3D6FB

Crystal structure of human caspase-1 with a naturally-occurring arg240->gln substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever).
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3d6fB00
3D6FB 1PAUB 1RHJB 2CJXB 2Y0BB 2H4YB 2XYHB 1QTNB 4DCOB 1SC4B 3R5JB 2QLBB 1SC3B 4ZVQB 4JB8B 1F9EB 2CJYB 2QLJB 2C2ZB 2Y1LB 1NMEB 2DKOB 2H48B 2C2MB 1RHMB 2C2KB 1RWMB 1RHQB 3KJNB 1QDUB 3EDRB 2CDRB 3RJMB 4ZVSB 2P2CB 3KJQB 1RWVB 1SC1B 3R6LB 3R7BB 3D6HB 1GFWB 5IC6B 1RWXB 2QL7B 1I3OB 4ZVTB 2QL5B 2HBYB 3GJTB 3SIPB 2XYGB 2XYPB 1RHUB 5K20B 1RHRB 2XZDB 4ZVRB 1RWKB 3IBFB 3QNWB 4DCPB 3P45B 2CNNB 2C2OB 3IBCB 1RHKB 2FQQB 1RWNB 5IC4B 2XZTB 1BMQB 2H5IB 3R7SB 3EDQB 2CNOB 4ZVUB 2H54B 2H4WB 3GJQB 3NS7B 2QLFB 1RWWB 1ICEB 4ZVOB 4LSZB 2H5JB 4ZVPB 2CNLB 2QL9B 4DCJB 2HBZB 2H65B 3R6GB 2C1EB 2HBRB 3GJSB 1IBCB 3D6MB 1RE1B 2H51B 3GJRB 3P4UB 1PYOB 1RWPB 3KJFB 2CNKB 3R7NB 1RWOB 1I51B 2HBQB
chains in the Genus database with same CATH superfamily
3K2YA 3TVYA 3BH6B 3DU5A 3ZO7A 2G2YA 1ZAVA 3QLHA 4PYDA 2CA9A 4RNNA 2G4BA 1VJWA 1LWCA 3NXZA 1PYSB 1NPRA 2HLTA 3QT7A 2DT9A 3MM7A 2AEFA 4OHZA 3KG0A 3HZGA 3R5CA 4X4OA 2V8VA 4TVAB 3A4TA 2GC8A 4JI8J 4RUAA 3PHEA 3UN3A 4X66F 1K73T 3QGHA 2HNZB 5B0BA 1NK4A 3IN5A 5D8HB 2PC6A 4M5DB 4DV7J 1DFDA 4P52A 3LPYA 3M2UA 1PC4A 2MQQA 1QVGR 4KGMA 1KFSA 4QIEA 4NCGA 5KG1A 2ROGA 2Y8WA 5GMEA 4I64A 2H4WB 3AXKA 3VR1A 2PFDA 2W7OA 2XB2D 4FXWA 3BREA 3OD2A 2CXEA 3JQKA 5J2QB 3MECB 4U6PA 2OEMA 4IG3A 3R27A 2CQ4A 5B0GA 4F7VA 3DYAB 4RW6A 5KFIA 2CNKB 4PXEA 1OIAA 4K4UA 5A8KA 2LQ8A 1B0TA 3N79A 3RAXA 2M8DB 4OLOA 4QIFA 2ZNYA 2DJWA 1FDBA 2M0GB 4P75A 1IN0A 4EYIB 2FGOA 4WKYA 3R97A 2DITA 3TRGA 5H9EJ 1CBKA 2WONA 4NI2B 3IS9B 2CJQA 4DL6A 1WF1A 1CC7A 2B6AB 1GFWB 2FD2A 4N5SA 4NXMF 3RBZA 4DPWA 1IQTA 1NDPA 3K5OA 4E98A 5AXNA 4HHHA 5F9LA 4JUZA 3LGHA 1RAGB 1R43A 2O3DA 3T19A 2EFNA 2XS7A 1R8CA 4K4YA 1FRIA 5I3UB 4DBQA 3IWNC 5DG7A 2DGSA 4X66J 4DLGA 5C24B 3BJYA 1OO0B 3PO4A 3IP0A 1A7GE 2KXFA 4HHUA 3HSZA 2BE2A 3CJKB 2IA0A 2KJVA 1TR0A 3KNAA 3FBEA 2YKPA 3W64A 1D09B 1JKHB 1HI8A 1FCAA 3MF5A 1PYOB 3CJRA 3N6LA 2UP1A 2DNNA 1I51B 4FF2A 1U0HA 2DHAA 1MU2A 3W62A 4AL7A 2K1RA 1QAJA 1SC4B 1NKEA 2Y3YA 3GU0A 2XMVA 3KOAA 4AXJA 2YWHA 1RCXB 2DNMA 2HIYA 1I5OB 3AHPA 1FKPB 2GAHC 3HVWA 4LRCA 1X4FA 3ETMA 4AT1B 1FTCA 5J2NA 3H4BA 5RUBA 4RW7A 4K4ZA 1RADB 1EX8A 1QAYA 4P2SA 2RVJA 4Q0BB 2DO4A 1RQ0A 2F3JA 2XY6A 4NXMJ 2RHQB 3C15B 2XSJB 3CJSA 3EVOA 3ICLA 3VAFA 4LRDA 4TQSA 