3D69B

Crystal structure of the fab fragment of an anti-factor ix antibody 10c12
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
224
structure length
218
Chain Sequence
GVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAIISYDGSKKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARASIAAARVLDYWGRGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-factor IX antibody, 10C12
publication title Crystal structure of Fab Fragment of an anti-Factor IX antibody 10C12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 218
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d69B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d69B01
4DK3A 5EN2A 2X42A 4XVSL 5HVHB 2NNAA 1OD9A 1H8NA 4UT6H 5F7WC 4F2MA 2HG5A 5C6PB 3HNSH 5D5MA 3TVMC 3MTRA 3W9EB 4WHDA 4HX1A 5D1QC 1D5IL 1HN1A 3HR5A 4P5TC 3HZKA 4UILL 3CLFH 1E28A 3MRNA 4IEFB 1N3NA 4RWYL 1U3HB 4IOIB 4D8PB 1BF8A 5HD8D 1RIHL 4X6FA 1L7IH 4U1IA 4RGNB 3MLSL 3FQRA 4HPOH 4ZUWA 3A67L 4LKCB 3AS2A 1RAMA 3AROA 5IBTL 3PL6C 4K7PL 4D9LL 2VAAB 5E5MB 4HIXL 3KPPA 3Q6FA 2FYYA 2YK1L 3VMOA 5FOJA 2JCCB 4ZO7A 1I3GH 2Z8VC 1GAFL 4OB5H 4N1CA 5DHYB 4NFCA 1OTTC 3NACL 1A8JH 1KCSH 4NSKA 5D1ZC 1UJTA 1WBXB 3DHMA 2WMPA 4P57A 4XVJH 2NLJB 5E2WH 4QT5B 5GS2H 5I16A 3D48R 1CLZL 3EGSA 5A2KH 3HE6B 2A77L 4OFVA 5FGSA 3KYOA 3MV7E 3O4LE 3ZE0F 3ZT7A 3PP4H 2Z4QB 1QACA 2OBGA 3PGDB 2P1YA 1K4CB 4WFHD 3CK0H 5ANME 1V7ML 4M1GL 1QLEH 4POYA 1FFPA 5K9OB 1PY9A 3I6KB 4KGJA 3IKCB 4OFDA 5FO8B 2BVOB 5C0FB 2YC1A 5CBEB 1JE6A 1NMBH 3ULUE 1OTTD 3KYNB 3NCCB 3WFDH 5JW5B 2IH3B 3IDXL 1NDGB 4UUJA 5F1IA 1SVZA 4LGRB 1CGXA 2F9BT 1W0WA 2WIMA 4CRPA 4J4PD 5D5ME 3LV3B 1JHTA 4GAJL 2DBLH 1SMOA 1SM3L 5SWZA 2O5XH 5A2LH 1UWXH 3QULA 1AQKL 1SQ2N 3C2AH 2DM7A 3UZQA 3VFPB 3VG0H 3U30B 3DX7A 3X11B 5JR1L 3TM6A 2QV2A 3V0VB 2EKSB 4QRRA 2HT3C 4ZPTB 3VWJA 2VB5A 3G6DL 1BM3L 1U2CA 4HCRH 4NKMA 1JGDB 4U1HB 5D7LE 3NFNA 2MQCA 1FH5L 4DKEL 4OI7A 1BREA 1D5IH 1DANT 3BW9B 4K71B 2OR9L 5DEFA 1VADB 2XZQL 1BFOA 1MUJB 4MD4A 1T0NB 3L7FA 4HC1L 3WJLA 1UM4H 1ADQA 5IB5A 3RVXD 4LCWD 3MLSH 1F4YL 2XKSA 5BZDB 3A67H 1S7RB 4X8JA 4OD2B 5IBTH 5I2IB 1YEGH 1CDHA 4K7PH 1YNTB 4P0DA 4S1DC 4J3XA 4KMQA 1YMMA 2R4SL 3BGMA 3G04B 2DJSA 1QP1A 5IB4A 4NQCE 3W0WD 5F9JB 4HK3N 1MCIA 2ADGB 5F70A 5D2NA 3ME0A 4G80B 1FC2D 2GSIB 2NXYB 3SGJC 1FJ1B 3D3VD 5DUBA 2GYSA 3PJSB 3RWFB 4YIQB 1BD2D 1HQRB 4F33A 1DSFH 1BQHG 3FOLA 2ESVB 2VMFA 3LZFL 1DR9A 3KPRD 3C2SA 3TZVC 3ZDYF 3CSYB 5SWZE 2R15A 4GRLA 5CGYD 2JIXA 4JRWA 1MHEB 5KVGL 1IBGL 5DQJB 4OLYH 2MOVA 5EB9A 1NCTA 4QRRE 3TIDA 5IB1A 2R23A 2ZNXA 3IDXH 4Y89A 4KKBC 5A43C 4F37F 2VWEE 3ARTA 1RVFH 1A47A 3V5HB 4YXLL 4LSTL 5GS1C 1ZGLM 4OT1H 3S37X 3BN9D 4NC1C 1ZLVK 1YNKL 3HRPA 3DX8B 1BMGA 1OAKL 1MRCL 3B3IA 1A6AA 1MHCB 5F89B 5JR1H 1D5XA 2FEDC 3OB8A 4B7IA 1Q38A 4OCLC 3LN4A 1HKFA 1MWAB 4OF6A 5DJXB 2ARWA 1CR9H 4JN1L 4KQ3H 1EXUB 3G6DH 5HGAB 4HULB 1BOYA 4I77L 2HFFB 2DTMH 2D3VA 3B9DA 1KT2A 1RJLB 1VGKB 3BKJL 4M7LT 1FO0B 4L1HA 3Q6GL 5J12C 1YMME 2IQ9L 1FH5H 4E41D 3RVVD 5IIEA 3SBWC 3CX2A 2CMRL 3L3KA 5DRXA 1G0XA 1H15B 1KJMA 1ZHBB 1EFXA 3BP5A 4JJ5B 1NCCH 3VD5A 3PWNA 5D2NE 2OR9H 3O41A 4PGCA 4HC1H 2EIEA 1SEQH 1YJDL 3IJSA 2ID5A 3HG1B 4DK6A 2DOCA 1FV1B 2G75B 3CXDH 4XVUC 4R90L 4R9HA 4JG0L 2WNGA 1RSFA 1HHHB 4WEUD 2V5YA 4PS4H 3VA2C 1BQSA 3IU4L 3VFUA 3VWKA 4Y5VB 5EUOF 1RK1B 3KPSA 4MA7H 3WO3B 3MOQA 3T2NH 4JFZH 5A2FA 5DQ9A 1BQHB 3GSUA 3OQ3B 2OTWA 2VIRB 2YPLB 1WIOA 3TGXA 5HYQB 5F9OL 5E5RB 3LZFH 4HDIB 2EDNA 3HCVB 1FNEA 3QHZL 4NQDD 1A7BA 5ERWA 3VJ6A 4HIIA 4XP4L 2FBJH 1IQDA 4Y88A 5KVGH 2Q86A 5H2BA 3V4UH 5GRJL 1JN6A 4M6OL 1DQQB 4PG9A 2EIBA 4WVRA 3UTZA 3GGWA 4U1JB 5HY9A 5GGVY 3BP6A 3PQYA 4KVCH 4MDIA 4YXLH 3NGBB 3SGKC 4ZOEA 1RHFA 2FATH 4EBQH 3LPFA 4LSTH 2NY6B 2A83B 1YNLL 2VR4A 1G9ML 3I2CL 4MA8H 5GRYA 1WBZB 2PYFB 5EH1A 1YNKH 1ZANL 4WCYH 3THML 3K1KC 1RHHB 4Y1AD 3IRPX 4QOKB 4XPHL 1PEZA 1G6RL 4FNLL 2PW1A 4RNRA 3N9GH 2MQ0A 1AGFA 2P5EB 4JN1H 5CHNA 2LVCA 5C3TA 1B4RA 1F8TL 3I50H 5IROC 2C1OB 1C5CL 3BEVA 3QUYD 4I77H 3I6LD 2DKUA 2XQBH 2FJGB 5BJTB 3GZKA 3WXWH 3OKNB 1IAIH 1QR4A 3Q6GH 2WLZA 3EO1B 3IGAB 4XRCA 4U1GC 1NPUA 2CMRH 1NDMB 1S7UA 1U36A 5F3HA 1ZHLA 3LMJL 4I48B 1YC7A 4ZMAT 3PWJA 2CSPA 3KPSE 1JYVA 5EA0L 4UAOC 2LU3A 4Y5XA 3V6FA 1HH6B 5EBLA 1YY9C 2NMSA 1NBVL 4XAKD 1BJMA 2CRYA 2A9NL 3GMRB 4OSUL 3AGVA 1JF1A 3UO1L 1A1MB 1QRND 5JOPE 2XICA 5FKAA 5EC1B 1BFVL 3GSNL 2WUBL 3FFCB 3GI9L 4YQXL 1PG7W 4ETYA 3MUZ1 3UDWA 3O2WL 5AAWA 4PRAB 5HHVH 4MDJB 5IJVB 5DUMH 4D2NA 3T4AB 3B9VA 1J0JA 4FQHB 3T08A 4XAWL 2IH1B 1ND0B 4EIZC 2ATPB 2MPAH 4FQCH 1XGPB 1MCQA 3EOBB 3FT3B 5CWSA 2ED7A 1RJCA 5LJYH 4P9HC 3S5LG 1N5YH 2YRPA 1EMTL 2OQJB 3D87B 4OZGB 1P1ZB 5JPMA 4XP9H 1D5ZB 5E5UB 4M7ZC 5TFSL 1FZMB 1K5NB 4DQOL 2CKBH 3DV4A 2Z91A 1F00I 4IIQA 5IOPA 1CICB 1FYTB 4NBZB 3S4SA 1DQLL 4BSWA 1R6VA 3BVNB 4PRHA 2H45A 2YEZB 1N0LA 1U6AH 2FGWL 2BSTA 2W91A 5HBBA 4WW1B 1G9MH 1FFOB 4GAYA 2R1YB 4GKNA 5I75C 2R69L 2NX5B 3BJLA 5LCVH 2NR6D 1RZJC 3F7YA 2HFEB 4PTTA 4IRSB 5F8QC 5HI4D 1LD9A 3GK8L 4ELKA 4I5BA 1TNMA 2C3VB 1OSZB 1HXYA 1CG9B 5DRNA 4ZUSB 1KB5B 4HGWB 2JJSA 4PJGF 1N0XL 1AP2A 1VPOH 4NJ9H 4U1KA 