3D5UA

Crystal structure of a wildtype polo-like kinase 1 (plk1) catalytic domain.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
288
Chain Sequence
LKEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the wild-type and activated catalytic domains of Brachydanio rerio Polo-like kinase 1 (Plk1): changes in the active-site conformation and interactions with ligands.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
molecule keywords Polo-like kinase 1
total genus 76
structure length 288
sequence length 288
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d5uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d5uA01
3ORLA 3IW8A 1BL6A 3VBXA 5TT7A 2ZB0A 3FUPA 4MBLA 1E9HA 4FTNA 3ULIA 4QTEA 3REPA 4JR7A 3IKAA 4L3PA 4N0SA 3PLSA 3SDJA 1H25A 3V8SA 1IG1A 4AW1A 3PSCA 4BKZA 4F1MA 5IEXA 2WMWA 2GS7A 4KSPA 3QFVA 3CSVA 3KRWA 3W33A 2XKEA 3QC9A 2YM8A 4I4FA 4BCJA 3QLGA 4O21A 4B7TA 2EU9A 2J9MA 2Q0BA 4FMQA 4QQJA 3KULB 1W82A 5AMNA 5FM3A 5I9UA 5M51A 3TNPC 4O82A 4HCUA 2VWUA 2W05A 2VWVA 3NEWA 4FNYA 2UZUE 1LEZA 4OTDA 2BHHA 3LCSA 3ORXA 4FNXA 1L8TA 3MN3A 3Q4CA 1GIIA 5I3OA 4TWPA 4V04A 4AOTA 3ID6C 4DH7A 5M56A 1WZYA 2JAVA 4RVLA 5E1SA 2Q83A 5I0BA 3MS9A 3NDMA 5FBOA 2VTSA 4FV5A 4R3RA 4U8ZA 5LCJA 3ZC6A 4OW8A 2GS6A 2WAJA 4I0RA 2PVKA 2PVMA 3DB8A 2BPMA 5KHWA 4NJ3A 3BGPA 5HVJA 4YC8A 3WZJA 4XG6A 3EIDA 3R9OA 1UA2A 4BYJA 3W2SA 1PMVA 5ACBC 3OZ6A 2WQMA 4BVUA 3R9RA 2UZWE 3II5A 3POZA 4CRSA 3P7CA 4HCTA 3ORKA 3S95A 4MK0A 3L9NA 4PL4A 4I93A 2I0YA 3QCYA 3R21A 4FZFB 4IFGA 4QMLA 3V8WA 5K3YA 4JBQA 4BDKA 2W4KA 5IISA 3GOPA 2VO6A 4KIPA 2W7XA 2QOCA 4AOIA 4BCQA 4LMUA 4RIYB 1Q3WA 1WAKA 5BQ0A 2RIOA 1W83A 2IVTA 4ANMA 3QTZA 1OITA 4JT3A 4I94A 1F5QA 3D15A 4Q5HA 3Q60A 5K0XA 2PHKA 1Z57A 1TVOA 4IWDA 4FKRA 4HYHA 3R9DA 1XBCA 4DTKA 2CNVA 3OTUA 4EK6A 3DKOA 3NW5A 3BU3A 4F64A 4ANOA 4C59A 3KEXA 4U40A 1H01A 3PP1A 5E4HA 2XMYA 3H3CA 5CF5A 2WMXA 1Q24A 3U6HA 3KFAA 4QYEA 2C3LA 4QMZA 2R3GA 4RLKA 4LG4A 4Y46A 4JLCA 5CSXA 4YTFA 5CEMA 1K9AA 2C6LA 4FC0A 4M15A 4FTCA 5ACKA 4NYEA 3AD4A 2HCKA 4UWCA 5ANKA 1V0OA 4ZY4A 2OZOA 4FA2A 2UW0A 2WMVA 4RMZA 2XK3A 4CMOA 1XR1A 3RWQA 3WIKA 5JGBA 2C6EA 4IC7A 3VS1A 4EH7A 4G2FA 3LMGA 4MQ2A 4EOKA 2OK1A 3QZIA 3KXNA 2ITWA 5HO6A 2XK9A 5H2UA 2R3JA 3PY1A 3Q96A 2P55A 2CDZA 2JDSA 3AT2A 4RJ5A 2JC6A 5EDPA 2QLQA 3NGAA 1YQJA 4A06A 4BCFA 1MRUA 4FX3A 2IW8A 1J7UA 2WQEA 4CMTA 3CXWA 3AC4A 5L6OA 3KREA 1SNXA 2OBJA 3OXTA 4YO4A 4RJ4A 4R6VA 2I40A 4Y5QA 5ANGA 5BMSA 5CU6A 3PE1A 2YFXA 2WQBA 4UY9A 5A46A 2C3KA 4NWMA 2WTJA 5HNIX 3RAIA 3M2WA 3FBVA 4Z7GA 3ZFMA 4EOPA 3GC8A 4CFVA 4FZ6A 3PJ1A 2OO8X 1YW2A 3HMPA 3QZFA 1BMKA 2V7AA 4GVJA 1APME 3F3UA 4U79A 3PRIA 4C3FA 4Q9SA 2QONA 4F70A 3PWDA 3NCZA 3DAKA 4HGLA 4EH6A 2PE0A 4D0XA 2EUFB 4AAAA 3U6IA 4DT8A 2EB3A 3C4CA 3CQUA 1H1PA 4D4RA 4ZZOA 4FKPA 4DH1A 5C8MA 4M13A 4IDVA 2A27A 4EOOA 3HV6A 1CDKA 3FMKA 3BBWA 3MA6A 4YJRA 3L9MA 3I0OA 5AX9A 4ACDA 2PVHA 3G9LX 5DH3A 4CFMA 4FZDB 4R7HA 4D4VA 4E6QA 4YLLA 4UN0C 1PRYA 3DLSA 3TUDA 5I9XA 2JD5A 2PUNA 1KE7A 4X7QA 4W8EA 4QYYA 3D7TB 5DT3A 3D5VA 3VNTA 3Q4TA 1JPAA 5IH4A 3DTWA 3LFNA 4HVGA 4N57A 4D4YA 4OBQA 1H08A 3R83A 3HZTA 4ZEGA 4BZOA 3NZ0A 4PQNA 4OBPA 5HORA 3E8NA 3HUBA 5JMSA 1H4LA 3KXMA 4EKKA 4TXCA 3DKCA 4CFNA 4H3PA 4LOOA 4HNFA 4AW0A 2BAQA 4GIHA 2QLUA 1GNGA 2Y4IC 3MB7A 5H9BA 4BDGA 3SQQA 2W1DA 4WNKA 4L43A 1M2PA 2PZIA 3PA4A 3O7LB 4N4SA 4QOXA 3CKXA 3P86A 3D14A 3E64A 1ZWSA 4I3ZA 4C38A 5IG1A 5GIPE 4PL3A 2C5NA 3R01A 4TYHB 4N6YA 2G2FA 4I24A 4H39A 3BHUA 2V7OA 2WTVA 2VGPA 3TNHA 4HNIA 4D9TA 2VN9A 4G17A 5EOLA 4B9DA 4MXOA 2PVNA 3QD0A 1FGIA 2BMCA 2R3RA 5G6VA 2RFNA 4C3PA 5KHXA 5DVRA 1KOBA 2UZLA 4NJDA 4E20A 3UO5A 3SOCA 3LMHA 1HOWA 1UV5A 2H96A 3JY9A 3GU7A 4NKAA 4Q9ZA 4RX5A 3F7WA 4A4OA 5KO1A 5BUIA 2WO6A 4NUSA 5HO8A 2FSLX 2UV2A 3M42A 4GRBA 3G6HA 1DI9A 4GG5A 4ITIA 3LIJA 4WD5A 5GZAA 4R7BA 3VBTA 3PVGA 4IZ7A 3MVLA 2E9VA 3PXKA 2ITUA 5CU0A 1GZ8A 3ANQA 3DXPA 3N4UA 5A14A 3LJ2A 2IN6A 4Z9LA 1IA9A 4WHZA 3N4TA 3OF0A 3SLSA 5A9UA 3BLHA 2XIRA 3HVCA 3S3IA 4A9SA 4ANBA 4QQTA 1TKIA 4E73A 5C01A 5CF6A 3EQRA 1SMHA 3KF7A 3OWLA 4RX9A 3R9HA 2PVYA 3BQCA 3TTJA 4BGQA 1Y6BA 3AGMA 3F88A 2QO7A 4FV0A 5AAGA 3OWJA 1PY5A 3F7ZA 3HMOA 4H1MA 4QRCA 4RIYA 4TYGA 3RGFA 4G3FA 3VHKA 1J1CA 3BX5A 5TOZA 3CD3A 5EM7A 2C5YA 3ZRLA 4FNZA 2C6MA 3N9XA 3PA3A 4IJPA 4EHEA 3DGKA 3PUPA 3F3TA 4P7EA 3VBWA 4QQCA 5J5SA 2QOQA 5A6NA 2XIXA 2GQGA 4KA3A 1RDQE 1R0PA 4NM0A 2ZB1A 4KWPA 3EQIA 4X3FB 2Y6OA 4BTJA 4IWQA 3LQ5A 1VJYA 3LFBA 3R22A 5CVHA 4C0TA 3SG8A 3ORIA 5F9EA 3TWJA 4GU6A 5FXSA 4D4SA 5CXZA 1O6KA 3BZ3A 4V01A 3SV0A 2XCKA 4LV5A 4FK3A 1FMOE 1CKIA 3FC2A 3LM0A 5DE2A 4I41A 3R7VA 2HW7A 3U4UA 3EHAA 4JQEA 4JG8A 3FI4A 4CV8A 3UZTA 2XYUA 5L3AA 2ZV9A 5EOBA 1ZRZA 4ZTSA 4MH7A 3UJGA 2GS2A 4L01A 3UO6A 3E63A 2C3IB 3BEGA 3EL7A 2H6DA 3QQUA 3E87A 3QUDA 4FEWA 3GB2A 4EOLA 1Q3DA 2CGWA 1XO2B 3R7EA 2HAKA 1PMNA 1ND4A 3S2PA 3OWPA 2YHVA 4M12A 4EKLA 1FOTA 3LCTA 3QD3A 3UQFA 4F1TA 4DCEA 5EK7A 5BUEA 5LJJA 1TQMA 2C47A 2VWWA 4G6LA 4LUEA 4ZTRA 2GNGA 3E62A 3KMWA 4TNDA 4QPSA 3ZS5A 3KCFA 3EQHA 4X2GA 1ZOEA 4BI0A 3AMYA 4NCTC 4YZBA 4L46A 3A4OX 2R3KA 3G6GA 3ORTA 