4NRUA 4B3SF 3SBMA 3GMGA 4CLFA 1VBYA 1Q8BA 2BJ3A 1U1OA 3EX7B 1RB0A 1L3VA 1TL5A 3BV8A 1T3OA 5EX0A 2A6OA 1FWPA 4EU0A 4F3QA 3NBPB 1B4SA 1FKAF 1YX2A 1ZA1B 5E3PA 4GO5X 4JBCA 4KKOA 3MM5B 2LA4A 4DSIA 1KN6A 2GO9A 4LVNP 3V5RA 3PJXA 1AXQA 2GHPA 2BMBA 2IC3A 4W92B 1RLCL 2R7VA 1UPPA 4FYXB 3SDEB 1N5VA 2CQPA 4KC5A 1F9FA 4QU7A 1U1KA 3HSDA 3MR2A 3QGIA 2C2EA 3DLEB 4CLYA 3CC4S 1R31A 2P2CB 1QSLA 3A12A 4ICLA 1XWLA 2BANB 5F41A 1DLOB 1YJUA 3GCXP 1CS4B 2GHVC 3Q8RB 4ED6A 4OHXA 1NH7A 1NZ8A 2WHOA 3CCSS 1M5VC 1YJTA 4QIWD 2D9OA 2MHEA 2WZ1A 3M6VA 1S0NA 5HROB 2PMHA 2YH0A 1VQ9S 2UXBF 3K0JA 1L3TA 3UO0A 4O4GA 1TL3B 4QBUA 4YP3A 5CAAA 1V5IB 1N56A 2Z4PA 3G86A 4USHA 4DCJB 5DM6Q 4JV1A 4PXBA 4DV4F 1SQFA 3MOJB 4CWBA 1TL1A 2R8IA 4B3SJ 2ADCA 1RT6B 2MQPA 4B9TA 3BGUA 4JI2F 1S1UB 4H4KA 5LSOA 3DOKA 5KT2A 1S76D 1YRUA 3I87A 1WOPA 2OHDA 4Y65A 1Y0HA 2XSFA 4YR0A 3OFEA 2CPIA 4DV2F 2KN4A 3P5BP 2HNYA 2QFIA 3B6BA 3I4PA 5E33A 1M5PC 3L9ZA 2GGPA 2G0IA 3MR5A 4UQGA 2V63A 4ZPVR 4EMDA 1SUQB 2Q1LA 4ZVTB 3ET6B 4PR6A 3NOCA 3AJDA 5IZHA 1TKTA 5HP1B 1N34F 5LMUF 4K5SA 3PFOA 1RI7A 3D7SB 1VRUB 1YWXA 1SKSA 1N36J 1FI4A 4CTAB 1RCOB 2DGQA 1XQIA 1WORA 2V4JA 3B8HA 4UZBA 1RA6A 2X1AA 4Q5VA 2PEBA 2NYHA 4M95A 1RLDA 5I42A 3P96A 4WK3A 1YQHA 2UXBJ 1SJ3P 2VOPA 1FTRA 5LSRA 2HLUA 3MFIA 1R0AB 3D0GE 3H5YA 1R0CB 4ED3A 3D0IE 4IOBA 1KRPA 4XDDA 4ZN1A 4HT5A 2JDJA 5EUHA 4QOTA 4RU9A 3JYTB 1HFEL 1ZAXA 4DV4J 1FRHA 5U47A 1VYAA 4URQU 2ILYA 4IDKA 1VQ6S 4JI2J 4NLPA 4I2PB 1N0UA 3O5TB 4UOGA 4DV2J 4OZ1A 3UDCA 2V2KA 2WVFA 3CCUS 4F4XA 1T95A 3UVJB 1GTEA 1U26A 3CSKA 1MN9A 3VAMA 3G2XA 2C2NA 3QGPA 3EXYA 1M5SA 1PJ6A 2CQGA 4ZPBA 3GILA 1NK6A 5A76A 1MSWD 3DGVA 3DGPA 3SSRA 1N34J 2MKSA 2EVZA 3BZQA 3K8WA 4O3PA 2RS2A 3MMCA 3MHYA 4OMFG 3HP6A 2MB0B 1DTTA 4LBIA 2BEFA 2HHXA 1VC5A 3D66A 5D4NA 4GMKA 1EAYC 2YPYA 2Z2YB 1CQNA 2OEKA 2CJ9A 3TUIC 5ETTA 4P2XA 5ETRA 4RNMA 2W01A 3M30B 1HBNB 4DV0J 2HQIA 2V8HA 2JZ5A 2XGQA 4QCLA 2D69A 1NB2A 3G87A 1PAEX 1LW0A 5CH7B 3D2WA 2MGZA 3OR2B 2OPSA 2C3YA 4Q8FA 2XNRA 3HF5A 2IFXA 2APOA 2UUAF 1LXJA 2RRAA 3FEZA 5HMWA 3N9UC 4WIIA 2Q79A 3AJ2A 3M8PB 4J9NA 4IFYB 5KFPA 3SFGA 3LGMA 1FEEA 5K14A 1C2PA 1L5UA 3NMAA 2CPFA 2OMOA 2V9KA 1TV6B 3NS5A 3VGUA 1Q81T 2P6TA 2EK6A 3MM8A 1LOUA 3UQSA 2MXYA 5E0OA 2MPUA 4F2RA 2KFYA 2ZUGA 2ZH3A 5B7WA 2BJ1A 1X4BA 1SC3B 5FDLA 1ZM4A 4KRWA 4X65F 1DQ9A 3QJJA 4HI1A 2KKHA 1OPIA 3DM2A 3KJNB 1FX2A 3ILLA 1C1CA 5HSPA 5E41A 3M8ZA 2BE9B 4UOHA 4NLUA 2GVZA 5F9NA 4A4JA 4DUYF 1JIHA 2F8MA 