3F62A 3VXMA 1YC8A 4GKSA 2H26A 1OP3K 4ELMA 2OI9B 4UQ3B 4GRWE 4U6HA 3U36B 3GIZL 4QRTB 5EA0H 3JVGC 1KG0A 4TNWK 4JQXA 1F4AA 3HPLB 4Y0GA 1PVHA 2R9HC 5EU7E 4TUOA 1I1YB 2A9NH 5INCB 3CPLB 3U0PA 5INDB 3AREC 4M9OA 2BY1A 1ZLWK 3WIIL 4GW1B 4XVTH 3VFTA 4JFFD 3GSNH 5IW3A 4F7EA 2NW2B 5HGHB 1JNHB 1PG7X 3GI9H 4R4BA 3C5ZA 1FZKB 5CJQH 3PHSA 2UWEA 4XNUH 1KEGL 2H41A 3U2SA 1WT5A 4UDUA 4UTBL 4PLKC 4QO1A 4M03A 5GRUL 1DVFB 4TUJA 4PJFB 1CLOH 3D85B 4PRHE 5IB3A 4NWTH 1MLBA 3S5LB 3BPLC 3DHJA 1INDH 4UV4L 4E42B 2ILLA 5MEND 1U58B 2CDEA 1AQDB 2NY2C 3DLQR 5I1GL 5DRZB 4HKXB 4WDIA 2WANA 6FABL 5DMIH 3FB8B 1EAPA 4PD4K 5JDJA 4UDTB 4I8DA 3WD5L 3IDIB 3O6FC 1JNNH 4XMPL 5F88A 3T0EC 3ULVD 3QDJD 4FQXC 2K9UA 1QSED 3VXME 2R69H 3RA7L 4U6VH 4ELME 4NGHL 5SWSD 4G42B 2R0ZL 1FNGA 1UGNA 2UZIH 4MNQD 1NCNA 4R4NC 2X89D 4JY4A 3GK8H 5LWYH 4U7KA 1CQKA 1UKTA 1MCBA 3C8HA 1P2CA 1FORH 3O6FD 2GFBB 2AAVA 3MUGB 2Y5TA 2H32H 5SX4I 5EG6C 2FB4L 3HZMA 3ZKSD 5CJOH 1LP9F 4M7KL 5C0CB 5HHMD 4APQA 2R2EB 4X7FC 2HJFA 3MUHL 3O2DA 2ZUSA 4MSWB 2UWEE 5BMFL 3B8SA 2IAMD 1X3DA 1N59A 2PTTB 4RGMB 4PJEA 1OAXL 2D03H 3P9LA 5HTSA 3U7AA 1NGZA 1G7JA 2YD3A 3MLTA 3T77A 5EBMB 1R5IB 1A6PA 1MAJA 1AGCA 5I76B 5I66B 3ZT6A 3WIIH 5DHVB 1RIUL 3W9DB 2GAZB 1HKLL 1MVUB 5AG9A 4EDWL 3WL9A 5A1AA 1DN0B 2DQIL 3RIAK 4PJ7F 2V7HA 1A5FL 3K80A 1UJ3C 2DQHL 2HT4D 2EH7H 4ODXB 4TSCL 4WW2B 2BP3A 3EJZC 2KQNA 1Q1JH 1MQKL 2PN5A 3DYPA 3GNML 3O0RL 3IJYB 4AENB 1UCBL 1ZEAL 1U3HA 2Y23A 1MLCB 3F65A 4IOIA 1U95B 4D8PA 5I1GH 4Z0BL 2ORBL 2ZG1A 2DQDH 4KPHL 2Q20A 5E5MA 3H9HA 1U3ZA 3JV0A 3NZHH 5AWNL 1X9QA 4LHJB 4NP4L 4LVOB 1EO8L 1MCOH 3K4DA 5CUSL 2JCCA 4JRYB 4WWKC 4XNYL 5DHYA 3T65B 3BOVA 2EEBA 1MREL 4FTVB 1L6ZA 1ZLUH 1WBXA 1T0MB 2XA3A 2M2DA 2NLJA 4NGHH 1QFWH 4QT5A 2D7MA 4P2CG 4Z78B 1R0AL 4WIQA 3HE6A 1E4KA 1FZJB 2I27N 3EAKA 2H1PL 2Z4QA 3R0NA 2D7PA 3PGDA 4PJEE 5DD0H 1KTLB 3LKPB 3HUJE 1K4CA 4YEFA 3FN0L 3QDHA 4ZSOB 3L95B 3I6KA 1WFTA 3O9WB 3S7GA 5FO8A 2XN9B 5AZEL 3X13B 5C0FA 3HB3C 3MCLL 4NOBA 3ILQD 4LSQL 4MNHB 5F7HA 4JY5H 5E70A 2NY3B 1IGYA 5IF0B 3KYNA 2P8PB 5F7YC 5JW5A 2IH3A 4ZXBB 2VDNL 4H20H 1NDGA 5KN5B 4JDVB 3W5MA 5D7KD 5D8JL 5D72L 1QHPA 3VFOA 4GQPH 1Z6JT 5ITFB 4M7JH 4TSBH 3A6OA 3HE7C 4NM4H 1AJ7L 3K2MC 3P0VH 3VFPA 4ZS6D 3X11A 4ZTOL 3ARGD 1NUFA 3I9GL 3V0VA 2EKSA 3CX5K 1QPXA 4ZPTA 3NIFF 4H0IA 2P49B 4RGNE 4XHJC 2DQIH 1QEWA 1JGDA 4RAVB 5GGVL 3TFKC 1ZT4B 5CD3B 2C9AA 4JFYB 1KOAA 3SKNA 4FG6D 2PCPB 5C8JB 4P3DB 1PJ9A 5DT1H 4HV8B 2JCCE 1G9NC 3BW9A 1DLHB 2QQKH 3F8UB 1BIIB 3F7QA 5J9PB 3MXWL 3VFNB 4QRSB 5HHQB 1VADA 1KN2H 1T7ZA 1MUJA 3MNWB 1T0NA 5DTFB 3A6CH 4ZFFB 4Z0BH 1U8PB 1QUNA 3GSOB 3LEXB 4PJDB 5BZDA 1KJ2A 1S7RA 4NNPH 1V5JA 4OD2A 4ZO6A 4YUEH 1DQJB 4EOWL 1YNTA 5I17B 4LSVH 3MUY1 4IRZL 1AXTL 3G04A 3FONA 2GJJA 4EN3B 4LPUA 1QFUL 5F9JA 4Y7MA 1OTSC 3MYZA 2ADGA 4K8RD 5D6DC 4OLXH 3EDDA 4TTDC 1N4XL 2XG5A 3EHBC 2VDQL 4G80A 1MREH 1QYGL 2VC2L 2GSIA 2RR3A 3G5VB 1FJ1A 32C2B 1WEJH 5GGRY 5ACLA 1MRFL 3PJSA 3RWFA 4YIQA 4Y4KC 4K9EH 4CMHB 1HQRA 4KJWD 2H1PH 4R4FH 2AP2A 3RWIA 1C7SA 3FN0H 2G9HB 2HTLC 3CSYA 4Y2DB 5F1NB 4R6UA 5DD1H 5DQJA 4LSQH 3NAAH 3EHBD 3I3DA 3TIEA 1AO7B 3UJIH 4TQEL 1AR1D 2XTJC 2YMXH 2F8XC 1RUAH 4XNXH 3TYGH 3DX8A 2G5RA 3CAFA 4OV6F 3QIBA 4HWEH 5F89A 4XC1L 3I9GH 1MFCL 1MWAA 1RU9H 5DJXA 1EXUA 5DJ6B 5HGAA 4YHPB 2HFFA 1BAFL 1RJLA 1VGKA 4KV5F 5GGVH 1FO0A 5MEQB 4FXGA 1K2DA 3MRJA 4NYLB 4U33A 3U7YL 7FABL 1AFVH 4LCCC 4PJBF 1H15A 1ZHBA 5CSGA 4JJ5A 3TEUA 1PKQE 1DJSA 4B0MM 1TMCB 1CGTA 3GKWL 5E8PB 3CVHH 5JXAH 4AG4H 3HG1A 1NH6A 1WZMA 2J5LB 2G75A 4Y19D 3EJYD 5IFJB 3QUMB 1IC1A 5DURD 4IRZH 3IFOB 4GQ9H 2ESVE 4FQIL 4OIAA 1HHHA 4MHHI 4F7CB 4JM2B 1YEEL 1QFUH 3KG5A 5E0QA 2DQJH 4OD1H 4QRPD 1HINH 3FHQA 2IALB 4OD3L 3B5TA 5J6GB 1D9KB 1IT9L 4G6AC 2VC2H 2F5BL 1NEUA 2MTPA 4Z7NF 1CDIA 1BQHA 3GMQB 3ZKND 2YPLA 5F7DB 3ARFD 5HYQA 1T6VN 3HNVL 4YX2L 4AEHL 2VZVA 4DFIA 1J5OL 3HCVA 4FXKB 2VRAA 2GCYA 3BP4B 5D93B 3BD4A 4JRXD 2DLGA 5CFHA 3B8YA 5F7EH 5DJYB 1DQQA 5IEHB 2MKWA 4LLVB 4AK1A 4U1JA 4G6AD 3IRZA 1FVCB 5GJTL 4JZNA 4ACPA 4P9ML 4WJ5B 3U46B 5FYLD 2A83A 2BHUA 4QHKI 1V3MA 4I0PB 1WBZA 1A6VL 2IEPA 3SDAC 3D2UD 2NY0B 3DURB 1RHHA 3OX8B 4QOKA 3SGEI 4XC1H 1FCGA 1MFCH 4LPXA 4JGJA 4F80A 4XMLH 2M26A 4JFHD 4X9BA 3DRTA 3UTSD 4HWUA 3HG1E 5D7JD 3MGOB 1IMHC 5T1LD 3FQXB 4ZAKD 3JUZA 5BJTA 4P23C 3BQUA 1RY7B 3QNYA 3OKNA 5E2VL 3T8XB 3EO1A 4MD0B 2GI7A 4FZ8L 3IGAA 4MAUL 3DUSA 4Z5RB 1NDMA 5F9WC 3IFNL 2D4FA 3DMMD 2RCSL 3LDBC 3S3PA 4PJ8B 4ONFL 5DQDH 3BUYB 4W4NA 1YEDB 1UCTA 4L8CA 5L8JB 5CINL 1HH6A 2F19L 3TVMB 2XXCB 3Q1SL 1II4E 4GW5A 5HGDA 5D1QB 3L9RA 3T2OA 4AMKL 2YPLE 2P48B 1CFSA 5L2JB 1A1MA 1U41A 4FQIH 5IFHL 3SO3C 1YEEH 5HPMB 5EC1A 2ZUYA 1SYSB 3K2UL 4MZ2A 3FFCA 1AGDB 4G8FB 5C0AD 4GMTH 5FUCE 4PRAA 4MDJA 5IJVA 2F5BH 5I1EL 3PL6B 4JFEB 3FMGL 3T4AA 1OQXA 4XPFL 4FQHA 5T3XE 2GY7B 2EDBA 2F5AL 1NC4D 3P2TA 3SDYH 2IH1A 1T1XB 1ND0A 2DKSA 3MBEB 3VFWB 1F4XL 2ATPA 3R06A 4TOYH 3FQUB 1XGPA 3EOBA 2Z92B 3FT3A 5D1ZB 1IC7H 3GUTB 4HS8L 5F7NC 1XGUB 4M1DH 1P1ZA 4QOKE 4YJZL 2HRPL 2Z31D 4HJJL 1FZMA 2I60L 5DI8B 1K5NA 1T4KB 2P5EE 4O51B 3LEVL 5F6IB 3RWCA 1CICA 2VDOL 3CDGB 1FYTA 4M5YH 