3D6FB

Crystal structure of human caspase-1 with a naturally-occurring arg240->gln substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever).
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3d6fB00
3R7NB 1RWXB 2H4YB 1RHQB 4LSZB 2HBRB 3R6LB 1RHKB 2CJYB 2C1EB 3R6GB 3R5JB 2CNNB 2HBYB 1RWNB 5IC6B 1RWOB 4ZVUB 2XZTB 2C2KB 2C2ZB 1I3OB 1RHJB 2H51B 2QLBB 4ZVQB 2P2CB 4ZVSB 1QTNB 1RHMB 1IBCB 2XYGB 1RWWB 1SC4B 2DKOB 2QL5B 1PAUB 4JB8B 1RWKB 2H48B 1RWMB 5K20B 3P4UB 2QL7B 1SC3B 1RWVB 3RJMB 1QDUB 3EDQB 2HBZB 3SIPB 3R7SB 4ZVTB 1RHRB 2QL9B 4ZVOB 3GJTB 2CNKB 2XYPB 3KJNB 2H54B 1PYOB 3NS7B 3R7BB 5IC4B 2FQQB 2H5IB 2Y0BB 1ICEB 3D6FB 1F9EB 2XYHB 3D6MB 3KJQB 2CNLB 3GJSB 2CDRB 1BMQB 2CJXB 4ZVPB 1RHUB 2H5JB 3GJQB 4ZVRB 3P45B 3IBFB 1RWPB 2H4WB 2QLJB 2C2MB 3KJFB 1GFWB 3GJRB 3QNWB 2Y1LB 2CNOB 1SC1B 1I51B 2H65B 2HBQB 2QLFB 3IBCB 3D6HB 4DCOB 3EDRB 1NMEB 2XZDB 4DCJB 2C2OB 4DCPB 1RE1B
chains in the Genus database with same CATH superfamily
3NNHA 2Z2LA 2VQFJ 2XY5A 2AJ1A 3FKBA 3KHRA 3IG1A 1RT7A 5F8LA 3TZXA 4OI2A 4NYOA 3D2WA 3SZ2A 2DEJA 2OUGA 1U02A 2JVRA 2CJYB 2BABA 3D0IE 4HEA9 4M5KA 2L41A 4DR1F 2J6UA 3CC4S 3MR5A 2ALYB 1YRXA 2BE7D 2XI2A 1KOOA 1RWNB 4P2SA 1HNVB 4CO4A 3K5PA 2GCFA 4JV0A 1RWOB 2QJ3A 2OPQB 3BH6B 4ZVUB 1RABB 1P9YA 1JLQA 5FLXU 4FS2A 1QSLA 5M2RA 1NK4A 2JEGA 2LXUA 2QSWA 2HQCA 4E98A 4RPFA 4WFBQ 2XLIA 4ZVHA 2PA3A 3M8PA 3OUYB 1QD1A 4ETXA 4FKYA 1U7LA 2RKIB 3SSRA 1DTQB 5H1SV 3BQ2A 5F0WA 3LGHA 3P8BB 3K7RA 2ZNZA 2ZWOA 1YZ7A 1QE1A 4FNHA 2QA1A 4CO5A 5GAHU 1MWYA 4A8XA 4DU8A 3UNYA 1S9FA 3PX0A 4ELUA 5D8HB 4QZVB 2V67A 4NLYA 4ED2A 3Q8VA 1LWFA 3GWCA 3KLIB 4EBDA 2CQGA 2KB2A 3FFIB 5KFWA 4OZ3A 3SFUA 3PW0A 3R1LA 2VONA 3G8TA 4YS2A 3MEGB 4ZMMA 4LF4J 1FERA 1HFEL 2AGOA 3NCRA 3OLAA 3NS5A 2H9ZA 2WAQD 3CCVS 3NEKA 1H3DA 3IXQA 3SQGA 2J9DE 2YNFB 3I96A 3GYGA 1TFYA 3M1VB 3C46A 2RQKA 1RWMB 1WI8A 2Z58B 1URRA 4DG1A 5LXYA 4X4SA 2IVYA 3POTB 2YXLA 2ZITA 1RISA 2XO7A 4W4MA 3BYRA 4K4TA 5EGYA 2MQPA 4X4UA 1FFSB 2F4FA 2HQIA 2NZCA 3B8HA 3V6JA 2ZVSA 4GKJJ 3ADAC 2Q3PA 3EDQB 3Q22A 4DL7A 1GH8A 3ETOA 3GFHA 1GEHA 1SXLA 5KFCA 2HG4A 2IHR1 1RT5B 3OFEA 2LEPA 5FIIA 3OXLA 4BC7A 2HZVA 1H73A 4KGZB 3S6EA 3ELHA 3H25A 1G7CB 4M5NA 1XNRJ 1UEKA 2HK3A 1AW0A 5KFJA 2YQ3A 2EPIA 3W65A 1VC6A 2K3KA 1CJKB 4KH1B 1IQZA 1FI4A 1UPPA 2GVZA 2B8PA 4IDKA 3LO3A 1JIHA 4MYUA 4NYZA 2EFOA 1LEOA 3IWLA 5IC4B 2AQ4A 1HBOA 2FDNA 4FF4A 2BMBA 2HRTA 4OI6A 1X9WA 4ZJLA 1T11A 2IRXA 2XMMA 2ZBRA 4KRWA 4M1KA 2OPSA 1HD0A 4IKAA 4MIBA 3BSAA 2RS2A 1VQNS 2OD6A 4U95A 2J0QD 1BMQB 2HURA 4GVBA 4N7TA 2XS2A 2DNZA 2OPRA 1M1KT 1SJ4P 3M8WA 1Y11A 1FRJA 3S1TA 2QRRA 3NNCA 4ZVRB 5CZXA 2LKZA 3FZBA 4P7VA 3RB4A 3OSPA 1TKTA 2IM0A 2E1PA 2MHEA 4TY8A 4DBQA 4YQWA 2MSSA 2WTFA 3LWLA 2AYGA 2CJKA 2QLJB 2DPIA 4HL9A 1NK7A 2LECA 5CH7B 4KR0B 4ZP9A 2IAJB 2YX4A 1DFDA 1CVJA 2JHEA 3HM9A 1TL3A 3I5CA 4CLKA 1K47A 2DNYA 4KYZA 3ZTPA 5I3UA 1VQ4S 5GMEA 2O5DA 1U1NA 4JI1J 4C97A 4EK2A 1I51B 1S6OA 2RHSB 4G1QB 1G4CA 4NLSA 4RX6A 1RA6A 3DLJA 2V63A 4PG7A 4UTGA 2YPYA 1N5VA 3GFYA 2NS1B 3WZ0A 3ZZPA 1PG5B 1RCOB 4WFNQ 5DDRC 4IFVA 2W2MP 2KVIA 4MKYA 1HYSA 3LTOA 3EPIA 3HJFA 1WKJA 4ZS6A 3J81j 4K59A 4DV4J 2R7XA 4NZ6A 3DN9A 3R5AA 2H4YB 1YJUA 4CT9A 2VQFF 3K5MA 1VYAA 4JI6J 4R25A 1VBKA 1X4DA 4ZA1A 4OZ1A 3ZNUA 4N56A 1X4BA 2HLUA 1R89A 1CJTB 4FXDA 3TJAA 2UU9J 1BY9A 2NLWA 3EZ5A 1MWZA 2A2DA 4NLTA 3AD8C 4WU2A 5A6PA 7FD1A 4J9NA 3DLKB 4MAKA 1BUXA 4XPEA 1J27A 5JMNA 1KQSR 1TL3B 1R8BA 2EXUA 9RUBA 1HIYA 2ZM6J 3IWNC 4EGLA 3G71S 1U1RA 3K17A 1C4CA 1X5PA 2KFYA 1FNXH 3ILOA 2J6SA 5D3GA 1RSCA 2FJEB 3WQPA 4ECYA 1UZDA 4U9RA 4J9SA 3TVKA 4NCBA 1S1VB 2BOPA 4R0EA 2Q1LA 2R42A 4I64A 4F3OA 5JXSA 2PI4A 2QMWA 1VQSA 4EZ6A 3UN2A 2RVJA 4NEZA 1BQMA 2IC3A 3MMAB 4JBCA 2DB1A 2KM8B 1DURA 1SC4B 1SKUB 3QWUA 4CO3A 1MSWD 2F8MA 4RWWA 3IR6B 5E33A 4PG6A 3Q24A 3W2WA 4LF9J 2NXNA 3EE3A 2Y1IA 5CYQA 1Y5LB 1QY7A 3R97A 1FRMA 3IMQJ 3VGSA 4RNNA 3M8RA 4NA3A 2LYVA 2CQ0A 2Y0SD 4KHMA 4K7QA 4USVA 3KK1B 4JUZA 3TQ1A 2BR0A 2DNKA 3HVAA 3QJPA 2AWZA 4DV3F 4K4UA 4QPXA 2FVQA 3CSKA 3MMAA 1EB0A 1Y10A 4PXBA 1VC0A 3NOGA 1E6YB 2HVEA 3MPVA 4OJ1A 5C24B 2KXNB 3QAEA 1PO6A 1NKCA 4JV5J 1AFJA 1WTFA 4EI2A 1X7VA 3NG8A 2Z8QA 4LF4F 2VG5A 4KPCA 1SV5B 2UU9F 1IWGA 3KWMA 3SSSA 3PKYA 2YNHA 1RK8A 4I2PB 4ERDA 5H9FK 1KONA 3QFWA 4DLEA 4O3NA 3KK2B 1HPZB 4KV8B 5ETMA 3ZZZA 4KFBA 2C28A 2ZZNA 2JNJA 2ZEJA 2H54B 2OPSB 3GMGA 3HSZA 3V6DA 5GVQA 4ECWA 4D3HA 2OAUA 1Y7PA 4Q2LA 3L95X 4IUFA 3C2PA 1FKAF 1UETA 5A8KB 1HBOB 1N48A 2FJAB 2ZNYA 3MR2A 2DT9A 1F9EB 5DDPC 1VLOA 2P6TA 4QIGA 1KTVA 4CLYA 5AJ3J 2ZVIA 2VBYA 1U4BA 1XQIA 4WXWA 4MFBA 5BR8J 1JLFB 1T94A 1RT6A 4ZVPB 1K73T 4IRCA 2WONB 3K8VA 5ETVA 1MMLA 2CQ3A 1NPKA 4DX5A 1CC8A 1CQNA 4C0HA 3J80U 3FBEA 1GNKA 5KT7A 1TAUA 4YN3B 5E2QA 4WZQA 2FY8A 4TY8B 2B43A 3L7OA 5K8NA 2OHDA 3AA9A 4J9MA 2LDIA 1CC7A 2MZ1A 3A12A 5ETTA 5RUBA 1YRTA 1REGX 5F0UA 5BXIA 1X4HA 2YBVA 4L73A 3BPSP 3DRPB 2QC3A 2EK1A 5HBMB 5F8HA 5J1PA 2FVCA 2RQCA 5H9EJ 2FVSA 2YWHA 2HQ3A 4V1Ak 4B3SF 3HD2A 1RCXB 2WW8A 2GJIA 4MKVA 3M9NB 3I56S 4A8OA 2OLWA 1NDPA 4GVBB 5L9NA 3GILA 2P9CA 1X9SA 3R9LA 4RUBA 2F9JA 3H8YA 2QYGA 4CIOA 4HT5A 1RTDB 4BS2A 3H5YA 4DR5F 2QG9B 2JZ5A 1NHUA 1APSA 3IR7B 1KVJA 3ENVA 5EDWA 3MXHP 3P6YC 3DOMA 3E51A 1TL7A 1C0UB 5I3UB 2GZOA 3OW2R 2DR6A 4NCAA 1K0VA 1CG2A 1Z4UA 1BGXT 2I2YA 3KG4A 5F41A 2PGCA 4KPYA 4YDXA 1KVKA 2PE8A 2YKOA 4J90A 3CJKB 1I94F 2KZZA 1S6QB 4IR9A 1RAHB 2RD5C 3IP0A 1YJRA 2G2OA 2R4FA 5L9XA 4A4JA 3CDEA 2OPQA 1S1WB 1VMBA 1LWXA 1V3SA 3H90A 1NSQA 1XERA 4CH7A 1RHMB 1C0TA 1RBLA 4A8YA 1FVSA 2LP4A 4EBEA 2ASLA 1D1UA 3CCUS 1ZAVA 3NGKA 4FYVB 1NJWA 3PYEA 2ZOMA 3HHLA 3QT8A 4N77A 5A2QY 5ETPA 3T1AA 3CD0A 4NOHA 2YH1A 2W9CA 3DDIA 2VPXB 2ZKUA 1Z1ZA 4DPWA 4OI3A 3U1LA 2ZM6F 3EWGA 4DV5J 1R31A 5LM7E 2C3MA 3OBIA 3IGNA 3L9ZA 3V6DB 1UFKA 3HSGA 2QTWA 3FEYB 1YIJS 4LF7J 2EFGA 4YHHF 1ZM2A 3EVWA 2X3DA 3NKYA 2AZ1A 3A13A 3FFIA 3R5GA 4FPIA 4R8UA 4ECZA 1HHTP 4IO1A 5EWFA 1FE0A 5GAGU 1RT6B 1W2IA 1S1XA 3B54A 4DL2A 1QM9A 4GKKJ 5B0DA 3CIZA 2AEJA 1SKWA 2VG7A 3HSJA 3KLEB 3I0SA 1U48A 2MKCA 2K2PA 3ZZYA 4PZVA 2RMLA 3OTEA 1S49A 3O8WA 4C11A 3HK2A 4Q43A 2RUSA 1N34J 4AL5A 1H98A 3MMJA 3TP2A 4AFFA 4Z7CA 1JX4A 1LWCA 2UUWA 4K0KF 2RAQA 3QJJA 1V5VA 3PHEA 4RR5A 2MGZA 2JL9A 4NLPA 4Y2MA 3BSOA 1UA0A 3QIDA 1KTQA 2PO4A 1T7PA 3FCWA 1R8PA 3ETMA 1U6ZA 3EMTA 3IBWA 4NMXA 1LWCB 3C66A 2ZH9A 4X4NA 3CJ5A 3CJKA 5IWAJ 2GW8A 4PXDA 2VHGA 2FZKB 5AE3A 2AGQA 3HJVA 2F5GA 1Q5YA 2E1AA 4F0MA 1NU4A 2E29A 4NMLA 4JI0J 5KFDA 3BDEA 2LEBA 1CJKA 1S12A 4UOFA 2W24A 5KFQA 1SJFA 3FBCA 2BZ2A 1U2FA 4QJVA 2MLZA 2C22A 1F5CA 3G2XA 4LSNA 3Q2TC 6FD1A 3SCIE 4EYHB 1QVGR 2F4VJ 2XMKA 4QWBA 4PXEA 3MAQA 2Y3YA 1N5YB 1S1TA 2K1RA 3SDEA 2AEMA 3NXZA 2LU2A 1H2VZ 4Q44A 4Y2KA 3KNGA 5KG1A 3UVJB 4DPTA 3DOKA 1DHMA 3BKUA 1T9WA 3I87A 3ZXWA 4RNOA 4C0BA 1WKLA 1XMQJ 4YY3F 3MM9A 2UV8G 4OLOA 3QO9A 4UOGA 2HHHJ 4O3RA 3OR1A 4Y2AA 1IR2A 5BYSA 1S7HA 3MUTP 1WC0A 4U8VA 3FQLA 3BGLA 4ZLLA 1JKHA 5E3PA 4CI0B 3C14A 4NZ0A 1NMEB 4WK3A 3QGHA 1LQ9A 3H40A 4V19J 2C2OB 1HMVA 3DI6A 2HAIA 3FMBA 3NRBA 4NLQA 2IYGA 3LPYA 3LPEA 2NXCA 4CO2A 2NREA 1S79A 1UMJA 5ETOA 4ECUA 1QVFR 1AFIA 2FJXA 2IMOA 4UW2A 3WHIA 2RF2B 3KDNA 4F4KA 1OPZA 3T1HJ 1KD1T 3GSDA 2C1EB 3BREA 3R5JB 1PC4A 4QYRA 1TL4A 3G8QA 2BE2A 1KN6A 2CNNB 4ZVFA 5B7WA 4LF8J 3CD7A 3PY8A 2E7VA 2J7WA 4A8SA 2DR8A 2B5JA 2DHHA 3UD3P 2V6AA 1LFPA 3V81A 5AXLA 3KUHA 2M5YA 4G1PA 4FVMA 4I68A 2KJVA 4ZP7A 2HYIB 1U2CA 3K2YA 1T8EA 3HT3A 1RT4A 1KS2A 4FF3A 2OFGX 3DHXA 3O5TB 5ETLA 4QU6A 3EGZA 1Q95G 4TU9A 5I3QA 3IFEA 4ED4A 5JUMA 2RDDA 2FIUA 4A46A 3G6XA 2D9PA 2NCKL 3CCZA 3QYYA 4FXVA 4IH6A 5T41A 3JSMB 5DLFA 5J2QB 4AUKA 1YJ9S 5DETA 2XC9A 2HHUA 3PCOB 2GIQA 2JH3A 2MZJA 3D3BJ 4I56A 1RWWB 4YUDA 2VFTA 2YKMA 4YR3A 1DAXA 3IG1B 5KFVA 3EX7B 2YWGA 4K50A 2PFFB 3OPKA 2FB0A 4Z37A 3PW7A 5CAAA 4FF1A 5ETQA 3GG1A 1RYSA 4NRUA 3J81Y 1S1XB 3CJQA 3PRBA 3M6VA 1PJ7A 4KQZA 4DV0J 2V8HA 1HNXF 3HULA 1MNEA 3PRDA 4MJKA 1Q78A 3ULHA 5BYRA 5HQ8A 1SJ3P 1VRQC 4PQUA 2LQ9A 3OR1B 3ZZTA 1IQTA 1JLFA 3UFCX 2LVWA 3TRGA 5ETKA 1S6PB 4DUZJ 3M6UA 2XCAA 4DV2F 4DQQA 2BBEA 3F0NA 4NX9A 1GXUA 3ET6A 4HACB 2OELA 4RW7A 1S0MA 5IV3A 1X60A 3MCOA 1D9DA 5GAHI 3H5UA 1O6XA 5JJBA 5BR8F 2HIQA 3AOAA 4LF1A 4JI3J 3UD4P 3M2UB 1KKHA 1HBNA 1HBUB 2OEJA 3RAXA 4RBUA 3R7SB 1NJZA 1QSYA 3NGSA 3TZYA 2R2TA 4IFYB 2EW9A 3RR7A 2GHPA 3RRKA 2ZH4A 1T3OA 3TUJC 2L08A 5KFZA 1EP4A 2IJRA 3EZUA 3LW5C 1P27B 4LR7A 2CPXA 3MD3A 3Q8UA 3FCVA 4USHA 2HNDB 2B9YA 4CYUA 3D6MB 3BKTA 1IKWB 1T9TA 4USKA 4F25A 3T3FA 3TNVA 3U27A 4IG0B 1U45A 1H7WA 1VRTB 1FA0A 3PW2A 4MIAA 3C15A 4NCGB 1RHUB 1N52B 1IBLJ 4Q8FA 3GJQB 1B99A 3DDKA 1N88A 2RS8A 4ZPBA 2EEYA 3ZZRA 4ZN3A 2D3UA 3FEZA 3KKFA 7FDRA 3PIPQ 3VAHA 1U47A 3MD1A 2OTJS 2LLZA 3DFEA 4GKJF 1GTEA 2JJ4D 1F1BB 4KHRA 3D0GE 5A8WB 2VKZG 4X62J 1U1LA 2HZAA 4C8ZA 5E41A 5L1JA 3SEOA 1WC5A 3GJRB 3I0RA 3KG0A 2I1RA 2E9TA 1UW9A 2FLOA 2C2NA 2IJFA 1MU2A 3BGRB 4CLFA 1X9MA 1Q82T 2WSCC 3GONA 1EKSA 1FRHA 1YRUA 4GVLA 2JEJA 1QE1B 4JI2J 1NEEA 2NXJA 3M32A 1V3ZA 2V2ZA 1IKXA 3W7BA 2ZE2A 1K1QA 4P74A 4DCJB 4HI1A 5KG3A 1F9FA 2AJ0A 4DR5J 1SJRA 4O3OA 2B3TB 2CUYA 3BEGB 3KFWX 4NI2B 4B9NA 2DNLA 3GZ7A 3NY0A 2C3UA 3BGUA 4YMEA 1GMWD 3HXMA 1R8CA 5K8PA 1RWUA 3CCRS 4IG3B 3OVSA 1ZZNA 1VQLS 4PRFA 1SH2A 2CPEA 3HT0A 3H4BA 4NLOA 4OFZA 4RW9A 3HHKA 4X65J 1TK0A 5A8WA 1IWAA 1YLXA 5IC6B 3QJLA 2B7BB 2OTLS 2XNRA 1R8AA 1SH3A 1R0CB 2VA3A 3NBPA 2C2KB 4QWDA 4CCHA 4DR6J 1HQEA 1U24A 1S6QA 2DTJA 2V4JA 1RI7A 2BM0A 2C2ZB 3EICA 5IM0A 2EFNA 2YTCA 2ZHOA 5GAGI 4ELTA 3AA8A 2Y1RI 2JFDA 1FRKA 2NYHA 2V8GA 4I2QB 5MLCV 4QW9A 4NLGA 1FD2A 3I82A 4WBFA 3O1LA 3V5RA 1NH7A 1M5VC 4TYBA 4O4GA 2V8PA 2KYZA 1WF2A 3NL0A 1L3VA 2N7YA 4H54A 5T14A 1VLYA 3DOLB 4LBHA 5HP1B 1E6YA 2IJNA 1EAYC 2A0FB 3SMZA 4F04B 2QL5B 1ACMB 4U67Q 5LSRA 4LUBA 3Q8QB 1VRUA 2A18A 4RW4B 2KHDA 1OSDA 1RADB 3GCXP 4DSJA 5J2MB 4OYWA 1MLAA 3NLCA 1TTHB 4DFPA 2H1YA 3EJMA 3W9JA 2B56A 4ELVA 4Q0BA 3KK3A 1SI9A 4KT0C 5K20B 4KH0B 4ZIWA 1TFWA 1WG1A 2B9EA 5KFAA 1HQUB 2Q66A 3R2DJ 3G82A 3SI8A 1YTYA 2DGVA 4W90B 1OIAA 1NHKL 2DRAA 3S8SA 1F3FA 2M7SA 2X7IA 5D15A 4DMZA 2E9RX 3E2EA 2NYIA 2XHWA 1VC5A 1EJ7L 3Q83A 1U8WA 4PG4A 4EFAC 3KLGA 3CC7S 4V19X 2BX6A 2O66A 3UNGC 3TWZA 1D3WA 2XMJA 2ZKTA 1WHWA 2HS4A 3KJVB 1R0AA 4CZCA 2HHVA 1V9OA 4RL1A 4JI8F 2VQEJ 3KJNB 3LH2S 1RDRA 2W2QP 3LALA 5E3QA 1K0TA 1OYDA 2DGOA 4IOBA 1WACA 5AE1A 2XGQA 2FQQB 3CCQS 4LF9F 1N5TA 1IM6A 1CS4A 1RTJB 