1H3DA 2HMIA 1TKZA 4RWXA 1Q0NA 2UVVA 4DPUA 1V5VA 1LXNA 3K5PA 2VQEF 4K5RA 5L1KA 4QPXA 4LF9J 2UUAJ 2IRXA 3TI0A 1QM9A 2QYCA 2VFRA 1JX4A 3EPIA 4FVMA 5KFTA 4NLTA 1KLMB 1PC5A 3HLUA 5M2RA 1KNZA 1CQMA 3TQ1A 4XAKA 2MSTA 2AX1A 4F25A 5HANA 4OZ2A 1ZPWX 5HJXA 2JNJA 4F26A 4H4MB 3PV8A 2V4RA 4QIGA 3OSPA 3A8IA 2U2FA 4DS5A 3MUVP 2ZD1A 1S0OA 1SIZA 1EQMA 4NZ0A 1TMJA 3ZZUA 2HZCA 5C25B 2JL9A 4X65J 3HMJG 2B8PA 4P71A 1T05A 5G4DA 1IM6A 3MD3A 1FK9B 4TU8A 4CLSA 5BXIA 3LTOA 3U1MA 1NDLA 1Y11A 3OV7A 1RK8A 2G1HA 4DR3F 1HW9A 2LU1A 3LUYA 2QE5A 4X4VA 1M5OC 2M4MA 3H4DA 2RQMA 2IAJB 5CD4A 1T9YA 3TR5A 2I5JB 4C8MA 4DUYJ 2W2NP 3KK1B 4ECYA 3KLEA 2XMKA 2VQEJ 3QT8A 3OHBA 3QJPA 4MIWA 3W66A 1WELA 4BC9A 1X5TA 3BQ2A 2ASLA 5K8PA 1FNOA 1D9FA 3EVWA 4X62F 5AE2A 3CCLS 2EFOA 4R5PA 5AXMA 3PXGa 2OPPB 4B9NA 3CC7S 3R5JB 5EWEA 2DNRA 4JI6F 3KK2B 1FEHA 1ULRA 3TA0A 3FNNA 2CQ2A 2JFKA 4TU9A 3KLVA 3CD6S 4ELVA 3I9ZA 3Q2SC 4CP5A 1N33F 3CD5A 1YVFA 4LQ9A 3KG1A 2W9BA 4IH5A 4Q8EA 3SZ2A 3I0RA 1RHUB 1APSA 4O3OA 1S49A 2YNHB 3FCWA 4LSLB 3BBCA 4USMA 2KT3A 2KYXA 4MK8A 3GR1A 2PI5A 4F0HA 1JXVA 1UVMA 1RT7A 3WHIA 3TEHB 2FDNA 4GKJF 2KB2A 3NP5A 3C46A 5ITHA 3ENWA 2ILZA 3PW4A 4DR3J 5GVQA 1MWZA 1RWWB 3KUGA 1HWLA 2XS5A 2BQUA 3D1OA 3I0SB 2ZH9A 3TAMA 3CB4A 2VJUA 3ENAA 4MYTA 2IYIA 4GRSA 2RU3A 3K57A 1AFJA 2KH9A 4IOAQ 4WU3A 3MEEA 4WU2A 1UTAA 3V4IA 3LW5C 1FHTA 2BM0A 2VUGA 4NCAA 2H48B 4J9SA 3UFCX 2MY7A 4X62J 3TOQA 1RKJA 5DDQC 1VQOS 3D6HB 4DN9A 4JI6J 1S1XB 3BGLA 4FZVA 3HVAA 3OR1B 4AUKA 2MYFA 4RL1A 5B0CA 3E01B 5LOQA 4PQUB 4OL8A 4L74A 1N33J 4UZCA 4WCEQ 2XLKA 2WSFC 3GYNA 3FRZA 3T5JA 4KSEB 3LP2B 4F2SA 4FNIA 3H8YA 1SIWB 2BOAA 1S1WA 4IYQA 5HMZA 3LP1A 1H98A 4LSZB 5KFMA 3H5XA 3AD8C 3PEHA 4HH0A 3U1LA 1BD6A 3UDVA 4EFAC 1SCJB 1YJVA 4GKJJ 3KJFB 3W2WB 3GR0A 5HN0A 4IRCA 1WEZA 2HBQB 5DETA 1B64A 4USVA 1YHQS 2FJXA 1B3TA 3EGVA 2VPWB 4B9LA 4CYUA 1KS2A 4WFBQ 4ZK7M 2MY8A 1HNXF 1YJNS 1AZSA 5HBMB 3EZOA 3FSYA 1FX4A 3UDLA 1YITS 1KTVA 1K0TA 1U1QA 2VBZA 2F8EX 3DNCA 5GAGI 1QSYA 1Y3KA 3EICA 4BC7A 2ZH2A 3I4HX 2WRMA 4ANEA 5HLFA 3MR6A 1SVDA 1O0PA 2DRAA 1Q5VA 5KFDA 4HL9A 2GMHA 3BO4A 2RIJA 2OLWA 3M05A 2AJ2A 2ASYA 2QMWA 5D0GA 3MDFA 2LQJA 5AJ3J 3LWMA 2ZJRQ 2A3JA 1T9UA 1PJ5A 3PRBA 1PGZA 4MKVA 3A8JA 4KTQA 3OFFA 2ZM6F 3VGTA 1U24A 1IKYA 3PCOB 4OZLA 2L9NA 1C0TB 1IKVB 1VQKS 2V2VA 3A3NB 4ZCKA 4NOHA 4QWAA 1U2CA 2V8PA 2Y1LB 4OYOA 1IKWA 4EO8A 2DHGA 4DPXA 2ZITA 1JK9B 1CC8A 3D67A 3IM9A 5B0EA 4N47A 2DHSA 2DCUB 3G82B 3M8QB 3A13A 