2EXWC 3VGGA 5C7XL 4LLYB 2R29L 1S3KH 3BVNA 2CLZB 2KZWA 2ADFH 4WW1A 5D7IB 1U8QB 2R1YA 3SE3C 2NX5A 3UJTL 5EOQL 5KVDH 1KXVC 2HFEA 3U4AA 4U2ZA 3N1MC 3RI5F 5TQ2L 1QSFE 1XF1A 1CN4A 3G6AB 4NQVB 4CKVX 5IM7A 3V4PH 4XNMA 1YEKL 4KROB 2C3VA 1OSZA 5HDQH 1LILA 4ZUSA 1KB5A 2AV7B 2X1OA 1A3LL 4HGWA 1K8IB 4WTZG 5E2VH 3L5WB 1GGUA 3CXHK 4FZ8H 4PJHF 4S0SD 4GBXD 4MAUH 1JPGA 3G6JB 4LDLB 1AGEB 1J1PL 2IPUG 3FFCE 4UQ3A 2RCSH 2IPTH 5B3JF 1E27B 3U36A 4YXHL 4WRLA 4QRTA 5CZKA 1J0ZA 3J8F7 4TVPD 2P46B 3CSBA 3HPLA 5CINH 1DEEB 2VDRH 2D7TL 2FO4B 3NA4A 3GB7B 1CFNA 1I1YA 5DJDA 3FFDA 4Z7UB 3H0TB 5IWLA 4EI5D 5INDA 4M9PA 1MCEA 4RIRB 3PGCB 3NIGE 3ET9F 3EYOB 5IFHH 4F58L 3X3FH 1HILB 2B39A 3MRQB 5DMGC 4GW1A 4XB7A 5HHPB 2NW2A 3HN3A 5HGHA 2W07A 4OZGE 4YHLL 1FZKA 2UY6A 3UAJD 3KR3H 3QI9D 5EU6B 4K3EH 3HC3L 2VNCA 1VACB 4QHUA 1FYTE 4OV5B 2XWBB 4DZBB 5FYJH 4UOW1 1IC4L 2F5AH 3D85A 4PJFA 3GMNB 3GO1L 2VZUA 3DTXB 3STZB 1F4XH 4NCC1 3S5LA 1MJJA 4X6DA 3UZVB 4TNWF 2NX5E 3SKJH 1ITCA 1U58A 1AQDA 4OUUB 4LGPB 1J9CT 3KXFB 5DRZA 2VLRD 2VO5A 1Z2KA 2AK1L 4OUOA 2HRPH 2YA0A 2BVQB 2I60H 5LXGH 3FB8A 5GGTA 4U6YA 4Q9QL 3QCUL 4QYOB 4DFHA 1BZQK 3O6ML 3VGBA 4UDTA 4OLZH 4UQ2A 4OLWH 4R3SA 5FDWA 1F5WA 1C12A 3TZVB 5B3NA 5IFAL 4IDLA 4S1RL 4O9HL 2AABL 1S8DB 1L0YA 2BSSA 3W2DL 4I0CC 4LASH 5JOFB 5A2JH 1FLTX 2PR4H 3CH8A 2DQGL 4JZOB 4C59B 5CKGA 3F6IA 4G42A 2EKJA 5GGSA 2OYPA 5K9KB 4GXVL 2IGFL 2AXGB 4GKOA 4HXBH 4BH8B 5GS1B 1MJUL 5IBUG 2J1KA 3PF2A 5B8CA 4ZD3L 1HK6A 1KJ3H 2V2WB 3FZUC 1S9WB 3IAQA 1SYVB 2GFBA 1E4WH 3S37H 3MUGA 2YD4A 2PETA 3MV7D 4F7MB 3EYUH 4NKIH 2VLLA 1KENH 1J1PH 5C0CA 3RFZC 4NO5B 4YBLB 4MSWA 5F7FA 3DETD 1R5VA 2W59A 4ENEC 3ULUD 2PKDA 2PTTA 5CCKL 4WUKH 3UTTA 2A1WL 1SJVA 4U0QB 4PP2B 1UT9A 4PJFE 1VHPA 5DVMA 5C2UB 4I9WD 4RISL 4ONOA 5I1CL 1UYWL 1MCWW 2OJEB 3QIWB 3UZEA 5EBMA 1R5IA 4G7VH 5I76A 4F58H 1B0GB 4ZYKB 3QPXH 5DHVA 2DIJA 2GAZA 2VZSA 1MVUA 1LDPL 3MLUL 4OCWL 2X2YA 4JFOB 2RIKA 4TVSa 4HMEA 5D1XB 5HHNA 5IHZB 4QWWD 1KCVH 4HIHB 3LN5B 4MS8C 4ODXA 4P9HL 2WZPD 4BJLA 1RV6X 3S98A 1JI1A 4WW2A 5ESVB 1BOGB 2H2SC 4I1NB 1JGUH 2DYPB 4XNZC 2IPKB 5F6HJ 3M1BA 5D7LD 4KKCD 4ODVL 2YKLL 1MLCA 4OLVL 1U95A 4HPYH 3ZDXE 1CU4H 3SJVD 2CR3A 1A2YA 3QCUH 4IMKA 4Q58C 3O6MH 4K2UL 4KWUA 1EEYB 2ITDB 1IGFL 1XEDA 1JWUB 1T7XA 3UX9B 2VR5A 3UROR 3TLRA 4JRYA 5CP7B 1J8HB 3T65A 3B5GA 1EJOH 3RIAF 4FTVA 3LOWA 1NAML 5C0CE 1T0MA 3D1MC 3U1SL 3RY6A 1DFBH 4Z78A 1PQZB 4NQCD 3WEXB 5HYSG 4KQ4L 1FZJA 3MLXH 5IBUB 4NO0B 1Y18B 5ISZB 1MJUH 1KTLA 3LKPA 3VWJC 1FIGL 3V9FA 1Y6KR 4D9RE 3L95A 3K4ZA 2ZUVA 2VWEC 2KQMA 3VXQA 3O9WA 2XN9A 3U9UB 2KPNA 4WI6A 4MNHA 1UZ6F 1JHLH 1ORSB 4EVNB 5IF0A 2P8PA 5KSBB 4ZXBA 2PXYB 5KN5A 5SWZD 4PV9B 5DYOB 4JDVA 5KVFL 3G5XA 5HXMA 5TF1L 2Z93B 1CFBA 3HZVB 1BGXL 1VDGA 3WJLC 4G6MH 5ITFA 4G6JH 4MCYB 1LVEA 2X4NB 2CDGB 3WIFB 2DLHA 1WZ1H 3KPOB 4AM0A 1U0QA 4RMQA 2AKRB 2HKFH 2J6EL 3IVKB 1A4KA 1LDPH 1WWCA 2VE6B 3ULVL 3MLWL 5D2NC 4HZLB 1MRDH 1HE7A 1ZT4A 3U7WH 3EDKA 4JG1L 4JFYA 5CD3A 3MLYL 2PCPA 5C8JA 5DR5L 4P3DA 2XG4A 5CEZL 4HV8A 4JRYE 1DLHA 2B0SL 1BIIA 5J9PA 2HT2C 3VFNA 4QRSA 2V5RA 3QUXB 3DBXB 2E9IA 1JTTA 3MNWA 2B20A 3QXAB 4FTVE 4S1SL 5DTFA 1HXMB 1YMMD 3ECBB 4HUWB 3CZFB 4GKZB 1JFQL 3FCTA 1Z0MA 3GSOA 4M4RA 3LEXA 5KSAD 2ADJB 4PJDA 4RMTA 4PY8J 5EC2B 1IE5A 1DQJA 3FQTB 5I17A 3N50A 2DM4A 4LEOB 1FRGL 5IVXB 1I9JL 1IGFH 4L8DB 4X7EC 2WLYA 4EN3A 4KZEL 4ZSOE 5K9JL 2LAAA 1JK8B 4N0UB 2XN9E 3K7UA 1VB9A 2GTWB 2EE2A 2HT2D 4M7ZB 3G5VA 32C2A 5DF0A 5KJRL 1NAMH 3U1SH 2RB8A 2NY4D 3WFCH 4GRLD 1RZ7L 2JIXD 4LPVA 3LH2L 4N90E 1HEZB 5IP4A 5KOMC 5IESL 1FIGH 2G9HA 4Y2DA 5F1NA 1A7PH 2VXUL 3PP3K 3DECA 4HWBA 4ZNEA 1EGJL 2VXVH 2DQFB 2DDQH 5KANG 1AO7A 1BZ9B 1I8LA 4LDEB 1MCCA 4P3CH 5KVFH 4OI9A 3P9MA 5D96C 1LE5B 4U3CA 5DS8B 3WNLA 2ZSWB 4FMKA 4L4VD 4K3HA 5KTEL 3DWTA 5D4QA 5H37H 3P73A 1MIMH 4DN4L 2NY1D 5FCUL 2J6EH 5DJ6A 5LVEA 35C8L 3LHPH 2VLMD 1M1SA 3MLWH 3VWKC 1RD6A 2OSLB 2IMMA 1WFUA 3AREB 4PJ9B 1T80A 4Y2OA 2ZJSH 3CZJA 1ZHKB 5J06A 4HFWA 3WKMH 4NPYB 1RULL 3RVUC 5CSZB 4O58H 3PNWB 2R0KH 3OR7B 5IK3B 5FB8B 2P5WB 3HI5H 1PG7H 4S1SH 1IGIH 2ITCA 3ZKXC 1JFQH 1J88A 1UA6L 1J0IA 4JN2B 4NQEB 2EIZB 1XGTB 4KMTL 4WO4C 3QUMA 2V17H 3MFFB 4IRJC 5ID0B 1N64L 2VOTA 4S2SA 3VWKD 3KPSD 3VG9B 1OGAD 3BPLB 4X83A 3RGHA 5I1DB 4F7CA 3LS5L 1I9JH 1PZ5A 4JM2A 4X5WB 3QISA 4YHOL 1PYWB 4U1LB 1T5WB 4X80H 4ZNEE 1ZS8B 3FQWB 1B4JL 2VTFA 1D9KA 5J6GA 2IANB 3NFPB 5GRVK 1I9IL 4DKFH 4F9LC 1TZIB 1AO7E 2J8UE 1T66C 1OM3H 3TH4T 2XI9A 3GMQA 5F7DA 3RAJH 3LH2H 5DWUL 3T0EB 4FQXB 4X6DF 4GMSL 2YOCA 1B2WL 2Y7QA 4HS6B 4PJXF 4FXKA 3MOBL 4TPRH 2LU7A 3PE9A 1J11A 4XH2B 1H3PH 3BZEB 3BP4A 5D9SB 4YHYC 5H35B 2E3VA 2IPUK 1EGJH 5J1SC 5IEHA 4WHTB 5FYKE 4LLVA 3LQAC 4KJPD 2V2TA 2VH5L 5JUEL 1FVCA 2GY5A 2QSVA 2ZCLL 3ZLQC 3U46A 2CKBB 2DMCA 4NHCL 4O4YL 4Y5XC 3NPSC 1TQCB 4I0PA 3MV8B 4Z9KB 4MMXC 1HOCB 3DURA 3BH8B 3OX8A 3MYJB 2VR9A 2DJ4A 4DN4H 3HA0A 1UWXK 1RPQA 3HNTL 1Q9LB 35C8H 3MGOA 2GKIA 4K8RL 1U8NB 1G9NL 3FQXA 2C7UA 4C57C 2BRQA 3UDWC 4XXDB 3FO0L 1ZLSL 3LEYH 1TCMA 3T8XA 4WGWB 4MD0A 4Z5RA 1XMWA 1MFEL 2Y6SD 1QLRB 4PJ8A 1OPGL 4GG6F 3BUYA 1YEDA 1P7QB 5FHAH 1ZHNB 1UJ3B 4NC0B 4P49A 