2WVCA 2HMIB 1XNRF 2E9ZA 4M5JA 2EFVA 2YNGB 3MM7B 3PYFA 3GJSB 4X84A 3UQSA 2Y8YA 2BANB 4HHHA 1AUSL 2ADBA 1H38A 2V8VA 4IG3A 2R8IA 3MCSA 1XR7A 4JI3F 1MWQA 1RTIA 3RG6A 3P3DA 3D28A 4F4XA 5DJBA 3TAPA 4CM2A 3V81B 3EGNA 3F41A 2IBKA 2MJNA 4NLXA 5EWEA 4K4WA 5J2NA 3KJFB 1JQGA 4DPUA 2J6TA 1REVB 3DNCA 3MMBA 2CPFA 2D7SA 4GO7X 3AODA 3PJXA 4LMZA 3QIPB 2WOMA 1XR6A 3L7UA 3QNWB 2KTQA 1O8BA 2QT7A 3AOCA 3TQEA 2DBBA 2RRAA 1U0SA 5M2UA 4X65F 4O44A 1RGVA 2KDOA 2ZBIA 3ZO7A 3AQOA 4ES1A 1FRIA 3O6QA 1PCAA 3JAMU 1NKBA 1CPZA 4DS4A 1HMVB 4WKYA 3SCLE 2OIHA 3OR2B 4UOHA 3M8YA 2DO4A 5LMNF 4Q0BB 3B82A 2WRMA 4OZ0A 3DYAA 4HTIA 1Y5NB 2MQLA 5HK4A 1FJGJ 4ZPTR 2PEHA 3SSQA 3KMSA 1GT8A 4P2MA 4ZLPA 5HBMA 3N28A 4QWAA 1YBTA 1F2HA 5IT4A 4PUOB 2VJVA 3KUEA 1GXTA 4JI1F 2RNEA 1WORA 2WBRA 5L39A 1KHWA 3EZOA 2HHPA 5D0GA 4DX6A 3V4IB 2GVZB 4D3GA 5KFOA 3TR5A 1KDNA 3BN4A 4O4GB 3TI0A 2OH2A 1MW7A 1GK8A 3FBBA 5E3CA 1N0UA 4H4OB 4HH1A 1Y4ZB 4M5DB 5D0EA 3HD1A 2FHJD 1AT1B 2MKIA 4I2QA 2DCUB 4O23A 3OXFA 4U96A 1RKJA 1YVFA 1HBUA 1CJVB 2P2CB 4KY3A 5C42B 2AT1B 2AU0A 4BLGA 5A2QU 3P5TL 5DGAA 2BQRA 3PHTA 4OV6A 3TYTA 5DDOC 2Z56B 4TU7A 3BJYA 1QSSA 4U7UK 1FTRA 3GYNA 1YGYA 1H7XA 3FCHA 3ENAA 3OL8A 3F73A 2BKNA 4KTQA 1DARA 2LA4A 3D6TB 2V2VA 3GIMA 1XTZA 1RZMA 3PZPA 1V3RA 5B0AA 2XY6A 3HHDA 3ILJA 1U1QA 5DG7A 1NXIA 2HW3A 2EWHA 4FYXB 3MEEA 1V6HA 4QIVA 1FWLA 3S7RA 2JEFA 4G1QA 3S01A 5A76A 3ZTRA 3PX6A 2BQ3A 1BE4A 2XMAA 2HHWA 2KHCA 2A10A 2MB0B 2QLXA 2ZDOA 1RBOB 4TXSA 5E7OB 4F3QA 4QIEA 1U0HB 5KG7A 1G2EA 5D0HA 3SFGA 1Q1KA 3JQJA 5A0YB 3NAHA 4WU3A 5B0EA 2BM1A 3LOUA 3US5A 5CD4H 3R1HA 4FNIA 1MROB 1T0TV 4HHJA 5HROB 1HR0J 1YWXA 3CGIA 2ZJPQ 1T95A 4K2JA 4ETZA 4MKBA 1U1KA 4TN2A 3KHHA 2GFFA 1RHRB 5C5JA 3A4TA 2XM3A 5M2PA 4DV6F 1BC6A 3W9IA 4AXIA 3RAQA 2MZRA 2HHQA 4P71A 3SCJE 3TZWA 2B51A 5CYMA 2VICA 4KSEB 1VQMS 1IBKF 1NAQA 1U8SA 2XMTA 3T6JA 5A8KA 5GMKa 2CVEA 1U1OA 2DNGA 1B70B 2BE9B 3G96A 1WC6A 4ES3A 2DRBA 1NUEA 1QUPA 3N6NA 2D41A 1Q0NA 1B7YB 3D6FB 4DV1F 1U25A 4IDKB 1N5SA 1SH0A 1WI6A 1CJVA 2GS8A 4P2FA 5C42A 2CDRB 3K5NA 3WC2A 2RHQB 4L6V3 3QZ7A 2XB2D 3F44A 3CCTA 4FDFA 2M0GB 3AFGA 2JFKA 5A8RB 2R9LA 4DQPA 4B17A 5F8JA 2IMWP 1KP6A 1SIWB 1Q8BA 3DI6B 4NPOA 3IAM9 3M2VA 2EI5A 4X64F 2C2MB 4CLTA 4PWDB 3PYDA 2UUCJ 1Q86T 5E3AA 3PR5B 3I32A 3IRXA 4C8YA 1FK9A 3PW5A 4ZPDA 2FHKA 2HFVA 2HNYB 4ZP6A 1UCNA 5MAOA 5CXTA 1FJEB 4ECQA 2RRNA 1J5OB 2ACYA 4OHXA 3M1VA 3T1YF 2BDPA 2QLFB 4OJHA 4QYZK 3C16B 2HS0A 2D1CA 1S99A 1P1TA 4N47A 3TAQA 3GIIA 4I6WA 1RE1B 4RNHA 4RWXA 3MECB 1EETA 1EKRA 5L46A 2GMLA 1CJUB 1XC9A 2K7KA 1E6VB 1HHSA 1FKOA 3IM9A 5B09A 4I0WA 2B9WA 2HVZA 3DLHA 1I1GA 3B6BA 3BDPA 4ILLA 2DY9A 2N4CA 1T9VA 1VDHA 3BN7A 3VALA 5HMYA 4C0OC 1S0VA 2VBXA 3NP5A 5JVGQ 2CQDA 3CJ4A 2JWNA 4DL0C 3FQKA 4FN5A 3L09A 4F7VA 1KQFB 3FBFA 3JSMA 3TJ9A 3H20A 2GAHC 4CLSA 4OMFG 4A8MP 4C48A 2R2SA 4RBVA 1ZAXA 1NKEA 5LXRA 2R7TA 3M8SA 3ITHB 3O3LA 2FLNA 1XR5A 4MK9A 2ZZTA 3H5SA 1HQEB 1B0PA 1D09B 4PYAA 5KTQA 1PGZA 4HKQA 1Y9OA 4AL6A 2D3O1 4LFBF 4LRBA 3UDVA 2J9CA 2D9OA 3WX4A 2ROEA 1RT7B 4LJMA 1SUQB 2IPOB 2DNNA 2MQ8A 2LXIA 4J9RA 4DSFA 1N56A 3KK2A 4NRTA 2GQ2A 4WF9Q 2QN6B 5AJ3F 2MDAA 4BCAA 5CA5A 3KTQA 3Q8SB 3HPOA 2X1BA 1RT1A 2CRLA 4ZOSA 2P5VA 4LR8A 3VVTA 3HP6A 3HHNB 1TUVA 5HI7A 4QCLA 1P1LA 1NK9A 4CO0A 3DRSA 1W25A 2UV8A 2XLKA 2HGNA 1NK6A 3TA0A 2QL7B 4DUTA 3W5XA 4C9DA 2EC2A 3W8GA 5FD1A 3BO2A 1GMUA 2CWKA 2MJUA 1NSAA 1IKYA 1I5OB 1EQ0A 2E1MC 5E0OA 2J0XA 1OJ4A 4PCQA 1QAXA 4OZ5A 4LRDA 2YPZA 2J8SA 2W1BA 2K7JA 1IXKA 1WD6A 4MH8A 2WB4A 3M2RA 3TJ8A 4ZVOB 1QAIA 1F2GA 1OY8A 2CNKB 2WB1D 1PBUA 2MPUA 3A1YG 3I9ZA 1NH8A 3MCMA 4QWEA 4X2BA 3AQPA 3QATA 3UPFA 1R27B 1G6BA 3DRXA 3W66A 4CNZA 1J5EJ 2C3PA 1X5SA 3RW6A 2GJ2A 3N79A 1RYRA 5FDLB 2HNDA 2LCWA 3EVMA 3GIKA 3UDEA 3AXMA 3BBCA 1KC8T 2CJXB 3MOZA 4ZLJA 2ZUAA 2MQOA 1VQ8S 1FNOA 5GADI 2PEBA 1Q5VA 2DR7A 1HI8A 3M8PB 4J9OA 1VGYA 5BJRA 2FJVA 2HAFA 4DS5A 1RT5A 3FSXA 2M8HA 3AHPA 4QIWD 5KFLA 3R8YA 2DPJA 2V9KA 1JLQB 3BSCA 3CJ8A 3IAS9 4F4ZA 1RTIB 2MTLA 1BQNA 1F0XA 2PIIA 3QZ8A 5E3RA 3H5XA 2HVHA 3J7Z5 4P72A 2VQEF 4I7FA 5L1KA 3V6HA 1JJHA 3GFXA 5IZHA 2NQPA 1UEVA 5KG0A 3DC2A 4DPXA 3ZZOA 5KT2A 2V50A 3PVXA 1XIQA 1LW2B 1MN7A 3I5AA 4B3OA 1CLFA 3IWXA 5F8IA 1KLMA 4NLDA 1NO8A 5SUHA 3VF0B 2Q79A 3MFIA 1I6JA 2DITA 3T9NA 4OX6A 4C6AA 3OL6A 2R7UA 1UWBA 1FEEA 5C7PA 2FVRA 4Q2MA 1HYSB 1H72C 3BV8A 2D3ZA 4OL8A 1L3KA 1YX2A 1C1BA 2A3JA 4LRFA 2OMLA 4O3QA 2CPYA 3HFVA 2IBOA 3KLHA 5I4MA 2AYMA 2ASYA 1VR6A 3HCXA 4J9UE 2G9OA 4OZJA 5HMXA 5L38A 5GAEU 2UUCF 2HLTA 1RHKB 1JNZB 2KH9A 2MZTA 2VFVA 4P6QA 1P6TA 1HBMA 3J7A1 3R6GB 4OYXA 5KFUA 4RUCA 2K3IA 2MKSA 3VV2B 2R2UA 2KFZA 3CC2S 1UVLA 4E8UA 2DGSA 1YHQS 2XY7A 2EKNA 1YJ7A 1C1CB 1N4LA 1EX8A 3H59A 3HHLD 2VJUA 1JMTA 1TKXA 1TV6A 3FGVA 1XJWB 1S77D 1HPZA 1RHJB 2IVMA 2KRRA 1X5TA 2DIUA 3NWGA 2B8QA 1HWUA 2VOPA 4B3RJ 1WC3A 1VJQA 4CLLA 3PRVA 1IKVB 5IWAF 2UUTA 2ZFHA 3MEKA 2DGUA 2M3DA 4QIFA 1DLOB 1JWWA 4DV4F 1PSDA 4ZCKA 1CSJA 1HHQA 1C0UA 5HJYA 4DSEA 3B4MA 5KT4A 2XEXA 4A8WA 2NPIA 5C24A 1EP4B 1EIYB 3GV7B 1PAUB 4OHZA 4KAIA 2GIRA 4A48A 1R0AB 4OI4A 3BYPA 4RO0A 2MHNA 3E3XA 2FJDB 3HHEA 2V68A 2VPWB 1KLNA 2OFHX 2DHXA 2J7KA 3DLGA 2V69A 2ZH7A 3SCKE 1DZ5A 4N76A 2CJ9A 2D69A 2JSXA 2G2ZA 4WWSA 3MECA 1BWEA 5I42B 1VI7A 1Y5IB 4JV1A 3N5BA 4GKKF 4JI2F 4USJC 2R8GA 3FMWA 1JXEA 3W8PA 1H2TZ 2BYCA 2JVOA 2MKHA 4HVZA 3PV8A 3GTYX 4L75A 4C7QA 4LRCA 1XN9A 2LEAA 1UVNA 1EARA 1AZSB 1M0SA 4AQYF 4DR3F 3IRXB 1SVDA 2GHVC 3OD2A 1F60B 4L3KA 2V94A 1WTBA 4HDGA 1U1PA 2RUGA 2DHAA 3IR5B 2XMUA 4G6VB 4USWA 1LW0A 4PWDA 1OQ3A 3M2VB 3KG1A 4PPDA 3THPA 5LSOA 1PIEA 4N8OA 4RUHA 2N7CA 3THVA 1FDDA 2XHCA 3QGIA 1LWFB 4CQ1A 4PABA 2V4QA 4B3MF 3KOAA 1VIOA 2ZC3A 3H7HB 3R7BB 2H3EB 3E8OA 4JOUA 4OHVA 2VIHA 1T02A 4MFBB 2UP1A 3QGPA 3DM2A 2CQ2A 4C3KA 3OXGA 4ZKAA 4J9VA 1ICEB 3ILIA 1JXVA 2DGXA 3QIPA 5AT1B 2IDEA 3U7JA 4PPZA 4Y00A 3IO1A 3SBMA 4DFJA 1TK8A 2FJWA 4OX9J 3BO4A 4DLGA 3OFHA 1RTHB 2Z2YB 3Q23A 4N8NA 4YOEA 3A8IA 4X4QA 1NB7A 3CDUA 2MYFA 5IQ6A 2PSZA 1URNA 4LREA 2F40A 1LWEB 4C4WA 3HVTB 1A6LA 5DO2A 2ZH2A 1LW2A 1Q8KA 2PA8D 2WSEC 4P73A 2MGZB 1RAGB 4TNOA 3MUVP 4JP8A 3TAMA 2YNGA 3PO4A 4NXMJ 2LA6A 4M5HA 2HSEB 5KT5A 3TOQA 4AE5A 4FBUA 1SC1B 3SYZA 2EKYA 2G13A 3DKDA 5A0YA 4C8KA 1AUDA 1HNIB 1UZHA 1RT3A 2O01C 4DV1J 4XK8C 2B9XA 2RSQA 3ONQA 3A3PB 1LKZA 1SKSA 3JYTA 2POKA 1WDTA 4WYWA 4DZ6A 1CJUA 4DFKA 2W9AA 2FHJA 2GO8A 4BDPA 1RHQB 1VISA 4RUAA 2CJAA 4EO6A 4A8QA 4M5GA 4ZPWR 3LP1A 3HFZB 1VQ6S 2LQ8A 3MM9B 4LF6F 2W4CA 3FRZA 4CLZA 2DXFA 1VOMA 1WSRA 4DJBA 1N34F 3TX8A 2Z30B 3QT6A 2CQIA 2MZQA 2RIJA 4ITSA 1WF0A 1VCTA 4OQJA 3W62A 1PJ5A 3C15B 2YWEA 2E5LJ 1U26A 3ENWA 3DLEA 2VBZA 4Y2CA 5IT0A 3AY0A 3OV7A 1L3TA 4ILRA 3RR8A 4LSNB 3RBXA 2CZVC 1JB0C 1S97A 4NXNF 3QRQA 3MM5A 2CZ4A 3MDFA 4ED5A 5CCLA 2WVEA 2UXBF 3JSYA 3FDSA 4MK7A 1O0PA 2GHWA 2OSRA 2HS3A 2YKMB 3GV8B 2GGPA 4USMA 1R0BG 5T7LB 4CH0S 4RW8B 1VK3A 4ZCLA 5THWA 2MZSA 1TK5A 2D3OR 1KFSA 3BBBA 5HAOA 2GO9A 3DRYA 3N0VA 5B08A 2V2QA 4M94A 3X1LB 3DLEB 1WC4A 2LMIA 3TW0A 3TX0A 2DGQA 1FD8A 3E01B 4ZN1A 1HBNB 4WP3A 2X1FA 3Q0AA 3THTA 3PYGA 2YNIA 1EZZB 4ANDA 3R5BA 1XWLA 2IDLA 5HATA 2DRDA 1NJIT 2C42A 1BQXA 3RTVA 4B3MJ 8AT1B 1XEZA 1K44A 1U1MA 3ET6B 4HACA 4RW7B 2MLXA 4AXJA 1TMMA 1I94J 1N32F 3KLIA 3KLEA 4WP8A 1Q7YT 4W98A 1VQPS 4E2FB 1SCJB 3I31A 4O0IA 2QIFA 1NK5A 1UL3A 4PWWA 1OWXA 1NLKL 2WOMB 2XI3A 1AB8A 3MMCA 2E1RA 3DRRA 4OX9F 3D66A 4IYQA 1P8GA 2AF6A 4WIQA 2WCXA 4RNMA 3OLBA 3LUYA 1DTTA 1MG7A 2RT3A 3PFEA 3ZFVA 4L72B 2OEKA 1IR0A 1VHIA 3UCGA 4DL6A 1ULRA 1VIXA 3IN5A 2XYPB 3MMCB 2LDYA 1NZAA 2XMWA 3A8EA 4H4KA 4HR2A 4BHQA 1VQOS 2AYBA 3OTOJ 2BRKA 3D67A 1AYEA 3D1OA 4KKOB 2FLLA 2QE5A 3W2VB 2QEXS 2AJQA 3TARA 4B9UA 4B9SA 2N3OA 4IO9Q 3H2VE 5FJ4A 2HWIA 3ISZA 1PC5A 4ZPVR 5KFKA 4DR3J 2XLJA 2NPFA 2IM3A 3LP2A 2ZDPA 2EG2A 3P96A 1S7IA 4CP5A 4CDIA 4ID5B 3C16A 2DNQA 3AD7C 1NDKA 2ASJA 2L9DA 1N6QB 2UXCJ 4KJIA 3VVUA 1FESA 4IG0A 4OI1A 3CCMS 1MMNA 1R6VA 2EG1A 1M5PC 2FY1A 5AE2A 5HJXA 2BJ3A 1JLGB 1VQKS 5IT9U 3OQ2A 4PEOA 4F0KA 4DL5A 2G1HA 3DGPA 4I67A 3HX9A 5D77A 5C25B 3KNAA 1X8DA 3QSIA 2ZC4A 3T6BA 2IAJA 2APOA 1EHWA 1NPRA 1WC1A 4OJ3A 4AQYJ 3IBCB 3BR9A 1KSPA 4CRJA 1JLAA 3JXOA 1R43A 2NUHA 1VQYA 1TKTB 2BKPA 4A47A 1IUJA 1F9HA 2CAJA 3LP0B 4CNYA 4DI6A 3T5JA 3DXBA 3MAAB 1RWXB 2HIYA 3MAHA 1S1UB 5J2PA 4M5IA 2OPRB 4NE9C 2W25A 4LFCF 3V2UC 2A6OA 2P9EA 1T05B 3MTKA 4BC9A 2DCLA 3A3NB 3HFKA 3KYLA 1J5OA 1WHYA 2YKQA 1UVKA 2R3VA 3EGWB 5CQGA 3G4SS 4M95A 4HHUA 1XNQJ 4DX8H 3NMRA 3W1YC 3CIMA 3KDOA 1X4EA 2DNMA 2KO1A 1OO0B 4K8RA 5E5NA 3ZZ0A 3TUZC 3CJTA 1IVZA 3AB2B 1K9MT 2VOOA 2DH7A 1C2PA 2W2PP 3KLHB 1PAEX 2DD8S 1FO1A 2H51B 4P10A 3A8KA 4M5DA 1N33F 1YG0A 2H5EA 2WBMA 4K4XA 4ER8A 4KC5A 4ZVSB 4QR2A 3VAMA 1X4CA 2V4JB 2VF3A 4I6AA 2W4PA 3SQOP 5IM0B 2W8KA 1W2BR 3OSNA 2GNKA 1OS5A 3GCWP 4B3RF 4J7CA 2YWWA 5G4DA 1HD1A 2ROPA 2V2KA 3C8YA 1Q4RA 3FVYA 3PXGa 3J7ZT 4ED1A 2HWHA 2AGPA 1SB6A 3CMAS 3G6YA 1CJTA 4I7FB 1WEZA 2HGLA 4KV8A 4DG1B 2KZMA 4QBUA 2EBEA 2FVPA 4F8RA 1HWIA 2E5HA 5HVHA 1SIZA 2YNHB 2W7OA 1K1SA 2ERRA 1M1GA 4OHYA 4F4WA 3HO1A 2IFXA 1M5HA 3VAFA 3BGOP 4IFVB 3UCZP 5LMUF 4F26A 3MR7A 1FHTA 1LV5A 1Q16B 1UJ6A 1U2RA 3GB0A 3DRRB 4M5MA 2JOQA 2ZD1A 4F2SA 8ATCB 2PD1A 1GX5A 1KQKA 2DHSA 1GX6A 1E6VA 1M90T 4TLRA 5IQQA 1PYSB 1VK8A 4B02A 3CB4A 3JB9k 3ZNJ1 2NZ4A 2ATCB 1TKZA 5D4PA 5G0RB 4DV7F 1JJ2R 1FXDA 1OY9A 1LXJA 2BJ7A 3GSIA 2QL9B 3R3TA 3GQCA 1XNQF 3W2WB 3M9MB 1M1HA 1S6UA 4ECRA 2VZ9A 1RAEB 3CT9A 5EN1A 5EUHA 3PR4A 3CF5Q 1FTCA 1AA1B 2RH3A 2HNYA 3GR0A 4X66F 2QA2A 1IKYB 1LOUA 4L74A 4B9LA 3A8JA 3GPAA 2QV6A 5K9FA 3BKFA 2MKYA 4Z7YA 4CYUB 2DVIA 2UUBJ 1S1WA 1D9AA 2NXUA 4CLWA 2HHXA 2XSJB 4UF4A 3VAGA 2ZOFA 3UCUP 4RU9A 2U2FA 2VFRA 1N5YA 5A8RA 1JLGA 4XTTA 1KRPA 1GAOA 3UDCA 3CCSS 4YB6A 3SV3A 1RT2A 5KFEA 4DQSA 4KGMA 3DGPB 1CULA 1B0VA 2YX7A 1IBMF 1SPBP 4NASA 2BJEA 2B6AB 2W4DA 4QOTA 3ILLA 2PMZD 1B64A 1FWPA 2OMOA 4YDDB 2AP6A 1WUUA 5IFMA 5KFSA 1ELOA 4CWBA 4DR2F 1KR4A 2ZBQA 1JLEA 1RJJA 4LR9A 3RB6A 4EYIB 1T9XA 1YSJA 3NS6A 4ED7A 1KFDA 2KL8A 4RW9B 1AXQA 3GG0A 1NK0A 4B3TF 1R3NA 2Q43A 3MFHA 3K57A 2OGUA 3Q86A 4DCOB 2UUAJ 1KOHA 3K89A 4LSLB 3IS9A 3U1MA 3LP2B 4U6PA 4LF8F 1QAYA 3JSRA 4DUYJ 2ZJQQ 2KI2A 3N5FA 2DY1A 4P9SA 3J7YI 1SL1A 4OZLA 1IN0A 1U6FA 2VG5B 5HVFA 2WHOA 1DQ9A 5T7LA 4DF4A 1T3NA 1RA7A 2CPIA 2JRSA 4ICLA 4OYMA 1YITS 1FRXA 2HHSA 1S9EB 1QTMA 2F63A 4PG5A 2VU5A 4O44B 1HBMB 5IS2A 1HNIA 3LWMA 2I6WA 1B7FA 1YJWS 