4HJOA 4NFNA 4G5PA 2QOKA 5DMZA 4ONAA 3TNWA 3LJ1A 4MD9E 4BHZA 3I5ZA 4D5KA 3MA3A 3D9VA 4UXLA 4L44A 4FICA 4RJ6A 3TXOA 2OFVA 3WF9A 3DK3A 5E7RA 2X7FA 4ZS4A 1CMKE 2CLQA 3CQWA 4YJTA 3TN8A 1QMZA 1H1SA 1OPLA 3TKUA 4ORKA 4EH4A 2PWLA 1GOLA 4CZTA 4FGBA 3FSFA 5EQPA 3P4KA 5AP7A 3SRVB 4DTBA 2C5VA 2G2IA 3MJ2A 4U81A 2ERZE 4M3QA 1Y57A 2Z7SA 3C0GA 1UNGA 4JI9A 3UMWA 3DCVA 3MV5A 4BBEA 4E4MA 2QG7A 5IQBA 4EJ7A 4D2SA 2VO3A 3MIAA 4O0SA 5IDNA 5HBJA 3PZEA 4IADA 2I0HA 4GVAA 3E8DA 4PL5A 4TRLA 1QPEA 4F09A 1ZLTA 2PUUA 5DFPA 3SD0A 5HNGA 1LPUA 4RIWB 5DHJA 4AACA 5AX3A 4AT4A 3AMAA 2H8HA 2ZAZA 3N51A 2B0QA 1JOWB 1ZYLA 4QYHA 4PPCA 5IDPA 4L00A 4K33A 3P5KA 3UG2A 1PMUA 4HGEA 4O0TA 3R8LA 3DNEA 4IWPA 3OMVA 5ANEA 2W5AA 4MD8E 4HPUE 3BYVA 5AAFA 4BCPA 2C4GA 2YM6A 3TZ8A 5AUTA 2C69A 2P4IA 1U59A 2BROA 2ITXA 1LP4A 4GMYA 4IVAA 4AXAA 5FGKA 4D9UA 4DTAA 4HYSA 5AAEA 1XBBA 3GVUA 1PW2A 4K2RA 2R3IA 3BIZA 3RPSA 4UX9A 2IVVA 2LGCA 1KV2A 4HZRA 4BWPA 3R8ZA 2CNUA 4I5HA 4R77A 3DV3A 2BRHA 3KB7A 4EOMA 2JDOA 3OT3A 4XHKB 2QR8A 3RCDA 2PK9A 4FKIA 4ZOGA 4PMSA 4X3FA 4XG2A 3RWPA 4Y73A 3GCVA 3DU8A 5BNJA 4KNBA 3ZO4A 1YHVA 4O86A 3ITZA 5FDPA 4UB7A 2XKCA 1IRKA 3H9FA 2O63A 3PJ2A 3Q6UA 4NIFA 5HLPA 3RZFA 4BWXA 3SW7A 2FSTX 5E8VA 4QQ5A 1OPKA 4GKHA 4Y83A 3QKMA 2GTMA 5FP5A 5IMXA 4F9YA 2X81A 2UVXA 4IC8A 5EH0A 2J5FA 1QL6A 4DEBA 2FH9A 5FM2A 2YABA 4GT3A 2J5EA 4YGAA 1QPJA 3H0ZA 3QA8A 4I5MA 3LXNA 4JDHA 4X2FA 4RFZA 3ROYA 4R5YA 4DBXA 1NA7A 1PJKA 4BYIA 2C6KA 5CT0A 2O8YA 3TUBA 4YTHA 3NAXA 2XUUA 2VTLA 4JBPA 4RFYA 4RJ7A 2ZM3A 4PX6A 3D7TA 2JITA 4GEOA 2YCSA 3OOMA 3IONA 2W06A 3WF7A 3DZOA 3KK9A 3PDTA 3C4ZA 3DJ6A 3UVPA 4ZK5A 2H34A 1J91A 2XS0A 2FB8A 3QALE 2QNJA 3QD2B 4IB5A 3NIEA 4OR5A 5EYMA 1Z5MA 3WF5A 4CFXA 4CV9A 3I5NA 3PYYA 4AOJA 5CALA 3ET7A 2JLDA 2QKRA 2W1HA 4Y8DA 4EZ3A 3ZRKA 1B38A 1ATPE 3IG7A 3OS3A 4L53A 4EOQA 1SVGA 2UVZA 2YA9A 2IJMA 3RPRA 4FSWA 5DIAA 3RHXA 4M68A 2BIYA 3GFWA 2R3LA 2X6EA 3G5DA 3GCSA 5J5TA 4DEHA 4BDDA 3ZZEA 4LRMA 4ZIMA 5KMOA 2UZVA 3CCNA 4YSMA 2PPQA 3EKKA 4Z55A 1JKLA 3DBFA 2F7XE 3QU0A 3O71A 5L2SA 5HVYA 4RC4A 4MQ1A 3VW8A 4LM5A 3PPKA 3NUXA 4OTRA 3ZFYA 3ZBFA 4FBXA 5DWRA 2UZNA 3UOJA 3O8UA 3A61A 3C4EA 3W8LA 3NYNA 4C33A 3WYYA 4QNAA 3HMIA 4E4NA 2ZOQA 3C4XA 3ZUTA 2W9FB 2QOHA 4QYFA 3F9NA 3OD6X 4NU1A 2X2LA 4GS6A 5EI6A 5HU9A 2J2IB 4N70A 3ZMMA 3SXSA 2WB8A 5I9YA 1XH5A 4FEXA 5EHLA 4O1OA 4FR4A 3KKVA 3VS6A 4H58A 4ACCA 3FQSA 5F94A 5HTCA 3OY3A 4RPVA 3L9PA 5EW9A 4ACGA 3L8VA 1ZZLA 4MXZA 4QYGA 3I7BA 4UXQA 2QG5A 5IQFA 2HOGA 5T3QA 3FLQA 5D1JA 3A2CA 3V5WA 1OMWA 3E7OA 5A4TA 4CKJA 3DS6A 5IA4A 1G5SA 3GT8A 3SX9A 4M0ZA 4K11A 2QOBA 2WGJA 4O0RA 2ZV2A 1XJDA 1V0PA 2F2CB 4FNWA 4WSYA 5L6PA 2YIXA 3FI2A 3ENHA 5HZNA 4O0UA 3EQGA 4B8LA 5K5XA 3QGWA 4R1VA 1OGUA 2R9SA 5CI7A 4FKLA 3FEGA 3K3IA 2VTJA 4IB1A 3OT8A 2XKDA 4UEUA 5FTOA 1Q97A 3EMGA 5T68A 3ODZX 4Y85A 4DFLA 3HMMA 4MBJA 4ID7A 4PDSA 1BX6A 2E9UA 2VWZA 4FVQA 4RZWA 4FG9A 3CJFA 2YDIA 2XRWA 4IVBA 3KXHA 1XH9A 3LFQA 4RX7A 4NW6A 5KMLA 3JVSA 5JSMA 3Q5IA 3BGQA 3IGGA 3PPZA 4J95A 4JX3A 4FF8A 2WTWA 4BICA 3WBLA 5AFVA 3L8PA 1KE5A 2CCIA 4C34A 3QCSA 2JFMA 3RK5A 3T9IA 4DINA 2VWBA 2X39A 3R1SA 1U5RA 4J8NA 4LGGA 4ZLOA 4D58A 4MNFA 3FLZA 4DFYA 5EQEA 2NRYA 2VTIA 1H00A 3F5UA 3PIXA 4K18A 4IM3A 2VTTA 2E9PA 4PV0A 4Y72A 2CSNA 4F0FA 3CIKA 2O3PA 2DYLA 2FSMX 2UW7A 4M84A 5B7VA 1ZAOA 1WBTA 3TIZA 3ZUUA 2GHGA 2X9FA 4FT0A 3UNKA 5LWMA 5IQDA 3ZM4A 2WMUA 4XG9A 4W9WA 1MUOA 2KTYA 2W5BA 3NWWA 4DG0E 3LQ3A 4EH2A 3UO4A 1O6YA 3A8WA 4WOVA 1WBWA 3KRJA 4NTTA 4CG8A 3OBJA 3F2AA 4MBIA 4F7JA 2C0OA 5AV2A 1MRVA 4XG4A 4FEVA 1GJOA 2V55A 5GIOE 3MW1A 3Q4ZA 2F7ZE 2OH0E 2C3JA 2VTAA 5DR6A 3NYXA 4IZAA 2B4SB 3DZQA 3R6XA 4XV3A 3TACA 5CASA 2I0VA 3OVVA 5IUIA 3G9NA 5B2KA 4ASZA 1UU9A 1YI3A 5J9ZA 4FIIA 2PZYA 4QTBA 3F3WA 3OWKA 2BHEA 4G5JA 2OW3A 2JBOA 3NPCA 4XRLA 5IZFA 3AC8A 3R00A 1RQQA 2A19B 5EW3A 2PTKA 4W8DA 4XV2A 4NZWB 3UOHA 2X0GA 1M17A 4CSVA 2CKEA 2Z8CA 2VAGA 4DA5A 2BRBA 3OEZA 1R3CA 3F5PA 4F65A 3COIA 5AP2A 3C7QA 4BRXA 4ZTQA 2NNWB 3PSDA 4PF4A 4QP7A 1CKPA 5HEZA 2QHMA 1OZ1A 3O50A 4KKEA 5CQWA 4V0GB 4D2PA 3KRRA 3DNDA 3LHJA 3R1QA 5AP3A 5JZJA 4PP7A 1JSUA 3KU2A 2R4BA 4O7NA 1BL7A 5FD2A 2AYPA 1W7HA 2XK7A 2Z7QA 3OROA 3NYVA 4XJ0A 4KRCA 2UW9A 4LQMA 3EL8A 4AUAA 4RWKA 5JEBA 2GTNA 3MY0A 2Y6MA 3QXPA 4DT9A 3C0IA 1W98A 5AP4A 3TEIA 4FIFA 3PY0A 2OFUA 4YO6A 4YLJA 1ZY4A 4FEUA 2UZEA 5GJGA 5BPYA 3BLQA 4FKUA 4DFXE 4CGAA 1JKKA 4C37A 2WELA 3WILA 4S33A 4WRGA 4E6AA 4FTMA 4O7YA 2DS1A 5AV0A 3IS5A 3RP9A 2X2KA 5L8JA 4K77A 5L4QA 4IAIA 3LMIA 4W4VA 3GC9A 5EKNA 2BILB 3UPXA 4F9AA 3HV5A 2GNLA 4FE2A 3V5JA 1WFCA 2OIDA 4QO9A 4YJVA 1ZXEA 2PULA 1O9UA 4USDA 3TM0A 3OEFX 4EBVA 4GK4A 3ORZA 3QWKA 3ZM9A 4RG0A 4UZHA 4ZSEA 4LL5A 3T8OA 3WARA 5JRQA 3ZU7A 1ZY5A 1R0EA 5FEDA 3UIMA 4XLVA 2PL0A 2GHLA 3O7LD 1Q99A 3C9WA 4O2ZA 4YJQA 4CRLA 2HXQA 4L8MA 4EUUA 4O6EA 3O51A 5KBQA 5C27A 3GCQA 2VWYA 3K5UA 5H8EA 3TT0A 4IAYA 3DLZA 3NAYA 2OICA 4FSNA 2WTIA 4U3YA 5CYIA 3RM7A 3SGCA 1H1WA 4I5PA 1JSTA 4D2VA 3FJQE 2X4ZA 3P1AA 4EJNA 3FMLA 2YERA 4LGDA 4XG8A 1KV1A 4EH8A 3OUKA 3KK8A 4QP3A 3Q32A 3LOKA 2X8EA 3TKIA 4Z7HA 2WMAA 1XHAA 2P3GX 2RG5A 4LYNA 4DBNA 3VUMA 4K6ZA 