5CZXA 2VFSA 2DISA 1S6QA 5DGAA 3DLGB 2CWKA 1RT4A 4RZRA 1HNXJ 4CLLA 1J5EF 5AXKA 3CCES 2VBYA 3Q2TC 1FWLA 2QTWA 3RRHA 1H73A 5HQMA 1BE4A 5A6PA 5LMNF 3SCKE 5L39A 1X4HA 4EUVA 2ZH6A 1N88A 3I5CA 1MMNA 3EUNA 2A10A 1PJ7A 4RJVA 3BSCA 2HAIA 1OJ4A 5KG2A 1Y5IB 4LR8A 4NLVA 1CJKA 3X3UA 2N7CA 5K9FA 5E3CA 2W25A 1AA1B 4IQMA 2XTJP 3W9JA 1WD6A 2QLBB 2DRBA 2HVZA 3ILIA 3KMSA 1WDDA 5ETSA 5HAOA 1S59A 2ZM6J 2AZ3A 2EBGA 5L1LA 2XY5A 2GIFA 5A0YB 2YTCA 1Q78A 4FYWB 3TO8A 3ZTSA 2E29A 5EX3A 4IQXA 3QWUA 4NLWA 3G6YA 2DPJA 1HQUA 2LKZA 2CZVC 1W2BR 1JLBB 4DSFA 1RT3A 2EBEA 3IBCB 3POTA 3A3PB 4JV0A 2MZJA 4OYXA 2OUGA 3X1LB 1JLGA 2KFZA 3MFHA 1Q86T 1J5EJ 2D41A 4FDFA 4YS2A 5LMNJ 3H42A 7AT1B 4LFBF 1TTHB 5KG7A 4USTA 2HS4A 3G8QA 3UI3A 1PYTA 4HH1A 1SV5B 4WWSA 3MUMP 1ZZNA 2J6TA 3KLIA 1NMEB 4TNOA 2E1PA 1S1VA 3CMES 1IKXA 2DTJA 4AD6A 1U1LA 1T03A 2YNIA 2M5YA 4X64F 1QLNA 5J2MB 4QYRA 1S0VA 2V5HG 3PKMA 1VQ4S 3TZYA 3CJ4A 2R7UA 3EJMA 3W3SA 3FRYA 3QFHA 2CNNB 4ZP6A 2VPXB 2FPHX 2NZ4A 2VPYB 2XZTB 2XQCA 3GIMA 1ZBTA 3GFZA 2NPIA 4DV3F 3GJQB 4DUZF 4QZVB 1WHXA 2LU2A 3P5TL 5BR8F 4Y28C 2YY3A 4RW9A 4Y2CA 3TZXA 2E5HA 4DSKA 3VAKA 4CO0A 2KVQE 4X4QA 1EQ0A 4B3OA 3QIPA 2BYCA 4OJGA 3Q23A 1Z2LA 2OTLS 1VRTA 5HO4A 4XK8C 3CJ2A 4ES1A 2MZQA 2VB6A 4LFBJ 4PAAA 1TAUA 3ZTOA 3KYLA 4EBEA 2VA2A 2UV8G 1MLAA 3FMBA 2FHMA 2V8GA 1TFWA 1RBOB 4WJBA 2HAFA 1JJ2R 2XMMA 3IG1B 2OFHX 4YR3A 4XO0A 4PZVA 4HYKA 1S57A 4NLDA 1RYRA 4LF6F 2YNGA 3J81j 3OTDA 1RTDB 2X1BA 4DX6A 3QIDA 4DV6J 4C11B 3HSGA 2V4QA 1NDCA 1HBUA 1V3ZA 3W8GA 3R7SB 4P72A 1S9EA 1I6JA 2V50A 4NYOA 3E2EA 1RKIA 4BHQA 2EKNA 4OYIA 4BWJA 3BDEA 5SUHA 4DV3J 4DUZJ 3R7NB 1WF2A 1WKLA 5IM0A 1XN9A 2MQLA 2DY1A 5BR8J 2HVIA 3OUYA 2MJNA 4FF4A 2RKIA 3SSQA 5LXRA 1QAIA 4NYZA 5IV4A 2H1YA 4U95A 4OZ0A 1FJ7A 1UW4A 1NM2A 3MZIA 2W4DA 3CEDA 4FPRA 3CTRA 1TL7A 3US5A 2ATLA 2MKCA 4ZLNA 2RSQA 4A8KA 5IQQA 3W9IA 2ASJA 3J7A1 1N5YA 1N6QB 3K5NA 4FXVA 1K0VA 3PW2A 3SV4A 1Z4UA 2XC9A 4LF6J 5AT1B 1TU0B 2IVFB 4FPIA 2N3OA 2WVEA 2Z56B 3M2VB 4K8RA 1T9VA 5CABA 3RR8A 4ER8A 3CJQA 4ZVPB 5KFKA 1GXUA 1H6KX 2CNLB 1HI0P 1J5OB 2W9CB 1P8GA 2ZNZA 4MYUA 2R3VA 4MFBA 1KEKA 1VS3A 5KFGA 5KT5A 1SJ4P 1PAUB 4I6AA 1WG4A 2UVUA 1YK9A 2L48A 3OJUA 1CJVB 1MROA 2YNFB 1T9WA 4HTIA 1H72C 2HIQA 2EXUA 3WBZA 2FZGB 4EGLA 9RUBA 1R8HA 5DO2A 2HKEA 1D1UA 3C6UA 5C42A 3SV3A 4NA2A 3NLCA 4DEZA 4WZQA 3KLFA 3RGIA 4YY3J 2NSCA 3F44A 2AWZA 7FD1A 3KK3A 3KLHB 3QNWB 2GJIA 4OI3A 4NMXA 3R2DJ 1RU1A 3GLJA 3CCWA 3NWRA 4OI0A 5J1EB 1B70B 