2BNRD 1UA6H 3OWEA 3NVQA 3S88L 1N64H 1RZFL 2OMNA 3JBG7 3QRGH 3V6ZB 3FO2B 1OTUD 4QRQB 4NRXB 4IIQC 1OP5H 1NUDA 5HPMA 1LO3L 1SYSA 1TVBB 4PRIB 4EQ2A 3JTTB 1INQB 4G8FA 4NKDB 3ZSTA 3GFUA 4AEFA 2O5YH 3GSNB 5E9DD 1SJHA 1I9IH 3PL6A 4JFEA 2R8SH 1MCWM 4KK5D 1T1XA 3QH3B 1MCHA 4WWKB 3VFWA 3MBEA 3FQUA 1LK2B 2Z92A 3QNXA 4U7MA 3DYOA 4FZEL 3QDMA 1GZQB 3MOBH 2GJZB 2R1XB 2IADB 5GZND 5F72S 3GUTA 1XGUA 3KGRA 3CD4A 4L5FH 2JJSC 25C8L 4PRHD 5DI8A 3QJFB 4O51A 2Q3ZA 3ARZA 5JUEH 3PHQB 4LLYA 2ZCLH 4W6XB 3OAZH 4G43B 4PBVC 3C5JB 5JW3H 3WNNA 4NHCH 1F42A 1IARB 4JQXC 4ODTL 5D7IA 4OZIF 3QO0B 1U8QA 2APBA 1T7VA 4YHML 4A6YH 4XPGH 3BE1H 4G6FB 5BVPL 3SDXB 1FGVH 2WWMC 4NQVA 4XXCA 5KSVB 1MPAH 4K8RH 3FO1B 3HE7B 5BVJB 4OQ1A 3FO0H 3ZHLA 2JELL 1K8IA 1EHNA 1QBLL 4G3YH 1CDYA 2DQUL 4P48A 3G6JA 1AGEA 4KDWA 1JPSL 1YMHB 4YZFE 1UKQA 4BZ1H 3MJ8B 5EU5B 1E27A 2H32B 5IMLB 1A7NL 4Z8FL 2QEJA 1S7TB 4JFEE 4XT1C 1DEEA 4PP1D 2FO4A 3T1WA 3GB7A 2LU4A 4IDJL 3H0TA 5L6YH 2ZPKH 3C5ZD 3ZE1F 1HYSC 4RIRA 3PGCA 4C83B 2P8MB 3EYOA 1HILA 3VXSB 4UB0H 5E99L 2XA8L 2DAVA 3SDDA 4EKXA 3F12B 2E7BA 3AB0B 3MROA 4R97C 2DD8L 3ZMRA 1QZ1A 5L88L 4YE4H 4HK0A 1VACA 4QCIB 4OV5A 4DZBA 4HG4J 5HI3C 3W39B 3PWPB 3GMNA 4L8SB 3DTXA 3STZA 5TQ0L 5BO1H 4LARL 4KU1A 2VDLL 2X4PA 4P4KD 2X1WL 3AS3A 1F6LL 1FQ9C 4KUCF 2H2PC 3BHBB 5D7IE 4JO4L 5CZVL 5J11C 4PY8I 4OUUA 3C60C 3KXFA 2HFTA 5EOCH 1H5BB 25C8H 1YEJL 4Y4KB 2BVQA 1NFIB 2AEPL 4QYOA 3MMEB 2ATKB 1WICA 3T0DA 2XRAH 3VRJB 5ALBH 1ZK9A 3DUHA 3U4BL 2IG2H 1JNJA 4APQC 3TZVA 2XKNB 5HI3D 1MIEL 1KGCE 2XWJB 1S8DA 1MCLA 5I19H 1W2KT 1O7SA 5JOFA 2ED9A 4JZOA 3G6JE 5EO1B 4YHMH 3I6GB 4NM8H 4LK4A 4EDXB 2NPLX 3MFGB 4M00A 5K9KA 2X1QA 2XTJB 2AXGA 5IHLB 4BH8A 3S34L 2EECA 5FUOH 3RIFF 1OW0C 1S5IH 4WTZA 3NABH 3D0LB 5EU3B 5FDYA 4PBWD 1S9WA 4Z7UE 4I3RL 5HVHC 1SYVA 3OF6D 1UFUA 2JELH 3V7AG 2DI9A 3ISWA 3SQOL 4F7MA 2DQUH 2QTEA 5DUPH 2HKHH 2ENSA 4Y16B 1I1RA 4WFEE 2P7TB 5EU6E 5T3ZE 3IXAB 4UV7H 4OCYH 3KPTA 1U3HC 2OXHA 2AJ3B 2CJUL 4LCCB 4TRPH 5DVNA 5JQ6H 4ZG1A 4IDJH 1KPVB 4RGNC 1UB5B 2YRZA 2WBJB 1W72L 1DBBL 2OJEA 3QIWA 5HDBF 4FQ2H 4RSVA 4PGDB 5LGHL 4ZYKA 3GMLB 1IGTB 1BBDL 1NBQA 1XIWD 2XA8H 4HGKC 5FYLH 5TE4L 4X0KB 4JFOA 1RUML 1V8HA 3T3PE 5D1XA 2VKXA 5IHZA 3GJFH 5EU4B 4GJTB 3WLBB 3LN5A 4HCRA 1U3HD 5ESVA 1YQ2A 2OJZL 3P4LA 5I18L 1XCQB 3HE6C 5TQ0H 4LARH 2DYPA 3MR9B 2IPKA 1A3RL 1S9YB 1WGOA 4JO4H 1IAKB 2AEQL 4MX7B 4PJAF 5HYEA 1OB1B 2B4CC 4G8GE 2D0HA 4Y4HC 3CGTA 5I1HL 1ETZB 2HVJB 2LQRA 3KLAA 1WAAF 4Z7OE 5IQ7H 1EEYA 4ZODA 2ITDA 5GXBB 2F54E 4MQ7B 1D5MB 5E1AB 1JPTL 1SJEB 5CP7A 3K0WA 4LSUH 3RDTD 2OMBA 5AD0A 3DOSA 4N5ED 4NC2B 1JGVL 4ZQKB 2ZSVA 3BD3A 1KC5H 2NTFB 3IXTB 2YZ8A 3DV6B 4OCRL 1PQZA 3WEXA 1NAKL 1HSBB 1EX0A 4HBCH 3SGKA 3DYMA 4C4KO 2NY7H 4M6MH 1E6JL 2ICWB 4NO0A 1AXSB 1Y18A 5ISZA 3VH8B 4Z76B 1T20B 5E2UL 2E8ZA 5E00A 4HJ0D 4K3DL 1GH7A 3CSPA 4NZRL 4WHYH 1RUKH 3HZYB 3W11C 1OCWL 3U9UA 3E8UH 3FN9A 4HWZA 1VFBB 3QQ9D 1ORSA 1PW3A 5E8DL 2X4UB 4DGVL 2VDMH 4EVNA 5JHDB 2QADB 2PXYA 5CZXC 3MRDA 4PV9A 2VN7A 5DYOA 4CN6A 5IW6B 4K71C 3CFDB 4MB5A 4GAGL 4NBYB 2Z93A 4GAFB 3GI8L 5AZ2H 3HZVA 1C7TA 1F11B 1I7RB 1QBMH 3T1FB 1BQUA 2BXZA 1CGYA 2X9WA 2X4NA 2CDGA 2DWDB 1TCRB 3WIFA 1N26A 3OKOA 2AKRA 4TNVK 1NCDL 2X9YA 3LD8C 5F96L 3MLRL 4JKWA 3UBXI 2D9QB 3Q48A 3QFJB 2VABB 5TE4H 2XTLA 3V0WH 3O11A 1RUMH 3HMXH 4NQXA 2X4TB 3GHBH 3O3EB 1CGSH 2CGRH 1X5YA 3AS1A 1IGJA 4AL8H 4GT7A 1GGCL 3KLSA 1GOFA 5I18H 4Z7WB 5EDXA 2JF1A 5JORB 4I13B 1DLFL 1J8HE 3QUXA 1AIFB 5GGUB 3QXAA 1RIVL 1HXMA 4XP1H 2B1AH 1FN4B 1PLGL 3ECBA 2Q8AH 2AEQH 3GRWL 4HUWA 3CZFA 3L3IA 4GKZA 1TETL 4JHAL 1IAMA 1LK3L 1Z9OA 4HC1A 4FFWC 3FQTA 3QXDB 3CVHB 2PYEE 4NBXB 1KBGH 4LEOA 1IRAY 5ISZE 5IVXA 2NXYD 5C71A 2BHYA 4L8DA 1JPTH 1JK8A 4TVPH 1RUQL 2EDJA 1P53A 4N0UA 2ENYA 4KXZI 4O00A 4WI9A 4JQVA 2XOTA 3CDYA 3ULUL 1OAYH 1JGVH 1EZVX 1DQDL 1B6DA 1ZGLB 2ESVD 5HYSA 3H7BB 5LBSL 3WFEH 1CL7L 1V7NL 3MJ9L 5KSBE 5M94B 1FSKC 5LQBL 4OCRH 5F7LB 1NAKH 4ORZC 4YAQB 3QIBC 1CFVL 5E6IB 1E6JH 1HEZA 3QWQB 5TE6L 3CH1B 4FFWD 4ZUUB 1NQBA 1JNLL 1T7YA 4WTWA 2EZ0D 4N9GB 4NNYA 3QHFL 1JTPA 1XF5B 1QD0A 2DQFA 2FX7L 4DGVH 2BNQB 4L8BA 2X7LB 5D71L 1JZ5A 1N5AB 5EUOB 1KYOJ 5DS8A 3VD3A 2AJSL 2ZSWA 3CDCA 1K85A 4JHWH 3FO9B 3UXFA 2VXQH 3LKSB 3GBML 2WBWB 2FH8A 5L0QB 1TNNA 3JWOH 1I1FB 1IEBB 2FX9L 3T04D 3C87A 3O8XD 3WBDA 5IMKB 1I4FB 4G7YH 4H0HB 1X5IA 4K94C 2C1PB 2XFXB 2YN3A 1S78D 2XT1B 5DFVD 4U1SB 3HUJF 5CSBA 2OSLA 1U42A 2ERJC 3M8OH 4JB9H 4PJ9A 3WS3B 4J23A 2BVYA 5IVXE 1J1XL 4C58B 5DO2C 5J13B 3FN3A 5F9AC 1GGCH 4NWUL 3SN6N 4NN7B 3IETA 4NPYA 3HG1D 5CSZA 4O5LL 4HUUB 3PNWA 1DCLA 3OR7A 5FKPB 5C6TL 4N0UE 3U4EA 3S9DB 5IK3A 2FNBA 3GHEL 5FB8A 1CXIA 4LLQB 3L5XL 2P5WA 4P2RB 1RIVH 4DVBB 3SHSA 5KVEH 1KTDB 3O3BB 4RA0C 3PXJA 4JN2A 1F4HA 2EIZA 5DD5L 4CJ1A 3ARBD 3MFFA 5ID0A 1H8OA 3Q2CA 4MVBC 5FUCC 5EORL 3C08H 5LG1A 5BV7L 1E4JA 4X5WA 1PYWA 4U1LA 2J8HA 2QSCH 3IS1X 3NGBC 3WXVL 1T5WA 3ULUH 1DBJL 2YPLD 1ZS8A 1GGBH 2NY6C 1DQDH 1N7MH 4YHZH 2IANA 2AJYL 3NFPA 4NUJB 1I7ZB 1TZIA 5EBWB 5LBSH 1BJ1H 1V7NH 5L7XL 1YYLH 5LQBH 1G7HB 3DRQA 4JJHA 1CLYH 1ZLUK 3T0EA 4M93B 5TE7L 1BWMA 1GJIA 1JNLH 1MNUL 3H9SB 