3BQRA 3ORMA 4LOPA 5CS6A 2BRNA 3FY2A 5J7HA 4O2PA 2GNJA 2V5QA 3IW6A 5HE0A 1UNHA 4S31A 3W32A 5AA8A 5LVMA 2XRUA 1K2PA 2F9GA 2GHMA 2W99B 3QQFA 4HOKA 5AP1A 4DHFA 4PP9A 5HNBA 1GY3A 3E5AA 4XV1A 4JIKA 3UBDA 1I09A 4DF3A 3EYGA 2UW8A 3D94A 5BVDA 4DGNA 1U46A 4DFZE 1Q8YA 3C1XA 3CC6A 4A9UA 3S1HA 4OTFA 3OXZA 3WZKA 4YURA 4IQ6A 1UKHA 2ERKA 3R7OA 4BHNA 3QQKA 3PJCA 3MPTA 4WUAA 3ZC5A 4AN2A 3AT3A 4AE6A 3TV7A 5CEPA 3QKLA 4GYGA 1BUHA 1PXMA 5DNRA 2XK4A 5TO8A 4GU9A 2VNWA 3MYGA 5AA9A 5CU4A 3A7IA 3JVRA 5JFWA 4YUQA 2J0IA 1Q61A 5FEEA 1WBOA 3AD6A 1H28A 5C26A 2JKKA 3E8EA 3NVMB 3DFAA 3NVKI 2CJMA 1JLUE 3VQUA 3CLYA 4QTCA 1TQPA 3GQLA 2Y4IB 4GG7A 2OI4X 3EB0A 5FXRA 1JBPE 4NSTA 4C02A 4WG4A 4F6UA 2QOFA 1LEWA 3DBDA 3CEKA 3ERKA 1FVTA 2BZIB 5KZIA 4M69B 1OKVA 4I21A 4X21A 5L2QA 1OIQA 1M14A 4C62A 4HPTE 2XNNA 3HYHA 4JAJA 4JG7A 4JS8A 4FSRA 3U9CA 3NLBA 3O23A 3U9NA 4RA4A 4RIOA 1J7LA 2OH4A 4KABA 4KRDA 5HIBA 4ZZNA 3MFRA 5D41A 4ZSJA 4P2KA 5E90A 2YWVA 1U54B 2R0UA 4XBRA 3ZYAA 2VTOA 2YLFA 2PVLA 3CTHA 2UVYA 4L6QA 2QU5A 3UQCA 1VR2A 2XIYA 3TTIA 5LVPA 4G3DA 5LMAA 4ZSAA 4JDIA 4EUTA 4KS8A 3NS9A 5E92A 3ALOA 3E92A 3QTSA 1XH8A 4HVSA 3C0HA 1YHSA 2QCSA 2ZV7A 4WG5A 1JKTA 3D5XA 4R5SA 5DEWA 4EQUA 5ETFA 3BYSA 2V22A 4GT4A 5JFSA 3A62A 4OTIA 3DKGA 4C36A 3CD8A 4ZXTA 3GGFA 1OUYA 4QMYA 4FV9A 4A4LA 5F20A 5L8KA 3FHRA 4BCGA 3NUPA 2WEVA 3DXQA 3DJ5A 4C58A 4FKTA 1OL1A 3OC1A 4YU2A 5CZHA 3MDYA 4I4EA 5AWMA 3KF4A 3WF8A 2RGPA 5AR8A 4IW0A 4BY9E 3W2QA 4I22A 2ZDUA 3KA0A 4F9WA 4H3BA 1F3MC 2ESMA 3DT1A 4FGRA 1VYWA 3QQJA 4J99A 4GFGA 4IX6A 4NEUA 3NR9A 4RLLA 1FQ1B 2WNTA 4IANA 4BCIA 4U5JA 4UMQA 3R2BA 4F7SA 1OBDA 4RIWA 5KKRB 2IO6A 2P2HA 2A0CX 2OJFE 4QMTA 3KN5A 4RSSA 2NO3A 3C4WA 5ICPA 4ZMFA 4G6OA 1H8FA 2E9OA 4M7IA 4U9AA 4BI2A 3UC4A 3AT4A 4XG7A 3WOWA 5IUGA 4O7ZA 3TDVA 3NCGA 4Q5EA 4UWYA 3CPBA 5K4IA 5EHOA 2JKMA 5JGDA 2XVDA 3G0FA 5EI2A 4QTDA 4R78A 4AA5A 3ZCLA 5FTQA 3VS7A 4W9XA 3QWJA 4FOBA 5CXHA 1WBNA 2PSQA 3HLLA 5C8NA 2VGOA 1PYXA 2VO7A 5C1QB 3EN6A 3KRXA 3WZEA 4XYFA 4E26A 2Z7RA 5BVEA 5DEYA 3RAHA 3EQDA 5L2WA 3I4BA 4XUFA 1JAMA 4HGSA 3CP9A 4GT5A 4JBOA 2WOUA 2YM7A 3E93A 4PTCA 4O83A 4CLJA 4WG3A 3DY7A 3RI1A 5FBNC 2BIKB 5AP6A 4CT2A 4MNEB 5CQUA 4C4GA 1YWRA 2W1EA 5E91A 3DAEA 2W1FA 3UNJA 1W0XC 4AA4A 5J7BA 1P4FA 1KUTA 1KSWA 3ENMA 4OT6A 4S2ZA 3OY1A 3VS5A 4UMRA 1NT2A 4UMTA 4EC9A 5HCXA 3MFSA 4ZJVA 3W10A 3QA0A 3VBVA 5LOHA 4QMQA 1BKXA 2HWOA 4BC6A 3FZPA 3ZLWA 4L7SA 4AFJA 2P2IA 2W0JA 4L9IA 3NNWA 3PVUA 4KINA 3DBCA 2W4OA 3Q9YA 2QU6A 4FSQA 2IW6A 4NCTA 4DYMA 1DI8A 1JNKA 3I6WA 4FUYA 3E8CA 3TI1A 3ZLYA 3BWJA 2XZSA 4DEIA 4FL1A 3HV4A 4AX8A 2HYYA 4E5WA 4PTGA 4ZY6A 4B8MA 3GUBA 2QQ7A 3OBGA 3LFFA 4J7BA 1OKZA 3VAPA 4ZY5A 2C5OA 3UYSA 2OWBA 3PJ3A 5AUWA 4YJOA 3O8PA 1VEBA 5AJQA 2B53A 3FZTA 3UOKA 4TWNA 4EHGA 3Q2JA 4FTUA 4G3GA 3MI9A 3GU6A 4BIBA 3PSBA 1J1BA 3IW7A 3JY0A 4FTAA 4G9RA 4NTSA 2A2AA 2ITYA 2X8DA 4ENYA 4BZDA 4MVFA 3NW7A 3EN7A 5DR9A 3GEQA 3QC4A 3K3JA 1H07A 4IM2A 4NK9A 5I9ZA 4U45A 3V5PA 1FPUA 4J8MA 3O17A 2VX3A 4CD0A 1UWHA 4IMYA 1IA8A 3LLAA 3QRTA 1AGWA 1Y91A 2WXVA 3GENA 3RNIA 1GZNA 2W5HA 3FYJX 4PPAA 3EN4A 3VBQA 4O6LA 5EM6A 4F9BA 2KULA 2JFLA 5AR2A 4TT7A 4FT3A 4J96A 4V0GA 5IKWA 4AN3A 1JSVA 4D0WA 4RVMA 2XIZA 4YMJA 1ZOHA 5A54A 4DE4A 4ZJJA 2V0DA 5HU3A 5M09A 3ZDIA 4U97A 4Y5HA 4ASXA 5AR7A 1R78A 3BPRA 2RKUA 3PIYA 5IUHA 1SYKA 4YNOA 3Q9WA 2YN8A 5A4EA 5BVFA 3GU4A 4FIGA 4DGLC 2R0IA 3LLTA 3ZHPC 1H26A 4L42A 2J0JA 5CANA 4BWKA 1IAHA 3PXYA 4PRJA 4ZSGA 3PY3A 3ORPA 4YZ9A 3UDBA 3WZDA 4E7WA 3OP5A 4GK2A 5HTIA 2Y9QA 1VYZA 1MQ4A 2UW4A 1V1KA 3QTRA 1VZOA 2IZTA 4KSQA 3VUKA 3ZEPA 3MSSA 5HD7A 2XNMA 3K2LA 2ZDTA 5IQAA 2XP2A 3EQFA 4EQCA 4FIJA 3W1FA 3JYAA 2XJ0A 3V5LA 4GIIA 3TZ9A 3A8XA 4QMSA 4U0IA 3Q9XA 5HBHA 4D1ZA 3QL8A 1Z9XA 4FV3A 4WUNA 3ROCA 3TCPA 2G2HA 5E9EA 5AR5A 5CU2A 3COMA 2HXLA 3S4QA 1ERKA 5TKDA 4G1WA 3R73A 3QX4A 3SA0A 3BV2A 3VHEA 2W1IA 2LAVA 2EXEA 2UZDA 4ALUA 2BAJA 3LCKA 4FIHA 5JKGA 4DITA 1KE8A 5EDQA 4IFCA 2ZJWA 4FKSA 1SM2A 2WMSA 3BI6A 4QP9A 4ANQA 2X1NA 4BDJA 3RKBA 3VUTA 4EZ5A 3M11A 1UWJA 3U51A 4OUCA 3HV7A 5H3QA 5IA3A 1OKWA 4IZ5A 4GK3A 4L67A 4DCAA 3ZSGA 4RVTA 2I6LA 4E3CA 2A4LA 3MPMA 3DK7A 2XM8A 1CTPE 2W1CA 3T3VA 4OBOA 4WNMA 4E1ZA 4DFBA 3C51A 5HE3A 3SRVA 3TNIA 4O7VA 3BYUA 4AT5A 4RWLA 3EOCA 1A48A 2XB7A 3KVXA 3FSKA 3WZUA 4C2WA 4YHFA 3COHA 5BYZA 5M55A 4O81A 3FDNA 3F3VA 4EHZA 2HZ4A 5KBRA 3POOA 2OXYA 5CAUA 5LXMA 3OG7A 2JIUA 4OAVB 5CT7A 4O38A 3DPKA 4XP3A 1Q8ZA 3WYXA 4MKCA 4ZLZA 4USEA 3DDQA 3GI3A 3HV3A 5L8LA 2ZMDA 3SXRA 3UZRA 5CNOA 3CGFA 5J8IA 4LRKA 4HYUA 4C4IA 3ZEWA 4JBVA 3NUYA 2VTQA 5AUUA 3BBTB 5A4LA 4MHAA 5LVLA 2R3NA 3P9JA 4IE9A 5AUZA 5HG8A 2BZJA 1ZMWA 3V8TA 4GL9A 3L1SA 1OIYA 4RC2A 2HZIA 4W4XA 2WEIA 2JEDA 3A7GA 2OU7A 2Z60A 4I6BA 1ZYCA 4DGOA 4DH8A 5BYLA 3FPMA 4F0IA 4FKGA 4ZTMA 5A3XA 2FA2A 2QKWB 3MGYA 4DEDA 3DQWA 5JK3A 3AC5A 4JRVA 4EOIA 1Q41A 4C7TA 5JRSA 3PA5A 4YJPA 2BFXA 4FV2A 5BUJA 4B99A 2J51A 4LV8A 5BVWA 4BCKA 2B9IA 5FRIA 3MVJA 3RJCA 3E3PA 3JUHA 3U55A 3FKNA 2ETRA 2W96B 4IAAA 4JNWA 1YDSE 1XQZA 4FTQA 4E6DA 2WFYA 5HG9A 4BTFA 1OL2A 4YC3A 3R8VA 5JZNA 4W4YA 3IW5A 4TYEA 4BTKA 4BB4A 3R2YA 4KKHA 4F1OA 3ZDUA 