4N8NA 3SCIE 3ZZRA 2YBVA 4NEYA 1FRJA 3HDSA 3M9MB 2E5LF 2HQ3A 1N5QA 3UR0A 3H2LA 2IJNA 1AUSL 1SC6A 4WFAQ 2UUCF 3D68A 2AEJA 4ES3A 1WC5A 2MZTA 5GAHI 3O8WA 4KYZA 3I55S 4M5GA 2BV3A 3PG9A 1WOSA 1H38A 2V69A 1P9YA 1KDNA 3HXMA 4C0OC 3IWLA 1TAQA 3PW5A 2W24A 4ZA1A 3VTIA 3QSIA 2R7XA 3IC1A 4M94A 2FLOA 3Q8SB 1UJ5A 2HQCA 1S99A 1O51A 3QLHB 4CLUA 1K44A 3NAHA 3PY8A 2HWIA 3PX6A 1W2IA 3IRXA 1NSPA 3IR6B 1X4AA 3P45B 2IRUA 1YSJA 3MM7B 1TELA 2HG4A 4QPTA 2H5IB 2BABA 4XIUA 5SZTA 2YKOA 4FYDA 1M1KT 1UEVA 4ITSA 3CE8A 4LF7F 1VJQA 4NX9A 4RUCA 2OIHA 4FYYB 3H90A 1S7HA 2ZDPA 1IVZA 2J8AA 1RU2A 3M2UB 2E9RX 4ECTA 6FD1A 4USWA 3ETOA 5GADI 3KKFA 3OHAA 2PA8D 3W9HA 3PYDA 1UEUA 3TYTA 1X31C 2E5LJ 5H1SV 2D3UA 2ZZNA 5CYJA 1HLWA 5M2PA 1RT5A 2UUCJ 1X4GA 3P3DA 3R5GA 1QD1A 1RYSA 4RW6B 3PFEA 4DG1A 5A8KB 2AD9A 3E3XA 4JV2A 3ZTRA 1URNA 1LK5A 5CD4H 3R6LB 2BR0A 4F04B 1T9XA 2FC9A 3OPKA 2DIVA 1AB8A 4DUTA 5KFYA 5EWFA 2VH7A 1JLCA 4R0EA 3V2UC 3RW7A 2WONB 2IDLA 2R7RA 4WFYA 1NK9A 2H3EB 3V81A 2Y8YA 5T41A 2DB1A 1RABB 3CMAS 1HYSB 1RAFB 4YB5A 1CJTA 3IR5B 3D1HA 2XMAA 3CCVS 4C8NA 2YKNA 1LWEB 4CLKA 3NNHA 2ERRA 4B17A 2VL1A 1XNRJ 3C66A 2HBZB 3J7YI 1BUXA 1PKUA 1A9NB 2K7JA 1H0HB 2W9AA 1WKJA 1RAJA 2KL8A 2L9WA 1N4LA 2MQ8A 5DJBA 1G2EA 3EM1A 4N77A 1QY7A 5ETPA 2I38A 2CYYA 4JI4F 2XMTA 4KPCA 1U0HB 4NYPA 2HZVA 1DARA 3BKTA 4OYBA 1MU2B 2YQ1A 1XR5A 5CYMB 4X4NA 3JSBA 3UNGC 3B82A 2E7VA 1C0UB 4J9VA 2HVHA 3FSIA 4P74A 4EBCA 2LP4A 2AGQA 1H7XA 2O67A 5DDOC 3C3LA 1HHSA 1ZTWA 2QYGA 5J2NB 2J9DA 2FQQB 1CLFA 4RW7B 2WBRA 2CQCA 4OYMA 3PM9A 3LP0B 2CVIA 2VG5A 5C24A 3PJWA 3HVTB 3NS7B 3N5FA 4AE5A 5HL7Q 3DOLB 2DXFA 4ECXA 5DG8A 1XERA 3Q86A 2GMJA 2FLNA 3ONQA 2CZ9A 4ZP9A 4YDDB 4LMZA 3MEKA 3T1AA 1VFJA 2RF2A 3VAGA 2NS1B 3H20A 3CGIA 5KFBA 2DNZA 2E44A 4KKOB 1SXLA 4LF8F 3PYEA 2FVCA 1FKPA 3IFEA 1F5CA 2RDJA 2RU9A 2IC3B 4IFVA 4P10A 5GAEU 1RAEB 2N7YA 4JI4J 5HI7A 3BSAA 4YHHF 1S10A 3G6XA 1FA0A 2FIUA 2EEYA 3B4DA 4Q0BA 4CO4A 2B56A 4CNZA 4RU2A 3M9OB 3MCSA 1K47A 3EGZA 3R3TA 2ROPA 2C3OA 3EDQB 3F0NA 2P8IA 2F4VJ 4QWBA 2QGFB 1TFYA 2CG8A 2ALZA 4DR6F 3G71S 1T9TA 1V3SA 1VQNS 1S0MA 1W7WA 1PIEA 4NMLA 4HR2A 1MW7A 2MKJA 3GIIA 2IVYA 2HFUA 2KRRA 3LOUA 3NCPA 5IT9Y 3MPWA 2HSEB 4IG0A 3GV7B 8AT1B 1GH8A 1S6PB 1L3KA 3WQPA 2B5JA 3MUTP 5K8MA 1TL1B 4MJKA 5E5NA 3WIVA 1H2TZ 3VZHA 1EKRA 2WAQD 4K50A 5HMXA 1JXLA 2NLWA 3K17A 3C16B 3H25A 2GV1A 1DLOA 1GT8A 3CO9A 3QSYB 4LF8J 3MCMA 3BPSP 4DFKA 1CS4A 2PIIA 1REGX 1CULB 2WOMA 2J6SA 3NCQA 1EKSA 5A8WA 