4RNFA 4PR6A 4ANEA 1TL1B 3N4WA 2FZGB 4QR1A 3RZAA 1ZOTA 1HWLA 5KG6A 4NEYA 2OD4A 5LJ5Y 1YJVA 4N41A 1WWHA 4KE5A 4LFAJ 3KHGA 3MOJB 4C2MA 2CQHA 3T1HF 4FYYB 2O67A 5DLGA 3FNNA 2ZHAA 3HHLC 3J7AN 4R5PA 2GVDA 3BBFA 4MIWA 2L9NA 1IBLF 1N32J 1NSKL 1RLDA 4ZDNA 3O2IA 5KG5A 1NRKA 4FZVA 4J37A 2I9SA 2YVSA 2V5HG 2DNRA 3EUNA 2YQ1A 3JSBA 1T9YA 2XNQA 5D4NA 5HQLA 3BQ1A 3VZIA 2R8JA 2B6AA 3AAWB 2F4VF 1ZH5A 5F8NA 1FRLA 1ZZFA 1RTZA 3AJDA 3AB4B 2CG8A 1FWKA 2EVZA 2XMVA 3BF4A 4YB7A 4X4RA 1RT3B 1PKUA 2H48B 3H2UB 3MCNA 1XK8A 2XSJA 3T19A 2UVWA 2HFSA 1ZETA 3DLKA 3UWTA 2YKNA 2ZH1A 3KLGB 1DY3A 1WG5A 3FEXB 1XBWA 2GIFA 2C2EA 3P49B 2WVFA 4TQRA 2KXFA 3BQ0A 2DNHA 4C3LA 5KFYA 1N6QA 4F4YA 1LWEA 3C6UB 2UVUA 5U47A 5DQHA 5J1NA 4LQ9A 3SQGB 1WHXA 2BJDA 1JJCB 1FDNA 2CVIA 2FHMA 3O44A 3ZTQA 4DUZF 3W61A 4IRKA 2XS5A 2BJ1A 2GA7A 4WKRA 1Q79A 2GJFA 4H4MA 3K5OA 3M6XA 2J0WA 3QT7A 3VR1A 4CT8A 4P2XA 2ATLA 2OJ3A 4X64J 1NPPA 2HHTA 2PMHA 3MTJA 4KKOA 5J1EA 4TVAB 3EXCX 4UOCA 3CE8A 3G6VA 2R7RA 1HNWJ 2QFIA 3VTIA 4EEYA 2UXDF 3OTCA 4UY8T 1KNZA 2B4VA 1VFJA 2J7UA 3TUIC 3MM8A 4MYTA 1FJGF 2HQGA 1X0PA 1YJTA 2R7SA 2NUUG 4UT4A 3K0JA 4DV5F 1D9FA 2QGFB 4FYDA 3BGFA 4IQMA 5KT6A 1HW8A 2BV3A 1JLBA 1VQ9S 3IBFB 1LFWA 3PNIA 1J2VA 2FUG9 2EC0A 3RB3A 1YI2S 2VL1A 2AJ4A 2B4UA 3HVTA 3BSNA 1IBKJ 3W64A 3RRHA 1HNVA 1TKXB 5KT3A 2AYEA 2M88A 4OYAA 1TZ0A 4G65A 4IOAQ 4JI7F 3AOBA 4WE1B 2RRBA 3H42A 4WIIA 3W5YA 3CDAA 1F5AA 3OL7A 2KG0A 3CJRA 4M8LA 4R5PB 2HBQB 2BE2B 2Z4PA 4XPCA 3RRGA 2XWXA 3TVZA 2MMYA 5F3ZA 2B7CB 2KT3A 4ED0A 1DBDA 1HNWF 4JI4J 3DLGB 1F3VA 2VC0A 3GIRA 3LP1B 5KOXA 2RF2A 2GV1A 2VUGA 2YX1A 4I2PA 4LIRA 2YWFA 4QR0A 3PIOQ 1T03B 4DOZA 2DK2A 3G6ES 1YZ6A 1PBAA 1M5OC 1R8HA 2GGPB 1TU0B 4LF2A 6AT1B 2CZ9A 4EWTA 4K4SA 4C98A 3PJWA 5HL7Q 5L1LA 4NYPA 2FGOA 5EX3A 1YBAA 1NSPA 3C6TB 4FKXA 1SL2A 4WZMA 2HBYB 4I69A 1RU2A 2AMCB 4IFYA 2AD9A 5KOWA 1VBXA 1FKOB 5HN0A 3NNAA 1M5SA 1IM4A 2F8HA 1WF1A 4YP3A 4LRAA 3KK1A 2V0NA 2M4MA 3JTNA 1W7WA 1GMVA 4DZDA 5ITHA 5J2QA 1C0TB 2UVRA 4QYZJ 1U49A 2HZCA 5FLXY 3RYLA 1AZSA 5I42A 4GO5X 3D5MA 1WKKA 4RU2A 3ZTSA 1QTNB 1J5EF 2AHOB 4URQU 1AROP 4YHHJ 1R7IA 4FP9A 2F7VA 5JVHQ 3VAKA 1SC6A 2GX8A 3DXSX 5F8GA 4YB1P 3VAIA 1TVRB 4DHVA 2I5JA 4NA2A 4F50A 1V5IB 1ZTTA 4JI6F 2DKOB 2HK2A 2X3GA 3N6MA 1C1BB 3QWPA 5D4OA 8RUCA 3CUNA 1RQ0A 2CADA 2KRBA 3OTBA 2JC1A 3T9ZA 1ZPVA 3D1HA 3QQCD 1UWBB 4NA1A 3GP9A 4Y34A 1RWKB 5LSLA 4ES2A 1HWKA 1VQ5S 4XO0A 2B4OA 4ECXA 4JV2A 3IRWP 4DPOA 2HKEA 2ZWPA 3C14B 2ZH6A 1S4EA 2QMXA 2YKPA 4P75A 3SV4A 4P7TA 2CA9A 1JLCB 5KFNA 1HR0F 4LF5F 2G4BA 1IKVA 2A6MA 4OYBA 4TLQA 5LMNJ 2C2RA 1Q81T 2QO3A 2XTJP 1D0EA 3EGVA 2HEKA 1X5OA 5D78A 4ZPCA 2MQQA 4CTAA 2CPJA 4LVOP 2HBZB 2ROGA 1FT8A 3ZC4A 1GTHA 2F65A 3G87A 4QW8A 3ZTOA 4J9KA 3KJVA 2BA9A 4AYBD 5GMDA 3VHQA 4AT1B 2SXLA 4WFAQ 3U1NA 3W60A 1WNEA 1QLNA 1CEZA 3D68A 4R8UB 2HVDA 2N4DA 3OJSA 2HNZB 3M9OB 3UR3C 2BW7A 3DM2B 4IQXA 4PYDA 3PW4A 3GFZA 2BW2A 4QWCA 4DL4A 4OJGA 2J9DA 2IYIA 4J9PA 3MEDB 1FKPA 2PFDA 3QLHB 4ATNA 1P9QC 3I0RB 4DV7J 1U0HA 4B3TJ 2CNLB 3OL9A 3GU0A 3WBZA 2KM8C 4B3OB 3MM6B 1FJ7A 3T5KA 5DDQC 1ROFA 3UO0A 1KBRA 2F9DA 4J91A 2GAGC 2Y8WA 2CJQA 3TEGA 1WJ9A 4L3NA 2ALZA 4JV5F 4CTAB 3ITHA 2C2DA 2CQ1A 2JDJA 2IVFB 3LP0A 1KWMA 5AXKA 1VHFA 2A1BA 1HARA 1VRTA 5KFPA 1S59A 2KJWA 2WVDA 5IT9Y 2HFZA 2AKWB 1GFWB 2OPPB 1NM2A 3GLJA 3HSDA 3NAIA 5KFMA 3BO3A 1TKDA 1K8AT 3DOKB 4ZLNA 1SQFA 3HZGA 1ZYQA 2QZ8A 4X62F 4DSLA 4G3IA 4B08A 1RAIB 2W9BA 3DMJA 2E5JA 1IR1A 2KFNA 4ECSA 2MLYA 5H9FJ 2ZJRQ 4J9QA 1BD6A 1HLWA 1XMOJ 4E0DA 3D4JA 4DR6F 3G86A 4WPAA 1NDLA 3TO8A 3VZHA 1S4FA 5DZ6A 4K5SA 2KN4A 1R6YA 3CMQA 3N9UC 1RT2B 3UR0A 3UE2A 3R7NB 1B0TA 1YDLA 1EETB 5EHHA 3DLLQ 3M2UA 2ZH5A 4YR2A 3MR3A 4DUYF 2HBRB 4OYPA 3R6LB 2OEMA 4DSKA 3OVBA 2IA6A 3HLUA 2W9BB 2QA4S 4PXCA 2M70A 4TYAA 2YQ0A 2MEWA 3DU5A 4OYZA 2FC8A 1FX4A 5HSPA 4WXOA 1WOSA 2L9WA 4I6YA 2E1CA 1S10A 1H6KX 1RB0A 2FLPA 4Y6IA 5A6WA 2J5AA 2E5LF 2YNFA 1TUGB 1UW4A 3UVJA 1RBAA 3MAAA 4EMDA 4NI2A 3OHBA 2KYXA 3T5LA 2DO0A 3KMQA 1CBKA 1IJFB 1JK9B 1JLAB 4OYIA 1TL1A 2OSQA 3PJ9A 3SDEB 4DN9A 2Y1JA 3IM8A 3CCJS 1RU1A 1WELA 1U09A 5C2GA 5HANA 4Q5VA 1Q7LB 1WEXA 1FXRA 2XYGB 3QAUA 4J5OA 4DV2J 1L3UA 3QSYB 4DV6J 2QA4G 2EBGA 2WSFC 4K4VA 5ETNA 2XWYA 1LNQA 2XSFA 2RU9A 1SUQA 3KUGA 4U8YA 5DS7A 1T03A 2COLA 4EZ9A 2E5GA 4JB8B 5J2NB 5KFXA 3NOCA 3HKZD 3NGUA 2HRUA 2MQNA 3RUBL 4X66J 4DXLA 5K8MA 4DV0F 1SKRA 3CTRA 4LFBJ 2ZBPA 3D7SB 1KQGB 4YB5A 1OSCA 4XIUA 2YNIB 5CYMB 1RAFB 3M05A 3NCQA 4PKDB 4JI8J 3TEHB 4I4BA 1VS3A 3I4HX 4K5RA 3H0PA 5KFBA 3UI3A 2BQUA 3Q8PB 1SJ1A 2O3DA 4NXMF 3CD5A 1SV5A 1RLCL 2NSBA 2QYCA 3H2LA 1FX2A 1QDUB 4C11B 1CS4B 2AJFE 3R5DA 5DGBA 3OTDA 3C3LA 1UVIA 4X4VA 1BHNA 4HTJA 2BACA 5D6GA 1TMJA 3DU6A 3K5LA 4J9LA 4AL7A 4IH7A 1FFWB 2DH8A 4TY9A 2E44A 2VG7B 1JLBB 1SJQA 1ZAWA 2DXDA 2Z0GA 1YK9A 3EXYA 3MM5B 1HI1A 2YH0A 5DRKA 2V4RA 3TUPA 2FHOB 2KU7A 4ICLB 5LMUJ 4Y3CA 4LFCJ 2VG6A 2ZH8A 3W3SA 1NB2A 1SQEA 2VKRA 3M8QA 3GJTB 3DOMB 3OTOF 1NJYA 1RT1B 2HGMA 1X4AA 3FSYA 4LF5J 1TVRA 1QUVA 2LU1A 1ZA2B 1D8ZA 2UXDJ 1S9GA 2H5IB 4GC6A 2V34A 2Y0BB 3FSIA 1PJ6A 2IA0A 1D8YA 1RAAB 3D3CJ 4QPTA 5BYQA 4CLPA 2XQCA 4IRDA 3GIJA 6FDRA 4M5LA 3MF5A 1ZTWA 3WX8A 4JYAF 4L76A 1BLUA 3BH7B 5CCMA 3Q89A 5ADZA 1WHVA 1LK7A 1TR0A 4NZ7A 5J2PB 2K1RB 3AH6A 1Z2ZA 5CHCB 4IR1A 4KHPJ 2DNOA 3GYXB 3HF5A 2PC6A 5DM6Q 3T1YJ 3EM1A 3PACA 2G2YA 3EVOA 3JAMY 1VRUB 4RW4A 2HPUA 3CNQP 2DISA 3K59A 1WDDA 4JI7J 5KFTA 3AJ2A 2UZAA 4RZRA 1PILA 2CKWA 4CLUA 2XS7A 2YKNB 3V4IA 2VASA 4DU7A 4URSA 4OLPA 3CDBA 3DMJB 4ZIVA 1HI0P 3KLFA 3VCDA 3J80Y 5KG2A 1OMSA 3MEEB 2BEFA 2HFOA 1DJ0A 2IIHA 2R7QA 3H98A 4HLBA 2VODA 3D6HB 1S0OA 3JQKA 3R2CJ 3CDWA 2VBWA 3EDRB 4F02A 5B0FA 1Y3JA 2K8GA 2AEFA 2CWXA 3ENQA 2WW4A 4U7UD 4JYAJ 3RBZA 3IS9B 5L8RC 5GADU 1VBYA 4ECTA 1RUSA 1TV6B 4GC7A 1LK5A 1PYTA 3U02A 3OFFA 4NXNJ 3OHAA 4G1IA 4YFUA 2WK4A 2YKAA 2PMWA 3BS9A 3OR2A 1T9UA 4WE1A 1FF2A 5HO4A 1G1XA 3LAMA 2GVDB 5ETSA 1ITPA 4LQ3A 4NLUA 4KHPF 4KFBB 3MEDA 1S6PA 2X1GA 3NGRA 3TVYA 3HMJG 5DG8A 3EYZA 2R7VA 1O5JA 2JLFA 2RU3A 3OVAA 3DLBA 2FJBB 4FXWA 4UY85 3CJSA 2GC8A 2WZ1A 1Y0HA 4LBPA 4C3MA 1I3OB 4K0KJ 3MWBA 4Y2IA 1L3SA 1S1VA 4UUXA 2W7AA 4HH0A 1IKXB 1S48A 2DYAA 2QLBB 1UAWA 1RKIA 3Q2SC 1NCLA 4ZVQB 4DX7A 1B4SA 3DGVA 4B9TA 2W01A 3KHLA 4ANCA 2P9GA 2WONA 3MUMP 2RDJA 4QQBA 4UUWA 1FEHA 3J7YU 1O51A 1H2UX 2HFNA 1ZPWX 2HRYA 3WIVA 5GAEI 4F67A 3HHLB 2CYYA 4URGA 2CQ4A 4USTA 2VA2A 1NDCA 3HVWA 4FYWB 1N36J 4HT7A 1FDAA 2DXEA 3M6WA 2OO4A 4TKTA 4M63A 2IY5B 2QX0A 1DQAA 4R0JA 4YY3J 3UN3A 1A7GE 5ETRA 4YEAA 1Y00A 2RILA 3MR6A 3I9V9 3N01A 2J76E 5C25A 2AV5A 3B4DA 4USIA 3NGTA 4XDDA 4AD6A 5CYJA 1UTAA 4X4PA 1VBZA 1NZ8A 4ZVEA 1L5UA 1UKUA 1RWVB 5HROA 4UZCA 3ZZUA 2I5JB 2KVQE 4WK1A 2B0GA 4DSIA 5SZTA 2A2CA 4LVNP 1CULB 4OV1A 5K14B 4ZK7M 3PG9A 1NNDA 1X4FA 1DLOA 5C2CA 4WP9A 4HYKA 2DR9A 1UVMA 1FE4A 3NMAA 4KGVB 5DZ7A 2BVZA 2FYXA 4XAKA 4A8KA 4IH5A 5KFFA 2KXHA 4ID5A 1LW0B 4CH1A 5D4LA 2ILZA 3CWJA 2AIRB 4ZJQA 3HI9A 2HVIA 3ICLA 2AZ3A 2G0CA 3NS7B 4MK8A 4ECVA 2AX1A 2XBPA 2JLEA 1UA1A 3CCWA 3M30A 3SXLA 4K4ZA 1YQHA 2FZCB 2U1AA 2IRYA 4DFMA 2N3LA 2L3MA 1UJ4A 1ZM4A 4USUA 1HWJA 2JLGA 4OHWA 1OPIA 3LA0A 4ZPAA 4KBIA 2MKJA 2ZH3A 4DL3A 2UXBJ 3RW7A 4K4YA 1NJXA 2VPYB 2OP5A 3QRRA 5IOLA 3PKMA 1MROA 1DTQA 2H4WB 2DIVA 4DPYA 3JYTB 3MPUB 2FTRA 4KO0A 3W63A 4W92B 3M8ZA 5LL6d 2DH9A 4ZHRB 5F9LA 2QLWA 2OKQA 2V8DA 1A0OB 1GMWA 4Y65A 5DQIA 2BJ8A 4S0MA 3WDOA 2W9CB 3G82B 2CXEA 4UZBA 1X31C 2ILYA 2O1PA 1F6TA 2QMUB 3GE9A 4DV3J 4ED6A 1T05A 3QT5A 2VFUA 4LFAF 2E7XA 5LT5A 1FCAA 3TZZA 5CABA 2I0XA 1S72S 2DR5A 3BM7A 1HW9A 5IXUA 2UUAF 2DEIA 4DF8A 1JLCA 1UWAA 2AW0A 3W2VA 4UQGA 3E01A 4ALZA 2WVBA 3UDLA 1JJ4A 4DCPB 2PN6A 4LSLA 4F36A 4ZVGA 4OZNA 1SBRA 1RT4B 1ZM9A 1WEYA 1TP7A 2F8EX 3CMES 4C8OA 1GQEA 2Y9HA 2G0JA 2B4PA 2LFVA 2XULA 3MM7A 4DN0A 4O3PA 2R8HA 3KLVA 5HP1A 1BXNA 5HLFA 2B5JB 3T5HA 2ZE2B 1F5BA 4PQAA 4Q8EA 1DTTB 1QJHA 2Z2MA 4ZCMA 3RBDA 3HVRA 5KFGA 1LXNA 4BBYA 2MSTA 2P6SA 4A8FA 2MY7A 2W2OP 4KGXB 1TL5A 2DNPA 1VQ7S 2HHHF 2Q6CA 3LGNA 3JTOA 4RKUC 3LANA 2HNZA 1W26A 2J9EA 2XZTB 4OYOA 2XO6A 1N36F 1DRZA 2DGTA 2EFPA 2UVVA 3G9CA 4FVCA 1REVA 3MMBB 4MKAA 4B3SJ 2PDAA 4Y28C 1SQGA 5F3TA 3OUYA 2HQFA 7AT1B 1UP1A 4ZITA 1IBMJ 3MI7X 4IOCQ 1IBCB 4C8MA 4XDCA 2JC0A 2YY3A 3CVKA 1OQ6A 1X0FA 3QGGA 5K8OA 1FNMA 2DJWA 1HNZF 4MT1A 2HQDA 4O3SA 4JI5J 2J0SD 3W9HA 4WFYA 4KIAA 4Q7AA 1RTJA 1BQNB 2ZOGA 5HVGA 2X1AA 5J2MA 5AXMA 3IC1A 4DDFA 2HMIA 2BXJA 1YBUA 1GXLA 2RDIA 2LQJA 2VG6B 3HDSA 3JQMA 3R5CA 5HQMA 1IJEB 3VGVA 2FPHX 3MZIA 2BRLA 4P52A 3V6KA 2XCPA 2BOAA 4DR4F 3QFHA 1H74A 4FPRA 4RBTA 4TU8A 5K14A 2MY8A 4CM0A 1YJNS 1RAJA 1TL7B 3P4UB 5HMZA 4MMOA 3BPDA 3VGUA 3W5ZA 3J81U 4BWMA 2LXFA 1KVIA 1VJWA 4NL5A 2E5IA 4TQSA 1TAQA 3PFOA 1N54B 2KT2A 1WG4A 2W7PA 2ABYA 2CQCA 1RTDA 5B0CA 3I5BA 4RW6A 1NBEB 2LQBA 3L7PA 2JEIA 3NBPB 3CCES 2R7OA 1Z2LA 4ZVTB 4DR7F 2E66A 2QSFA 4H4KC 5CD4A 3RGIA 3KK3B 2W8LA 5H9EK 1FJCA 1H0HB 4DQRA 5F8MA 3PDNA 3X3UA 1IKWA 3QPIA 2AJ2A 2VDHA 4LF7F 3MM6A 3DRPA 3MEGA 3OT9A 1TELA 4WYLA 1S0NA 3N6LA 2R2RA 3CPWR 3GR1A 4OI0A 4PAAA 2ZUGA 3MM8B 3PTWA 2VD3A 2CPDA 3TA1A 3NGDA 3I55S 3DOLA 2YWKA 2J8AA 1HQ2A 1N33J 2IRUA 3JS9A 5F9NA 2XZWA 2M8DB 1TUWA 2M2BA 5K5MA 4WTOB 2H5JB 3M32B 3P45B 2V9WA 2M9KA 1RWPB 4RJVA 2RKIA 1XMOF 1JXLA 1XMBA 1HNZJ 2FC9A 1NK8A 2L48A 1M5KC 3I4PA 3CXCR 1NHVA 1MU2B 3BGRA 1N0VC 1ZBTA 4GMKA 4EUVA 1FVQA 5HMWA 2CJBA 2CQPA 4Y0FA 1RAOA 1FXLA 3C6UA 2MKKA 1HQUA 1HA1A 1JLEB 1UFWA 4EU0A 2DGWA 2CNOB 2ZZMA 2JX2A 3PX4A 1U6BA 1N8RT 3EPGA 2BUNA 3KXDA 4OZ2A 1YKWA 1S1UA 3DDNA 3VGTA 4DR2J 4DWIA 4FF2A 3LAKA 4UQTA 3T41A 4ED8A 1KEKA 3H4DA 2KKHA 3WIUA 1ZM3A 4ZP8A 2BJ9A 2RE1A 1UPMB 5D3GB 2CPZA 2VC1A 4RLEA 3VWSA 2CDQA 1UVJA 4O0NA 2X51A 3HKWA 2VB6A 4LSZB 5EX0A 3VQSA 5D0RA 3PEJA 4DR7J 4F3MA 1Q8IA 2KT5A 3IGVA 2CQBA 4FBTA 4F0HA 2HWTA 3QMQA 4ID8A 1BWVA 3JTPA 4PWUA 4EBCA 4PUOA 3MHYA 4WFZA 4LIWA 4O4RA 3MPWA 2K06A 2OPPA 2XG8A 2F1FA 5KFIA 3POTA 1RACB 3UN5A 3K8WA 3CD6S 1Q53A 5LOQA 5B0BA 2EFQA 2Q6BA 2C3YA 2ADCA 3IA0A 2CIMA 3DYAB 2E7WA 2AX0A 3M2RB 3MPDA 3D0HE 4JI0F 5CYQB 3GV5B 1OYEA 3NCPA 3TA2A 2CFXA 1MN9A 1FFGB 1X4GA 4NLRA 1JNRB 1Q8LA 2HFUA 4NCGA 1UFLA 3AD9C 2R7WA 2BKOA 4DR1J 4LF6J 1FKPB 3QLHA 5CZVA 3WC0A 3RAMA 3G8SA 3BB5A 1HNXJ 4B9VA 2ZBCA 1BQMB 2IC3B 2KG1A 5L1IA 1FK9B 3FZ2A 3D1QA 5KFRA 2MXYA 1S57A 3DCAA 3LGMA 2ZD1B 4Z2XA 2UUBF 2R8KA 4JI5F 2VV5A 3FRYA 3Q8YA 1CQMA 1S9EA 2GQQA 3BZQA 3AT1B 3F56A 3FC9A 1HL6A 3L4BC 2VFSA 3DRSB 3M8QB 3MURP 3VAJA 1QAJA 4U7CA 2FD2A 2I38A 2P8IA 1OY6A 3ISNC 4NWBA 5HLFB 3PEHA 3UD5A 2ACMA 3P5BP 1B3TA 4B9MA 3LF0A 3MPYA 4KGKA 1KLMB 5LJ3Y 3PO5A 3MGJA 3QO9B 3V4MA 1S76D 2VH7A 4X4OA 1Y3KA 4WCEQ 3K58A 1EQMA 1SC3B 2BANA 2NXEA 3D54A 2G1DA 2IM1A 4OX7A 3OFGA 4RW6B 2PT0A 2I8EA 3TAMB 4DEZA 3OJUA 3C19A 3M7VA 3AJ1A 3RJMB 4WTYA 4OX8A 3CJ0A 2C3OA 3L3CA 4C8NA 1A9NB 4HDHA 4I1TA 3FUYA 2DHGA 4ENOA 3CO9A 3I0SB 1S1TB 4PG8A 2N82B 4F4AA 3SIPB 5IV4A 2VPZB 3RU0A 1WSVA 2MQMA 1RTHA 3ISND 3R27A 4ZHRA 4KO0B 4X4TA 3CCLS 2NSCA 4DR4J 2XGPA 3CW2C 2OI2A 3B78A 4H4OA 5B0GA 2PI5A 4K2XA 4OIXA 1DQ8A 3CEDA 1PYOB 4ZJOA 2M52A 4RW8A 5AXNA 2RQ4A 3KLFB 5DQGA 3QBCA 2Z2ZA 2UXCF 3AXKA 3CO0P 1MMDA 4YR0A 1JKHB 2VDIA 2GQCA 2CPHA 4BWJA 3KJQB 2XYHB 4WJBA 1G3OA 1C4AA 9ATCB 3CJ2A 2G0IA 5KFHA 5KG4A 5EWGA 5J1EB 2CG4A 4NLWA 3M30B 4LT6A 2RQMA 4ED3A 1XMQF 3CULA 3LQVA 2GMHA 3UW1A 4JI4F 2ZHBA 3FJ2A 4FS1A 4H4MB 4ILMA 2D74B 1S5ZA 1TQLA 2RJZA 4DQIA 3I6PA 3BR8A 4CO1A 4N5SA 5I3PA 1C1CA 2GMJA 1UEUA 4MTPA 1FDBA 1SL0A 1ZA1B 5KAKA 3TANA 5DG9A 1TKZB 1RXOB 3CJ3A 2LQ5A 4NLVA 2IM2A 5G0RA 3QRPA 4ZCIA 1ZS6A 3C6TA 3HZEA 3NWRA 4HI2A 3PM9A 3VQTA 3RBEA 2ASDA 2RB7A 1WOOA 1S9GB 2Y1LB 4F2RA 4LBIA 4GRSA 3Q8RB 2H65B 2NR0A 4PQUB 2W2NP 3RB0A 1KHVA 3M4XA 5FDLA 1WOPA 3DHWC 4KB7A 3D9BA 1UJ5A 4EO8A 3A3OB 2FGCA 2F3JA 2XZDB 2QFJA 5DM7Q 2Z57B 1RP5A 4Q45A 4QU7A 3FK4A 1N5QA 4C8LA 1HKAA 4WFXA 2EK6A