2CKOA 4M14A 4FSTA 4EHVA 5HKMA 4D55A 3OW3A 2J6MA 4OTPA 4GCJA 5ANJA 4PPBA 1ZYSA 4YP8A 5M4IA 4FIEA 4FTKA 1B6CB 4IX5A 3TIYA 4M8TA 2XKFA 3PLAE 3KGAA 1MP8A 5CU3A 1OM1A 2QD9A 4TN6A 4BBFA 2X8IA 3HL7A 5ANDA 3VJOA 4GFMA 4CT1A 3MTFA 5E8XA 4AZSA 4BKJA 3EFKA 3NUUA 4K0YA 3TKHA 4AA0A 3BCEA 3HDMA 5EM5A 4KBKA 5LARA 5LMKC 1X8BA 3MFUA 5CVFA 2F4JA 4RT7A 3G90X 4F6WA 4BBMA 4O1PA 3CE3A 3F66A 2J90A 3GP0A 4PUZA 3VO3A 4CTBA 2OJJA 4LGHA 5CAVA 5HO7A 1P14A 3GCUA 3KVWA 2WQOA 4NM5A 4YR8A 4KUJA 3Q04A 3FMHA 4FT7A 1Q62A 3VJNA 3ZXZA 5M4UA 3BV3A 3AC3A 3HP5A 4X2KA 5B0XA 2WPAA 1JVPP 1KE6A 1QPDA 2B1PA 3F5XA 5CNNA 3OCGA 3QAME 4CMUA 3BYMA 3QQHA 2PE2A 3HMNA 1YXUA 5I4NA 2VUWA 4ACHA 4AGCA 3ATTA 3BEAA 4XH6A 3R8PA 4YHJA 4CKIA 4CQGA 4ZMEA 5J1WA 4X2JA 4KB8A 4LMNA 2PVJA 3WE4A 3G2FA 2YWPA 1NVSA 4ALWA 5FG8A 4CCBA 4USFA 5DT4A 5LQFA 1FVRA 1P4OA 4RIXA 3VUDA 4CCUA 1H1QA 2ZM1A 2RFDA 1B39A 3QLFA 2Y4PA 1WBVA 3QD4A 2XA4A 4YJSA 3FXZA 4DC2A 1M2QA 5GJDA 2WMBA 3ZBXA 2OJIA 3BYOA 4MNEA 2YCRA 4IAFA 4R3CA 1G8SA 4O7RA 4RX8A 2PVFA 3UC3A 2C30A 2HK5A 4QD6A 1M2RA 4AW2A 2O65A 4ZTNA 3IW4A 5D11A 4O7SA 5ETIA 3IPHA 2WIHA 4U7ZA 4EYJA 2O2UA 3LVPA 4II5A 4H05A 3H4JA 3KCKA 3D2IA 3LFDA 2IZSA 2OG8A 2FSOX 2VD5A 2YM4A 4E4LA 4MXAA 5AP5A 2OJ9A 4FK6A 1J3HA 4WSQA 2O0UA 4E5BA 1WBSA 4FSUA 1CM8A 3V51A 3ZTXA 2PVRA 3ALNA 3GU5A 4DEAA 3HP2A 3R04A 4QMNA 4F08A 4C3RA 4F99A 5GHVA 5GINE 4FV1A 3FLYA 4OLIA 4CYJA 5IA2A 4UV0A 2QO2A 2BCJA 3I81A 4D1XA 2O5KA 4EK4A 1CKJA 4M66A 2BALA 2CLXA 5AR3A 3IGOA 2X4FA 3KXGA 3SHEA 4GV1A 4TWCA 3SC1A 4L3JA 5BVNA 3L8XA 3A7HA 2IVUA 4TY1A 2RFEA 1XKKA 5C4KA 4HW7A 2VTPA 2W9ZB 4JL9A 3F3ZA 4MTAA 4WBBB 4EBWA 4LRJA 1FMKA 4MXCA 4IEBA 3DQXA 1HCKA 4U44A 4XEYA 2ITNA 2Y7JA 3W2OA 4FYNA 4FZAB 3RK7A 3QRIA 4D2TA 3RMFA 4YNEA 5EHYA 2BZHB 3W2CA 1BI8A 5CF8A 4APPA 2QODA 3AG9A 1W8CA 2HY0A 3RAWA 4G34A 1WMKA 4RBLA 1G8AA 1YOJA 2OXXA 4FEQA 3VUHA 4ASDA 3LW0A 4AE9A 4MCVA 5EYDA 3TV6A 3NYOA 3BHYA 4H3QA 3PG1A 4BL1A 1PXKA 4KAOA 4MF1A 3ZONA 2ZM4A 3VQHA 5HCZA 2E2BA 3QKKA 1RW8A 2V62A 2BVAA 4FSZA 5J1VA 3PE2A 2VWXA 3VRZA 4AGDA 4IZYA 3JS2A 3E7VA 3NNVA 4LUDA 3FL5A 2VTHA 2XNBA 2B9HA 4QP2A 4ZP5A 1KOAA 3WE8A 4CQEA 5HTBA 2HY81 4YJUA 2YCFA 5L6WL 5M08A 2B55A 4FG7A 4EL9A 4GKIA 4FSMA 4IVCA 4WT6A 4G6NA 5DR2A 3VS0A 4F7LA 4XOYA 3IO7A 4FOCA 2WTDA 3MJ1A 3QYWA 3LKMA 4XLIA 2I0EA 5J9LA 4R7IA 4ANLA 5HICA 3O2MA 3ZO2A 5CAPA 4FV7A 1GZOA 3UPZA 3RZBA 3VIDA 3QRUA 2EB2A 4WNOA 2VX1A 3CPCA 4FTLA 4CXAA 4IACA 1OIUA 2JGZA 2BFYA 4RWIA 2VX0A 4UWBA 2WD1A 4A9YA 4CYIA 5I9VA 3LFCA 4L68A 4BDHA 3E88A 2HENA 4S32A 3TZ7A 3VS2A 3ETAA 3AC1A 3PVBA 2UZOA 3MBLA 4ZJIA 4IB0A 1IASA 1ZARA 5LMKA 3GC7A 4ITJA 5HQ0A 4HVHA 4QTAA 3QTWA 4TWOA 3VUGA 5D9HA 2YITA 3F61A 3NMUF 4E4XA 3RK9A 4IB3A 3ANRA 4BFMA 2XH5A 3MVHA 5C8KA 1REKA 5HIEA 5KMIA 1E1XA 4FVRA 4CFUA 2R3OA 2B54A 1BI7A 3DBQA 4J1RA 5DI1A 1PXPA 3PVWA 3DDPA 4KIOA 4P4CA 5TR6A 3IECA 3RINA 3U4WA 3UE4A 2DWBA 5KZ0A 2PUIA 4JAIA 5B2LA 3I0QA 3ZZWA 5IH6A 4C4JA 5T6KA 4YPSA 3NX8A 4FG8A 4FV8A 2OGVA 2WIPA 5K0KA 2OZAB 5E8UA 3BWFA 4O7WA 3OCBA 2YZAA 4I92A 2C6TA 3F69A 1JWHA 4BCNA 4F9CA 2ETMA 4GUBA 2IPXA 4FI1A 5FUTA 3GU8A 4ZLYA 3UG1A 3L9LA 4B0GA 3HNGA 4MWIA 2B52A 3NIZA 4NM3A 3UODA 5H8BA 5AUVA 4EC8A 4ZAUA 3H9RA 3H0YA 3ZSHA 4DH3A 2YEXA 4NM7A 1REJA 1Y8GA 3P08A 2SRCA 2FGIA 3AQVA 4PMPA 2GU8A 5LVOA 1YHWA 3CJGA 3OCSA 2PUPA 4C8BA 3CS9A 2QC6A 4FSYA 4QMUA 4EOJA 5KX8A 4LFIA 2OIQA 2YAAA 2VWIA 4B6LA 1OBGA 3HAMA 2XEYA 4UYAA 2OXDA 5FWKK 2PYWA 1R1WA 4I0SA 2J50A 2ITVA 3QYZA 5CX9A 5GNKA 3VF8A 2GQSA 3F2NA 3G0EA 3Q6WA 3R1NA 1DAYA 5KUPA 3T9TA 2XIKA 2BAKA 4RQVA 4YBKA 4ANSA 2IWIA 4MWHA 4D5HA 2Q0NA 2XCHA 3QXOA 4GFOA 5CAOA 4QP4A 5DRBA 3KULA 2JIIA 2YDKA 2F7EE 4BCHA 5JFXA 4AFEA 2GSFA 3VF9A 5D7VA 3FMEA 2R3MA 4M67A 4CG9A 5IU2A 3F5GA 2XM9A 3QRJA 2F49A 4MD7E 1L3RE 2WZJA 4HZSA 4AQCA 1IAJA 4FKJA 1Y8YA 3PXFA 3BHTA 4LL0A 4O0WA 5CY3A 2GMXA 4YC6A 4GJ3A 3TG1A 1FVVA 2XNOA 3D4QA 1O6LA 4IIRA 4CZYB 2CCHA 5A4QA 2XNEA 2Y8OA 3FZSA 3LXLA 2ITPA 3THBA 2YM3A 5TF9A 2FO0A 4L52A 5DT0A 2QO9A 3SW4A 3UIUA 3C13A 4JDJA 4JG6A 4EQMA 5BVKA 4L45A 3QGYA 5HLNA 4BR3A 4S30A 4TPTA 3Q53A 3R7IA 4EZ7A 5BX0A 4EH3A 2C6OA 5DN3A 4MXXA 4F0GA 4AU8A 1PXNA 4PDPA 2C1BA 2VNYA 3ACJA 4BF2A 5JQ8A 3B8QA 5EDRA 3VRYA 4A9TA 5J79A 3MH2A 2VTMA 3TV4A 5FXQA 1RJBA 4XP0A 3MVMA 3BELA 1UNLA 1MQBA 5K4JA 2PMLX 3EN9A 3FWQA 2XBJA 2BTRA 4JQ8A 5CEQA 4O27B 4IX4A 3JR1A 2XBAA 5IEYA 2W1GA 4MAOA 3TUCA 2ITTA 2IZUA 3KC3A 4BGHA 5CSPA 5AUXA 4BDFA 1WCCA 4U41A 2QURA 2QOIA 3FC1X 4I1ZA 4X3FC 2GDOA 5AIKA 5TE0A 4HYIA 4ENXA 2B9FA 5D12A 2X7OA 4G31A 3GCPA 2RF9A 4WKQA 2YZLA 4MF0A 1OUKA 4FVPA 4E6CA 3F2RA 5AIRA 3H9OA 5EQYA 1ZYDA 3BHHA 4L7FA 3R8MA 3QQLA 2ZYBA 4CNHA 1YXTA 4APCA 4U3ZA 4JVGA 3UVQA 3WF6A 2GNHA 3PTGA 2XNGA 2P33A 1PXIA 4NKSA 4BGGA 3R9NA 4A07A 4KD1A 2BDFA 3A7FA 2NPQA 4FUXA 3PP0A 4A7CA 4TZRA 3BGZA 4U42A 2EVAA 5AUYA 3IOKA 3R02A 1IEPA 1FBNA 3FLSA 3VS4A 2BDJA 4RFMA 4C57A 4K8AA 3KN6A 5FDXA 3Q3BA 4ZZMA 3FXWA 4KBAA 5H8GA 1RE8A 5GJFA 5IQEA 3DOGA 3U87A 3FXXA 5ITAA 3QCQA 4IBMA 4KS7A 3QHWA 4O0VA 1UVRA 4IDTA 3WIGA 3P7BA 2JBPA 3SOAA 3V6RA 3LAUA 4QMXA 4I6HA 5AM6A 3VN9A 4YZMA 4QPAA 1S9JA 4QMWA 4X6RA 