A;  3ANK A;  1O6Q A; 
#chains in the Genus database with same CATH homology
 1FT1 B;  1S64 B;  2XWB B;  2YIK A;  1FAE A;  3GLY A;  4WVC A;  5M7I A;  3ACS A;  3QT9 A;  2XQW A;  3M7C A;  4Q88 A;  2AHF A;  4YDE B;  3TF4 A;  1RQ5 A;  1QQF A;  3RSY A;  3QXQ A;  2FV1 A;  4KKI A;  2RGK A;  3HXB B;  2NVP A;  2H6H B;  3QXF A;  1O5M B;  3C72 B;  3CU7 A;  2BB6 A;  1O6R A;  1DCE B;  2WY7 A;  1WU6 A;  4CJ1 A;  1TN7 B;  4ZH5 A;  3Q75 B;  2GH4 A;  1LF6 A;  1H36 A;  3H2W A;  1GXM A;  4LNV A;  1UT9 A;  1TNB B;  2P0V A;  1N95 B;  3DST B;  2G02 A;  3H7L A;  1V5C A;  1XWT A;  1FMI A;  1W6J A;  1LF9 A;  4J5T A;  4BOJ A;  2DRO A;  3QPF A;  2B4F A;  2XFG A;  5DGQ A;  3E37 B;  4XUV A;  3EQA A;  1F9O A;  3WUX A;  1QSJ A;  3S4D A;  3WIR A;  3W5N A;  1N9A B;  3M76 A;  1V7W A;  3QDE A;  4Z4L A;  3E73 A;  4V1S A;  1QBQ B;  3RX7 A;  3GZK A;  4GTV B;  1JS4 A;  3CIH A;  1TNU B;  3Q73 B;  1V7V A;  3G6J B;  1H3A A;  4ZG8 A;  4FXG B;  2H6F B;  4C1S A;  1H35 A;  4YCR A;  3VXD A;  4D4C A;  4Z4J A;  1H54 A;  1LD7 B;  1LTX B;  2IEJ B;  4ONT A;  4YDO B;  4MU9 A;  4L6X A;  3DSX B;  3S4C A;  3HXE B;  4LNB B;  4AYO A;  1N4S B;  1FT2 B;  2DRR A;  2F6D A;  2AHG A;  3E32 B;  1HCU A;  1G6I A;  1O6H A;  1O1T B;  4LNG B;  4D4D A;  2A8Z A;  1N4R B;  3WKH A;  1NL4 B;  3W7U A;  1KRF A;  1H39 A;  2B39 A;  1KSC A;  3HXF B;  3OXU A;  3M71 A;  3A3V A;  2Z07 A;  4AYP A;  2R2L B;  1GLM A;  5AGD A;  3P5R A;  3RJ3 A;  1L1Y A;  2ZIR B;  1G9G A;  5FO9 B;  3E30 B;  3REN A;  2RI8 A;  3EU8 A;  4ZH1 A;  1IS9 A;  4V1R A;  5M7Y A;  4DOE A;  1H12 A;  1FPP B;  3PZ3 B;  4BOK A;  3SAE A;  1SA5 B;  1NC5 A;  1TN6 B;  4TXT A;  1V7X A;  1X9D A;  2CQS A;  3SDT A;  1JCQ B;  2GOX A;  3AFJ A;  4D94 A;  3ON6 A;  2PMV A;  1D8D B;  3WKI A;  3RX5 A;  3PYB A;  2DRS A;  3M7L A;  3PMM A;  3KSQ B;  4WU0 A;  5GZK A;  4D4A A;  3Q7A B;  3ANJ A;  1FO3 A;  2FUZ A;  4WVA A;  3M74 A;  4CJ0 A;  2JG0 A;  5FO7 B;  1JCR B;  1JCS B;  3D3I A;  3QSP A;  3X17 A;  1GA2 A;  3M72 A;  2EAD A;  3QWT A;  1UMP A;  2EAE A;  3SDQ A;  2BED B;  1FBO A;  1XWQ A;  3S4A A;  2BBC A;  3Q79 B;  4TF4 A;  3H3K A;  