3ULSB 1YDPB 4XH2A 3TC9A 3BZEA 5DJZB 5H35A 1DE4B 3BQUC 5DVKA 2NY6D 4WHTA 2L7JA 1T03L 3R1GH 5T5FL 4DTGH 3WYRA 2NXZC 2FD6L 3VFMB 1S7QB 4H8WH 3KNBB 4QOKD 3IDYB 2CKBA 2NNAB 2AJSH 4KRPD 4I2XB 4F2MB 2P5ED 2E6QA 5I1IL 1PSKH 4ODUB 5I8KH 3S36L 1HOCA 3BH8A 3MYJA 4M43L 2FX9H 2VZTA 3VFVB 2MHAB 2P5WE 2WQRA 5I73C 2XY2A 5FGBA 1Q9LA 1HHGB 4FQJH 4XBEL 1U8NA 4NQEE 1FLRL 4IOFC 3S96B 2P45B 3FQRB 3MBXL 5J0BA 3W0WB 3U9PL 4A2LA 1J1XH 2E7HA 3QUKB 2CIKB 3KPPB 2G60L 1QSFD 4M48H 4UINH 1NCBH 4NZUL 4NWUH 2FYYB 4FOMA 2XXMB 3D3VB 5JLZB 1QLRA 4DGIL 1NGPL 1NMAL 4YC2C 3L5XH 1AY1L 2IANE 5E8OB 1C5DB 5CEXB 1P7QA 1U93B 5IR1A 1ZHNA 1UJ3A 5C0NC 3TV3L 4NSKB 3DGCR 4Q0XL 4P57B 5A3IC 5DD5H 3RZCD 4J6RH 3SY0B 1FPTL 4PYGA 5I15L 4HD9A 3T0EE 2WK2A 3C6LD 3NH7L 3FRPG 1TJGL 3FO2A 3V6ZA 1EH9A 5BV7H 2CH8A 4NRXA 2A38A 3EZJB 5DK3A 3EBAA 1TVBA 1JRHL 4M02A 4PRIA 1INQA 1UM6H 2L0DA 3MRMB 4OJFL 4NKDA 3VFGH 1NCAL 1J1OL 3WDIA 2FJFA 4PJGB 2YC1B 3QIUC 3GSNA 3MX0A 1MCPL 4QNPF 3VXTB 1BEYL 1ODAA 5MP6L 1T1YA 1EBAA 1GPOL 4S1QH 4GS7C 1F4WH 4XHQA 1A1OB 4WV1B 1VGEL 1LK2A 2NTSP 1GZQA 2GJZA 5F8RC 2R1XA 2IADA 3MV8E 4ODBD 5KW9L 1CICD 4LIQH 1FYTD 3WFBL 5C2BL 3ARDD 3H3PL 5F7MC 1A0QH 4F57H 4P59L 3QJFA 4TUKL 5M95B 4JDZB 4TSAL 3HAEG 1HIML 1G7PB 4ZPVB 2OI9C 2MJWA 3WSQL 3PHQA 1RUPL 5AG8A 2XACC 5GSRB 2WP3O 4G43A 3OAUH 3B9AA 4WENB 3C5JA 5GRZA 4IRSD 4NKMB 1RFDL 4HMDA 4X4MA 4HT1L 4KFZC 3PDDA 3QO0A 1YYMH 3V5KB 3W81A 4M62H 5K59E 2CD0A 1EPFA 4XPBL 1EBPA 1CDBA 4NRYB 4K23H 3SDXA 4MD4B 3S3JA 4LLWB 4YDVB 2OL3L 1P84J 4EUPG 2D0GA 5KSVA 2R56H 1X5ZA 4XBEH 3CMOH 3C09B 4XCCH 2AJXH 3FO1A 5TPWL 5ITBL 5EOTB 2BOBB 3BT2L 5BRZA 4N68A 4H8WC 1LEGA 5C08E 3BGMB 4WTXA 1KN4H 4NO3B 2DI8A 4F37K 2A0LD 1YMHA 4PRIE 4N8VG 3MJ8A 5EU5A 3VGAB 4NQTA 2H32A 5IMLA 1QTYT 1S7TA 1X5LA 4M8VA 5IKCA 3BKCL 1JJUA 3TV3H 4JO3H 3OPZL 4Q0XH 1BJ8A 2O5ZH 5L2KB 3D0VB 1DQTA 1CZ8L 4HIJA 2EEAA 1DUYB 5IT2H 3NCFB 1TJGH 2P8MA 4CW1A 3NTCL 2O93L 3VXSA 4MXWL 2Q6WB 1DL7L 1LO4H 3MREB 1DVFD 1J8KA 1GRWA 3F12A 5I0DA 4LRNH 4OJFH 1UWGL 1OAQH 5HI5C 4M1CC 1N2RA 1BEYH 2B5IC 4QCIA 1HCVA 1VFAB 1W0VB 3STLA 2R23B 2HTKD 1LP9B 3W39A 3GMMB 3PWPA 4L8SA 3BYTA 5CMAB 3LB6D 4Y1AB 4LSPL 1N6VA 3BHBA 3LQAL 2FHBA 3K1DA 4LMQI 4CUCA 5B8CC 1ROWA 1JHKH 4M5ZL 4ORGA 4MYWB 1H5BA 3G08B 1ZA3B 1FAIH 1Y0LB 4V2BA 5C6WH 4L1DA 1A14L 4Y4KA 3QUYB 1FCCA 3OJDB 3SDXE 1NFIA 4E9LA 4WEBL 3MMEA 2ATKA 4TSAH 4OM0L 3VRJA 4LRIA 2W9DL 3O4OC 3UPRB 3HMWL 1D6EB 1Q0YH 2XKNA 2XWJA 2CUHA 4OF3A 3EO0B 3FAWA 1D6VL 4PJ7B 4PGBB 4JLRA 4RGMC 2DN7A 3WHE1 2R0LL 2GW5A 3I6GA 4P3WA 1KJMB 4HS3A 1UWEL 2BVEA 3HC4H 2DQTL 4LVEA 1CD9B 2OL3H 3VXNB 5EU3A 3SKUD 5ITBH 3BT2H 3RPKA 2I5YH 4GG8B 2YSSB 4N8VB 3VXSE 3SCMD 1A7OL 2FHCA 5HHXL 4FMFA 1KCRL 4WW2C 3TJHC 1QBBA 2ADIB 4V2CB 4Y16A 3QEQB 2P7TA 3UBXG 4F7PA 4KI5C 2XQYG 3IXAA 4HH9B 3V52L 5EZLB 4JDTL 3BXNB 3OPZH 5GGRB 1KPVA 3OMZA 5DQ9B 3OHXB 4MXVF 1UB5A 3GSUB 2WBJA 3LVEA 3M45A 4MQXD 3ILPB 1H0DA 4IMKC 4PGDA 3NFSH 1SMAA 1EZVY 3GMLA 1IGTA 4CJ0A 3VFSB 3F5WB 4WO4B 4KTEH 1INEL 4IRJB 4XP6H 5H37G 3BDXA 1QNZL 5EU4A 3WLBA 4YWGH 1SBSL 2D0FA 3EO9H 3RY6C 3H8NA 3BP6B 4CVXB 3PQYB 3BDBA 1XCQA 4JVWA 1VKXB 3MR9A 1S9YA 2WAHA 3OV6A 1YQVL 1U3YA 2I24N 5C0GB 1QR1B 1IAKA 1NGQH 4GRMB 3N1QC 4M5ZH 4MX7A 4NJAH 1WWAX 1OB1A 2VZOA 4DN3L 4JRYD 1A14H 3CMGA 3QPQC 2XTJE 4X7SL 4RZCB 1ETZA 2HVJA 2PW1B 4RNRB 1GHFL 2HWZL 2W9DH 1NSNL 4FTVD 4JVPA 1IGCL 3QWOB 4ZXBC 3L5HA 1D5MA 4F9PA 5E1AA 1SJEA 1CE1L 4OQTH 2J4WL 1D6VH 4OZGF 5I8EB 2D9CA 4DGYL 2NTFA 3IXTA 1ZHLB 1HSBA 1G6VK 3O9WD 2F74B 2YHGA 2ICWA 3SQBA 1AXSA 1HHKB 4Z76A 1T20A 4Y5XB 4OAWB 5ESQB 3V6FB 2NY3D 5CD5C 3HZYA 2VXTH 3E1F1 3ZE0E 5T1KD 4QGYA 1VFBA 2J7LA 2R0WH 4FQLH 4N0CC 2VUYA 1OAUL 2AJZA 3KWWB 5IW6A 4MLSA 3CFDA 1EA9C 4HKJA 3V52H 1MH5B 1F11A 1I7RA 4YDKL 4LQFL 2H3NA 3MLZL 2RFXB 3P11H 2DWDA 1BX2B 1TCRA 5MENB 5E2TL 1F6AB 3BAEL 4MAYC 1KELL 4X99A 4DJMA 1NFDF 4EN3C 3BSZH 3QFJA 2VABA 2XPGA 4ZOBA 4RAHA 3UP1A 1BIHA 5DEZA 2X4TA 3TCLA 2IC2A 1U8JB 3O3EA 2HMIC 2HRLA 1A7RL 1QPPA 1UG9A 4D3CL 1EEZB 3B2VL 4K7FA 2Z91B 1YUHB 5FFLA 2FRGP 2FECL 4KY1H 8FABB 4WUUE 5JORA 5D70L 2QSTA 3NCEB 5GGUA 5SWSB 2SEBA 1YQVH 3T4YB 4GLRH 4W70A 1FN4A 4Y2DC 4EN3D 3BMVA 5I6XB 3O2DL 2LABA 5J4MA 4P2OD 4AIZB 1T04B 3Q3GA 4XCYA 1MF2L 3CVHA 2NZ9C 4IOSD 3AVEA 1KXTB 3MGTB 1I85A 3LCYA 4DVRL 1TQBC 2OZ4H 1GGIH 4RFOL 3V7AE 3NMEA 4I5BB 3PGFH 4OTXH 4UOJA 3DGGA 5HHMB 5F21B 1AP2B 1G7LB 4U1KB 1XF2B 1ZGLA 5JHDE 3H7BA 4MMZC 4DGYH 4C56B 4PJBB 4HHAA 1YECH 2X4RB 4YAQA 2X9XA 4PJ5E 5E6IA 5IQ9A 4BYHA 1I1CA 4UIKL 5L9DL 3CH1A 3RTQD 4ZUUA 1JYWA 2ZCKH 5E94B 3SE3A 1HWGB 1GC1L 4TUOB 2WUCH 5HGBB 5HHOD 1JBJA 4JFDD 1OT1A 1XF5A 3B9KD 2OR8A 1P6AB 5BS0D 4AZ8A 1IM9B 1IGMH 3QFJE 2X7LA 3ZDYE 2WM0A 5J6HB 1CL7I 1LO5B 3MLPA 1N5AA 2A6DB 2DIBA 4NN6B 2VKWA 3JWDC 4FP8L 5EUOA 2FWOA 4YFLF 2Q3AA 4BH7B 3W82A 1JGLH 1FNSL 1MVFA 4DAGL 2JB5H 1CD0A 1F58H 3FO9A 3LKSA 2EDTA 4Z7WE 5SX5K 4OFYD 4UIMB 1I9RL 3RWGA 1I1FA 5GQBA 3OKDA 2HFGL 3NCBB 1MLBB 4OFKA 4YDLB 3RHWK 3OKYA 4JM2C 1KIRB 1I4FA 1DBKL 1J05A 2C1PA 2XFXA 4JQIL 4U1SA 1MJ8H 1D9KC 1DBAH 5ICZB 3WS3A 4JPVH 4D3CH 1KLGB 4JO1H 4AEEA 3L3OB 4URTB 1GOHA 4O02L 3F58L 