5IA0A 2JIVA 1F0QA 4XG3A 3UP2A 4ALVA 4KBCA 5JT2A 3D7ZA 1HCLA 2RG6A 5AR4A 3ZLSA 4BIEA 3R7YA 4PMTA 3FZRA 1SVHA 2GNFA 3AOXA 3FL4A 4IAZA 3UGCA 4BTMA 2OIBA 2G01A 2VV9A 1IR3A 1AQ1A 3D5WA 3KY2A 5IPJA 3I6UA 1NVQA 1YXVA 2CGXA 2VTNA 3EJ1A 3IOPA 4RIXB 3C5IA 3CGOA 4ITHA 3EYHA 4MX9A 4C35A 2CKQA 1FINA 3QX2A 1CSNA 3FYKX 3LM5A 4FODA 4JQ7A 4PTEA 5D10A 5EG3A 5CSWA 4O96A 3KMUA 3SXFA 4AT3A 4MEDA 4BCOA 2CN5A 5LWNA 4GSBA 4AZFA 2AUHA 5HIDA 5I5ZA 1XBAA 3EQBA 4OTQA 4I6FA 1QCFA 3IDPA 3HGKA 2WTKC 1AD5A 4P90A 4XP2A 4TW9A 3KXXA 3EZVA 4FKWA 2CGVA 5F95A 3IDBA 3CTQA 4GYIA 4RRVA 1YDRE 4AW5A 3OFMA 2WMQA 4JX7A 2GPHA 2YJSA 4F6SA 2Z2WA 3FE3A 3OTVA 3UQGA 5AV4A 3TJDA 2I7QA 3NUAA 2PMNX 1URCA 1ZOGA 4WRSA 1H24A 1PXLA 4JOAA 4Y95A 4OGRA 5HHWA 5HESA 3A60A 4PY1A 2J0MB 2XEZA 1WVXA 5DBXA 4DEEA 4CEGA 2R3PA 1DS5A 4IM0A 5EI8A 4RVKA 2YISA 3NRMA 3WI6A 3RM6A 4HGTA 4AP7A 5JQ5A 1M7QA 3R7UA 5IQCA 3OCTA 1YKRA 3P78A 2WKMA 1PKGA 4WBOA 4AG8A 5C4LA 3OW4A 4I20A 3G33A 1U4DA 1TQIA 4OAUC 3GFEA 2C5XA 3E3BX 5CVGA 4B4LA 2R7IA 4FTJA 2GQRA 3CY2A 5FTGA 3GOKA 4FT5A 4K9YA 4U43A 4IX3A 1UU7A 5D7AA 4QP6A 5FQDC 4BDBA 3O0GA 3QZHA 4TNBA 2EXCX 4XNEA 1E1VA 2C68A 1DAWA 2W4JA 2ZV8A 4XV9A 3R28A 3ZH8A 5F4NA 4CVAA 2G1TA 3FHIA 2BKKA 4DLIA 4DG3E 3ZUVA 3HEGA 5DYJA 5K5NA 4S34A 5G1XA 1OVEA 4YTCA 3FY0A 3BU6A 4AGUA 4C4EA 3DA6A 3VUIA 3CKWA 4WNPA 2RL5A 5CENA 2YIQA 4I6QA 5AEPA 3JPVA 2WOTA 4JRNA 3TDWA 3K54A 5E8YA 2OJGA 4EWQA 1NVRA 2OZAA 4E5AX 1YOMA 3EH9A 2HWPA 2XF0A 2X2MA 3FKLA 3U54A 2VU3A 3OOGA 2CGUA 1OIRA 4FV4A 3FZ1A 2J0LA 4BDCA 4F7NA 3JXWA 4I5CA 3PXZA 5KE0A 4KIKA 3EFLA 1H0VA 5M06A 5L2IA 3D0EA 3PWYA 4OTWA 2JKQA 3RPVA 3AXWA 1LR4A 3MY5A 4J97A 4AZEA 3RPYA 2XYNA 2OLCA 4FT9A 3DB6A 4XRJA 4AF3A 4IHPA 3NNUA 3RCJA 4DEGA 1ZYJA 1NW1A 3R71A 3UMXA 4BN1A 2BTSA 4BCMA 4CLIA 4BI1A 5DA3A 1PHKA 1GAGA 2UUEA 5ANIA 5BVOA 3RBWA 1PXJA 3A99A 5CSVA 3TJCA 5HGIA 1OL7A 2YLEA 4G16A 4ARKA 5C9CA 2XJ1A 1WVWA 1OECA 4HVIA 5M57A 3RNYA 2HIWA 5K9IA 4IH8A 1W84A 2IZRA 3QTIA 5DG5A 5HG7A 1SVEA 5CF4A 3UIXA 4WIHA 4ERKA 3FMNA 4BIDA 5J95A 2HELA 4W4WA 2RSVA 4D1SA 2PZ5A 3HAVA 2OKRA 3M1SA 3UOLA 4TTHB 2CKPA 5DRDA 3P79A 3I79A 4P5ZA 2RFSA 4DLJA 4QP1A 3BE9A 3W18A 4I0TA 3S00A 2UW6A 3VC4A 2WMRA 3CTJA 3QUEA 4EK3A 2CPKE 4WA9A 5IMEA 3I7CA 3ATSA 3HRFA 2HZNA 3MH3A 4JDKA 3V04A 5IQGA 1LUFA 2E9NA 4TYIA 4FYOA 4NFMA 3F6XA 3I60A 5J9YA 1Q4LA 4RZVA 3LCDA 3UIBA 5E8SA 1WVYA 3NUSA 4RQKA 3FI8A 4AN9A 2XK8A 2J0KA 5IQIA 4YBJA 5C03A 5KMJA 4CKRA 4QNYA 3FAAA 4IJ9A 4J98A 5HX8A 4DFUA 3HA6A 3IK3A 4RA5A 3ZOSA 1FGKA 1V0BA 2HZ0A 2NRUA 1URWA 2OF2A 5GZ9A 1T46A 3C4FA 1R39A 2WU7A 5EW8A 4LI5A 1NY3A 1PKDA 3EKNA 4O91A 4EYMA 3PPJA 5CTPA 4PDOA 1Q8WA 4O7TA 3LCOA 3QCXA 4EORA 3B8RA 1YI6A 3MFTA 2R5TA 5IA1A 4X2NA 4I23A 3NSZA 2YIYA 3QHRA 1OL6A 3ULZA 5CEKA 2PMOX 2YIRA 5CZIA 1OL5A 5AV3A 3VS3A 4KKGA 2QOOA 2X9EA 3BE2A 4ERWA 3DKFA 4FTIA 1STCE 1UU8A 1YI4A 4Z3VA 4YSJA 3KMMA 5HE1A 4G3CA 1PYEA 2ITOA 4TYJA 2F57A 3MIYA 3HA8A 2VTRA 3QRKA 4QT1A 3UZPA 5EKOA 5HLWA 5DGZA 2WU6A 3DBEA 3MH0A 4E93A 5HE2A 3RPOA 4U6RA 3ZRMA 3HUCA 2XJ2A 1M7NA 4FTRA 2PZPA 1H27A 3D83A 3PRFA 5LMBA 1ZMVA 2XNPA 2PE1A 5KKRC 4MYGA 4AZVA 1A06A 2W1ZA 4O0YA 3FMMA 3KXZA 4PNKA 3QF9A 3R30A 4CTCA 3R1YA 3MTLA 4AGWA 4N6ZA 2P0CA 3A4PA 2GCDA 3LFAA 3Q2MA 4Q2AA 4YZNA 4YZDA 2Y0AA 3C5UA 2UW3A 3P7AA 3Q5ZA 1YDTE 5EFQA 3FPQA 3SAYA 5J87A 2ETKA 2NP8A 3LFSA 1G3NA 3DFCB 4BKYA 1KWPA 1EH4A 3OXIA 2W17A 4CFWA 4A4XA 4OT5A 5EYKA 5HX6A 5ANOA 5CLPA 4YPDA 3DTCA 4NW5A 2GFSA 3UVRA 3EFWA 4IWOA 3AC2A 3PG3A 3QTQA 2Z02A 2VRXA 4TYHA 2X7GA 1YXSA 3LE6A 4YJNA 5IF1A 3RTPA 4EK8A 2G15A 3IDCA 2BR1A 1ZZ2A 3EQCA 1P2AA 4J52A 5L2TA 3GXLA 3K5VA 3LQ8A 1PMEA 3QBNA 2ZVAA 3PXQA 3QQGA 5A6OA 1WBPA 2R3FA 3R63A 4KIQA 4NH1A 5FP6A 3CBLA 1UKIA 5JN2A 4M0YA 3UYTA 3KL8A 5CAQA 2QOLA 3FQHA 2PU8A 2R2PA 2B7AA 2WHBA 4CZUA 3NUNA 1XH6A 4BDAA 2HW6A 2WTCA 3I1AA 2BRMA 3QTUA 1MRYA 2PZRA 4G3EA 1Y6AA 2AC5A 4O0XA 4FZ7A 4IVDA 3W2RA 4TL0A 2OSCA 4ZTLA 3VBYA 4RJ3A 4QMVA 1I44A 3A7JA 1PF8A 3ZXTA 4NT4A 5E1EA 2CNQA 4KIKB 2QVSE 2JDTA 5M53A 2YM5A 4R8QA 4EOSA 2BDWA 2FVDA 2YAKA 4ZSLA 5HCYA 5LCKA 3MH1A 4DFNA 3V6SA 4E8AA 4EWHA 3AMBA 4F4PA 3SG9A 3LZBA 4JJRA 1GIJA 3HECA 2PMIA 1OB3A 1YXXA 3PZHA 4MXYA 3ZO3A 3H30A 2J7TA 5LVNA 4YTIA 4WO5A 4DH5A 3R7GA 5GZ8A 4V05A 3DAJA 2YACA 5AADA 1BLXA 2J4ZA 1YRPA 2OF4A 2FUMA 3DK6A 1NXKA 3PFQA 4PMMA 2ITZA 4YZCA 3LPBA 4X0MA 4BDEA 3PXRA 3UTOA 3FLNC 4RJ8A 4YLKA 4TKSA 3ELJA 3SVVA 3HRBA 3KRLA 3Q52A 2WQNA 3FZOA 5DLSA 4XBUA 2QI8A 5A4CA 2FYSA 3MY1A 5DOSA 3VWAA 4JXFA 4UZDA 2JDVA 2DQ7X 4DN5A 4EH5A 5ETCA 1XWSA 3FQEA 2BZKB 4AZTA 4PWNA 5E8ZA 2C6IA 4PNIA 4FKQA 1A9UA 3SKCA 4IXPA 5CEIA 1BYGA 4G9CA 1OPJA 4IAKA 3MWUA 2C0IA 3V5QA 5HD4A 2UW5A 2R3QA 3TL8A 4FKVA 5E8TA 2R3HA 5EM8A 2YJRA 3BHVA 5HBEA 5M4CA 3FMDA 4P5QA 3CR0A 4R1YA 1XH7A 3MB6A 4C4FA 2CHLA 3R8UA 3N4VA 3O8TA 2CMWA 5I9WA 4A9RA 3H10A 3FI3A 4ANNA 4UMUA 4AZWA 1DM2A 4DAWA 3V3VA 1P5EA 3IQ7A 2O64A 3EFJA 3D5UA 3Q4UA 3RVGA 4C61A 4DGMA 3CQEA 3FV8A 4LOQA 1H0WA 2ONLA 3EWHA 4EEVA 4FTOA 1YVJA 3BLRA 3RALA 5JGAA 4X3JA 4EI4A 4M97A 2EWAA 4UALA 3AD5A 3DXNA 2JDRA 1OI9A 5FLFA 4C2VA 2Z7LA 5HVKA 1J7IA 3B2WA 3OUNB 4EH9A 