chains in the Genus database with same CATH topology
3R7NB 1RWXB 2H4YB 1RHQB 4LSZB 2HBRB 3R6LB 1RHKB 2CJYB 2C1EB 3R6GB 3R5JB 2CNNB 2HBYB 1RWNB 5IC6B 1RWOB 4ZVUB 2XZTB 2C2KB 2C2ZB 1I3OB 1RHJB 2H51B 2QLBB 4ZVQB 2P2CB 4ZVSB 1QTNB 1RHMB 1IBCB 2XYGB 1RWWB 1SC4B 2DKOB 2QL5B 1PAUB 4JB8B 1RWKB 2H48B 1RWMB 5K20B 3P4UB 2QL7B 1SC3B 1RWVB 3RJMB 1QDUB 3EDQB 2HBZB 3SIPB 3R7SB 4ZVTB 1RHRB 2QL9B 4ZVOB 3GJTB 2CNKB 2XYPB 3KJNB 2H54B 1PYOB 3NS7B 3R7BB 5IC4B 2FQQB 2H5IB 2Y0BB 1ICEB 3D6FB 1F9EB 2XYHB 3D6MB 3KJQB 2CNLB 3GJSB 2CDRB 1BMQB 2CJXB 4ZVPB 1RHUB 2H5JB 3GJQB 4ZVRB 3P45B 3IBFB 1RWPB 2H4WB 2QLJB 2C2MB 3KJFB 1GFWB 3GJRB 3QNWB 2Y1LB 2CNOB 1SC1B 1I51B 2H65B 2HBQB 2QLFB 3IBCB 3D6HB 4DCOB 3EDRB 1NMEB 2XZDB 4DCJB 2C2OB 4DCPB 1RE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7N B;  1RWX B;  2H4Y B;  1RHQ B;  4LSZ B;  2HBR B;  3R6L B;  1RHK B;  2CJY B;  2C1E B;  3R6G B;  3R5J B;  2CNN B;  2HBY B;  1RWN B;  5IC6 B;  1RWO B;  4ZVU B;  2XZT B;  2C2K B;  2C2Z B;  1I3O B;  1RHJ B;  2H51 B;  2QLB B;  4ZVQ B;  2P2C B;  4ZVS B;  1QTN B;  1RHM B;  1IBC B;  2XYG B;  1RWW B;  1SC4 B;  2DKO B;  2QL5 B;  1PAU B;  4JB8 B;  1RWK B;  2H48 B;  1RWM B;  5K20 B;  3P4U B;  2QL7 B;  1SC3 B;  1RWV B;  3RJM B;  1QDU B;  3EDQ B;  2HBZ B;  3SIP B;  3R7S B;  4ZVT B;  1RHR B;  2QL9 B;  4ZVO B;  3GJT B;  2CNK B;  2XYP B;  3KJN B;  2H54 B;  1PYO B;  3NS7 B;  3R7B B;  5IC4 B;  2FQQ B;  2H5I B;  2Y0B B;  1ICE B;  3D6F B;  1F9E B;  2XYH B;  3D6M B;  3KJQ B;  2CNL B;  3GJS B;  2CDR B;  1BMQ B;  2CJX B;  4ZVP B;  1RHU B;  2H5J B;  3GJQ B;  4ZVR B;  3P45 B;  3IBF B;  1RWP B;  2H4W B;  2QLJ B;  2C2M B;  3KJF B;  1GFW B;  3GJR B;  3QNW B;  2Y1L B;  2CNO B;  1SC1 B;  1I51 B;  2H65 B;  2HBQ B;  2QLF B;  3IBC B;  3D6H B;  4DCO B;  3EDR B;  1NME B;  2XZD B;  4DCJ B;  2C2O B;  4DCP B;  1RE1 B; 
#chains in the Genus database with same CATH topology
 3NNH A;  2Z2L A;  2VQF J;  2XY5 A;  2AJ1 A;  3FKB A;  3KHR A;  3IG1 A;  1RT7 A;  5F8L A;  3TZX A;  4OI2 A;  4NYO A;  3D2W A;  3SZ2 A;  2DEJ A;  2OUG A;  1U02 A;  2JVR A;  2CJY B;  2BAB A;  3D0I E;  4HEA 9;  4M5K A;  2L41 A;  4DR1 F;  2J6U A;  3CC4 S;  3MR5 A;  2ALY B;  1YRX A;  2BE7 D;  2XI2 A;  1KOO A;  1RWN B;  4P2S A;  1HNV B;  4CO4 A;  3K5P A;  2GCF A;  4JV0 A;  1RWO B;  2QJ3 A;  2OPQ B;  3BH6 B;  4ZVU B;  1RAB B;  1P9Y A;  1JLQ A;  5FLX U;  4FS2 A;  1QSL A;  5M2R A;  1NK4 A;  2JEG A;  2LXU A;  2QSW A;  2HQC A;  4E98 A;  4RPF A;  4WFB Q;  2XLI A;  4ZVH A;  2PA3 A;  3M8P A;  3OUY B;  1QD1 A;  4ETX A;  4FKY A;  1U7L A;  2RKI B;  3SSR A;  1DTQ B;  5H1S V;  3BQ2 A;  5F0W A;  3LGH A;  3P8B B;  3K7R A;  2ZNZ A;  2ZWO A;  1YZ7 A;  1QE1 A;  4FNH A;  2QA1 A;  4CO5 A;  5GAH U;  1MWY A;  4A8X A;  4DU8 A;  3UNY A;  1S9F A;  3PX0 A;  4ELU A;  5D8H B;  4QZV B;  2V67 A;  4NLY A;  4ED2 A;  3Q8V A;  1LWF A;  3GWC A;  3KLI B;  4EBD A;  2CQG A;  2KB2 A;  3FFI B;  5KFW A;  4OZ3 A;  3SFU A;  3PW0 A;  3R1L A;  2VON A;  3G8T A;  4YS2 A;  3MEG B;  4ZMM A;  4LF4 J;  1FER A;  1HFE L;  2AGO A;  3NCR A;  3OLA A;  3NS5 A;  2H9Z A;  2WAQ D;  3CCV S;  3NEK A;  1H3D A;  3IXQ A;  3SQG A;  2J9D E;  2YNF B;  3I96 A;  3GYG A;  1TFY A;  3M1V B;  3C46 A;  2RQK A;  1RWM B;  1WI8 A;  2Z58 B;  1URR A;  4DG1 A;  5LXY A;  4X4S A;  2IVY A;  3POT B;  2YXL A;  2ZIT A;  1RIS A;  2XO7 A;  4W4M A;  3BYR A;  4K4T A;  5EGY A;  2MQP A;  4X4U A;  1FFS B;  2F4F A;  2HQI A;  2NZC A;  3B8H A;  3V6J A;  2ZVS A;  4GKJ J;  3ADA C;  2Q3P A;  3EDQ B;  3Q22 A;  4DL7 A;  1GH8 A;  3ETO A;  3GFH A;  1GEH A;  1SXL A;  5KFC A;  2HG4 A;  2IHR 1;  1RT5 B;  3OFE A;  2LEP A;  5FII A;  3OXL A;  4BC7 A;  2HZV A;  1H73 A;  4KGZ B;  3S6E A;  3ELH A;  3H25 A;  1G7C B;  4M5N A;  1XNR J;  1UEK A;  2HK3 A;  1AW0 A;  5KFJ A;  2YQ3 A;  2EPI A;  3W65 A;  1VC6 A;  2K3K A;  1CJK B;  4KH1 B;  1IQZ A;  1FI4 A;  1UPP A;  2GVZ A;  2B8P A;  4IDK A;  3LO3 A;  1JIH A;  4MYU A;  4NYZ A;  2EFO A;  1LEO A;  3IWL A;  5IC4 B;  2AQ4 A;  1HBO A;  2FDN A;  4FF4 A;  2BMB A;  2HRT A;  4OI6 A;  1X9W A;  4ZJL A;  1T11 A;  2IRX A;  2XMM A;  2ZBR A;  4KRW A;  4M1K A;  2OPS A;  1HD0 A;  4IKA A;  4MIB A;  3BSA A;  2RS2 A;  1VQN S;  2OD6 A;  4U95 A;  2J0Q D;  1BMQ B;  2HUR A;  4GVB A;  4N7T A;  2XS2 A;  2DNZ A;  2OPR A;  1M1K T;  1SJ4 P;  3M8W A;  1Y11 A;  1FRJ A;  3S1T A;  2QRR A;  3NNC A;  4ZVR B;  5CZX A;  2LKZ A;  3FZB A;  4P7V A;  3RB4 A;  3OSP A;  1TKT A;  2IM0 A;  2E1P A;  2MHE A;  4TY8 A;  4DBQ A;  4YQW A;  2MSS A;  2WTF A;  3LWL A;  2AYG A;  2CJK A;  2QLJ B;  2DPI A;  4HL9 A;  1NK7 A;  2LEC A;  5CH7 B;  4KR0 B;  4ZP9 A;  2IAJ B;  2YX4 A;  1DFD A;  1CVJ A;  2JHE A;  3HM9 A;  1TL3 A;  3I5C A;  4CLK A;  1K47 A;  2DNY A;  4KYZ A;  3ZTP A;  5I3U A;  1VQ4 S;  5GME A;  2O5D A;  1U1N A;  4JI1 J;  4C97 A;  4EK2 A;  1I51 B;  1S6O A;  2RHS B;  4G1Q B;  1G4C A;  4NLS A;  4RX6 A;  1RA6 A;  3DLJ A;  2V63 A;  4PG7 A;  4UTG A;  2YPY A;  1N5V A;  3GFY A;  2NS1 B;  3WZ0 A;  3ZZP A;  1PG5 B;  1RCO B;  4WFN Q;  5DDR C;  4IFV A;  2W2M P;  2KVI A;  4MKY A;  1HYS A;  3LTO A;  3EPI A;  3HJF A;  1WKJ A;  4ZS6 A;  3J81 j;  4K59 A;  4DV4 J;  2R7X A;  4NZ6 A;  3DN9 A;  3R5A A;  2H4Y B;  1YJU A;  4CT9 A;  2VQF F;  3K5M A;  1VYA A;  4JI6 J;  4R25 A;  1VBK A;  1X4D A;  4ZA1 A;  4OZ1 A;  3ZNU A;  4N56 A;  1X4B A;  2HLU A;  1R89 A;  1CJT B;  4FXD A;  3TJA A;  2UU9 J;  1BY9 A;  2NLW A;  3EZ5 A;  1MWZ A;  2A2D A;  4NLT A;  3AD8 C;  4WU2 A;  5A6P A;  7FD1 A;  4J9N A;  3DLK B;  4MAK A;  1BUX A;  4XPE A;  1J27 A;  5JMN A;  1KQS R;  1TL3 B;  1R8B A;  2EXU A;  9RUB A;  1HIY A;  2ZM6 J;  3IWN C;  4EGL A;  3G71 S;  1U1R A;  3K17 A;  1C4C A;  1X5P A;  2KFY A;  1FNX H;  3ILO A;  2J6S A;  5D3G A;  1RSC A;  2FJE B;  3WQP A;  4ECY A;  1UZD A;  4U9R A;  4J9S A;  3TVK A;  4NCB A;  1S1V B;  2BOP A;  4R0E A;  2Q1L A;  2R42 A;  4I64 A;  4F3O A;  5JXS A;  2PI4 A;  2QMW A;  1VQS A;  4EZ6 A;  3UN2 A;  2RVJ A;  4NEZ A;  1BQM A;  2IC3 A;  3MMA B;  4JBC A;  2DB1 A;  2KM8 B;  1DUR A;  1SC4 B;  1SKU B;  3QWU A;  4CO3 A;  1MSW D;  2F8M A;  4RWW A;  3IR6 B;  5E33 A;  4PG6 A;  3Q24 A;  3W2W A;  4LF9 J;  2NXN A;  3EE3 A;  2Y1I A;  5CYQ A;  1Y5L B;  1QY7 A;  3R97 A;  1FRM A;  3IMQ J;  3VGS A;  4RNN A;  3M8R A;  4NA3 A;  2LYV A;  2CQ0 A;  2Y0S D;  4KHM A;  4K7Q A;  4USV A;  3KK1 B;  4JUZ A;  3TQ1 A;  2BR0 A;  2DNK A;  3HVA A;  3QJP A;  2AWZ A;  4DV3 F;  4K4U A;  4QPX A;  2FVQ A;  3CSK A;  3MMA A;  1EB0 A;  1Y10 A;  4PXB A;  1VC0 A;  3NOG A;  1E6Y B;  2HVE A;  3MPV A;  4OJ1 A;  5C24 B;  2KXN B;  3QAE A;  1PO6 A;  1NKC A;  4JV5 J;  1AFJ A;  1WTF A;  4EI2 A;  1X7V A;  3NG8 A;  2Z8Q A;  4LF4 F;  2VG5 A;  4KPC A;  1SV5 B;  2UU9 F;  1IWG A;  3KWM A;  3SSS A;  3PKY A;  2YNH A;  1RK8 A;  4I2P B;  4ERD A;  5H9F K;  1KON A;  3QFW A;  4DLE A;  4O3N A;  3KK2 B;  1HPZ B;  4KV8 B;  5ETM A;  3ZZZ A;  4KFB A;  2C28 A;  2ZZN A;  2JNJ A;  2ZEJ A;  2H54 B;  2OPS B;  3GMG A;  3HSZ A;  3V6D A;  5GVQ A;  4ECW A;  4D3H A;  2OAU A;  1Y7P A;  4Q2L A;  3L95 X;  4IUF A;  3C2P A;  1FKA F;  1UET A;  5A8K B;  1HBO B;  1N48 A;  2FJA B;  2ZNY A;  3MR2 A;  2DT9 A;  1F9E B;  5DDP C;  1VLO A;  2P6T A;  4QIG A;  1KTV A;  4CLY A;  5AJ3 J;  2ZVI A;  2VBY A;  1U4B A;  1XQI A;  4WXW A;  4MFB A;  5BR8 J;  1JLF B;  1T94 A;  1RT6 A;  4ZVP B;  1K73 T;  4IRC A;  2WON B;  3K8V A;  5ETV A;  1MML A;  2CQ3 A;  1NPK A;  4DX5 A;  1CC8 A;  1CQN A;  4C0H A;  3J80 U;  3FBE A;  1GNK A;  5KT7 A;  1TAU A;  4YN3 B;  5E2Q A;  4WZQ A;  2FY8 A;  4TY8 B;  2B43 A;  3L7O A;  5K8N A;  2OHD A;  3AA9 A;  4J9M A;  2LDI A;  1CC7 A;  2MZ1 A;  3A12 A;  5ETT A;  5RUB A;  1YRT A;  1REG X;  5F0U A;  5BXI A;  1X4H A;  2YBV A;  4L73 A;  3BPS P;  3DRP B;  2QC3 A;  2EK1 A;  5HBM B;  5F8H A;  5J1P A;  2FVC A;  2RQC A;  5H9E J;  2FVS A;  2YWH A;  2HQ3 A;  4V1A k;  4B3S F;  3HD2 A;  1RCX B;  2WW8 A;  2GJI A;  4MKV A;  3M9N B;  3I56 S;  4A8O A;  2OLW A;  1NDP A;  4GVB B;  5L9N A;  3GIL A;  2P9C A;  1X9S A;  3R9L A;  4RUB A;  2F9J A;  3H8Y A;  2QYG A;  4CIO A;  4HT5 A;  1RTD B;  4BS2 A;  3H5Y A;  4DR5 F;  2QG9 B;  2JZ5 A;  1NHU A;  1APS A;  3IR7 B;  1KVJ A;  3ENV A;  5EDW A;  3MXH P;  3P6Y C;  3DOM A;  3E51 A;  1TL7 A;  1C0U B;  5I3U B;  2GZO A;  3OW2 R;  2DR6 A;  4NCA A;  1K0V A;  1CG2 A;  1Z4U A;  1BGX T;  2I2Y A;  3KG4 A;  5F41 A;  2PGC A;  4KPY A;  4YDX A;  1KVK A;  2PE8 A;  2YKO A;  4J90 A;  3CJK B;  1I94 F;  2KZZ A;  1S6Q B;  4IR9 A;  1RAH B;  2RD5 C;  3IP0 A;  1YJR A;  2G2O A;  2R4F A;  5L9X A;  4A4J A;  3CDE A;  2OPQ A;  1S1W B;  1VMB A;  1LWX A;  1V3S A;  3H90 A;  1NSQ A;  1XER A;  4CH7 A;  1RHM B;  1C0T A;  1RBL A;  4A8Y A;  1FVS A;  2LP4 A;  4EBE A;  2ASL A;  1D1U A;  3CCU S;  1ZAV A;  3NGK A;  4FYV B;  1NJW A;  3PYE A;  2ZOM A;  3HHL A;  3QT8 A;  4N77 A;  5A2Q Y;  5ETP A;  3T1A A;  3CD0 A;  4NOH A;  2YH1 