2V3P A;  1KZO B;  1IA7 A;  1DOG A;  3W7S A;  1WZZ A;  1N4Q B;  1C3D A;  5FOB B;  1LD8 B;  1KS8 A;  1MZC B;  4D4B A;  2V8J A;  1TNY B;  2FV0 A;  1XW2 A;  3SFY B;  1CEM A;  3PZ1 B;  3M73 A;  2D8L A;  4KTR A;  1R76 A;  3WKF A;  3EU5 B;  4L9P B;  5JPM B;  3ANI A;  3WIW A;  2WII B;  3M78 A;  3QT3 A;  2V8K A;  4ZRP A;  2ZIS B;  3VW5 A;  3PYA A;  3WKG A;  4GTR B;  2H6I B;  1FBW A;  2QNO A;  1AYX A;  1K72 A;  3OED A;  1WU5 A;  5GY3 A;  1GSZ A;  1GXN A;  3KQ4 A;  4DOD A;  2VN7 A;  1V5D A;  5KKB A;  3EUV B;  5CA3 A;  4ZRQ A;  3P5P A;  2I07 B;  1KSD A;  1GAI A;  3P2C A;  4LIX A;  3M7E A;  2ZZR A;  4AYR A;  4GTM B;  4CE7 A;  1UG9 A;  4AYQ A;  1D8E B;  1L2A A;  3SDU A;  2A73 B;  2F0Y B;  3DPY B;  1N4P B;  5CZL A;  1H3B A;  3S4B A;  3W7T A;  5MEH A;  1H14 A;  4GTQ B;  3SDV A;  2NOJ A;  4KKJ A;  5E2J A;  3M75 A;  1AGM A;  3PZ2 B;  1H37 A;  3EZ8 A;  2BB5 A;  3SQC A;  5DGR A;  3RRS A;  2V3N A;  4FXK B;  1H13 A;  1TN8 B;  3K11 A;  3D5S A;  1KWF A;  4FUS A;  3E34 B;  3PZ4 B;  1NXC A;  1G9J A;  1TF4 A;  2JJB A;  3S9V A;  4GTO B;  3W5M A;  1WU4 A;  1O1S B;  2DRQ A;  1FP3 A;  1VD5 A;  5CD2 A;  2EAB A;  3QFY A;  2FBA A;  3DSW B;  1FO2 A;  3Q7F B;  1SQC A;  2GZ6 A;  3QRY A;  3W7W A;  1FCE A;  2PN5 A;  1KKT A;  4MBG B;  3SDR A;  2JF4 A;  2AFA A;  1S63 B;  1KZP B;  4EHM B;  1KFG A;  1G87 A;  3KLS A;  1O1R B;  2VN4 A;  3SFX B;  2OKX A;  1GHQ A;  2V8I A;  1TNZ B;  1DL2 A;  3W7X A;  1IA6 A;  4GL3 A;  2XWJ B;  4M76 A;  5FO8 B;  2D5J A;  1GXO A;  1X81 B;  2SQC A;  2WY8 A;  4L0G A;  4JJJ A;  3RX8 A;  2EAC A;  1CLC A;  1O79 A;  3GT5 A;  3E33 B;  3KSL B;  3DRA B;  1KRE A;  5JPN B;  2H6G B;  3DSV B;  1H3C A;  1NI1 B;  3Q78 B;  3T33 A;  3DSS B;  2ZBL A;  4EL8 A;  1W6K A;  1TNO B;  3E6U A;  4WVB A;  2WYN A;  3QFZ A;  3DSU B;  1SA4 B;  4Q2B A;  3D5R A;  3WC3 A;  4GTS B;  1HZF A;  3K7X A;  4GTT B;  1F9D A;  2CQT A;  4QT9 A;  2G0D A;  2WIN B;  1N94 B;  3M77 A;  1ULV A;  1GAH A;  3ACT A;  3M7B A;  3HXC B;  3QG0 A;  3WIQ A;  4GTP B;  5GW7 A;  3HXD B;  2RI9 A;  4KTP A;  3ANK A;  1O6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...