4PDYA 5KNJA 4Z16A 2A1AB 2YIWA 4H36A 4QMPA 3EN5A 3UNZA 3P23A 1M52A 3LXPA 2JAMA 5E8WA 3O96A 4YHTA 2C1AA 5BYYA 4J53A 2G9XA 2UZBA 3FMJA 3ZFXA 4O7LA 2BUJA 4R3PA 2I1MA 2UZTA 3GC0A 5CI6A 2ACXA 4UMPA 2XK6A 4ACMA 5KMKA 2BKZA 4AS0A 1H1RA 4O22A 4GUEA 4AWIA 3BU5A 4UYNA 2PY3A 4NL0A 4BZNA 3GBZA 2AC3A 4EONA 3EZRA 2R64A 1JKSA 4FL3A 4NIFB 1Q5KA 3T3UA 4D2WA 2VO0A 3NW6A 5DPVA 5M4FA 5ETAA 3Q9ZA 3W2PA 2VZ6A 4CFFA 3S0OA 4UBAA 5CEOA 3BKBA 4HVDA 5BMMA 5AV1A 1YOLA 1XH4A 4F63A 2CN8A 1GZKA 1YWNA 3R0TA 4QP8A 3QTXA 3HKOA 3W16A 2REIA 5JH6A 1U54A 1GIHA 3QUPA 1Q8UA 4OTGA 3LJ0A 4RC3A 3U8WA 3PJ8A 4FV6A 3HDNA 3W8QA 4BDIA 1U5QA 4L3LA 5M44A 2ITQA 4XX9A 1SZMA 3FLWA 4EK5A 4FKOA 2YCQA 3QZGA 2WMTA 4DGGA 3TZMA 4O84A 3DJ7A 4GW8A 3VVHA 4M69A 4ZTHA 3OHTA 3ZLXA 2QHNA 3PIZA 3TNQB 4ZS0A 2IVSA 3G15A 3VULA 4JR3A 4XCUA 3UP7A 5IH5A 3EQPA 3ODYX 1Q8TA 3NNXA 1UU3A 4X6QC 3RHKA 3ZSIA 5JFVA 2X6DA 5I3RA 3AGLA 4DG2E 4HCVA 4QPMA 2ONLC 5CSHA 5B2MA 1YWVA 3V5TA 2WTKB 1PXOA 3CY3A 5HI2A 4GJ2A 4GH2A 4D28A 1T45A 3LFEA 3LXKA 4H1JA 2C6DA 2R7BA 3F82A 3MESA 2JKOA 3C50A 4QMMA 3GQIA 4JIAA 4XMOA 3BRBA 1QPCA 3FKOA 4XS2A 3GNIB 3ZO1A 5IA5A 5FEQA 4RWJA 4C4HA 5HG5A 3RAKA 2F2UA 2EXMA 2GFCA 3L8SA 5EYCA 5KCVA 1KE9A 2H9VA 5CWZA 4XOZA 1SNUA 1ZMUA 1OKYA 4D2RA 2C0TA 4U80A 3U6JA 4QMOA 3ACKA 4FL2A 1S9IA 5KMMA 2YDJA 4FTTA 2IW9A 3HRCA 5F1ZA 5M07A 3HX4A 1JQHA 3D2KA 3G51A 5IEVA 2GNIA 1K3AA 3P0MA 5AM7A 2ZMCA 5AP0A 3COKA 2DUVA 2QR7A 3VW6A 3B2TA 2BRGA 4RGJA 2IG7A 3ORNA 3W55A 5HOAA 4ASEA 4K1BA 3KQ7A 5KMNA 3V01A 4J71A 4OTHA 2B9JA 3MPAA 5IQHA
chains in the Genus database with same CATH superfamily
3ORLA 3IW8A 1BL6A 3VBXA 5TT7A 2ZB0A 3FUPA 4MBLA 1E9HA 4FTNA 3ULIA 4QTEA 3REPA 4JR7A 3IKAA 4L3PA 4N0SA 3PLSA 3SDJA 1H25A 3V8SA 1IG1A 4AW1A 3PSCA 4BKZA 4F1MA 5IEXA 2WMWA 2GS7A 4KSPA 3QFVA 3CSVA 3KRWA 3W33A 2XKEA 3QC9A 2YM8A 4I4FA 2ZFYA 4BCJA 3QLGA 4O21A 4B7TA 2EU9A 2J9MA 2Q0BA 4FMQA 4QQJA 3KULB 1W82A 5AMNA 5FM3A 5I9UA 5M51A 3TNPC 4O82A 4HCUA 2VWUA 2W05A 2VWVA 3NEWA 4FNYA 2UZUE 1LEZA 4OTDA 2BHHA 3LCSA 3ORXA 4FNXA 1L8TA 3MN3A 3Q4CA 1GIIA 5I3OA 4TWPA 4V04A 4AOTA 3ID6C 4DH7A 5M56A 1WZYA 2JAVA 4RVLA 5E1SA 2Q83A 5I0BA 3MS9A 3NDMA 5FBOA 2VTSA 4FV5A 4R3RA 4U8ZA 5LCJA 3ZC6A 4OW8A 2GS6A 2WAJA 4I0RA 2PVKA 2PVMA 3DB8A 2BPMA 5KHWA 4NJ3A 3BGPA 5HVJA 4YC8A 3WZJA 4XG6A 3EIDA 3R9OA 1UA2A 4BYJA 3W2SA 1PMVA 5ACBC 3OZ6A 2WQMA 4BVUA 3R9RA 2UZWE 3II5A 3POZA 4CRSA 3P7CA 4HCTA 3ORKA 3S95A 4MK0A 3L9NA 4PL4A 4I93A 2I0YA 3QCYA 3R21A 4FZFB 4IFGA 4QMLA 3V8WA 5K3YA 4JBQA 4BDKA 1OGYA 2W4KA 5IISA 3GOPA 2VO6A 4KIPA 2W7XA 2QOCA 4AOIA 4BCQA 4LMUA 4RIYB 1Q3WA 1WAKA 5BQ0A 2RIOA 1W83A 2IVTA 4ANMA 3QTZA 1OITA 4JT3A 4I94A 1F5QA 3D15A 4Q5HA 3Q60A 5K0XA 2PHKA 1Z57A 1TVOA 4IWDA 4FKRA 4HYHA 3R9DA 1XBCA 4DTKA 2CNVA 3OTUA 4EK6A 3DKOA 3NW5A 3BU3A 4F64A 4ANOA 4C59A 3KEXA 4U40A 1H01A 3PP1A 5E4HA 2XMYA 3H3CA 5CF5A 2WMXA 1Q24A 3U6HA 3KFAA 4QYEA 2C3LA 4QMZA 2R3GA 4RLKA 4LG4A 4Y46A 4JLCA 5CSXA 4YTFA 5CEMA 1K9AA 2C6LA 4FC0A 4M15A 4FTCA 5ACKA 4NYEA 3AD4A 2HCKA 4UWCA 5ANKA 2XALA 1V0OA 4ZY4A 2OZOA 4QDVA 4FA2A 2UW0A 2WMVA 4RMZA 2XK3A 4CMOA 1XR1A 3RWQA 3WIKA 5JGBA 2C6EA 4IC7A 3VS1A 4EH7A 4G2FA 3LMGA 4MQ2A 4EOKA 2OK1A 3QZIA 3KXNA 2ITWA 5HO6A 2XK9A 5H2UA 2R3JA 3PY1A 3Q96A 2P55A 2CDZA 2JDSA 3AT2A 4RJ5A 2JC6A 5EDPA 2QLQA 3NGAA 1YQJA 4A06A 4BCFA 2X0PA 1MRUA 4FX3A 2IW8A 1J7UA 2WQEA 4CMTA 3CXWA 3AC4A 5L6OA 3KREA 1SNXA 2OBJA 3OXTA 4YO4A 4RJ4A 4R6VA 2I40A 4Y5QA 5ANGA 5BMSA 5CU6A 3PE1A 2YFXA 2WQBA 4UY9A 5A46A 2C3KA 4NWMA 2WTJA 5HNIX 3RAIA 3M2WA 3FBVA 4Z7GA 3ZFMA 3UDZA 4EOPA 3GC8A 4CFVA 4FZ6A 3PJ1A 2OO8X 1YW2A 3HMPA 3QZFA 1BMKA 2V7AA 4GVJA 1APME 3F3UA 4U79A 3PRIA 4C3FA 4Q9SA 2QONA 4F70A 3PWDA 3NCZA 3DAKA 4HGLA 4EH6A 2PE0A 4D0XA 2EUFB 4AAAA 3U6IA 4DT8A 2EB3A 3C4CA 3CQUA 1H1PA 4D4RA 4ZZOA 4FKPA 4DH1A 5C8MA 4M13A 4IDVA 2A27A 4EOOA 3HV6A 1CDKA 3FMKA 3BBWA 3MA6A 4YJRA 3L9MA 3I0OA 5AX9A 4ACDA 2PVHA 3W0MA 3G9LX 5DH3A 4CFMA 4FZDB 4R7HA 4D4VA 4E6QA 4YLLA 4UN0C 1PRYA 3DLSA 3TUDA 5I9XA 2JD5A 2PUNA 1KE7A 4X7QA 4W8EA 4QYYA 3D7TB 5DT3A 3D5VA 3VNTA 3Q4TA 1JPAA 5IH4A 3DTWA 3LFNA 4HVGA 4N57A 4D4YA 4OBQA 1H08A 3R83A 3HZTA 4ZEGA 4BZOA 3NZ0A 4PQNA 4OBPA 5HORA 3E8NA 3HUBA 5JMSA 1H4LA 3KXMA 4EKKA 4TXCA 3DKCA 4CFNA 4H3PA 4LOOA 4HNFA 4AW0A 2BAQA 4GIHA 2QLUA 1GNGA 2Y4IC 3MB7A 5H9BA 4BDGA 3SQQA 2W1DA 2A98A 4WNKA 4L43A 1M2PA 2PZIA 3PA4A 3O7LB 4N4SA 4QOXA 3CKXA 3P86A 3D14A 3E64A 1ZWSA 4I3ZA 4C38A 5IG1A 5GIPE 4PL3A 2C5NA 3R01A 4TYHB 4N6YA 2G2FA 4I24A 4H39A 3BHUA 2V7OA 2WTVA 2VGPA 3TNHA 4HNIA 4D9TA 2VN9A 4G17A 5EOLA 4B9DA 4MXOA 2PVNA 3QD0A 1FGIA 2BMCA 2R3RA 5G6VA 2RFNA 4C3PA 5KHXA 5DVRA 1KOBA 2UZLA 4NJDA 4E20A 3UO5A 3SOCA 3LMHA 1HOWA 1UV5A 2H96A 3JY9A 3GU7A 4NKAA 4Q9ZA 4RX5A 3F7WA 4A4OA 5KO1A 5BUIA 2WO6A 4NUSA 5HO8A 2FSLX 2UV2A 3M42A 4GRBA 3G6HA 1DI9A 4GG5A 4ITIA 3LIJA 4WD5A 5GZAA 4R7BA 4DDGA 3VBTA 3PVGA 4IZ7A 3MVLA 2E9VA 3PXKA 2ITUA 5CU0A 1GZ8A 3ANQA 3DXPA 3N4UA 5A14A 3LJ2A 2IN6A 4Z9LA 1IA9A 4WHZA 3N4TA 3OF0A 3SLSA 5A9UA 3BLHA 2XIRA 3HVCA 3S3IA 4A9SA 4ANBA 4QQTA 1TKIA 4E73A 5C01A 5CF6A 3EQRA 1SMHA 3KF7A 3OWLA 4RX9A 3R9HA 3UDSA 2PVYA 3BQCA 3TTJA 