A;  2W9C A;  3DDI A;  2VPX B;  2ZKU A;  1Z1Z A;  4DPW A;  4OI3 A;  3U1L A;  2ZM6 F;  3EWG A;  4DV5 J;  1R31 A;  5LM7 E;  2C3M A;  3OBI A;  3IGN A;  3L9Z A;  3V6D B;  1UFK A;  3HSG A;  2QTW A;  3FEY B;  1YIJ S;  4LF7 J;  2EFG A;  4YHH F;  1ZM2 A;  3EVW A;  2X3D A;  3NKY A;  2AZ1 A;  3A13 A;  3FFI A;  3R5G A;  4FPI A;  4R8U A;  4ECZ A;  1HHT P;  4IO1 A;  5EWF A;  1FE0 A;  5GAG U;  1RT6 B;  1W2I A;  1S1X A;  3B54 A;  4DL2 A;  1QM9 A;  4GKK J;  5B0D A;  3CIZ A;  2AEJ A;  1SKW A;  2VG7 A;  3HSJ A;  3KLE B;  3I0S A;  1U48 A;  2MKC A;  2K2P A;  3ZZY A;  4PZV A;  2RML A;  3OTE A;  1S49 A;  3O8W A;  4C11 A;  3HK2 A;  4Q43 A;  2RUS A;  1N34 J;  4AL5 A;  1H98 A;  3MMJ A;  3TP2 A;  4AFF A;  4Z7C A;  1JX4 A;  1LWC A;  2UUW A;  4K0K F;  2RAQ A;  3QJJ A;  1V5V A;  3PHE A;  4RR5 A;  2MGZ A;  2JL9 A;  4NLP A;  4Y2M A;  3BSO A;  1UA0 A;  3QID A;  1KTQ A;  2PO4 A;  1T7P A;  3FCW A;  1R8P A;  3ETM A;  1U6Z A;  3EMT A;  3IBW A;  4NMX A;  1LWC B;  3C66 A;  2ZH9 A;  4X4N A;  3CJ5 A;  3CJK A;  5IWA J;  2GW8 A;  4PXD A;  2VHG A;  2FZK B;  5AE3 A;  2AGQ A;  3HJV A;  2F5G A;  1Q5Y A;  2E1A A;  4F0M A;  1NU4 A;  2E29 A;  4NML A;  4JI0 J;  5KFD A;  3BDE A;  2LEB A;  1CJK A;  1S12 A;  4UOF A;  2W24 A;  5KFQ A;  1SJF A;  3FBC A;  2BZ2 A;  1U2F A;  4QJV A;  2MLZ A;  2C22 A;  1F5C A;  3G2X A;  4LSN A;  3Q2T C;  6FD1 A;  3SCI E;  4EYH B;  1QVG R;  2F4V J;  2XMK A;  4QWB A;  4PXE A;  3MAQ A;  2Y3Y A;  1N5Y B;  1S1T A;  2K1R A;  3SDE A;  2AEM A;  3NXZ A;  2LU2 A;  1H2V Z;  4Q44 A;  4Y2K A;  3KNG A;  5KG1 A;  3UVJ B;  4DPT A;  3DOK A;  1DHM A;  3BKU A;  1T9W A;  3I87 A;  3ZXW A;  4RNO A;  4C0B A;  1WKL A;  1XMQ J;  4YY3 F;  3MM9 A;  2UV8 G;  4OLO A;  3QO9 A;  4UOG A;  2HHH J;  4O3R A;  3OR1 A;  4Y2A A;  1IR2 A;  5BYS A;  1S7H A;  3MUT P;  1WC0 A;  4U8V A;  3FQL A;  3BGL A;  4ZLL A;  1JKH A;  5E3P A;  4CI0 B;  3C14 A;  4NZ0 A;  1NME B;  4WK3 A;  3QGH A;  1LQ9 A;  3H40 A;  4V19 J;  2C2O B;  1HMV A;  3DI6 A;  2HAI A;  3FMB A;  3NRB A;  4NLQ A;  2IYG A;  3LPY A;  3LPE A;  2NXC A;  4CO2 A;  2NRE A;  1S79 A;  1UMJ A;  5ETO A;  4ECU A;  1QVF R;  1AFI A;  2FJX A;  2IMO A;  4UW2 A;  3WHI A;  2RF2 B;  3KDN A;  4F4K A;  1OPZ A;  3T1H J;  1KD1 T;  3GSD A;  2C1E B;  3BRE A;  3R5J B;  1PC4 A;  4QYR A;  1TL4 A;  3G8Q A;  2BE2 A;  1KN6 A;  2CNN B;  4ZVF A;  5B7W A;  4LF8 J;  3CD7 A;  3PY8 A;  2E7V A;  2J7W A;  4A8S A;  2DR8 A;  2B5J A;  2DHH A;  3UD3 P;  2V6A A;  1LFP A;  3V81 A;  5AXL A;  3KUH A;  2M5Y A;  4G1P A;  4FVM A;  4I68 A;  2KJV A;  4ZP7 A;  2HYI B;  1U2C A;  3K2Y A;  1T8E A;  3HT3 A;  1RT4 A;  1KS2 A;  4FF3 A;  2OFG X;  3DHX A;  3O5T B;  5ETL A;  4QU6 A;  3EGZ A;  1Q95 G;  4TU9 A;  5I3Q A;  3IFE A;  4ED4 A;  5JUM A;  2RDD A;  2FIU A;  4A46 A;  3G6X A;  2D9P A;  2NCK L;  3CCZ A;  3QYY A;  4FXV A;  4IH6 A;  5T41 A;  3JSM B;  5DLF A;  5J2Q B;  4AUK A;  1YJ9 S;  5DET A;  2XC9 A;  2HHU A;  3PCO B;  2GIQ A;  2JH3 A;  2MZJ A;  3D3B J;  4I56 A;  1RWW B;  4YUD A;  2VFT A;  2YKM A;  4YR3 A;  1DAX A;  3IG1 B;  5KFV A;  3EX7 B;  2YWG A;  4K50 A;  2PFF B;  3OPK A;  2FB0 A;  4Z37 A;  3PW7 A;  5CAA A;  4FF1 A;  5ETQ A;  3GG1 A;  1RYS A;  4NRU A;  3J81 Y;  1S1X B;  3CJQ A;  3PRB A;  3M6V A;  1PJ7 A;  4KQZ A;  4DV0 J;  2V8H A;  1HNX F;  3HUL A;  1MNE A;  3PRD A;  4MJK A;  1Q78 A;  3ULH A;  5BYR A;  5HQ8 A;  1SJ3 P;  1VRQ C;  4PQU A;  2LQ9 A;  3OR1 B;  3ZZT A;  1IQT A;  1JLF A;  3UFC X;  2LVW A;  3TRG A;  5ETK A;  1S6P B;  4DUZ J;  3M6U A;  2XCA A;  4DV2 F;  4DQQ A;  2BBE A;  3F0N A;  4NX9 A;  1GXU A;  3ET6 A;  4HAC B;  2OEL A;  4RW7 A;  1S0M A;  5IV3 A;  1X60 A;  3MCO A;  1D9D A;  5GAH I;  3H5U A;  1O6X A;  5JJB A;  5BR8 F;  2HIQ A;  3AOA A;  4LF1 A;  4JI3 J;  3UD4 P;  3M2U B;  1KKH A;  1HBN A;  1HBU B;  2OEJ A;  3RAX A;  4RBU A;  3R7S B;  1NJZ A;  1QSY A;  3NGS A;  3TZY A;  2R2T A;  4IFY B;  2EW9 A;  3RR7 A;  2GHP A;  3RRK A;  2ZH4 A;  1T3O A;  3TUJ C;  2L08 A;  5KFZ A;  1EP4 A;  2IJR A;  3EZU A;  3LW5 C;  1P27 B;  4LR7 A;  2CPX A;  3MD3 A;  3Q8U A;  3FCV A;  4USH A;  2HND B;  2B9Y A;  4CYU A;  3D6M B;  3BKT A;  1IKW B;  1T9T A;  4USK A;  4F25 A;  3T3F A;  3TNV A;  3U27 A;  4IG0 B;  1U45 A;  1H7W A;  1VRT B;  1FA0 A;  3PW2 A;  4MIA A;  3C15 A;  4NCG B;  1RHU B;  1N52 B;  1IBL J;  4Q8F A;  3GJQ B;  1B99 A;  3DDK A;  1N88 A;  2RS8 A;  4ZPB A;  2EEY A;  3ZZR A;  4ZN3 A;  2D3U A;  3FEZ A;  3KKF A;  7FDR A;  3PIP Q;  3VAH A;  1U47 A;  3MD1 A;  2OTJ S;  2LLZ A;  3DFE A;  4GKJ F;  1GTE A;  2JJ4 D;  1F1B B;  4KHR A;  3D0G E;  5A8W B;  2VKZ G;  4X62 J;  1U1L A;  2HZA A;  4C8Z A;  5E41 A;  5L1J A;  3SEO A;  1WC5 A;  3GJR B;  3I0R A;  3KG0 A;  2I1R A;  2E9T A;  1UW9 A;  2FLO A;  2C2N A;  2IJF A;  1MU2 A;  3BGR B;  4CLF A;  1X9M A;  1Q82 T;  2WSC C;  3GON A;  1EKS A;  1FRH A;  1YRU A;  4GVL A;  2JEJ A;  1QE1 B;  4JI2 J;  1NEE A;  2NXJ A;  3M32 A;  1V3Z A;  2V2Z A;  1IKX A;  3W7B A;  2ZE2 A;  1K1Q A;  4P74 A;  4DCJ B;  4HI1 A;  5KG3 A;  1F9F A;  2AJ0 A;  4DR5 J;  1SJR A;  4O3O A;  2B3T B;  2CUY A;  3BEG B;  3KFW X;  4NI2 B;  4B9N A;  2DNL A;  3GZ7 A;  3NY0 A;  2C3U A;  3BGU A;  4YME A;  1GMW D;  3HXM A;  1R8C A;  5K8P A;  1RWU A;  3CCR S;  4IG3 B;  3OVS A;  1ZZN A;  1VQL S;  4PRF A;  1SH2 A;  2CPE A;  3HT0 A;  3H4B A;  4NLO A;  4OFZ A;  4RW9 A;  3HHK A;  4X65 J;  1TK0 A;  5A8W A;  1IWA A;  1YLX A;  5IC6 B;  3QJL A;  2B7B B;  2OTL S;  2XNR A;  1R8A A;  1SH3 A;  1R0C B;  2VA3 A;  3NBP A;  2C2K B;  4QWD A;  4CCH A;  4DR6 J;  1HQE A;  1U24 A;  1S6Q A;  2DTJ A;  2V4J A;  1RI7 A;  2BM0 A;  2C2Z B;  3EIC A;  5IM0 A;  2EFN A;  2YTC A;  2ZHO A;  5GAG I;  4ELT A;  3AA8 A;  2Y1R I;  2JFD A;  1FRK A;  2NYH A;  2V8G A;  4I2Q B;  5MLC V;  4QW9 A;  4NLG A;  1FD2 A;  3I82 A;  4WBF A;  3O1L A;  3V5R A;  1NH7 A;  1M5V C;  4TYB A;  4O4G A;  2V8P A;  2KYZ A;  1WF2 A;  3NL0 A;  1L3V A;  2N7Y A;  4H54 A;  5T14 A;  1VLY A;  3DOL B;  4LBH A;  5HP1 B;  1E6Y A;  2IJN A;  1EAY C;  2A0F B;  3SMZ A;  4F04 B;  2QL5 B;  1ACM B;  4U67 Q;  5LSR A;  4LUB A;  3Q8Q B;  1VRU A;  2A18 A;  4RW4 B;  2KHD A;  1OSD A;  1RAD B;  3GCX P;  4DSJ A;  5J2M B;  4OYW A;  1MLA A;  3NLC A;  1TTH B;  4DFP A;  2H1Y A;  3EJM A;  3W9J A;  2B56 A;  4ELV A;  4Q0B A;  3KK3 A;  1SI9 A;  4KT0 C;  5K20 B;  4KH0 B;  4ZIW A;  1TFW A;  1WG1 A;  2B9E A;  5KFA A;  1HQU B;  2Q66 A;  3R2D J;  3G82 A;  3SI8 A;  1YTY A;  2DGV A;  4W90 B;  1OIA A;  1NHK L;  2DRA A;  3S8S A;  1F3F A;  2M7S A;  2X7I A;  5D15 A;  4DMZ A;  2E9R X;  3E2E A;  2NYI A;  2XHW A;  1VC5 A;  1EJ7 L;  3Q83 A;  1U8W A;  4PG4 A;  4EFA C;  3KLG A;  3CC7 S;  4V19 X;  2BX6 A;  2O66 A;  3UNG C;  3TWZ A;  1D3W A;  2XMJ A;  2ZKT A;  1WHW A;  2HS4 A;  3KJV B;  1R0A A;  4CZC A;  2HHV A;  1V9O A;  4RL1 A;  4JI8 F;  2VQE J;  3KJN B;  3LH2 S;  1RDR A;  2W2Q P;  3LAL A;  5E3Q A;  1K0T A;  1OYD A;  2DGO A;  4IOB A;  1WAC A;  5AE1 A;  2XGQ A;  2FQQ B;  3CCQ S;  4LF9 F;  1N5T A;  1IM6 A;  1CS4 A;  1RTJ B;  2WVC A;  2HMI B;  1XNR F;  2E9Z A;  4M5J A;  2EFV A;  2YNG B;  3MM7 B;  3PYF A;  3GJS B;  4X84 A;  3UQS A;  2Y8Y A;  2BAN B;  4HHH A;  1AUS L;  2ADB A;  1H38 A;  2V8V A;  4IG3 A;  2R8I A;  3MCS A;  1XR7 A;  4JI3 F;  1MWQ A;  1RTI A;  3RG6 A;  3P3D A;  3D28 A;  4F4X A;  5DJB A;  3TAP A;  4CM2 A;  3V81 B;  3EGN A;  3F41 A;  2IBK A;  2MJN A;  4NLX A;  5EWE A;  4K4W A;  5J2N A;  3KJF B;  1JQG A;  4DPU A;  2J6T A;  1REV B;  3DNC A;  3MMB A;  2CPF A;  2D7S A;  4GO7 X;  3AOD A;  3PJX A;  4LMZ A;  3QIP B;  2WOM A;  1XR6 A;  3L7U A;  3QNW B;  2KTQ A;  1O8B A;  2QT7 A;  3AOC A;  3TQE A;  2DBB A;  2RRA A;  1U0S A;  5M2U A;  4X65 F;  4O44 A;  1RGV A;  2KDO A;  2ZBI A;  3ZO7 A;  3AQO A;  4ES1 A;  1FRI A;  3O6Q A;  1PCA A;  3JAM U;  1NKB A;  1CPZ A;  4DS4 A;  1HMV B;  4WKY A;  3SCL E;  2OIH A;  3OR2 B;  4UOH A;  3M8Y A;  2DO4 A;  5LMN F;  4Q0B B;  3B82 A;  2WRM A;  4OZ0 A;  3DYA A;  4HTI A;  1Y5N B;  2MQL A;  5HK4 A;  1FJG J;  4ZPT R;  2PEH A;  3SSQ A;  3KMS A;  1GT8 A;  4P2M A;  4ZLP A;  5HBM A;  3N28 A;  4QWA A;  1YBT A;  1F2H A;  5IT4 A;  4PUO B;  2VJV A;  3KUE A;  1GXT A;  4JI1 F;  2RNE A;  1WOR A;  2WBR A;  5L39 A;  1KHW A;  3EZO A;  2HHP A;  5D0G A;  4DX6 A;  3V4I B;  2GVZ B;  4D3G A;  5KFO A;  3TR5 A;  1KDN A;  3BN4 A;  4O4G B;  3TI0 A;  2OH2 A;  1MW7 A;  1GK8 A;  3FBB A;  5E3C A;  1N0U A;  4H4O B;  4HH1 A;  1Y4Z B;  4M5D B;  5D0E A;  3HD1 A;  2FHJ D;  1AT1 B;  2MKI A;  4I2Q A;  2DCU B;  4O23 A;  3OXF A;  4U96 A;  1RKJ A;  1YVF A;  1HBU A;  1CJV B;  2P2C B;  4KY3 A;  5C42 B;  2AT1 B;  2AU0 A;  4BLG A;  5A2Q U;  3P5T L;  5DGA A;  2BQR A;  3PHT A;  4OV6 A;  3TYT A;  5DDO C;  2Z56 B;  4TU7 A;  3BJY A;  1QSS A;  4U7U K;  1FTR A;  3GYN A;  1YGY A;  1H7X A;  3FCH A;  3ENA A;  3OL8 A;  3F73 A;  2BKN A;  4KTQ A;  1DAR A;  2LA4 A;  3D6T B;  2V2V A;  3GIM A;  1XTZ A;  1RZM A;  3PZP A;  1V3R A;  5B0A A;  2XY6 A;  3HHD A;  3ILJ A;  1U1Q A;  5DG7 A;  1NXI A;  2HW3 A;  2EWH A;  4FYX B;  3MEE A;  1V6H A;  4QIV A;  1FWL A;  3S7R A;  2JEF A;  4G1Q A;  3S01 A;  5A76 A;  3ZTR A;  3PX6 A;  2BQ3 A;  1BE4 A;  2XMA A;  2HHW A;  2KHC A;  2A10 A;  2MB0 B;  2QLX A;  2ZDO A;  1RBO B;  4TXS A;  5E7O B;  4F3Q A;  4QIE A;  1U0H B;  5KG7 A;  1G2E A;  5D0H A;  3SFG A;  1Q1K A;  3JQJ A;  5A0Y B;  3NAH A;  4WU3 A;  5B0E A;  2BM1 A;  3LOU A;  3US5 A;  5CD4 H;  3R1H A;  4FNI A;  1MRO B;  1T0T V;  4HHJ A;  5HRO B;  1HR0 J;  1YWX A;  3CGI A;  2ZJP Q;  1T95 A;  4K2J A;  4ETZ A;  4MKB A;  1U1K A;  4TN2 A;  3KHH A;  2GFF A;  1RHR B;  5C5J A;  3A4T A;  2XM3 A;  5M2P A;  4DV6 F;  1BC6 A;  3W9I A;  4AXI A;  3RAQ A;  2MZR A;  2HHQ A;  4P71 A;  3SCJ E;  3TZW A;  2B51 A;  5CYM A;  2VIC A;  4KSE B;  1VQM S;  1IBK F;  1NAQ A;  1U8S A;  2XMT A;  3T6J A;  5A8K A;  5GMK a;  2CVE A;  1U1O A;  2DNG A;  1B70 B;  2BE9 B;  3G96 A;  1WC6 A;  4ES3 A;  2DRB A;  1NUE A;  1QUP A;  3N6N A;  2D41 A;  1Q0N A;  1B7Y B;  3D6F B;  4DV1 F;  1U25 A;  4IDK B;  1N5S A;  1SH0 A;  1WI6 A;  1CJV A;  2GS8 A;  4P2F A;  5C42 A;  2CDR B;  3K5N A;  3WC2 A;  2RHQ B;  4L6V 3;  3QZ7 A;  2XB2 D;  3F44 A;  3CCT A;  4FDF A;  2M0G B;  3AFG A;  2JFK A;  5A8R B;  2R9L A;  4DQP A;  4B17 A;  5F8J A;  2IMW P;  1KP6 A;  1SIW B;  1Q8B A;  3DI6 B;  4NPO A;  