4F0MA 2ASDA 4YHHJ 4WYLA 1TKTB 5HROA 1S72S 1BWEA 2Y9HA 3O3LA 1B0VA 3DXSX 4DXLA 1U25A 1ICEB 1M5KC 2LEBA 5DM7Q 2W2PP 1N8RT 3SXLA 3R8YA 5D4OA 2DR7A 4I68A 4GC6A 4DR7F 2QA1A 4K4WA 4LRFA 4C2MA 3S1TA 1G7CB 1NUEA 3NGSA 3UCZP 2RUGA 2HK3A 3D54A 3QYYA 3FMWA 3FEYB 3KXDA 4NCBA 1S9FA 3KDNA 1GK8A 4LJMA 4OHWA 5F0UA 2CDRB 5HVFA 2AGPA 4WXOA 1JWWA 3V6JA 1ZTTA 2XCPA 4F4AA 4FKXA 2AZ1A 1FRLA 5D4LA 5KFQA 2Y0SD 3LAMA 3GZ7A 3BYPA 1WSVA 2BUNA 1FRXA 5HP1A 2KXNB 2Y1IA 3LH2S 3S01A 4KGVB 2R8GA 4ZN3A 4ELTA 3EZ5A 2VFVA 2ZOFA 3JS9A 2HHVA 1VRUA 3Q22A 3ENVA 3FSXA 3W5XA 4DPYA 3RAMA 2FY8A 2BE7D 3JSYA 3KNGA 4CO3A 4YB1P 3GFHA 2JEGA 3H2UB 1CVJA 5L38A 2JC0A 4FNHA 1LNQA 2FGCA 4ZLPA 5JUMA 1FKOA 2DVIA 3MMCB 2XMJA 1GMWD 1TP7A 5D3GB 2MHNA 3BGOP 1DTTB 1S6OA 4YB6A 4QYZK 1VQ8S 3KWMA 4J7CA 4DR7J 4WFZA 2F7VA 1RHQB 2HW3A 2DY9A 4K7QA 3MR3A 1R6YA 4ZPAA 2EWHA 2YX4A 1YZ6A 3CDBA 1FT8A 5GMKa 4OYAA 1N32F 4E8UA 3M2RB 3AQOA 1GXLA 4C0HA 2MGZB 3NS6A 2OPSB 2MKIA 2QG9B 2OAUA 4AXIA 2XLJA 3G6VA 2CIMA 1Q16B 1EIYB 2HVEA 3DRYA 4WF9Q 4DU8A 2BDPA 2G13A 6AT1B 3RB3A 3WX8A 2LQ9A 1W26A 1YKWA 1RBAA 5K14B 3NKYA 1BWVA 5EN1A 2CFXA 1JNZB 2R7WA 1FFSB 2B4OA 5AE3A 2MQOA 3MM8B 4OZ3A 3R1LA 4B9VA 3M30A 1LWFA 1WC6A 2F9JA 2FJEB 4RNOA 2VFUA 4ZHRB 1IBLF 5I3QA 4ZVSB 3IMQJ 4BS2A 5FDLB 4QW8A 2CPZA 4TQRA 3DN9A 3OR2A 4GKKF 4W98A 1YTYA 5DRKA 2FY1A 1FE4A 2XMWA 2IM2A 2ACYA 2ZHBA 2LYVA 2HFSA 4NXNF 3UR3C 1E6YA 3QT5A 3GP9A 1ZM3A 3W65A 1N32J 4PUOB 4KE5A 2GVZB 5L46A 4ETZA 2ALYB 1SH0A 2HMIB 1TKZB 2VICA 1UA0A 1V3RA 3V6DA 3T5HA 3HM9A 2CUYA 4TY9A 2H5JB 4JV5F 1TV6A 3HCXA 2BQ3A 1BY9A 3CJ5A 3OBIA 4CLTA 1E6VA 2R4FA 5J1PA 1FWKA 2E66A 2D74B 2P6SA 1RWUA 4Z7CA 1FRKA 4UUXA 3TUPA 2JC1A 3OTOF 1TUWA 3Q8VA 1HHTP 3MAHA 4ZJQA 2MLZA 2AEMA 6FDRA 4B02A 1KQFB 4CO1A 4N76A 2PMZD 3U7JA 3UWTA 5EDWA 3KMQA 1P1LA 4USKA 2WVBA 4U8YA 1QAXA 3PYFA 2J7KA 2DPIA 1OSCA 2FHKA 4RX6A 4O44B 4G1QA 3OTEA 1UVNA 1A0OB 1IBLJ 4UY8T 4ZMMA 4Y3CA 3RB4A 1Q8LA 3FFIA 1YJWS 5J1NA 3QFWA 4DQIA 3UD3P 2E1RA 4JP8A 4FP9A 1OQ3A 5DLGA 4GKKJ 2ZBIA 4KHRA 4LF1A 2RHSB 1NHKL 5ETMA 1SL0A 5B0DA 2RILA 3JTOA 4NXNJ 2J9DE 3HI9A 3MM9A 2G0CA 3M1VA 5ETOA 2MQNA 4WFXA 3KLEB 1Y10A 4JV5J 2BXJA 4DCOB 4H4MA 1VQYA 3DC2A 1ZH5A 1RTZA 4J37A 1M5HA 2PN6A 1KQKA 3I32A 4N41A 4R5PB 3VGVA 3THTA 3OTOJ 3CDAA 4LRBA 1VISA 2RAQA 2B8QA 1BLUA 1GQEA 4USJC 4TLRA 2RS8A 4X4PA 1I3OB 5C25A 4JI7F 3T3FA 1XEZA 3H2VE 3OLAA 2OPRA 2N82B 2KZZA 4BLGA 2J0WA 1HQ2A 2IYGA 4M63A 2JLFA 1G1XA 1DQ8A 1HBMB 3I0RB 