4BGQA 1Y6BA 3AGMA 3F88A 2QO7A 4FV0A 5AAGA 3OWJA 1PY5A 3F7ZA 3HMOA 4H1MA 4QRCA 4RIYA 4TYGA 3RGFA 4G3FA 3VHKA 1J1CA 3BX5A 5TOZA 3CD3A 5EM7A 2C5YA 3ZRLA 4FNZA 2C6MA 3N9XA 3PA3A 4IJPA 4EHEA 3DGKA 3PUPA 3F3TA 4P7EA 3VBWA 4QQCA 5J5SA 2QOQA 5A6NA 2XIXA 2GQGA 4KA3A 1RDQE 1R0PA 4NM0A 2ZB1A 4KWPA 3EQIA 4X3FB 2Y6OA 4BTJA 4IWQA 3LQ5A 1VJYA 3LFBA 3R22A 5CVHA 4C0TA 3SG8A 3ORIA 5F9EA 3TWJA 4GU6A 5FXSA 4D4SA 5CXZA 1O6KA 3BZ3A 4V01A 3SV0A 2XCKA 4LV5A 4FK3A 1FMOE 1CKIA 3FC2A 3LM0A 5DE2A 4I41A 3R7VA 2HW7A 3U4UA 3EHAA 4JQEA 4JG8A 3FI4A 4CV8A 3UZTA 2XYUA 5L3AA 2ZV9A 5EOBA 1ZRZA 4ZTSA 4MH7A 3UJGA 2GS2A 4L01A 3UO6A 3E63A 2C3IB 3BEGA 3EL7A 2H6DA 3QQUA 3E87A 3QUDA 4FEWA 3GB2A 4EOLA 1Q3DA 2CGWA 1XO2B 3R7EA 3P5JC 2HAKA 1PMNA 4AXFA 1ND4A 3S2PA 3OWPA 2YHVA 4M12A 4EKLA 1FOTA 3LCTA 3QD3A 3UQFA 4F1TA 4DCEA 5EK7A 5BUEA 5LJJA 1TQMA 2C47A 2VWWA 4G6LA 4LUEA 4ZTRA 2GNGA 3E62A 3KMWA 4TNDA 4QPSA 3ZS5A 3KCFA 3EQHA 4X2GA 1ZOEA 4BI0A 3AMYA 4NCTC 4YZBA 4L46A 3A4OX 2R3KA 3G6GA 3ORTA 4HJOA 4NFNA 4G5PA 2QOKA 5DMZA 4ONAA 3TNWA 3LJ1A 4MD9E 4BHZA 3I5ZA 4D5KA 3MA3A 3D9VA 4UXLA 4L44A 4FICA 4RJ6A 3TXOA 2OFVA 3WF9A 3DK3A 5E7RA 2X7FA 4ZS4A 1CMKE 2CLQA 3CQWA 4YJTA 3TN8A 1QMZA 1H1SA 1OPLA 3TKUA 4ORKA 1W2CA 4EH4A 2PWLA 1GOLA 4CZTA 4FGBA 3FSFA 5EQPA 3P4KA 5AP7A 3SRVB 4DTBA 2C5VA 2G2IA 3MJ2A 4U81A 2ERZE 4M3QA 1Y57A 2Z7SA 3C0GA 1UNGA 4JI9A 3UMWA 3DCVA 3MV5A 4BBEA 4E4MA 2QG7A 5IQBA 4EJ7A 4D2SA 2VO3A 3MIAA 4O0SA 5IDNA 5HBJA 2NYAA 3PZEA 4IADA 2I0HA 4GVAA 3E8DA 4PL5A 4TRLA 1QPEA 4F09A 1ZLTA 2PUUA 5DFPA 3SD0A 5HNGA 1LPUA 4RIWB 5DHJA 4AACA 5AX3A 4AT4A 3AMAA 4QEBA 2H8HA 2ZAZA 3N51A 4AQKA 2B0QA 1JOWB 1ZYLA 4QYHA 4PPCA 5IDPA 4L00A 4K33A 3P5KA 3UG2A 1PMUA 4HGEA 4O0TA 3R8LA 3DNEA 4IWPA 3OMVA 5ANEA 2W5AA 4MD8E 4HPUE 3BYVA 5AAFA 4BCPA 2C4GA 2YM6A 3TZ8A 5AUTA 2C69A 2P4IA 1U59A 2BROA 2ITXA 1LP4A 4GMYA 4IVAA 4AXAA 5FGKA 4D9UA 4DTAA 4HYSA 5AAEA 1XBBA 3GVUA 1PW2A 4K2RA 2R3IA 3BIZA 3RPSA 4UX9A 2IVVA 2LGCA 1KV2A 4HZRA 4BWPA 3R8ZA 2CNUA 4I5HA 4R77A 3DV3A 2BRHA 3KB7A 4EOMA 2JDOA 3OT3A 4XHKB 2QR8A 3RCDA 2PK9A 4FKIA 2XANA 4ZOGA 4PMSA 4X3FA 4XG2A 3RWPA 4Y73A 3GCVA 3DU8A 5BNJA 4KNBA 3ZO4A 1YHVA 4O86A 3ITZA 5FDPA 4UB7A 2XKCA 1IRKA 3H9FA 2O63A 3PJ2A 3Q6UA 4NIFA 5HLPA 3RZFA 4BWXA 3SW7A 2FSTX 5E8VA 4QQ5A 1OPKA 4GKHA 4Y83A 3QKMA 2GTMA 5FP5A 5IMXA 4F9YA 2X81A 2UVXA 4IC8A 5EH0A 2J5FA 1QL6A 4DEBA 2FH9A 5FM2A 2YABA 4GT3A 2J5EA 4YGAA 1QPJA 3H0ZA 3QA8A 2XAMA 4I5MA 3LXNA 4JDHA 4X2FA 4RFZA 3ROYA 4R5YA 4DBXA 1NA7A 1PJKA 4BYIA 2C6KA 5CT0A 2O8YA 3TUBA 4YTHA 3NAXA 2XUUA 2VTLA 4JBPA 4RFYA 4RJ7A 2ZM3A 4PX6A 3D7TA 2JITA 4GEOA 2YCSA 3OOMA 3IONA 2W06A 3WF7A 3DZOA 3KK9A 3PDTA 3C4ZA 3DJ6A 3UVPA 4ZK5A 2H34A 1J91A 2XS0A 2FB8A 3QALE 2QNJA 3QD2B 4IB5A 3NIEA 4OR5A 5EYMA 1Z5MA 3WF5A 4CFXA 4CV9A 3I5NA 3PYYA 4AOJA 5CALA 3ET7A 2JLDA 2QKRA 2W1HA 4Y8DA 4EZ3A 3ZRKA 1B38A 1ATPE 3IG7A 3OS3A 4L53A 4EOQA 1SVGA 2UVZA 2YA9A 2IJMA 3RPRA 4FSWA 5DIAA 3RHXA 4M68A 2BIYA 3GFWA 2R3LA 2X6EA 3G5DA 3GCSA 5J5TA 3ML1A 4DEHA 4BDDA 3ZZEA 4LRMA 4ZIMA 3AKJA 5KMOA 2UZVA 3CCNA 4YSMA 2PPQA 3EKKA 4Z55A 1JKLA 3DBFA 2F7XE 3QU0A 3O71A 5L2SA 5HVYA 4RC4A 4MQ1A 3VW8A 2IEWA 3PPKA 4LM5A 3NUXA 4OTRA 3ZFYA 3ZBFA 4FBXA 5DWRA 2UZNA 3UOJA 3O8UA 3A61A 3C4EA 3W8LA 3NYNA 4C33A 3WYYA 4QNAA 3HMIA 4E4NA 2ZOQA 3C4XA 3ZUTA 2W9FB 2QOHA 4QYFA 3F9NA 3OD6X 4NU1A 2X2LA 4GS6A 5EI6A 5HU9A 2J2IB 4N70A 3ZMMA 3SXSA 2WB8A 5I9YA 1XH5A 4FEXA 5EHLA 4O1OA 4FR4A 3KKVA 3VS6A 4H58A 4ACCA 3FQSA 5F94A 5HTCA 3OY3A 4RPVA 3BLAA 3L9PA 5EW9A 4ACGA 3L8VA 1ZZLA 4MXZA 4QYGA 3I7BA 4UXQA 2QG5A 5IQFA 2HOGA 5T3QA 3FLQA 5D1JA 3A2CA 3V5WA 1OMWA 3E7OA 5A4TA 4CKJA 3DS6A 5IA4A 1G5SA 3GT8A 3SX9A 4M0ZA 4K11A 2QOBA 2WGJA 4O0RA 2ZV2A 1XJDA 1V0PA 2F2CB 4FNWA 4WSYA 5L6PA 2YIXA 3FI2A 3ENHA 5HZNA 4O0UA 3EQGA 4B8LA 5K5XA 3QGWA 4R1VA 1OGUA 2R9SA 5CI7A 4FKLA 3FEGA 3K3IA 2VTJA 4IB1A 3OT8A 2XKDA 4UEUA 5FTOA 1Q97A 3EMGA 5T68A 3ODZX 4Y85A 4DFLA 3HMMA 4MBJA 4ID7A 4PDSA 1BX6A 2E9UA 2VWZA 4FVQA 4JMQA 4RZWA 4FG9A 3CJFA 2YDIA 2XRWA 4IVBA 3KXHA 1XH9A 3LFQA 4RX7A 4NW6A 5KMLA 3JVSA 5JSMA 3Q5IA 3BGQA 3IGGA 3PPZA 4J95A 4JX3A 3NFFB 4FF8A 2WTWA 4BICA 3WBLA 5AFVA 3L8PA 1KE5A 4MUQA 2CCIA 4C34A 3QCSA 2JFMA 3RK5A 3T9IA 4DINA 2VWBA 2X39A 3R1SA 1U5RA 4J8NA 4LGGA 4ZLOA 4D58A 4MNFA 3FLZA 4DFYA 5EQEA 2NRYA 2VTIA 1H00A 3F5UA 3PIXA 4K18A 4IM3A 2VTTA 2E9PA 4PV0A 4Y72A 2CSNA 4F0FA 3CIKA 2O3PA 2DYLA 2FSMX 2UW7A 4M84A 5B7VA 1ZAOA 1WBTA 3TIZA 3ZUUA 2GHGA 2X9FA 4FT0A 3UNKA 5LWMA 5IQDA 3ZM4A 2WMUA 4XG9A 4W9WA 1MUOA 2KTYA 2W5BA 3NWWA 4DG0E 3LQ3A 4EH2A 3UO4A 1O6YA 3A8WA 4WOVA 1WBWA 3KRJA 4NTTA 4CG8A 3OBJA 3F2AA 4MBIA 4F7JA 2C0OA 5AV2A 1MRVA 4XG4A 4FEVA 1GJOA 2V55A 5GIOE 3MW1A 3Q4ZA 2F7ZE 2OH0E 2C3JA 2VTAA 5DR6A 3NYXA 4IZAA 2B4SB 3DZQA 3R6XA 4XV3A 3TACA 5CASA 2I0VA 3OVVA 5IUIA 3G9NA 5B2KA 4ASZA 1UU9A 1YI3A 5J9ZA 4FIIA 2PZYA 4QTBA 3F3WA 3OWKA 2BHEA 4G5JA 2OW3A 2JBOA 3NPCA 4XRLA 5IZFA 3AC8A 3R00A 1RQQA 2A19B 5EW3A 2PTKA 4W8DA 4XV2A 4NZWB 3UOHA 2X0GA 1M17A 4CSVA 2CKEA 2Z8CA 2VAGA 4DA5A 2BRBA 3OEZA 1R3CA 3F5PA 4F65A 3COIA 5AP2A 3C7QA 4BRXA 4ZTQA 2NNWB 3PSDA 4PF4A 4QP7A 1CKPA 5HEZA 2QHMA 