4HUUA 5FKPA 4LLUB 5D70H 4F7TB 4KRNA 4LLQA 4R97B 4ONHB 4P2RA 4DVBA 2FIKA 2X40A 1KTDA 1J0HA 3O3BA 1J10A 2FIRT 4JO2L 4J8RB 5D93C 4LSSH 4U05A 2E9WA 4ZFOB 4U6TA 4N0YH 2NY5H 4JY4B 2GEEA 4PUBL 1EHAA 1GIGL 3OG4B 2OK0L 4R7NB 3RUGA 4OZHF 3C60B 4JAMB 4KHXL 1MFAL 3EOTH 3TO4D 3WIHH 3MRRB 1JUFB 5JHLL 1FGNH 1AXIB 1I7ZA 5EBWA 2BNQE 4EJ1C 1G7HA 2NY0C 4J4PA 2HJFB 3MA9L 1OLLA 4OGYL 5EUOE 4CDHA 4JM4L 5E03A 3KYKH 3H9SA 5E24E 3E2HB 3ARGB 3RWHB 1GC1H 1V05A 1YDPA 2BY0A 1CVRA 3RL1A 5DJZA 1GZPB 4TULH 1DE4A 3LSOB 5E4EC 2BX5A 1MJ7L 4YXKL 1TZGL 5IGXH 1MEXH 5GJSL 4WY7L 1ZT7B 3PUCA 1EHXA 4LOUD 4I0PD 5CILL 2EYSB 5IHUH 3VFMA 2DLFL 3QA3B 1S7QA 2G2RB 4I18B 3KNBA 3B2UD 3WL9B 1KEMH 1G9EA 5ILTL 1YEIH 4OM1L 5GS0H 2V7HB 4I2XA 4AJ0A 5DDHA 3TT1H 4J3OC 2HAZA 4ODUA 2VQTA 5JDSB 3IAPA 1CDGA 2N7BA 1A9EB 1I9RH 3VRLE 3WLWC 4W4OA 1B0RB 3M17B 1CXFA 3VFVA 2MHAA 4P2RE 5CJXA 4A6YB 4H1LH 4XWOC 1U9KA 4L3ED 1HHGA 4MJ4A 3S96A 5TDNA 2M1KA 5D2LF 4ZFGL 4NN5C 4PJ8D 3W0WA 3B9EA 4KK8C 4C4KT 1OLZA 1BVKA 3QUKA 2CIKA 3H9HB 1HDMB 5I9QB 1FVDA 4HUXB 3TVMD 3KPMB 3TPUB 3D3VA 3DIFB 5JLZA 5D1QD 5SX4H 5FECA 3MBEC 1URLA 4P5TD 3NA9L 5E8OA 1C5DA 5ALCH 5CEXA 5JXEC 1U93A 4R96B 1BD2A 4XCEB 5LAXB 1P7KB 3OJ2C 4UU9B 4JO2H 1RZGB 4KI1A 3P4OB 3SY0A 4W6WB 3BDYL 2PTVA 3TJEH 1Q9KB 2BDNH 5F6IC 3PL6D 3H9SE 4PUBH 1UZ8B 2OK0H 1RZ8B 1V3KA 3VFRB 4HF5L 1BP3B 2XZCH 4OCXL 1S7VB 1JZ8A 3MRMA 5I1LB 4Y4HB 4PJGA 1GGYA 1AC6A 1MWAL 2C4FT 5JHLH 3H3KA 3VXTA 1NEZG 1IGYB 5D1ZD 1SY6H 4P2QB 4KZDL 2FDBP 1FO0L 4YLQT 5GRWA 3GMPB 1A1OA 4WV1A 3SPVB 3VFOB 5KG9B 5LGKA 4XXCC 4X6EB 4XC3H 4KROC 3K74B 1MCNA 3RKPA 1MJ7H 2K7PA 1JRHI 3VXRB 5GJSH 5GPRA 4WY7H 4JDZA 12E8H 2BRRL 1G7PA 4ZPVA 2XQYK 2XZAL 4X4XB 5GSRA 4E41A 3MOAL 5IBLC 4XVSH 1HI6A 3W0WE 1QEWB 4OM1H 2JE8A 3TP4A 5FEBA 3SKNB 3RJQB 3V5KA 4YGVB 4K94L 3ARYA 43CAB 1K8DB 3D3VE 4JEGB 4KROD 2K3TA 4XCFL 4EZMA 2J8UF 1KGCD 4NRYA 4UILH 1ZXQA 4LLWA 1CD1B 4YDVA 15C8L 3JV6B 4RWYH 3SDDC 2HT3D 3AY4A 1RIHH 3MODL 5EOTA 2BOBA 1IQWL 1KJ2B 3EFDL 3MPCA 4QRPB 1TPXB 4D9LH 4HIXH 2XNAB 3MV9D 4CVZB 3LD8B 3FONB 2YK1H 4QXGL 2O26U 4NO3A 3OKLB 1CDUA 5J8OA 5GS0C 1S7WA 5AYQA 4WHYG 1JIBA 1GAFH 3UCRA 3EYSL 3IS0X 4PJGE 4L4TB 3ARXA 4CNIB 1AKJD 3NACH 1RI8A 5AUMB 1VEPA 5T3XL 5L2KA 3D0VA 1A64A 3FRPA 5MEOA 1CLZH 2A77H 4QXWA 1C08B 1DUYA 5FIEA 2MCPL 4WFED 4MJ5B 5EU6D 5T3ZD 4PG2A 5FYJE 2EE6A 4RCAA 3RWIB 4S1DD 2HN7A 2Q6WA 1OWWA 1V7MH 4M1GH 3MREA 4HF5H 4JR9L 4YPGB 2N4IA 1JV5B 3GDBA 4AEIL 3TIEB 1VFAA 1W0VA 4NZTL 1LP9A 3GMMA 1BF2A 4PREA 1T1WB 4KZDH 3OZ9L 5CMAA 3D2UB 1XH3B 3OL2A 4Y1AA 2ZG2A 5DD3L 1EHLL 1QBAA 4X9IA 4X9GA 4GAJH 5AYUL 1WTGT 5IMOB 1SM3H 5T1DL 1FSKB 3G08A 3TZVD 1ZA3A 1Y0LA 3UTSB 1AQKH 2VXSL 5D7JB 3QUYA 3QIBB 4LHUG 3OJDA 5T1LB 3NCJL 2BRRH 5EBGA 4LP4A 3SE9L 3WS6A 4LLDB 2C3HA 2CK0L 1BM3H 3L7EB 3UPRA 5FM8A 1D6EA 2CO7B 4YBLC 4KKBD 3X3GL 4G8GD 2CQVA 3DMMB 3EO0A 4PJ7A 4PGBA 4FXGB 3R8BB 1K2DB 3MRJB 4DKEH 3L1OL 4QTIL 5IVNA 2VDKL 2F54D 4MQTB 4XCFH 3QIWC 4I3SL 3SO5A 2XZQH 3QB7C 2A6IB 2FEDD 5A2IH 1W8NA 3T0WA 3VXNA 5L2KE 1TLKA 1QRNA 5IB2B 2D7NA 4GFTB 1F4YH 1AR2A 3IF1A 2VYRE 4GG8A 5D1XC 2YSSA 4I0KA 4N8VA 5C0AB 4NUGL 4XBPA 2R4SH 2W9LA 4QXGH 1OHQA 2ADIA 3O6KL 3QQNA 1TJHL 1ZTXL 3QEQA 4XTRC 3LIZL 5FAAA 3AM8A 2ERJB 4NHUB 4HH9A 1H3XA 4ZUVB 2EDEA 3QP3A 4FFVC 5EZLA 3V2AR 3BXNA 2I26N 4LVHC 4R26L 4DKDC 3VDCA 5GGRA 1AE6L 1LP9E 1JGEB 3OHXA 3ILPA 1QSVA 4XVUD 4X6BB 3K46A 1UH4A 3VFSA 1IAOA 4PV8A 3ZKMC 3F5WA 4BELD 4RMWA 2GCYB 2YPKB 4QXUL 4KVNL 1OP5K 1IBGH 4WO4A 3Q5OA 4IRJA 1P9MA 1NLBL 3RVWC 1F90L 3BI9X 4XPTL 1QVOB 5ADPL 4G5ZL 1KB5L 5DMYA 4CVXA 3OZ9H 2CXGA 4JZNB 3U83A 3TNNB 4PRPB 1VKXA 4PD4J 4PJ7E 4FXLA 1RZKL 5AYUH 4KHTL 4LEXL 4U3XA 5C0GA 4JFXB 5HGGS 4F9LA 1QR1A 4EQ3A 4GRMA 1T2QL 2CLVB 4LHUB 5FM4A 5T1DH 3GJEB 1ACYL 3S6CA 3U0WL 1OAKH 1MRCH 4IMLA 2X4SB 3P0YL 4RZCA 3RY5A 2VISB 3CIQA 1J8HD 3NCJH 3QUZC 1OOAA 4KC3B 3W5NA 5E6ZA 4NNXB 3ROLB 3QWOA 4PFEA 3DRTB 1ZVHA 2PO6B 2CK0H 2PXYC 3RUGF 2EDHA 4E5XB 2C4XA 4GBXB 4YBQC 4GSDL 5EUKA 3BKJH 3BQUB 8CGTA 1P4LB 1JMXA 3OAZK 2FGZA 3QNYB 4XMKL 2PYED 3MRFA 5I8EA 2IQ9H 1FNFA 5DD6B 5F93C 1MFBL 4CDGC 3K8KA 5ISZD 4QTIH 3DUSB 4JHZA 2NXZB 2EO1A 2P42B 5E2JA 4GLRI 2F74A 4M8QB 3QEQE 1Z3GL 1NAMA 5EZIL 4L8CB 1HHKA 4WI5A 1UEYA 1YJDH 4Z7QF 4OAWA 1F3DJ 5ESQA 2DL2A 1HZHL 4GW5B 4YGAB 5HGDB 3L9RB 4JFFA 4OLUL 4R90H 1CFSB 1JTOA 2LVEA 3ZTNL 4JG0H 5I73B 5JPNB 2BOCB 3QI9B 1FZOB 1FP5A 5F97E 3UBXA 1B0WA 4U1MB 5MERB 3KWWA 1TJHH 5FO9B 5ID1A 3IU4H 1ZTXH 5GGTL 3QUXC 1BFSA 1MH5A 2AGJL 4GUPA 2RFXA 3PQYE 1YY9D 1BX2A 5MENA 3EOAB 3RI5K 1F6AA 2VLRB 3R06B 4YC2B 5F9OH 3TCXA 3CU1A 2NW3A 3ZZ1A 3QHZH 3SGEH 4QXUH 4XP4H 3STBA 4JQVC 1X7QB 2J6EA 5GRJH 1JVKA 1U8JA 4M6OH 4Z7UF 3G9VA 1F90H 1EEZA 4RFNB 3TBTB 3QDJA 1YUHA 1IL1B 1FG2B 3RWCB 4G5ZH 3NIFE 8FABA 4Q74A 5SWSA 1YNLH 4F8QA 2GUOB 3I2CH 3T4YA 3QIUB 1HH9B 4RAUB 5HYJD 4LNRB 1T2QH 2X89A 1KB9K 1ZANH 4MA3B 1AD9B 3THMH 5E4IA 1PFCA 4XPHH 4ISVB 4AIZA 1T04A 1G6RH 1BBJB 4FNLH 5I1KL 4GS7B 2QHLA 3MGTA 1F8TH 2JJUA 1C5CH 5IM7B 4XNMB 5T5NG 5JMRA 4ALAL 4HBQA 4ODSL 5B4MC 3DVIA 2FECI 1M7DA 1G7LA 1XF2A 4LAQL 3KDMB 1RMFL 4C56A 1JPGB 4KKLC 4PJBA 2VLKB 