4XDCA 3RW6A 3NMRA 2WB4A 4GC7A 3TANA 4FS2A 4OYWA 1VLYA 5I4MA 1UVIA 4QR1A 3IAS9 2RB7A 1TK8A 1RT7B 3Q8QB 3GYGA 3DFEA 3DDNA 1JNRB 2V2ZA 3N6NA 2RJZA 2W2MP 3OW2R 2BM1A 3BSOA 2R8JA 3EXCX 4OI1A 5K8NA 2HGLA 2V67A 1QE1B 5DDRC 2A2CA 2AT1B 3IRWP 3Q8UA 3JAMU 4U96A 4K4SA 3N5BA 3VZIA 3MEEB 3GQCA 5LXYA 3V4IB 3PW0A 5KFCA 3EYZA 2NYIA 1VIOA 5LSLA 3VV2B 3DI6B 4LF2A 9ATCB 1QTMA 3D28A 3L4BC 3F73A 1X7VA 1NK5A 3PNIA 2HQGA 4CT9A 4RO0A 3BGFA 2HK2A 2YNHA 3FGVA 4DQQA 4EYHB 4BCAA 4CDIA 4JI7J 2G1DA 2E1AA 2VZ9A 4ID5A 2AMCB 1RTHB 4X84A 4PG4A 4O3RA 1T3NA 1JQGA 1S12A 1UZDA 3LP1B 2H51B 4DF8A 3P49B 3A1YG 2NR0A 3PTWA 3T9ZA 3ADAC 4OV1A 4R8UA 4LF5F 1O5JA 3I5BA 4ANDA 2IPOB 1D8YA 2DGWA 3HJFA 4OV6A 3HT3A 2DHXA 1DHMA 2C22A 4ZVGA 4OYPA 1JJ4A 1ZA2B 1NXIA 3CJ3A 3R7BB 4EEYA 3HJVA 1VI7A 2FLPA 3CT9A 2EW9A 4PG6A 4CYUB 1N0VC 3PVXA 1TKXB 4ZVRB 2HFVA 2C2DA 2QC3A 2QLWA 3KHLA 1Q79A 2JWNA 1AZSB 3OR1A 2KTQA 4LFCF 2POKA 3RAQA 3PX0A 3E01A 3T5LA 1J2VA 2MMYA 2VFTA 3SCLE 1RTIA 3N4WA 1IXKA 2PA3A 3RRKA 2LDIA 1Q8KA 3TA2A 3CULA 3M6UA 4G1PA 2ZZMA 4I56A 3CJ8A 2ZKTA 4OX8A 4O3SA 3I5AA 1FJEB 4PKDB 2F9DA 1YBTA 3THVA 3QWPA 1K8AT 4QYZJ 1P6TA 1LFWA 3E8OA 1VDHA 4NLYA 4QQBA 1FJGF 4LREA 4HLBA 3L3CA 2L08A 2ZZTA 2DBBA 1LEOA 1N36F 3CIZA 1IKYB 3JB9k 2CPHA 1EARA 1NK7A 4A8FA 2BZ2A 3BO2A 4ZCIA 3C14A 4LF5J 1JXEA 3DLHA 1VK8A 3VF0B 5HBMA 4UT4A 2Z30B 1BHNA 1IKWB 2CPDA 4M5MA 1IR0A 2DH9A 2YH1A 4KT0C 3THPA 5KFSA 1RUSA 3EWGA 3V4MA 1UJ6A 4CH0S 1K9MT 1NK0A 2CPYA 5HJYA 3ENQA 3GIJA 2HHPA 1RT4B 1SJ1A 4ED4A 4TLQA 5DLFA 2BJEA 1TUVA 2YKAA 4LBPA 4LFCJ 2HHHJ 3W8PA 1Y7PA 2JOQA 4YMEA 2XULA 2DYAA 2GVDA 2H65B 3TX8A 2V9WA 1NKCA 4J9MA 3GSIA 4XTTA 1RGVA 2LMIA 1RT1A 2O1PA 3TJ9A 5EHHA 2GCFA 5AXLA 4TXSA 4I67A 3LGNA 5L9XA 4KGKA 2UVWA 1FDDA 2YX1A 1VMBA 2R7SA 1C0TA 2F40A 2BX6A 1JLQA 4MH8A 3PKYA 1ELOA 3HHLA 1CJKB 1JLFA 4DPTA 2ZE2A 2CQIA 5HVHA 2JJ4D 1FVSA 3D4JA 1MN7A 3PR4A 1N5TA 1FJGJ 2XWYA 4KFBA 4UQTA 4DR1F 2FVRA 3G82A 4UUWA 4C8LA 5D4PA 3RBDA 2DGXA 5JVGQ 1RJJA 3FEXB 3DLGA 1IQZA 4KQZA 1KONA 1ZS6A 3GIRA 2Q6CA 4ZCMA 3RTVA 3GFXA 4CLZA 1HQUB 3DLBA 2V68A 4DV0F 2VKZG 2HRUA 4ECZA 1RT3B 4ZP8A 5DGBA 3DRRA 4L76A 4X4RA 2KT5A 3H98A 3IM8A 4NE9C 3LQVA 4EZ6A 1HNWJ 3BO3A 2F4FA 3KHRA 1MMDA 1RAAB 2DNGA 3MMAB 3HHDA 2DH8A 3VGSA 1CG2A 3PRDA 4C7QA 2L9DA 2HHWA 2KRBA 4Y2AA 3KJVA 2B9YA 3DMJA 1RAHB 2H4YB 2XYHB 1EZZB 1B7YB 2X3DA 3SCJE 2HNDA 1G6BA 4F4YA 4OYZA 3T6BA 1F2HA 3BQ0A 4B9SA 2HPUA 3MAAB 4M5LA 1WC1A 1OS5A 5A0YA 2CDQA 2DGTA 3FQLA 