1OZ1A 3O50A 4KKEA 5CQWA 4V0GB 4D2PA 3KRRA 3DNDA 3LHJA 3R1QA 5AP3A 5JZJA 4PP7A 1JSUA 3KU2A 2R4BA 4O7NA 1BL7A 5FD2A 2AYPA 1W7HA 2XK7A 2Z7QA 3OROA 3NYVA 4XJ0A 4KRCA 2UW9A 4LQMA 3EL8A 4AUAA 4RWKA 5JEBA 2GTNA 3MY0A 2Y6MA 3QXPA 4DT9A 3C0IA 1W98A 5AP4A 3TEIA 4FIFA 3PY0A 2OFUA 4YO6A 4YLJA 1ZY4A 4FEUA 2UZEA 5GJGA 5BPYA 3BLQA 4FKUA 4DFXE 1XMLA 4CGAA 1JKKA 4C37A 2WELA 3WILA 4S33A 4WRGA 4E6AA 4FTMA 4O7YA 2DS1A 5AV0A 3IS5A 3RP9A 2X2KA 5L8JA 4K77A 5L4QA 4IAIA 3LMIA 4W4VA 3GC9A 5EKNA 2BILB 3UPXA 4F9AA 3HV5A 2GNLA 4FE2A 3V5JA 1WFCA 2OIDA 4QO9A 4YJVA 1ZXEA 2PULA 1O9UA 4USDA 3TM0A 3O5AA 3OEFX 4EBVA 4GK4A 3ORZA 3QWKA 3ZM9A 4RG0A 4UZHA 4ZSEA 4LL5A 3T8OA 3WARA 5JRQA 3ZU7A 1ZY5A 1R0EA 5FEDA 3UIMA 4XLVA 2PL0A 2GHLA 3O7LD 1Q99A 3C9WA 4O2ZA 4YJQA 4CRLA 2HXQA 4L8MA 4EUUA 4O6EA 3O51A 5KBQA 5C27A 3GCQA 2VWYA 3K5UA 5H8EA 3TT0A 4IAYA 3DLZA 3NAYA 2OICA 4FSNA 2WTIA 4U3YA 5CYIA 3RM7A 3SGCA 1H1WA 4I5PA 1JSTA 4D2VA 3FJQE 2X4ZA 3P1AA 4EJNA 3FMLA 2YERA 4LGDA 4XG8A 1KV1A 4EH8A 3OUKA 3KK8A 4QP3A 3Q32A 3LOKA 2X8EA 3TKIA 4Z7HA 2WMAA 1XHAA 2P3GX 2RG5A 4LYNA 4DBNA 3VUMA 4K6ZA 3BQRA 3ORMA 4LOPA 4O4CA 2BRNA 3FY2A 5CS6A 5J7HA 4O2PA 2GNJA 2V5QA 3IW6A 5HE0A 1UNHA 4S31A 3W32A 5AA8A 5LVMA 3W0PA 2XRUA 1K2PA 2F9GA 2GHMA 2W99B 3QQFA 4HOKA 5AP1A 4DHFA 4PP9A 5HNBA 1GY3A 3E5AA 4XV1A 4JIKA 3UBDA 1I09A 4DF3A 3EYGA 2UW8A 3D94A 5BVDA 4DGNA 1U46A 4DFZE 1Q8YA 3C1XA 3CC6A 4A9UA 3S1HA 4OTFA 3OXZA 3WZKA 4YURA 4IQ6A 1UKHA 2ERKA 3R7OA 4BHNA 3QQKA 3PJCA 3MPTA 4WUAA 3ZC5A 4AN2A 3AT3A 4AE6A 3TV7A 5CEPA 3QKLA 4GYGA 1BUHA 1PXMA 5DNRA 2XK4A 5TO8A 4GU9A 2VNWA 3MYGA 5AA9A 5CU4A 3A7IA 3JVRA 5JFWA 4YUQA 2J0IA 1Q61A 5FEEA 1WBOA 3AD6A 1H28A 5C26A 2JKKA 3E8EA 3NVMB 3DFAA 3W0RA 2CJMA 1JLUE 3VQUA 3NVKI 3CLYA 4QTCA 1TQPA 3GQLA 2Y4IB 4GG7A 2OI4X 3EB0A 5FXRA 1JBPE 4NSTA 4C02A 4WG4A 4F6UA 2QOFA 1LEWA 3DBDA 3CEKA 3ERKA 1FVTA 2BZIB 5KZIA 4M69B 1OKVA 4I21A 4X21A 5L2QA 1OIQA 1M14A 4C62A 4HPTE 2XNNA 3HYHA 4JAJA 4JG7A 4JS8A 4FSRA 3U9CA 3NLBA 3O23A 3U9NA 4RA4A 4RIOA 1J7LA 2OH4A 4KABA 4KRDA 5HIBA 4ZZNA 3MFRA 5D41A 4ZSJA 4P2KA 5E90A 2YWVA 1U54B 2R0UA 4XBRA 3ZYAA 2XARA 2VTOA 2YLFA 2PVLA 3CTHA 2UVYA 4L6QA 2QU5A 3UQCA 1VR2A 2XIYA 3TTIA 5LVPA 4G3DA 5LMAA 4ZSAA 4JDIA 4EUTA 4KS8A 3NS9A 5E92A 3ALOA 3E92A 3QTSA 1XH8A 4HVSA 3C0HA 1YHSA 2QCSA 2ZV7A 4WG5A 1JKTA 3D5XA 4R5SA 5DEWA 4EQUA 5ETFA 3BYSA 2V22A 4GT4A 5JFSA 3A62A 3VONA 4OTIA 3DKGA 4C36A 3CD8A 4ZXTA 3GGFA 1OUYA 4QMYA 4FV9A 4A4LA 5F20A 5L8KA 3FHRA 4BCGA 3NUPA 2WEVA 3DXQA 3DJ5A 4C58A 4FKTA 1OL1A 3OC1A 4YU2A 4DDIA 5CZHA 3MDYA 4I4EA 5AWMA 3KF4A 3WF8A 2RGPA 5AR8A 4IW0A 4BY9E 3W2QA 4I22A 2ZDUA 3KA0A 4F9WA 4H3BA 1F3MC 2ESMA 3DT1A 4FGRA 1VYWA 3QQJA 1ST0A 4J99A 4GFGA 4IX6A 4NEUA 3NR9A 4RLLA 1FQ1B 2WNTA 4IANA 4BCIA 4U5JA 4UMQA 3R2BA 4F7SA 1OBDA 3PUFC 4RIWA 5KKRB 2IO6A 2P2HA 2A0CX 2OJFE 4QMTA 3KN5A 4RSSA 2NO3A 3C4WA 5ICPA 4ZMFA 4G6OA 1H8FA 2E9OA 4M7IA 4U9AA 4BI2A 3UC4A 3AT4A 4XG7A 3WOWA 5IUGA 4O7ZA 3TDVA 3NCGA 4Q5EA 4UWYA 3CPBA 5K4IA 5EHOA 2JKMA 5JGDA 2XVDA 3G0FA 5EI2A 4QTDA 4R78A 4AA5A 3ZCLA 5FTQA 3VS7A 4W9XA 3QWJA 4FOBA 5CXHA 1WBNA 2PSQA 3HLLA 5C8NA 2VGOA 1PYXA 2VO7A 5C1QB 3EN6A 3KRXA 3WZEA 4XYFA 4E26A 2Z7RA 5BVEA 5DEYA 3RAHA 3EQDA 5L2WA 3I4BA 4XUFA 1JAMA 4HGSA 3CP9A 4GT5A 4JBOA 2WOUA 2YM7A 3E93A 4PTCA 4O83A 4CLJA 4WG3A 3PFYA 3DY7A 3RI1A 5FBNC 2BIKB 5AP6A 4CT2A 4MNEB 5CQUA 4C4GA 1YWRA 2W1EA 5E91A 3DAEA 2W1FA 3UNJA 1W0XC 4AA4A 5J7BA 1P4FA 1KUTA 2AEGA 1KSWA 3ENMA 4OT6A 4S2ZA 3OY1A 3VS5A 4UMRA 1NT2A 4UMTA 4EC9A 5HCXA 3MFSA 4ZJVA 3W10A 3QA0A 3VBVA 5LOHA 4QMQA 1BKXA 2HWOA 4BC6A 3FZPA 3ZLWA 4L7SA 4AFJA 2P2IA 2W0JA 4L9IA 3NNWA 3PVUA 4KINA 3DBCA 2W4OA 3Q9YA 2QU6A 4FSQA 2IW6A 4NCTA 4DYMA 1DI8A 1JNKA 3I6WA 4FUYA 3E8CA 3TI1A 3ZLYA 3BWJA 2XZSA 4DEIA 2X0QA 4FL1A 3HV4A 4DHZA 4AX8A 2HYYA 4E5WA 4PTGA 4ZY6A 4B8MA 3GUBA 2QQ7A 3OBGA 3LFFA 4J7BA 1OKZA 3VAPA 4ZY5A 2C5OA 3UYSA 2OWBA 3PJ3A 5AUWA 4YJOA 3O8PA 1VEBA 5AJQA 2B53A 3FZTA 3UOKA 4TWNA 4EHGA 3Q2JA 4FTUA 4G3GA 3MI9A 3GU6A 4BIBA 3PSBA 1J1BA 3IW7A 3JY0A 4FTAA 4G9RA 4NTSA 2A2AA 2ITYA 2X8DA 4ENYA 4BJJB 4BZDA 4MVFA 3NW7A 3EN7A 5DR9A 3GEQA 3QC4A 3K3JA 1H07A 4IM2A 4NK9A 5I9ZA 4U45A 3V5PA 1FPUA 4J8MA 3O17A 2VX3A 4CD0A 1UWHA 4IMYA 1IA8A 3LLAA 3QRTA 1AGWA 1Y91A 2WXVA 3GENA 3RNIA 1GZNA 2W5HA 3FYJX 4PPAA 3EN4A 3VBQA 4O6LA 5EM6A 4F9BA 2KULA 2JFLA 5AR2A 4TT7A 4FT3A 4J96A 4V0GA 5IKWA 4AN3A 1JSVA 4D0WA 4RVMA 2XIZA 4YMJA 1ZOHA 5A54A 4DE4A 4ZJJA 2V0DA 5HU3A 5M09A 3ZDIA 4U97A 4Y5HA 4ASXA 5AR7A 1R78A 3BPRA 2RKUA 3PIYA 5IUHA 1SYKA 4YNOA 3Q9WA 2YN8A 2X0OA 5A4EA 5BVFA 3GU4A 4FIGA 4DGLC 2R0IA 3LLTA 3ZHPC 1H26A 4L42A 2J0JA 5CANA 4BWKA 1IAHA 3PXYA 4PRJA 4ZSGA 3PY3A 3ORPA 4YZ9A 3UDBA 3WZDA 4E7WA 3OP5A 4GK2A 5HTIA 2Y9QA 1VYZA 1MQ4A 2UW4A 1V1KA 3QTRA 1VZOA 2IZTA 4KSQA 3VUKA 3ZEPA 3MSSA 5HD7A 2XNMA 3K2LA 2ZDTA 5IQAA 2XP2A 3EQFA 4EQCA 4FIJA 3W1FA 3JYAA 2XJ0A 3V5LA 4GIIA 3TZ9A 3A8XA 4QMSA 4U0IA 3Q9XA 5HBHA 4D1ZA 3QL8A 1Z9XA 4FV3A 4WUNA 3ROCA 3TCPA 2G2HA 5E9EA 2XAOA 5AR5A 5CU2A 3COMA 2HXLA 3S4QA 1ERKA 5TKDA 4G1WA 3R73A 3QX4A 3SA0A 3BV2A 3VHEA 2W1IA 2LAVA 2EXEA 2UZDA 4ALUA 2BAJA 3LCKA 4FIHA 5JKG