3IAM 9;  3M2V A;  2EI5 A;  4X64 F;  2C2M B;  4CLT A;  4PWD B;  3PYD A;  2UUC J;  1Q86 T;  5E3A A;  3PR5 B;  3I32 A;  3IRX A;  4C8Y A;  1FK9 A;  3PW5 A;  4ZPD A;  2FHK A;  2HFV A;  2HNY B;  4ZP6 A;  1UCN A;  5MAO A;  5CXT A;  1FJE B;  4ECQ A;  2RRN A;  1J5O B;  2ACY A;  4OHX A;  3M1V A;  3T1Y F;  2BDP A;  2QLF B;  4OJH A;  4QYZ K;  3C16 B;  2HS0 A;  2D1C A;  1S99 A;  1P1T A;  4N47 A;  3TAQ A;  3GII A;  4I6W A;  1RE1 B;  4RNH A;  4RWX A;  3MEC B;  1EET A;  1EKR A;  5L46 A;  2GML A;  1CJU B;  1XC9 A;  2K7K A;  1E6V B;  1HHS A;  1FKO A;  3IM9 A;  5B09 A;  4I0W A;  2B9W A;  2HVZ A;  3DLH A;  1I1G A;  3B6B A;  3BDP A;  4ILL A;  2DY9 A;  2N4C A;  1T9V A;  1VDH A;  3BN7 A;  3VAL A;  5HMY A;  4C0O C;  1S0V A;  2VBX A;  3NP5 A;  5JVG Q;  2CQD A;  3CJ4 A;  2JWN A;  4DL0 C;  3FQK A;  4FN5 A;  3L09 A;  4F7V A;  1KQF B;  3FBF A;  3JSM A;  3TJ9 A;  3H20 A;  2GAH C;  4CLS A;  4OMF G;  4A8M P;  4C48 A;  2R2S A;  4RBV A;  1ZAX A;  1NKE A;  5LXR A;  2R7T A;  3M8S A;  3ITH B;  3O3L A;  2FLN A;  1XR5 A;  4MK9 A;  2ZZT A;  3H5S A;  1HQE B;  1B0P A;  1D09 B;  4PYA A;  5KTQ A;  1PGZ A;  4HKQ A;  1Y9O A;  4AL6 A;  2D3O 1;  4LFB F;  4LRB A;  3UDV A;  2J9C A;  2D9O A;  3WX4 A;  2ROE A;  1RT7 B;  4LJM A;  1SUQ B;  2IPO B;  2DNN A;  2MQ8 A;  2LXI A;  4J9R A;  4DSF A;  1N56 A;  3KK2 A;  4NRT A;  2GQ2 A;  4WF9 Q;  2QN6 B;  5AJ3 F;  2MDA A;  4BCA A;  5CA5 A;  3KTQ A;  3Q8S B;  3HPO A;  2X1B A;  1RT1 A;  2CRL A;  4ZOS A;  2P5V A;  4LR8 A;  3VVT A;  3HP6 A;  3HHN B;  1TUV A;  5HI7 A;  4QCL A;  1P1L A;  1NK9 A;  4CO0 A;  3DRS A;  1W25 A;  2UV8 A;  2XLK A;  2HGN A;  1NK6 A;  3TA0 A;  2QL7 B;  4DUT A;  3W5X A;  4C9D A;  2EC2 A;  3W8G A;  5FD1 A;  3BO2 A;  1GMU A;  2CWK A;  2MJU A;  1NSA A;  1IKY A;  1I5O B;  1EQ0 A;  2E1M C;  5E0O A;  2J0X A;  1OJ4 A;  4PCQ A;  1QAX A;  4OZ5 A;  4LRD A;  2YPZ A;  2J8S A;  2W1B A;  2K7J A;  1IXK A;  1WD6 A;  4MH8 A;  2WB4 A;  3M2R A;  3TJ8 A;  4ZVO B;  1QAI A;  1F2G A;  1OY8 A;  2CNK B;  2WB1 D;  1PBU A;  2MPU A;  3A1Y G;  3I9Z A;  1NH8 A;  3MCM A;  4QWE A;  4X2B A;  3AQP A;  3QAT A;  3UPF A;  1R27 B;  1G6B A;  3DRX A;  3W66 A;  4CNZ A;  1J5E J;  2C3P A;  1X5S A;  3RW6 A;  2GJ2 A;  3N79 A;  1RYR A;  5FDL B;  2HND A;  2LCW A;  3EVM A;  3GIK A;  3UDE A;  3AXM A;  3BBC A;  1KC8 T;  2CJX B;  3MOZ A;  4ZLJ A;  2ZUA A;  2MQO A;  1VQ8 S;  1FNO A;  5GAD I;  2PEB A;  1Q5V A;  2DR7 A;  1HI8 A;  3M8P B;  4J9O A;  1VGY A;  5BJR A;  2FJV A;  2HAF A;  4DS5 A;  1RT5 A;  3FSX A;  2M8H A;  3AHP A;  4QIW D;  5KFL A;  3R8Y A;  2DPJ A;  2V9K A;  1JLQ B;  3BSC A;  3CJ8 A;  3IAS 9;  4F4Z A;  1RTI B;  2MTL A;  1BQN A;  1F0X A;  2PII A;  3QZ8 A;  5E3R A;  3H5X A;  2HVH A;  3J7Z 5;  4P72 A;  2VQE F;  4I7F A;  5L1K A;  3V6H A;  1JJH A;  3GFX A;  5IZH A;  2NQP A;  1UEV A;  5KG0 A;  3DC2 A;  4DPX A;  3ZZO A;  5KT2 A;  2V50 A;  3PVX A;  1XIQ A;  1LW2 B;  1MN7 A;  3I5A A;  4B3O A;  1CLF A;  3IWX A;  5F8I A;  1KLM A;  4NLD A;  1NO8 A;  5SUH A;  3VF0 B;  2Q79 A;  3MFI A;  1I6J A;  2DIT A;  3T9N A;  4OX6 A;  4C6A A;  3OL6 A;  2R7U A;  1UWB A;  1FEE A;  5C7P A;  2FVR A;  4Q2M A;  1HYS B;  1H72 C;  3BV8 A;  2D3Z A;  4OL8 A;  1L3K A;  1YX2 A;  1C1B A;  2A3J A;  4LRF A;  2OML A;  4O3Q A;  2CPY A;  3HFV A;  2IBO A;  3KLH A;  5I4M A;  2AYM A;  2ASY A;  1VR6 A;  3HCX A;  4J9U E;  2G9O A;  4OZJ A;  5HMX A;  5L38 A;  5GAE U;  2UUC F;  2HLT A;  1RHK B;  1JNZ B;  2KH9 A;  2MZT A;  2VFV A;  4P6Q A;  1P6T A;  1HBM A;  3J7A 1;  3R6G B;  4OYX A;  5KFU A;  4RUC A;  2K3I A;  2MKS A;  3VV2 B;  2R2U A;  2KFZ A;  3CC2 S;  1UVL A;  4E8U A;  2DGS A;  1YHQ S;  2XY7 A;  2EKN A;  1YJ7 A;  1C1C B;  1N4L A;  1EX8 A;  3H59 A;  3HHL D;  2VJU A;  1JMT A;  1TKX A;  1TV6 A;  3FGV A;  1XJW B;  1S77 D;  1HPZ A;  1RHJ B;  2IVM A;  2KRR A;  1X5T A;  2DIU A;  3NWG A;  2B8Q A;  1HWU A;  2VOP A;  4B3R J;  1WC3 A;  1VJQ A;  4CLL A;  3PRV A;  1IKV B;  5IWA F;  2UUT A;  2ZFH A;  3MEK A;  2DGU A;  2M3D A;  4QIF A;  1DLO B;  1JWW A;  4DV4 F;  1PSD A;  4ZCK A;  1CSJ A;  1HHQ A;  1C0U A;  5HJY A;  4DSE A;  3B4M A;  5KT4 A;  2XEX A;  4A8W A;  2NPI A;  5C24 A;  1EP4 B;  1EIY B;  3GV7 B;  1PAU B;  4OHZ A;  4KAI A;  2GIR A;  4A48 A;  1R0A B;  4OI4 A;  3BYP A;  4RO0 A;  2MHN A;  3E3X A;  2FJD B;  3HHE A;  2V68 A;  2VPW B;  1KLN A;  2OFH X;  2DHX A;  2J7K A;  3DLG A;  2V69 A;  2ZH7 A;  3SCK E;  1DZ5 A;  4N76 A;  2CJ9 A;  2D69 A;  2JSX A;  2G2Z A;  4WWS A;  3MEC A;  1BWE A;  5I42 B;  1VI7 A;  1Y5I B;  4JV1 A;  3N5B A;  4GKK F;  4JI2 F;  4USJ C;  2R8G A;  3FMW A;  1JXE A;  3W8P A;  1H2T Z;  2BYC A;  2JVO A;  2MKH A;  4HVZ A;  3PV8 A;  3GTY X;  4L75 A;  4C7Q A;  4LRC A;  1XN9 A;  2LEA A;  1UVN A;  1EAR A;  1AZS B;  1M0S A;  4AQY F;  4DR3 F;  3IRX B;  1SVD A;  2GHV C;  3OD2 A;  1F60 B;  4L3K A;  2V94 A;  1WTB A;  4HDG A;  1U1P A;  2RUG A;  2DHA A;  3IR5 B;  2XMU A;  4G6V B;  4USW A;  1LW0 A;  4PWD A;  1OQ3 A;  3M2V B;  3KG1 A;  4PPD A;  3THP A;  5LSO A;  1PIE A;  4N8O A;  4RUH A;  2N7C A;  3THV A;  1FDD A;  2XHC A;  3QGI A;  1LWF B;  4CQ1 A;  4PAB A;  2V4Q A;  4B3M F;  3KOA A;  1VIO A;  2ZC3 A;  3H7H B;  3R7B B;  2H3E B;  3E8O A;  4JOU A;  4OHV A;  2VIH A;  1T02 A;  4MFB B;  2UP1 A;  3QGP A;  3DM2 A;  2CQ2 A;  4C3K A;  3OXG A;  4ZKA A;  4J9V A;  1ICE B;  3ILI A;  1JXV A;  2DGX A;  3QIP A;  5AT1 B;  2IDE A;  3U7J A;  4PPZ A;  4Y00 A;  3IO1 A;  3SBM A;  4DFJ A;  1TK8 A;  2FJW A;  4OX9 J;  3BO4 A;  4DLG A;  3OFH A;  1RTH B;  2Z2Y B;  3Q23 A;  4N8N A;  4YOE A;  3A8I A;  4X4Q A;  1NB7 A;  3CDU A;  2MYF A;  5IQ6 A;  2PSZ A;  1URN A;  4LRE A;  2F40 A;  1LWE B;  4C4W A;  3HVT B;  1A6L A;  5DO2 A;  2ZH2 A;  1LW2 A;  1Q8K A;  2PA8 D;  2WSE C;  4P73 A;  2MGZ B;  1RAG B;  4TNO A;  3MUV P;  4JP8 A;  3TAM A;  2YNG A;  3PO4 A;  4NXM J;  2LA6 A;  4M5H A;  2HSE B;  5KT5 A;  3TOQ A;  4AE5 A;  4FBU A;  1SC1 B;  3SYZ A;  2EKY A;  2G13 A;  3DKD A;  5A0Y A;  4C8K A;  1AUD A;  1HNI B;  1UZH A;  1RT3 A;  2O01 C;  4DV1 J;  4XK8 C;  2B9X A;  2RSQ A;  3ONQ A;  3A3P B;  1LKZ A;  1SKS A;  3JYT A;  2POK A;  1WDT A;  4WYW A;  4DZ6 A;  1CJU A;  4DFK A;  2W9A A;  2FHJ A;  2GO8 A;  4BDP A;  1RHQ B;  1VIS A;  4RUA A;  2CJA A;  4EO6 A;  4A8Q A;  4M5G A;  4ZPW R;  3LP1 A;  3HFZ B;  1VQ6 S;  2LQ8 A;  3MM9 B;  4LF6 F;  2W4C A;  3FRZ A;  4CLZ A;  2DXF A;  1VOM A;  1WSR A;  4DJB A;  1N34 F;  3TX8 A;  2Z30 B;  3QT6 A;  2CQI A;  2MZQ A;  2RIJ A;  4ITS A;  1WF0 A;  1VCT A;  4OQJ A;  3W62 A;  1PJ5 A;  3C15 B;  2YWE A;  2E5L J;  1U26 A;  3ENW A;  3DLE A;  2VBZ A;  4Y2C A;  5IT0 A;  3AY0 A;  3OV7 A;  1L3T A;  4ILR A;  3RR8 A;  4LSN B;  3RBX A;  2CZV C;  1JB0 C;  1S97 A;  4NXN F;  3QRQ A;  3MM5 A;  2CZ4 A;  3MDF A;  4ED5 A;  5CCL A;  2WVE A;  2UXB F;  3JSY A;  3FDS A;  4MK7 A;  1O0P A;  2GHW A;  2OSR A;  2HS3 A;  2YKM B;  3GV8 B;  2GGP A;  4USM A;  1R0B G;  5T7L B;  4CH0 S;  4RW8 B;  1VK3 A;  4ZCL A;  5THW A;  2MZS A;  1TK5 A;  2D3O R;  1KFS A;  3BBB A;  5HAO A;  2GO9 A;  3DRY A;  3N0V A;  5B08 A;  2V2Q A;  4M94 A;  3X1L B;  3DLE B;  1WC4 A;  2LMI A;  3TW0 A;  3TX0 A;  2DGQ A;  1FD8 A;  3E01 B;  4ZN1 A;  1HBN B;  4WP3 A;  2X1F A;  3Q0A A;  3THT A;  3PYG A;  2YNI A;  1EZZ B;  4AND A;  3R5B A;  1XWL A;  2IDL A;  5HAT A;  2DRD A;  1NJI T;  2C42 A;  1BQX A;  3RTV A;  4B3M J;  8AT1 B;  1XEZ A;  1K44 A;  1U1M A;  3ET6 B;  4HAC A;  4RW7 B;  2MLX A;  4AXJ A;  1TMM A;  1I94 J;  1N32 F;  3KLI A;  3KLE A;  4WP8 A;  1Q7Y T;  4W98 A;  1VQP S;  4E2F B;  1SCJ B;  3I31 A;  4O0I A;  2QIF A;  1NK5 A;  1UL3 A;  4PWW A;  1OWX A;  1NLK L;  2WOM B;  2XI3 A;  1AB8 A;  3MMC A;  2E1R A;  3DRR A;  4OX9 F;  3D66 A;  4IYQ A;  1P8G A;  2AF6 A;  4WIQ A;  2WCX A;  4RNM A;  3OLB A;  3LUY A;  1DTT A;  1MG7 A;  2RT3 A;  3PFE A;  3ZFV A;  4L72 B;  2OEK A;  1IR0 A;  1VHI A;  3UCG A;  4DL6 A;  1ULR A;  1VIX A;  3IN5 A;  2XYP B;  3MMC B;  2LDY A;  1NZA A;  2XMW A;  3A8E A;  4H4K A;  4HR2 A;  4BHQ A;  1VQO S;  2AYB A;  3OTO J;  2BRK A;  3D67 A;  1AYE A;  3D1O A;  4KKO B;  2FLL A;  2QE5 A;  3W2V B;  2QEX S;  2AJQ A;  3TAR A;  4B9U A;  4B9S A;  2N3O A;  4IO9 Q;  3H2V E;  5FJ4 A;  2HWI A;  3ISZ A;  1PC5 A;  4ZPV R;  5KFK A;  4DR3 J;  2XLJ A;  2NPF A;  2IM3 A;  3LP2 A;  2ZDP A;  2EG2 A;  3P96 A;  1S7I A;  4CP5 A;  4CDI A;  4ID5 B;  3C16 A;  2DNQ A;  3AD7 C;  1NDK A;  2ASJ A;  2L9D A;  1N6Q B;  2UXC J;  4KJI A;  3VVU A;  1FES A;  4IG0 A;  4OI1 A;  3CCM S;  1MMN A;  1R6V A;  2EG1 A;  1M5P C;  2FY1 A;  5AE2 A;  5HJX A;  2BJ3 A;  1JLG B;  1VQK S;  5IT9 U;  3OQ2 A;  4PEO A;  4F0K A;  4DL5 A;  2G1H A;  3DGP A;  4I67 A;  3HX9 A;  5D77 A;  5C25 B;  3KNA A;  1X8D A;  3QSI A;  2ZC4 A;  3T6B A;  2IAJ A;  2APO A;  1EHW A;  1NPR A;  1WC1 A;  4OJ3 A;  4AQY J;  3IBC B;  3BR9 A;  1KSP A;  4CRJ A;  1JLA A;  3JXO A;  1R43 A;  2NUH A;  1VQY A;  1TKT B;  2BKP A;  4A47 A;  1IUJ A;  1F9H A;  2CAJ A;  3LP0 B;  4CNY A;  4DI6 A;  3T5J A;  3DXB A;  3MAA B;  1RWX B;  2HIY A;  3MAH A;  1S1U B;  5J2P A;  4M5I A;  2OPR B;  4NE9 C;  2W25 A;  4LFC F;  3V2U C;  2A6O A;  2P9E A;  1T05 B;  3MTK A;  4BC9 A;  2DCL A;  3A3N B;  3HFK A;  3KYL A;  1J5O A;  1WHY A;  2YKQ A;  1UVK A;  2R3V A;  3EGW B;  5CQG A;  3G4S S;  4M95 A;  4HHU A;  1XNQ J;  4DX8 H;  3NMR A;  3W1Y C;  3CIM A;  3KDO A;  1X4E A;  2DNM A;  2KO1 A;  1OO0 B;  4K8R A;  5E5N A;  3ZZ0 A;  3TUZ C;  3CJT A;  1IVZ A;  3AB2 B;  1K9M T;  2VOO A;  2DH7 A;  1C2P A;  2W2P P;  3KLH B;  1PAE X;  2DD8 S;  1FO1 A;  2H51 B;  4P10 A;  3A8K A;  4M5D A;  1N33 F;  1YG0 A;  2H5E A;  2WBM A;  4K4X A;  4ER8 A;  4KC5 A;  4ZVS B;  4QR2 A;  3VAM A;  1X4C A;  2V4J B;  2VF3 A;  4I6A A;  2W4P A;  3SQO P;  5IM0 B;  2W8K A;  1W2B R;  3OSN A;  2GNK A;  1OS5 A;  3GCW P;  4B3R F;  4J7C A;  2YWW A;  5G4D A;  1HD1 A;  2ROP A;  2V2K A;  3C8Y A;  1Q4R A;  3FVY A;  3PXG a;  3J7Z T;  4ED1 A;  2HWH A;  2AGP A;  1SB6 A;  3CMA S;  3G6Y A;  1CJT A;  4I7F B;  1WEZ A;  2HGL A;  4KV8 A;  4DG1 B;  2KZM A;  4QBU A;  2EBE A;  2FVP A;  4F8R A;  1HWI A;  2E5H A;  5HVH A;  1SIZ A;  2YNH B;  2W7O A;  1K1S A;  2ERR A;  1M1G A;  4OHY A;  4F4W A;  3HO1 A;  2IFX A;  1M5H A;  3VAF A;  3BGO P;  4IFV B;  3UCZ P;  5LMU F;  4F26 A;  3MR7 A;  1FHT A;  1LV5 A;  1Q16 B;  1UJ6 A;  1U2R A;  3GB0 A;  