2IAMA 5F71A 2X4RA 4MQSB 3LMJH 4M6NL 5EZIH 1T5XB 3V7MA 5JIIA 5E94A 2Y06L 1HZHH 1OP9A 1U8MB 1NBVH 5HGBA 4ZS7L 5DJDB 1CFNB 3FFDB 3WMSA 5MENE 2EDOA 4PJ9C 4OSUH 3JV5A 2P43B 3UO1H 2OTUA 3A6BL 2E6JA 3PXHA 1IM9A 1BFVH 1A21A 2WUBH 3MQIA 1EGJA 4Z7OF 5J6HA 4PGZA 4H88L 4YQXH 1LO5A 3O2WH 2A6DA 2DJUA 3U0TB 5K9QI 4BH7A 4Q97A 4CN1A 3U6RB 3RU8L 3CX5J 1MY7A 1JF6A 1XR8B 4QHUB 5JIPA 1R3KB 4KK6C 4S0TD 2R9HD 4XAWH 1V3JA 4UIMA 1YJDC 3IDMB 4YNYB 4BK5A 4BM7A 4HQQL 4LCUB 1HNGA 5SWSE 3VG9C 3SJVB 3ARED 1MJJB 4X6DB 1KIRA 4PJXB 4LU5L 1I1AC 4DEPC 1EMTH 4FA8A 1TDQA 3INUL 4PGJA 1LQSR 5ICZA 5TFSH 4U6YB 1KLGA 3QWRD 4DQOH 1TENA 3RVTC 3NIDF 4F15B 2YXMA 3L3OA 4UQ2B 4PLKD 1DQLH 1QQDB 4R3SB 5FDWB 3GJFK 1C12B 4NQED 4LLUA 4P46B 4P5KB 3BFOA 3E3QC 4F7TA 5HHME 3O3AA 2FGWH 4KV5E 4ONHA 1M7IA 4ODWB 2BSSB 2B1HL 2F8OA 4C56E 4PJBE 2BZDA 3QNZB 4J8RA 2B5IB 2Q8BL 4BFEA 4BQ9A 2NY2D 4PLOB 5GGSB 4O2EB 4OIIL 5CEZD 4ZFOA 5I1KH 2W1NA 4Z95L 5E8NB 2IAND 3KS0H 4DWHA 3RHWF 4R7NA 5B8CB 4HFUL 3C60A 4JAMA 4EXPX 4ODSH 5C07B 1N0XH 3MRRA 4MA1C 1JUFA 3T0ED 4MXQC 4LAQH 1P7HL 3AS0A 4FFYL 4FQXD 1TQCC 4JFPB 1RK0B 3ES6B 4JFQB 2VLLB 3V0AC 4XI5C 3CFKA 2YD9A 1G9MC 3FOMB 3O4OB 3D39B 3GIZH 2VUOA 4UTAL 4GG6B 5D7SL 1R5VB 4YDJB 1FYHB 5FGBC 3Q5YA 2H8PA 4R4ND 2QQNL 1CK0L 3ARGA 3RWHA 1PGRB 3UTTB 4Z7NE 3WUWG 4BK4A 1GZPA 4LP5A 3LSOA 1NC2D 3HFML 1R5WA 3A6BH 1ZT7A 2GSGB 4FQ1L 4MXQD 4UI2A 4GOSA 2HA1A 2EYSA 3MV8D 1OW0A 3C5SB 3QA3A 2G2RA 4D0BB 1MQ8A 4I18A 4PR5B 3OBAA 4H5SB 3WNPA 5C9JB 5CGMA 1KEGH 5HHNB 4UTBH 3TN0C 3L3GB 2A6KA 5GRUH 5ADOL 5JDSA 1BECA 5ACZA 3IAGC 1A9EA 5KSBF 4HQQH 1QG3A 1B0RA 3M17A 2AJUL 2AXJA 2EE9A 4OCNC 3M1BB 4KRMB 4UV4H 4A6YA 4ETQB 1EJ6A 4BZ2L 3FT2B 1L9NA 6FABH 3IDUA 3ZYIA 4JZJB 1A2YB 1MHHB 2ZUUA 1HDMA 5K33A 3QQ4A 5GRXG 3WD5H 4HUXA 3KPMA 3TPUA 3DIFA 1IILE 4XMPH 2FLBT 2ICES 5BW7A 5DK2B 2E7LA 3EJZD 3T0AA 3BWAA 1ACZA 2B1HH 4R96A 3RA7H 4XCEA 2V9QA 2F58L 1P7KA 1LO0L 5LAXA 3VI3F 1MHPL 4UU9A 1RZGA 4CN4A 2HH0L 5C08D 4HLJA 2Q8BH 1EEQA 3VI4F 3P4OA 2R0ZH 2IBZX 1T1ZB 3PWLA 3T3ME 2UUDH 1Q9KA 2KH2B 1UZ8A 1B6UA 4KKAC 1RZ8A 3VFRA 1S7VA 5KZCB 3VXQB 5I1LA 4WWKD 4Y4HA 4DW2L 5FYKL 1FL6A 4PTUA 4FFYH 2FB4H 4LHQB 4PJHA 4ODHL 1DEDA 4M7KH 4UNUA 1VA9A 3DARA 5EO9B 4P2QA 43C9B 4L4VB 5KS9F 5BMFH 3G5XB 3GMPA 3SPVA 5KG9A 3DROB 3EFFB 1OAXH 4X6EA 2NY1B 2ED8A 4KKAD 2D7QA 1A9BB 4LCIL 3FHAA 2ZUXA 4AM0B 3VXRA 3HB3D 1Q0XL 1RIUH 2X41A 1ZVSB 1SHMA 1A22B 1HKLH 1A4KB 4EDWH 4X4XA 3BRFA 4LPCA 5CAYB 2YD6A 1CF8L 3LKQB 3SEPA 3ZDZE 1A5FH 1P4IL 3GBNL 2DQHH 3T2QA 4TSCH 4YGVA 5ADOH 43CAA 5GISL 1K8DA 1U2HA 1TJIL 4HUKB 1CLCA 1I75A 3HE7D 2AJUH 3EYQC 4X7CC 3CCHB 1MQKH 1CD1A 2AK4B 3O0RH 3GNMH 1NUGA 1UCBH 3JV6A 1ZEAH 3O45B 4D9QE 1IEAB 1OGAB 3FCTB 4BZ2H 1FC1A 3AB0C 4NKQB 4QRUB 2ORBH 3MXVL 2JJTA 4KPHH 2FX8L 4QRPA 2R1WB 4XHJD 2DQCL 1CFQA 2XNAA 4MAYB 1ZMYA 4WI8A 5AWNH 4NP4H 5DGRA 4CVZA 3TFKD 4W6YB 3CLEL 3OKLA 3RWJB 4HH8A 1EO8H 1HSAB 5CUSH 4L8SC 4Z7VF 3IDNA 9CGTA 1A6UL 1S7XB 3WNOA 5JW4M 4XNYH 4L4TA 4RQQA 4CNIA 3VXSD 4LFHD 1H5BC 1A6TA 4P2QE 3IDGB 1R0AH 1UM5L 1WTLA 2A6JB 5B3JE 5T33L 1C08A 1MOEA 4MJ5A 4JRXA 4XWGL 4LRIC 2YA1A 4OF0A 2YD5A 4ZOAA 3A0OA 2I9LB 1CIUA 5DLML 5AZEH 2FLRT 3MCLH 3VXRE 1NEZA 1OTSD 1E6OL 4YPGA 3ULVF 4TTDD 3X17A 1JV5A 1LE9A 3GSQA 1TQBB 2VDNH 1T1WA 1KPRA 4EIGB 4ESKA 3D2UA 3GJFA 5D8JH 5D72H 3P9MB 4Y4KD 1I8MB 3G5YA 1XH3A 2OS7A 4JPWL 3DPBA 2E8YA 1N6QL 5IMOA 1AHWC 1AJ7H 2HTLD 3UTSA 1FBIL 5D7JA 5T1LA 4YH6A 3P73B 2MKLC 4ZTOH 2BC4B 5IJKC 4ZAKA 3ORJA 4LCYA 1YPZF 1Q0XH 1WVZA 2F8VA 1IKFL 1ZE3C 4LLDA 4WNQB 3L7EA 3B5HA 4J1UA 1CE6A 4ERSL 3QG7L 5SV3A 4FQPA 5EZJB 4ZDHB 4Y16C 4PB9L 1A6ZB 1H3WM 4LBEA 2DQEL 2XTJD 3DMMA 1P4IH 4R7DB 1KSRA 4HFWB 4R8WL 1DP0A 1T6WA 2WBJC 4X4ZA 2BNRB 3MXWH 5EZOL 4L4TE 1TTUA 2A6IA 3CXHJ 2CDFB 2ITCB 3MRKB 2EIDA 2VDPL 2ZWLT 1CXKA 1ORQB 5IB2A 4PJAB 4HXAL 4K55A 3MNVB 5JQHC 1NL0L 4OF5A 4S2SB 4EOWH 2VLJB 1EO7A 1RQ5A 5C0AA 1VESA 1AXTH 3GIVB 3N1FC 4A2MA 1PZ5B 3LAFA 5HPOA 5E9DB 5DRWA 1LEIB 3UYRL 1JPFB 5C92A 3QCTL 1MAML 2BY3A 1FVEB 2X5PA 1N4XH 2BXYA 4NHUA 2VDQH 1QYGH 4ZUVA 5FYLE 2B2XL 3SKOB 5DZOA 3R4DA 1MRFH 2WQ8A 1JGEA 2E5EA 3FB7B 5JW4N 4ONGL 5T33H 3BP7B 5K59F 4BUHA 4XWGH 3HI6L 4X6BA 2E6PA 2Y7QB 4CVUA 3DJ9A 2P44B 4F9PC 2YPKA 5FM5M 4OGXL 4BSVA 4KDTA 3KYMB 2V2TB 3HMXA 5F7UA 1QVOA 4TQEH 2LTQC 2VZ3A 4DKAA 1YEHL 4PRPA 3TNNA 1VFUA 5F9DC 4JFXA 4K9EC 2RHEA 1KPUB 2CLVA 4LHUA 5I1JL 2WWKO 1AD0B 3GJEA 3QAZB 1FBIH 3AFLA 2X4SA 1VSCA 4WUUD 3L3JB 2V2XB 1IM3B 2VISA 1TIUA 2E9BA 4NNXA 3ROLA 1WWWX 5CBAB 2PO6A 2QADC 2ICCA 2YPVL 4E5XA 3VCLB 4GBXA 4AH2B 2C7UB 5DJ8B 1BAFH 4N9OB 2JB6B 5E4EB 1EO5A 2DQEH 3UC0L 1P4LA 3N1PC 5C0AE 3U7YH 5DD6A 5C3LD 7FABH 1OWRM 1KIPA 4R8WH 1G7MB 2AI0L 3R8QA 3OKMB 1D5BB 3SDAD 4X4YB 5EZOH 4M8QA 5T3ZL 3D5OF 1UQSA 2Y4SA 1WJ3A 1U8IB 2VDPH 1T89A 3GKWH 4XP5L 1MCJA 5GZOC 2RGSA 5CS7A 1S7SB 3BYYA 5JHDD 2QADD 2N7AA 5K9QG 4JKLA 3HNSL 1BVLB 2EC9T 4JY6B 4PJ5D 4P23D 3OGCA 3DX6B 5JPNA 2BOCA 3QI9A 2CLRB 1FZOA 5TH2B 4CGTA 4PJIF 4U1MA 5MERA 3QCTH 5FO9A 4OD3H 3VGDA 4NN5B 4U0RB 1IT9H 1UZ6E 1L7IL 1SJHB 4M61B 5MEPA 4P4KB 3PDOA 4AYFA 1JYXA 4ONGH 3HKFA 3EOAA 4PRPE 2VLRA 3HNVH 