3DRR B;  4M5M A;  2JOQ A;  2ZD1 A;  4F2S A;  8ATC B;  2PD1 A;  1GX5 A;  1KQK A;  2DHS A;  1GX6 A;  1E6V A;  1M90 T;  4TLR A;  5IQQ A;  1PYS B;  1VK8 A;  4B02 A;  3CB4 A;  3JB9 k;  3ZNJ 1;  2NZ4 A;  2ATC B;  1TKZ A;  5D4P A;  5G0R B;  4DV7 F;  1JJ2 R;  1FXD A;  1OY9 A;  1LXJ A;  2BJ7 A;  3GSI A;  2QL9 B;  3R3T A;  3GQC A;  1XNQ F;  3W2W B;  3M9M B;  1M1H A;  1S6U A;  4ECR A;  2VZ9 A;  1RAE B;  3CT9 A;  5EN1 A;  5EUH A;  3PR4 A;  3CF5 Q;  1FTC A;  1AA1 B;  2RH3 A;  2HNY A;  3GR0 A;  4X66 F;  2QA2 A;  1IKY B;  1LOU A;  4L74 A;  4B9L A;  3A8J A;  3GPA A;  2QV6 A;  5K9F A;  3BKF A;  2MKY A;  4Z7Y A;  4CYU B;  2DVI A;  2UUB J;  1S1W A;  1D9A A;  2NXU A;  4CLW A;  2HHX A;  2XSJ B;  4UF4 A;  3VAG A;  2ZOF A;  3UCU P;  4RU9 A;  2U2F A;  2VFR A;  1N5Y A;  5A8R A;  1JLG A;  4XTT A;  1KRP A;  1GAO A;  3UDC A;  3CCS S;  4YB6 A;  3SV3 A;  1RT2 A;  5KFE A;  4DQS A;  4KGM A;  3DGP B;  1CUL A;  1B0V A;  2YX7 A;  1IBM F;  1SPB P;  4NAS A;  2BJE A;  2B6A B;  2W4D A;  4QOT A;  3ILL A;  2PMZ D;  1B64 A;  1FWP A;  2OMO A;  4YDD B;  2AP6 A;  1WUU A;  5IFM A;  5KFS A;  1ELO A;  4CWB A;  4DR2 F;  1KR4 A;  2ZBQ A;  1JLE A;  1RJJ A;  4LR9 A;  3RB6 A;  4EYI B;  1T9X A;  1YSJ A;  3NS6 A;  4ED7 A;  1KFD A;  2KL8 A;  4RW9 B;  1AXQ A;  3GG0 A;  1NK0 A;  4B3T F;  1R3N A;  2Q43 A;  3MFH A;  3K57 A;  2OGU A;  3Q86 A;  4DCO B;  2UUA J;  1KOH A;  3K89 A;  4LSL B;  3IS9 A;  3U1M A;  3LP2 B;  4U6P A;  4LF8 F;  1QAY A;  3JSR A;  4DUY J;  2ZJQ Q;  2KI2 A;  3N5F A;  2DY1 A;  4P9S A;  3J7Y I;  1SL1 A;  4OZL A;  1IN0 A;  1U6F A;  2VG5 B;  5HVF A;  2WHO A;  1DQ9 A;  5T7L A;  4DF4 A;  1T3N A;  1RA7 A;  2CPI A;  2JRS A;  4ICL A;  4OYM A;  1YIT S;  1FRX A;  2HHS A;  1S9E B;  1QTM A;  2F63 A;  4PG5 A;  2VU5 A;  4O44 B;  1HBM B;  5IS2 A;  1HNI A;  3LWM A;  2I6W A;  1B7F A;  1YJW S;  4RNF A;  4PR6 A;  4ANE A;  1TL1 B;  3N4W A;  2FZG B;  4QR1 A;  3RZA A;  1ZOT A;  1HWL A;  5KG6 A;  4NEY A;  2OD4 A;  5LJ5 Y;  1YJV A;  4N41 A;  1WWH A;  4KE5 A;  4LFA J;  3KHG A;  3MOJ B;  4C2M A;  2CQH A;  3T1H F;  4FYY B;  2O67 A;  5DLG A;  3FNN A;  2ZHA A;  3HHL C;  3J7A N;  4R5P A;  2GVD A;  3BBF A;  4MIW A;  2L9N A;  1IBL F;  1N32 J;  1NSK L;  1RLD A;  4ZDN A;  3O2I A;  5KG5 A;  1NRK A;  4FZV A;  4J37 A;  2I9S A;  2YVS A;  2V5H G;  2DNR A;  3EUN A;  2YQ1 A;  3JSB A;  1T9Y A;  2XNQ A;  5D4N A;  5HQL A;  3BQ1 A;  3VZI A;  2R8J A;  2B6A A;  3AAW B;  2F4V F;  1ZH5 A;  5F8N A;  1FRL A;  1ZZF A;  1RTZ A;  3AJD A;  3AB4 B;  2CG8 A;  1FWK A;  2EVZ A;  2XMV A;  3BF4 A;  4YB7 A;  4X4R A;  1RT3 B;  1PKU A;  2H48 B;  3H2U B;  3MCN A;  1XK8 A;  2XSJ A;  3T19 A;  2UVW A;  2HFS A;  1ZET A;  3DLK A;  3UWT A;  2YKN A;  2ZH1 A;  3KLG B;  1DY3 A;  1WG5 A;  3FEX B;  1XBW A;  2GIF A;  2C2E A;  3P49 B;  2WVF A;  4TQR A;  2KXF A;  3BQ0 A;  2DNH A;  4C3L A;  5KFY A;  1N6Q A;  4F4Y A;  1LWE A;  3C6U B;  2UVU A;  5U47 A;  5DQH A;  5J1N A;  4LQ9 A;  3SQG B;  1WHX A;  2BJD A;  1JJC B;  1FDN A;  2CVI A;  2FHM A;  3O44 A;  3ZTQ A;  4DUZ F;  3W61 A;  4IRK A;  2XS5 A;  2BJ1 A;  2GA7 A;  4WKR A;  1Q79 A;  2GJF A;  4H4M A;  3K5O A;  3M6X A;  2J0W A;  3QT7 A;  3VR1 A;  4CT8 A;  4P2X A;  2ATL A;  2OJ3 A;  4X64 J;  1NPP A;  2HHT A;  2PMH A;  3MTJ A;  4KKO A;  5J1E A;  4TVA B;  3EXC X;  4UOC A;  3CE8 A;  3G6V A;  2R7R A;  1HNW J;  2QFI A;  3VTI A;  4EEY A;  2UXD F;  3OTC A;  4UY8 T;  1KNZ A;  2B4V A;  1VFJ A;  2J7U A;  3TUI C;  3MM8 A;  4MYT A;  1FJG F;  2HQG A;  1X0P A;  1YJT A;  2R7S A;  2NUU G;  4UT4 A;  3K0J A;  4DV5 F;  1D9F A;  2QGF B;  4FYD A;  3BGF A;  4IQM A;  5KT6 A;  1HW8 A;  2BV3 A;  1JLB A;  1VQ9 S;  3IBF B;  1LFW A;  3PNI A;  1J2V A;  2FUG 9;  2EC0 A;  3RB3 A;  1YI2 S;  2VL1 A;  2AJ4 A;  2B4U A;  3HVT A;  3BSN A;  1IBK J;  3W64 A;  3RRH A;  1HNV A;  1TKX B;  5KT3 A;  2AYE A;  2M88 A;  4OYA A;  1TZ0 A;  4G65 A;  4IOA Q;  4JI7 F;  3AOB A;  4WE1 B;  2RRB A;  3H42 A;  4WII A;  3W5Y A;  3CDA A;  1F5A A;  3OL7 A;  2KG0 A;  3CJR A;  4M8L A;  4R5P B;  2HBQ B;  2BE2 B;  2Z4P A;  4XPC A;  3RRG A;  2XWX A;  3TVZ A;  2MMY A;  5F3Z A;  2B7C B;  2KT3 A;  4ED0 A;  1DBD A;  1HNW F;  4JI4 J;  3DLG B;  1F3V A;  2VC0 A;  3GIR A;  3LP1 B;  5KOX A;  2RF2 A;  2GV1 A;  2VUG A;  2YX1 A;  4I2P A;  4LIR A;  2YWF A;  4QR0 A;  3PIO Q;  1T03 B;  4DOZ A;  2DK2 A;  3G6E S;  1YZ6 A;  1PBA A;  1M5O C;  1R8H A;  2GGP B;  1TU0 B;  4LF2 A;  6AT1 B;  2CZ9 A;  4EWT A;  4K4S A;  4C98 A;  3PJW A;  5HL7 Q;  5L1L A;  4NYP A;  2FGO A;  5EX3 A;  1YBA A;  1NSP A;  3C6T B;  4FKX A;  1SL2 A;  4WZM A;  2HBY B;  4I69 A;  1RU2 A;  2AMC B;  4IFY A;  2AD9 A;  5KOW A;  1VBX A;  1FKO B;  5HN0 A;  3NNA A;  1M5S A;  1IM4 A;  2F8H A;  1WF1 A;  4YP3 A;  4LRA A;  3KK1 A;  2V0N A;  2M4M A;  3JTN A;  1W7W A;  1GMV A;  4DZD A;  5ITH A;  5J2Q A;  1C0T B;  2UVR A;  4QYZ J;  1U49 A;  2HZC A;  5FLX Y;  3RYL A;  1AZS A;  5I42 A;  4GO5 X;  3D5M A;  1WKK A;  4RU2 A;  3ZTS A;  1QTN B;  1J5E F;  2AHO B;  4URQ U;  1ARO P;  4YHH J;  1R7I A;  4FP9 A;  2F7V A;  5JVH Q;  3VAK A;  1SC6 A;  2GX8 A;  3DXS X;  5F8G A;  4YB1 P;  3VAI A;  1TVR B;  4DHV A;  2I5J A;  4NA2 A;  4F50 A;  1V5I B;  1ZTT A;  4JI6 F;  2DKO B;  2HK2 A;  2X3G A;  3N6M A;  1C1B B;  3QWP A;  5D4O A;  8RUC A;  3CUN A;  1RQ0 A;  2CAD A;  2KRB A;  3OTB A;  2JC1 A;  3T9Z A;  1ZPV A;  3D1H A;  3QQC D;  1UWB B;  4NA1 A;  3GP9 A;  4Y34 A;  1RWK B;  5LSL A;  4ES2 A;  1HWK A;  1VQ5 S;  4XO0 A;  2B4O A;  4ECX A;  4JV2 A;  3IRW P;  4DPO A;  2HKE A;  2ZWP A;  3C14 B;  2ZH6 A;  1S4E A;  2QMX A;  2YKP A;  4P75 A;  3SV4 A;  4P7T A;  2CA9 A;  1JLC B;  5KFN A;  1HR0 F;  4LF5 F;  2G4B A;  1IKV A;  2A6M A;  4OYB A;  4TLQ A;  5LMN J;  2C2R A;  1Q81 T;  2QO3 A;  2XTJ P;  1D0E A;  3EGV A;  2HEK A;  1X5O A;  5D78 A;  4ZPC A;  2MQQ A;  4CTA A;  2CPJ A;  4LVO P;  2HBZ B;  2ROG A;  1FT8 A;  3ZC4 A;  1GTH A;  2F65 A;  3G87 A;  4QW8 A;  3ZTO A;  4J9K A;  3KJV A;  2BA9 A;  4AYB D;  5GMD A;  3VHQ A;  4AT1 B;  2SXL A;  4WFA Q;  3U1N A;  3W60 A;  1WNE A;  1QLN A;  1CEZ A;  3D68 A;  4R8U B;  2HVD A;  2N4D A;  3OJS A;  2HNZ B;  3M9O B;  3UR3 C;  2BW7 A;  3DM2 B;  4IQX A;  4PYD A;  3PW4 A;  3GFZ A;  2BW2 A;  4QWC A;  4DL4 A;  4OJG A;  2J9D A;  2IYI A;  4J9P A;  3MED B;  1FKP A;  2PFD A;  3QLH B;  4ATN A;  1P9Q C;  3I0R B;  4DV7 J;  1U0H A;  4B3T J;  2CNL B;  3OL9 A;  3GU0 A;  3WBZ A;  2KM8 C;  4B3O B;  3MM6 B;  1FJ7 A;  3T5K A;  5DDQ C;  1ROF A;  3UO0 A;  1KBR A;  2F9D A;  4J91 A;  2GAG C;  2Y8W A;  2CJQ A;  3TEG A;  1WJ9 A;  4L3N A;  2ALZ A;  4JV5 F;  4CTA B;  3ITH A;  2C2D A;  2CQ1 A;  2JDJ A;  2IVF B;  3LP0 A;  1KWM A;  5AXK A;  1VHF A;  2A1B A;  1HAR A;  1VRT A;  5KFP A;  1S59 A;  2KJW A;  2WVD A;  5IT9 Y;  2HFZ A;  2AKW B;  1GFW B;  2OPP B;  1NM2 A;  3GLJ A;  3HSD A;  3NAI A;  5KFM A;  3BO3 A;  1TKD A;  1K8A T;  3DOK B;  4ZLN A;  1SQF A;  3HZG A;  1ZYQ A;  2QZ8 A;  4X62 F;  4DSL A;  4G3I A;  4B08 A;  1RAI B;  2W9B A;  3DMJ A;  2E5J A;  1IR1 A;  2KFN A;  4ECS A;  2MLY A;  5H9F J;  2ZJR Q;  4J9Q A;  1BD6 A;  1HLW A;  1XMO J;  4E0D A;  3D4J A;  4DR6 F;  3G86 A;  4WPA A;  1NDL A;  3TO8 A;  3VZH A;  1S4F A;  5DZ6 A;  4K5S A;  2KN4 A;  1R6Y A;  3CMQ A;  3N9U C;  1RT2 B;  3UR0 A;  3UE2 A;  3R7N B;  1B0T A;  1YDL A;  1EET B;  5EHH A;  3DLL Q;  3M2U A;  2ZH5 A;  4YR2 A;  3MR3 A;  4DUY F;  2HBR B;  4OYP A;  3R6L B;  2OEM A;  4DSK A;  3OVB A;  2IA6 A;  3HLU A;  2W9B B;  2QA4 S;  4PXC A;  2M70 A;  4TYA A;  2YQ0 A;  2MEW A;  3DU5 A;  4OYZ A;  2FC8 A;  1FX4 A;  5HSP A;  4WXO A;  1WOS A;  2L9W A;  4I6Y A;  2E1C A;  1S10 A;  1H6K X;  1RB0 A;  2FLP A;  4Y6I A;  5A6W A;  2J5A A;  2E5L F;  2YNF A;  1TUG B;  1UW4 A;  3UVJ A;  1RBA A;  3MAA A;  4EMD A;  4NI2 A;  3OHB A;  2KYX A;  3T5L A;  2DO0 A;  3KMQ A;  1CBK A;  1IJF B;  1JK9 B;  1JLA B;  4OYI A;  1TL1 A;  2OSQ A;  3PJ9 A;  3SDE B;  4DN9 A;  2Y1J A;  3IM8 A;  3CCJ S;  1RU1 A;  1WEL A;  1U09 A;  5C2G A;  5HAN A;  4Q5V A;  1Q7L B;  1WEX A;  1FXR A;  2XYG B;  3QAU A;  4J5O A;  4DV2 J;  1L3U A;  3QSY B;  4DV6 J;  2QA4 G;  2EBG A;  2WSF C;  4K4V A;  5ETN A;  2XWY A;  1LNQ A;  2XSF A;  2RU9 A;  1SUQ A;  3KUG A;  4U8Y A;  5DS7 A;  1T03 A;  2COL A;  4EZ9 A;  2E5G A;  4JB8 B;  5J2N B;  5KFX A;  3NOC A;  3HKZ D;  3NGU A;  2HRU A;  2MQN A;  3RUB L;  4X66 J;  4DXL A;  5K8M A;  4DV0 F;  1SKR A;  3CTR A;  4LFB J;  2ZBP A;  3D7S B;  1KQG B;  4YB5 A;  1OSC A;  4XIU A;  2YNI B;  5CYM B;  1RAF B;  3M05 A;  3NCQ A;  4PKD B;  4JI8 J;  3TEH B;  4I4B A;  1VS3 A;  3I4H X;  4K5R A;  3H0P A;  5KFB A;  3UI3 A;  2BQU A;  3Q8P B;  1SJ1 A;  2O3D A;  4NXM F;  3CD5 A;  1SV5 A;  1RLC L;  2NSB A;  2QYC A;  3H2L A;  1FX2 A;  1QDU B;  4C11 B;  1CS4 B;  2AJF E;  3R5D A;  5DGB A;  3OTD A;  3C3L A;  1UVI A;  4X4V A;  1BHN A;  4HTJ A;  2BAC A;  5D6G A;  1TMJ A;  3DU6 A;  3K5L A;  4J9L A;  4AL7 A;  4IH7 A;  1FFW B;  2DH8 A;  4TY9 A;  2E44 A;  2VG7 B;  1JLB B;  1SJQ A;  1ZAW A;  2DXD A;  2Z0G A;  1YK9 A;  3EXY A;  3MM5 B;  1HI1 A;  2YH0 A;  5DRK A;  2V4R A;  3TUP A;  2FHO B;  2KU7 A;  4ICL B;  5LMU J;  4Y3C A;  4LFC J;  2VG6 A;  2ZH8 A;  3W3S A;  1NB2 A;  1SQE A;  2VKR A;  3M8Q A;  3GJT B;  3DOM B;  3OTO F;  1NJY A;  1RT1 B;  2HGM A;  1X4A A;  3FSY A;  4LF5 J;  1TVR A;  1QUV A;  2LU1 A;  1ZA2 B;  1D8Z A;  2UXD J;  1S9G A;  2H5I B;  4GC6 A;  2V34 A;  2Y0B B;  3FSI A;  1PJ6 A;  2IA0 A;  1D8Y A;  1RAA B;  3D3C J;  4QPT A;  5BYQ A;  4CLP A;  2XQC A;  4IRD A;  3GIJ A;  6FDR A;  4M5L A;  3MF5 A;  1ZTW A;  3WX8 A;  4JYA F;  4L76 A;  1BLU A;  3BH7 B;  5CCM A;  3Q89 A;  5ADZ A;  1WHV A;  1LK7 A;  1TR0 A;  4NZ7 A;  5J2P B;  2K1R B;  3AH6 A;  1Z2Z A;  5CHC B;  4IR1 A;  4KHP J;  2DNO A;  3GYX B;  3HF5 A;  2PC6 A;  5DM6 Q;  3T1Y J;  3EM1 A;  3PAC A;  2G2Y A;  3EVO A;  3JAM Y;  1VRU B;  4RW4 A;  2HPU A;  3CNQ P;  2DIS A;  3K59 A;  1WDD A;  4JI7 J;  5KFT A;  3AJ2 A;  2UZA A;  4RZR A;  1PIL A;  2CKW A;  4CLU A;  2XS7 A;  2YKN B;  3V4I A;  2VAS A;  4DU7 A;  4URS A;  4OLP A;  3CDB A;  3DMJ B;  4ZIV A;  1HI0 P;  3KLF A;  3VCD A;  3J80 Y;  5KG2 A;  1OMS A;  3MEE B;  2BEF A;  2HFO A;  1DJ0 A;  2IIH A;  2R7Q A;  3H98 A;  4HLB A;  2VOD A;  3D6H B;  1S0O A;  3JQK A;  3R2C J;  3CDW A;  2VBW A;  3EDR B;  4F02 A;  5B0F A;  1Y3J A;  2K8G A;  2AEF A;  2CWX A;  3ENQ A;  2WW4 A;  4U7U D;  4JYA J;  3RBZ A;  3IS9 B;  5L8R C;  5GAD U;  1VBY A;  4ECT A;  1RUS A;  1TV6 B;  4GC7 A;  1LK5 A;  1PYT A;  3U02 A;  3OFF A;  4NXN J;  3OHA A;  4G1I A;  4YFU A;  2WK4 A;  2YKA A;  2PMW A;  3BS9 A;  3OR2 A;  1T9U A;  4WE1 A;  1FF2 A;  5HO4 A;  1G1X A;  3LAM A;  2GVD B;  5ETS A;  1ITP A;  4LQ3 A;  4NLU A;  4KHP F;  4KFB B;  3MED A;  1S6P A;  2X1G A;  3NGR A;  3TVY A;  3HMJ G;  5DG8 A;  3EYZ A;  2R7V A;  1O5J A;  2JLF A;  2RU3 A;  3OVA A;  3DLB A;  2FJB B;  4FXW A;  4UY8 5;  3CJS A;  2GC8 A;  2WZ1 A;  1Y0H A;  4LBP A;  4C3M A;  1I3O B;  4K0K J;  3MWB A;  4Y2I A;  1L3S A;  1S1V A;  4UUX A;  2W7A A;  4HH0 A;  1IKX B;  1S48 A;  2DYA A;  2QLB B;  1UAW A;  1RKI A;  3Q2S C;  1NCL A;  4ZVQ B;  4DX7 A;  1B4S A;  3DGV A;  4B9T A;  2W01 A;  3KHL A;  4ANC A;  2P9G A;  2WON A;  3MUM P;  2RDJ A;  4QQB A;  4UUW A;  1FEH A;  3J7Y U;  1O51 A;  1H2U X;  2HFN A;  1ZPW X;  2HRY A;  3WIV A;  5GAE I;  4F67 A;  3HHL B;  2CYY A;  4URG A;  2CQ4 A;  4UST A;  2VA2 A;  1NDC A;  3HVW A;  4FYW B;  1N36 J;  4HT7 A;  1FDA A;  2DXE A;  3M6W A;  2OO4 A;  4TKT A;  4M63 A;  2IY5 B;  2QX0 A;  1DQA A;  4R0J A;  4YY3 J;  3UN3 A;  1A7G E;  5ETR A;  4YEA A;  1Y00 A;  2RIL A;  3MR6 A;  3I9V 9;  3N01 A;  2J76 E;  5C25 A;  2AV5 A;  3B4D A;  4USI A;  3NGT A;  4XDD A;  4AD6 A;  5CYJ A;  1UTA A;  4X4P A;  1VBZ A;  1NZ8 A;  4ZVE A;  1L5U A;  1UKU A;  1RWV B;  5HRO A;  4UZC A;  3ZZU A;  2I5J B;  2KVQ E;  4WK1 A;  2B0G A;  4DSI A;  5SZT A;  2A2C A;  4LVN P;  1CUL B;  4OV1 A;  5K14 B;  4ZK7 M;  3PG9 A;  1NND A;  1X4F A;  1DLO A;  5C2C A;  4WP9 A;  4HYK A;  2DR9 A;  1UVM A;  1FE4 A;  3NMA A;  4KGV B;  5DZ7 A;  2BVZ A;  2FYX A;  4XAK A;  4A8K A;  4IH5 A;  5KFF A;  2KXH A;  4ID5 A;  1LW0 B;  4CH1 A;  5D4L A;  2ILZ A;  3CWJ A;  2AIR B;  4ZJQ A;  3HI9 A;  2HVI A;  3ICL A;  2AZ3 A;  2G0C A;  3NS7 B;  4MK8 A;  4ECV A;  2AX1 A;  2XBP A;  2JLE A;  1UA1 A;  3CCW A;  3M30 A;  3SXL A;  4K4Z A;  1YQH A;  2FZC B;  2U1A A;  2IRY A;  4DFM A;  2N3L A;  2L3M A;  1UJ4 A;  1ZM4 A;  4USU A;  1HWJ A;  2JLG A;  4OHW A;  1OPI A;  3LA0 A;  4ZPA A;  4KBI A;  2MKJ A;  2ZH3 A;  4DL3 A;  2UXB J;  3RW7 A;  4K4Y A;  1NJX A;  2VPY B;  2OP5 A;  3QRR A;  5IOL A;  3PKM A;  1MRO A;  1DTQ A;  2H4W B;  2DIV A;  4DPY A;  3JYT B;  3MPU B;  2FTR A;  4KO0 A;  3W63 A;  4W92 B;  3M8Z A;  5LL6 d;  2DH9 A;  4ZHR B;  5F9L A;  2QLW A;  2OKQ A;  2V8D A;  1A0O B;  1GMW A;  4Y65 A;  5DQI A;  2BJ8 A;  4S0M A;  3WDO A;  2W9C B;  3G82 B;  2CXE A;  4UZB A;  1X31 C;  2ILY A;  2O1P A;  1F6T A;  2QMU B;  3GE9 A;  4DV3 J;  4ED6 A;  1T05 A;  3QT5 A;  2VFU A;  4LFA F;  2E7X A;  5LT5 A;  1FCA A;  3TZZ A;  5CAB A;  2I0X A;  1S72 S;  2DR5 A;  3BM7 A;  1HW9 A;  5IXU A;  2UUA F;  2DEI A;  4DF8 A;  1JLC A;  1UWA A;  2AW0 A;  3W2V A;  4UQG A;  3E01 A;  4ALZ A;  2WVB A;  3UDL A;  1JJ4 A;  4DCP B;  2PN6 A;  4LSL A;  4F36 A;  4ZVG A;  4OZN A;  1SBR A;  1RT4 B;  1ZM9 A;  1WEY A;  1TP7 A;  2F8E X;  3CME S;  4C8O A;  1GQE A;  2Y9H A;  2G0J A;  2B4P A;  2LFV A;  2XUL A;  3MM7 A;  4DN0 A;  4O3P A;  2R8H A;  3KLV A;  5HP1 A;  1BXN A;  5HLF A;  2B5J B;  3T5H A;  2ZE2 B;  1F5B A;  4PQA A;  4Q8E A;  1DTT B;  1QJH A;  2Z2M A;  4ZCM A;  3RBD A;  3HVR A;  5KFG A;  1LXN A;  4BBY A;  2MST A;  2P6S A;  4A8F A;  2MY7 A;  2W2O P;  4KGX B;  1TL5 A;  2DNP A;  1VQ7 S;  2HHH F;  2Q6C A;  3LGN A;  3JTO A;  4RKU C;  3LAN A;  2HNZ A;  1W26 A;  2J9E A;  2XZT B;  4OYO A;  2XO6 A;  1N36 F;  1DRZ A;  2DGT A;  2EFP A;  2UVV A;  3G9C A;  4FVC A;  1REV A;  3MMB B;  4MKA A;  4B3S J;  2PDA A;  4Y28 C;  1SQG A;  5F3T A;  3OUY A;  2HQF A;  7AT1 B;  1UP1 A;  4ZIT A;  1IBM J;  3MI7 X;  4IOC Q;  1IBC B;  4C8M A;  4XDC A;  2JC0 A;  2YY3 A;  3CVK A;  1OQ6 A;  1X0F A;  3QGG A;  5K8O A;  1FNM A;  2DJW A;  1HNZ F;  4MT1 A;  2HQD A;  4O3S A;  4JI5 J;  2J0S D;  3W9H A;  4WFY A;  4KIA A;  4Q7A A;  1RTJ A;  1BQN B;  2ZOG A;  5HVG A;  2X1A A;  5J2M A;  5AXM A;  3IC1 A;  4DDF A;  2HMI A;  2BXJ A;  1YBU A;  1GXL A;  2RDI A;  2LQJ A;  2VG6 B;  3HDS A;  3JQM A;  3R5C A;  5HQM A;  1IJE B;  3VGV A;  2FPH X;  3MZI A;  2BRL A;  4P52 A;  3V6K A;  2XCP A;  2BOA A;  4DR4 F;  3QFH A;  1H74 A;  4FPR A;  4RBT A;  4TU8 A;  5K14 A;  2MY8 A;  4CM0 A;  1YJN S;  1RAJ A;  1TL7 B;  3P4U B;  5HMZ A;  4MMO A;  3BPD A;  3VGU A;  3W5Z A;  3J81 U;  4BWM A;  2LXF A;  1KVI A;  1VJW A;  4NL5 A;  2E5I A;  4TQS A;  1TAQ A;  3PFO A;  1N54 B;  2KT2 A;  1WG4 A;  2W7P A;  2ABY A;  2CQC A;  1RTD A;  5B0C A;  3I5B A;  4RW6 A;  1NBE B;  2LQB A;  3L7P A;  2JEI A;  3NBP B;  3CCE S;  2R7O A;  1Z2L A;  4ZVT B;  4DR7 F;  2E66 A;  2QSF A;  4H4K C;  5CD4 A;  3RGI A;  3KK3 B;  2W8L A;  5H9E K;  1FJC A;  1H0H B;  4DQR A;  5F8M A;  3PDN A;  3X3U A;  1IKW A;  3QPI A;  2AJ2 A;  2VDH A;  4LF7 F;  3MM6 A;  3DRP A;  3MEG A;  3OT9 A;  1TEL A;  4WYL A;  1S0N A;  3N6L A;  2R2R A;  3CPW R;  3GR1 A;  4OI0 A;  4PAA A;  2ZUG A;  3MM8 B;  3PTW A;  2VD3 A;  2CPD A;  3TA1 A;  3NGD A;  3I55 S;  3DOL A;  2YWK A;  2J8A A;  1HQ2 A;  1N33 J;  2IRU A;  3JS9 A;  5F9N A;  2XZW A;  2M8D B;  1TUW A;  2M2B A;  5K5M A;  4WTO B;  2H5J B;  3M32 B;  3P45 B;  2V9W A;  2M9K A;  1RWP B;  4RJV A;  2RKI A;  1XMO F;  1JXL A;  1XMB A;  1HNZ J;  2FC9 A;  1NK8 A;  2L48 A;  1M5K C;  3I4P A;  3CXC R;  1NHV A;  1MU2 B;  3BGR A;  1N0V C;  1ZBT A;  4GMK A;  4EUV A;  1FVQ A;  5HMW A;  2CJB A;  2CQP A;  4Y0F A;  1RAO A;  1FXL A;  3C6U A;  2MKK A;  1HQU A;  1HA1 A;  1JLE B;  1UFW A;  4EU0 A;  2DGW A;  2CNO B;  2ZZM A;  2JX2 A;  3PX4 A;  1U6B A;  1N8R T;  3EPG A;  2BUN A;  3KXD A;  4OZ2 A;  1YKW A;  1S1U A;  3DDN A;  3VGT A;  4DR2 J;  4DWI A;  4FF2 A;  3LAK A;  4UQT A;  3T41 A;  4ED8 A;  1KEK A;  3H4D A;  2KKH A;  3WIU A;  1ZM3 A;  4ZP8 A;  2BJ9 A;  2RE1 A;  1UPM B;  5D3G B;  2CPZ A;  2VC1 A;  4RLE A;  3VWS A;  2CDQ A;  1UVJ A;  4O0N A;  2X51 A;  3HKW A;  2VB6 A;  4LSZ B;  5EX0 A;  3VQS A;  5D0R A;  3PEJ A;  4DR7 J;  4F3M A;  1Q8I A;  2KT5 A;  3IGV A;  2CQB A;  4FBT A;  4F0H A;  2HWT A;  3QMQ A;  4ID8 A;  1BWV A;  3JTP A;  4PWU A;  4EBC A;  4PUO A;  3MHY A;  4WFZ A;  4LIW A;  4O4R A;  3MPW A;  2K06 A;  2OPP A;  2XG8 A;  2F1F A;  5KFI A;  3POT A;  1RAC B;  3UN5 A;  3K8W A;  3CD6 S;  1Q53 A;  5LOQ A;  5B0B A;  2EFQ A;  2Q6B A;  2C3Y A;  2ADC A;  3IA0 A;  2CIM A;  3DYA B;  2E7W A;  2AX0 A;  3M2R B;  3MPD A;  3D0H E;  4JI0 F;  5CYQ B;  3GV5 B;  1OYE A;  3NCP A;  3TA2 A;  2CFX A;  1MN9 A;  1FFG B;  1X4G A;  4NLR A;  1JNR B;  1Q8L A;  2HFU A;  4NCG A;  1UFL A;  3AD9 C;  2R7W A;  2BKO A;  4DR1 J;  4LF6 J;  1FKP B;  3QLH A;  5CZV A;  3WC0 A;  3RAM A;  3G8S A;  3BB5 A;  1HNX J;  4B9V A;  2ZBC A;  1BQM B;  2IC3 B;  2KG1 A;  5L1I A;  1FK9 B;  3FZ2 A;  3D1Q A;  5KFR A;  2MXY A;  1S57 A;  3DCA A;  3LGM A;  2ZD1 B;  4Z2X A;  2UUB F;  2R8K A;  4JI5 F;  2VV5 A;  3FRY A;  3Q8Y A;  1CQM A;  1S9E A;  2GQQ A;  3BZQ A;  3AT1 B;  3F56 A;  3FC9 A;  1HL6 A;  3L4B C;  2VFS A;  3DRS B;  3M8Q B;  3MUR P;  3VAJ A;  1QAJ A;  4U7C A;  2FD2 A;  2I38 A;  2P8I A;  1OY6 A;  3ISN C;  4NWB A;  5HLF B;  3PEH A;  3UD5 A;  2ACM A;  3P5B P;  1B3T A;  4B9M A;  3LF0 A;  3MPY A;  4KGK A;  1KLM B;  5LJ3 Y;  3PO5 A;  3MGJ A;  3QO9 B;  3V4M A;  1S76 D;  2VH7 A;  4X4O A;  1Y3K A;  4WCE Q;  3K58 A;  1EQM A;  1SC3 B;  2BAN A;  2NXE A;  3D54 A;  2G1D A;  2IM1 A;  4OX7 A;  3OFG A;  4RW6 B;  2PT0 A;  2I8E A;  3TAM B;  4DEZ A;  3OJU A;  3C19 A;  3M7V A;  3AJ1 A;  3RJM B;  4WTY A;  4OX8 A;  3CJ0 A;  2C3O A;  3L3C A;  4C8N A;  1A9N B;  4HDH A;  4I1T A;  3FUY A;  2DHG A;  4ENO A;  3CO9 A;  3I0S B;  1S1T B;  4PG8 A;  2N82 B;  4F4A A;  3SIP B;  5IV4 A;  2VPZ B;  3RU0 A;  1WSV A;  2MQM A;  1RTH A;  3ISN D;  3R27 A;  4ZHR A;  4KO0 B;  4X4T A;  3CCL S;  2NSC A;  4DR4 J;  2XGP A;  3CW2 C;  2OI2 A;  3B78 A;  4H4O A;  5B0G A;  2PI5 A;  4K2X A;  4OIX A;  1DQ8 A;  3CED A;  1PYO B;  4ZJO A;  2M52 A;  4RW8 A;  5AXN A;  2RQ4 A;  3KLF B;  5DQG A;  3QBC A;  2Z2Z A;  2UXC F;  3AXK A;  3CO0 P;  1MMD A;  4YR0 A;  1JKH B;  2VDI A;  2GQC A;  2CPH A;  4BWJ A;  3KJQ B;  2XYH B;  4WJB A;  1G3O A;  1C4A A;  9ATC B;  3CJ2 A;  2G0I A;  5KFH A;  5KG4 A;  5EWG A;  5J1E B;  2CG4 A;  4NLW A;  3M30 B;  4LT6 A;  2RQM A;  4ED3 A;  1XMQ F;  3CUL A;  3LQV A;  2GMH A;  3UW1 A;  4JI4 F;  2ZHB A;  3FJ2 A;  4FS1 A;  4H4M B;  4ILM A;  2D74 B;  1S5Z A;  1TQL A;  2RJZ A;  4DQI A;  3I6P A;  3BR8 A;  4CO1 A;  4N5S A;  5I3P A;  1C1C A;  2GMJ A;  1UEU A;  4MTP A;  1FDB A;  1SL0 A;  1ZA1 B;  5KAK A;  3TAN A;  5DG9 A;  1TKZ B;  1RXO B;  3CJ3 A;  2LQ5 A;  4NLV A;  2IM2 A;  5G0R A;  3QRP A;  4ZCI A;  1ZS6 A;  3C6T A;  3HZE A;  3NWR A;  4HI2 A;  3PM9 A;  3VQT A;  3RBE A;  2ASD A;  2RB7 A;  1WOO A;  1S9G B;  2Y1L B;  4F2R A;  4LBI A;  4GRS A;  3Q8R B;  2H65 B;  2NR0 A;  4PQU B;  2W2N P;  3RB0 A;  1KHV A;  3M4X A;  5FDL A;  1WOP A;  3DHW C;  4KB7 A;  3D9B A;  1UJ5 A;  4EO8 A;  3A3O B;  2FGC A;  2F3J A;  2XZD B;  2QFJ A;  5DM7 Q;  2Z57 B;  1RP5 A;  4Q45 A;  4QU7 A;  3FK4 A;  1N5Q A;  4C8L A;  1HKA A;  4WFX A;  2EK6 A; 
#chains in the Genus database with same CATH homology
 3R7N B;  1RWX B;  2H4Y B;  1RHQ B;  4LSZ B;  2HBR B;  3R6L B;  1RHK B;  2CJY B;  2C1E B;  3R6G B;  3R5J B;  2CNN B;  2HBY B;  1RWN B;  5IC6 B;  1RWO B;  4ZVU B;  2XZT B;  2C2K B;  2C2Z B;  1I3O B;  1RHJ B;  2H51 B;  2QLB B;  4ZVQ B;  2P2C B;  4ZVS B;  1QTN B;  1RHM B;  1IBC B;  2XYG B;  1RWW B;  1SC4 B;  2DKO B;  2QL5 B;  1PAU B;  4JB8 B;  1RWK B;  2H48 B;  1RWM B;  5K20 B;  3P4U B;  2QL7 B;  1SC3 B;  1RWV B;  3RJM B;  1QDU B;  3EDQ B;  2HBZ B;  3SIP B;  3R7S B;  4ZVT B;  1RHR B;  2QL9 B;  4ZVO B;  3GJT B;  2CNK B;  2XYP B;  3KJN B;  2H54 B;  1PYO B;  3NS7 B;  3R7B B;  5IC4 B;  2FQQ B;  2H5I B;  2Y0B B;  1ICE B;  3D6F B;  1F9E B;  2XYH B;  3D6M B;  3KJQ B;  2CNL B;  3GJS B;  2CDR B;  1BMQ B;  2CJX B;  4ZVP B;  1RHU B;  2H5J B;  3GJQ B;  4ZVR B;  3P45 B;  3IBF B;  1RWP B;  2H4W B;  2QLJ B;  2C2M B;  3KJF B;  1GFW B;  3GJR B;  3QNW B;  2Y1L B;  2CNO B;  1SC1 B;  1I51 B;  2H65 B;  2HBQ B;  2QLF B;  3IBC B;  3D6H B;  4DCO B;  3EDR B;  1NME B;  2XZD B;  4DCJ B;  2C2O B;  4DCP B;  1RE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...