4AEHH 4YX2H 2P47B 5DC4B 1J5OH 3QNXB 1I85C 1I3GL 3QDMB 4R2GC 4OB5L 5EIIB 5KSUB 4CU8A 3FQNA 1KCSL 1X7QA 2X6MA 4XVJL 5E2WL 1CD8A 3HS0B 2X09A 3WNMA 1I8IB 3TBTA 1IL1A 1FG2A 4H1LG 5GJTH 3REVA 4P9MH 4X6CF 1YEHH 5E6IC 5FYKU 3V6BR 3CK0L 4HAGA 2GUOA 4PPTA 3VXUB 3QIUA 1HH9A 3BGFB 4RAUA 4LNRA 1IJ9A 4TVPE 1A6VH 1F3JB 4MA3A 1AD9A 1NMBL 5C0BD 5KAQF 1H3TA 4PLNC 4DUXA 2QLVB 3HTLX 4ISVA 2AVGA 1BBJA 1REIA 5C0IA 3MV7A 3K4AA 4KTDL 5H8DA 5HYFA 2EXWD 5DC9B 2DBLL 5A16B 3HUJB 4YFLI 2O5XL 2WSKA 3KDMA 3HLAB 3C2AL 3VG0L 2VLKA 2AI0H 2EYTB 2DMKA 4KK9C 3BISA 3IFNH 5L0QC 5T3ZH 4ONFH 5HD8C 2AXFB 4DOHB 3KPLA 1T5XA 4XP5H 4HCRL 4LPYA 2F19H 1LGVA 5DC0A 2BNQD 1U8MA 5FA4B 3Q1SH 2C26A 1XIWB 4AMKH 4WFGD 5E7FA 2VLRE 5HSFA 2EEDA 5IV2B 5J13C 5F1OB 4PB0L 3QR2A 4G8EB 4NN7C 5DJ2B 3OXRB 3SDDB 3K2UH 2WIIB 5GGQL 4J3TA 4NQSB 1U8HB 4KK9D 5DVOA 4LPTA 2IBZY 3MROB 1UM4L 2DBJA 3U0TA 5I1EH 5I71B 3U6RA 3FMGH 4IHOB 4HK0B 1XR8A 4XPFH 1YEGL 4U3HA 5D7LA 1R3KA 4HKZB 4KGLA 3IDMA 4YNYA 4TN9A 1DDHB 3QDGB 3S8WA 4LCUA 3SDCB 3OR6B 3SJVA 2X4PB 3RIFK 4PJXA 1KLFA 1GCFA 5DMGD 4HS8H 1CXHA 1Q94B 4POUB 4HJJH 3IJHB 4H1LB 4P2RD 1CXLA 3LEVH 3RDTB 2VDOH 4J4PC 5C7XH 1QQDA 2R29H 1DSFL 2YXFA 4P5KA 4P46A 3TBVB 4M93C 4ODWA 4NQCA 4D0CB 4NO2A 1JYNA 1CT8A 2VLKE 3QNZA 4OLYL 5EFIB 2L7UA 3SOBL 3UJTH 5EOQH 5IMMA 4XX1G 3MCKB 3FT4B 4O2EA 4I9WE 5TQ2H 5E8NA 3ZYZA 5ELIA 5DJAA 2VSCA 1RVFL 4LPWA 3L6FA 1Z9MA 1YEKH 1M71B 4KTDH 4NIKB 4PIRF 3RNKB 3ZYJA 5KBNC 5JZ7C 4OT1L 3IDYC 1A3LH 5DFTA 5C07A 3WE6A 3E6FB 3O4LD 5J1TC 4JFPA 1RK0A 3ES6A 2NCMA 4JFQA 5DGQA 3H9SD 4BFBD 3VXOB 3FOMA 3D39A 1CR9L 2HJLB 4KQ3L 4W4OC 3RVXC 3UEZA 4YXHH 3RKDC 4C54A 4GG6A 1U91B 4OFPA 5CJXC 1KCKA 4AY0A 2ARJB 4YDJA 5SX5H 2DTML 5FUZL 1NGXB 2D7TH 2BSRB 1J86A 3WDHA 4I3GA 1WIUA 4ZO8A 5JZ7D 3FZUD 3BGAA 3S3SA 3P4NB 3C9NA 2JTDA 4X98B 3SJVE 4OKVB 3CNKA 1NFKA 2GSGA 4X6DE 4PB0H 1NCCL 4PJXE 4BFIB 1L0XA 5GGQH 4YEEA 3C5SA 4D0BA 4YHLH 4PR5A 1SEQL 1CXEA 4H5SA 2XIDA 2E27L 5C9JA 3IYLW 3RKDD 4U31A 3CXDL 3HC3H 5EPMB 4ENED 3L3GA 5EO0B 1IC4H 5C09B 3GO1H 5E95B 1IZKA 5CGYC 3MA7A 5KSAA 4PS4L 3HAEH 4N1HB 3REWA 1PKQB 4ETQA 3AXLB 2GJ6B 4MA7L 4LVHB 1IZJA 3AMLA 5IW1A 3T2NL 2AK1H 3FT2A 4JFZL 2UVFA 4JZJA 4Q9QH 3KLAB 1MHHA 5E08L 3RBSA 4PJCF 4MS8D 1RZJL 1YA5A 3SGDI 5IFAH 3BN9C 4S1RH 2V5SA 5C07E 4O9HH 2AABH 5DK2A 4QF1B 4WV1C 2H2SD 5AD0B 2X4OB 2JJWA 2FBJL 3W2DH 3OKKA 4EUPH 3IB4A 2YUXA 4OZIA 1ZAGA 4WHCA 1L6XA 3V4UL 2DQGH 2ZSVB 4FFZL 3SOBH 5C70A 4FN0A 3D39E 1T1ZA 3FRUB 4GG6E 4GXVH 2IGFH 3WHXB 5F3BB 4Z7WF 4KVCL 5TF0A 4ZUTB 3UTTE 4EBQL 2FATL 5E00B 4ZD3H 3RVVC 4MA8L 5F1SA 4HWZB 1QA9B 3S36X 4WCYL 4LIQE 3QUZB 5FYJD 3EJJX 4Z77A 5EO9A 43C9A 3N9GL 3MRDB 4L4VA 4HJGB 4YHNA 5DFWH 3GEWB 5GSVB 3I50L 5EIVA 1OL0A 3RZWA 3RX8A 3C6SB 2XQBL 3WUWA 3DROA 5CCKH 5FUZH 1EDQA 3EFFA 2A1WH 4QRRD 3O8XB 1SJXA 3LQMA 3AY4C 3C09C 3WXWL 4TTGA 3BRDA 1IAIL 3VWJD 1GSMA 4IBLT 1A9BA 2CR6A 4RISH 1HHJB 5I1CH 1UYWH 3EDFA 4KI5E 3OKOB 4RMSA 4H26A 3VD4A 1ZVSA 4JKKA 3MLUH 4OCWH 3VGAC 3O11B 4NQXB 4K3JL 2E27H 3LKQA 1ZT1B 4P9HH 4Q6IB 2Q87A 1IGJB 4CBPA 1UH3A 1OAZL 3FB6B 1M05B 1CGVA 2AQ3A 4MHHG 3CCHA 3MJGX 4PG2C 1A3QA 3ARBB 2AK4A 4OZIE 3O45A 4ODVH 3S97C 2YKLH 4OLVH 1IEAA 3L3IB 1OGAA 5HHVL 1LDSA 1RZIB 2CIIB 5DUML 4QRUA 3WHE0 2OL3A 3RX7A 2R1WA 3ELAT 4MAYA 5E08H 4K2UH 3VE0B 5C0DB 2YS4A 4WI7A 3RWJA 1RZJH 3SKMB 2MPAL 1HSAA 4FQCL 4XB8A 5L2KD 1UXWA 1IKNA 1S7XA 4M3JA 1FFQA 3ARUA 1N5YL 1ZSDA 4UT7L 1CDCA 2YBRB 4QY8A 4XP9L 4FFZH 4OI8A 1T0PB 1K3ZA 5HYSB 2Z35A 2ZOLB 1QFHA 3IDGA 4L4VE 4M3KB 2CKBL 1P69B 3QUYC 2A6JA 4KQ4H 1NBZB 3VRLF 3WS6C 3OG6B 1U6AL 2I9LA 3HHRB 4NNYB 4Q9BA 3ZE1E 3P77A 2VLME 1OT2A 1FG9C 1NANI 2WINA 5LCVL 4Y5YB 3VA6A 2J8OA 1P4BL 3UTPE 4KRPB 4L8BB 5K93A 4LGSB 3FKUS 5TF1H 1I8MA 1ONQB 2XKUA 1Q72L 1BGXH 4D0DB 3OJVC 4WFFE 2EDQA 1VPOL 4NJ9L 1C16B 1TTGA 2W92A 1JZ6A 2DM2A 5CJ5A 2BC4A 3U79A 3LN9A 2AK4E 4YO0B 4WNQA 1OGAE 3ULVH 1QSFB 5EZJA 4L9DA 4PJDE 4ZDHA 4JPKL 4K3JH 1EFXD 1A6ZA 3AM8C 5DXWA 4R7DA 4JG1H 3TPKA 3MLYH 2YUZA 4X8XA 3E0GA 4KXZH 5DR5H 1WBYB 3OXSB 4OFIA 1OAZH 2PUQT 3HI1A 3IETB 2H6PA 5CEZH 3ULUF 4OQTA 2B0SH 4LL9A 2BNRA 3U4EB 1MCFA 3F7VB 4XVTL 3RZCB 4P2YA 1RJYA 2FBOJ 1ULVA 2CDFA 3MRKA 5CJQL 1KFAL 3C6LB 4XNUL 1WUNT 1ORQA 4PJAA 5D5MF 3EYVB 1G7IB 3SE4C 3MNVA 2ZUWA 1MELA 1P9MC 3QEQD 2AERT 4MNGB 5SWQB 2VLJA 3PV7A 1CLOL 1FRGH 4NT6B 1GXEA 1WAAA 3GIVA 1XR9B 3H6JA 2BMKB 3I85A 4NWTL 3WDJA 4KZEH 3EKCA 5E9DA 5K9JH 1LEIA 4FQQB 1INDL 1JPFA 1I1AB 4DEPB 3RVUD 3VXPB 2NR6C 1FVEA 4UT7H 2QKIB 2I07B 5KJRH 3SKOA 4E0RB 5HI4C 5JOPD 5DMIL 2C3GA 3DRQB 5GS3A 1MI5B 1RZ7H 3FB7A 3TYFA 3MRHB 3BP7A 4WO4D 1A7QL 3D9AL 4IRJD 3ARDB 1JNNL 5IESH 1BVZA 2VXUH 4Z0XA 3PQYD 4U6VL 5HDBE 3P40A 1WLHA 1BZ7B 1ZA6B 1P4BH 5EWIL 2QQLL 1X5JA 2UZIL 3KYMA 3GBLA 3ESUF 5LWYL 1T66D 3TA3B 1Q72H 3CFBB 1KCUL 1KULA 4MA1B 5FV2A 3WCYA 1FORL 4U1NB 2XY1A 4BKLB 3T0XA 1KPUA 2AXHA 1AD0A 3QXUA 2BNRE 4X7DC 3EYFB 5KTEH 3L3JA 1R3IL 1IM3A 2V2XA 5CJOL 5CLTA 5FCUH 5T5NF 3TBSB 1NFDB 5CBAA 3VCLA 1CGWA 4PJAE 2F53B 1G6RB 4JPKH 4AH2A 5DJ8A 5JO5A 2JB6A 2D03L 5CJBA 2VLJE 2OZ4A 5LGJA 2R2HB 2EE3A 1WAAE 4U49A 1OF2A 4POZC 5E9DE 1G7MA 1RULH 3OKMA