4AQYF 4A47A 4YOEA 1X9MA 2AW0A 3NGTA 1S1VB 2RRNA 5KFRA 3BYRA 3FK4A 1IKXB 2COLA 1JLBA 1T03B 4G65A 2PO4A 4O0IA 5DQHA 1RHKB 2A2DA 1JLAB 4DR1J 3GB0A 3AB4B 1A6LA 5H9EK 4NA1A 3TUJC 1FD8A 5L1JA 4NZ7A 4L72B 2A1BA 3F56A 2XI3A 2B3TB 5IT4A 1HNVB 3ULHA 1S9GA 4F50A 1YJRA 2DR9A 1WG5A 2HRTA 3P6YC 1LW2A 1NJZA 2EKYA 2F8HA 4QR2A 3FKBA 2D3OR 1D9DA 4ILLA 2LXUA 4P6QA 3FC9A 3OTCA 4WPAA 2FJBB 2N3LA 4PWUA 5KG3A 3CDWA 4Y2KA 1VC6A 3DDIA 3MCNA 5MLCV 4RW9B 4Q43A 4A8SA 4DN0A 4LF9F 2JSXA 5F8MA 5KFXA 3WC2A 4M5KA 5D0HA 3QIPB 1VRTB 3T6JA 2VV5A 1NRKA 3IBWA 3LAKA 1U1PA 1ZOTA 2R9LA 2RMLA 2W7PA 4AQYJ 1CJUA 2DNKA 5FD1A 1P27B 2K8GA 5IT0A 2ZEJA 4C4WA 4RW8A 3BSNA 4UW2A 3TX0A 2WB1D 2XEXA 4GVBA 3CVKA 4I69A 4F3OA 2IY5B 2P9EA 2QL9B 2OP5A 2K3KA 4HT7A 3TZWA 2KVIA 3TNVA 1S9EB 1M1GA 4CH1A 1RWPB 1UWBA 3JQMA 2EK1A 4IRDA 3DOMB 1JMTA 4LVOP 1RAIB 2DNLA 3IGVA 5HQLA 3JTPA 2QMUB 2PT0A 2DGUA 1DTQA 5T7LA 2BACA 5IM0B 4PRFA 1RWMB 4G3IA 5LJ5Y 3BDPA 2GJFA 4C8ZA 3OUYB 3D1QA 3HSJA 1ZZFA 2RKIB 3AA9A 4TYAA 1CSJA 4WBFA 2CKWA 3MR7A 2CAJA 4URGA 2E5GA 3KDOA 3UE2A 3U02A 3I9V9 2AYEA 4Y6IA 4U67Q 1BQMB 3FZBA 2GQ2A 3AFGA 3ZNJ1 2R2SA 4TN2A 1U2FA 1N5YB 4E0DA 3DXBA 2BJDA 3ZZOA 1FNXH 3QT6A 2NXNA 2IM1A 1SBRA 4P2MA 4A48A 3ITHA 2CQBA 2AJFE 1NKBA 4W4MA 3HKWA 4OI4A 2OFGX 1KVJA 2I9SA 2E1MC 3TAQA 3VWSA 2Y1RI 2AYGA 1ROFA 3OSNA 1HI1A 2KHDA 1C1BA 2KI2A 4L6V3 4CLWA 3MEGB 3N01A 1R0BG 2VPZB 2MLYA 4WFNQ 1MROB 1Q1KA 2WW4A 1MG7A 3OVBA 2QSWA 3Q8YA 1DY3A 4IRKA 3K8VA 4EZ9A 2CPJA 4UY85 3R5BA 5C42B 2OMLA 1N6QA 3KLFB 4Q7AA 1Y00A 4MK9A 3M2VA 2E5IA 5KFAA 3B4MA 1UFWA 2E9ZA 1KVIA 1RACB 1IJEB 4C3MA 2QN6B 2VKRA 1YBUA 3HVRA 4EK2A 1HPZA 4CO2A 1X0PA 4ZIWA 1CJVA 2HS3A 2KT2A 3HX9A 3AOBA 3R9LA 3ILJA 2C3PA 2JRSA 5F3TA 5C7PA 4NLOA 3BBFA 3C6TA 1X8DA 3CCTA 3PZPA 3H5UA 2M8HA 3DLJA 4DL7A 2LECA 5HATA 1U4BA 2XYPB 1HNIA 1RWKB 3MM6A 2GIRA 1SJQA 5KFZA 3Q24A 1RT2A 3J81Y 2AYBA 3BQ1A 3OT9A 1R7IA 3BKUA 3JSRA 2HVDA 2KM8B 2OPQA 5BYRA 3NNCA 1ACMB 5J1EA 3BN7A 1GMUA 1SQEA 1U09A 2AJ0A 1HQEB 3DLKA 2XBPA 4MKBA 2A6MA 3MTKA 2OGUA 3CPWR 1EP4B 2HBRB 3QBCA 4DR4F 1OMSA 2M70A 2ABYA 1WTBA 3AB2B 4KO0A 3VVUA 3RBEA 3N6MA 4JB8B 1UVKA 2EC0A 3VAIA 1UA1A 4RNFA 5AJ3F 4Q2LA 5C2GA 1RT5B 4PCQA 3MEDA 2BRLA 2WK4A 4DG1B 4B3RF 1RHRB 4NA3A 4Y2IA 2AJ4A 1ZPVA 1YRXA 3CNQP 2QT7A 5EGYA 2OEJA 1JLCB 1LK7A 2D1CA 4KIAA 1JLEA 3V81B 4DHVA 2BW2A 5DDPC 2QFJA 2KDOA 1NEEA 3QJLA 1VIXA 2X1GA 2VOOA 2X51A 2ZH5A 1CJTB 4ECRA 2NSBA 4ZCLA 2YKNB 1SL2A 3CIMA 1Q53A 1VRQC 2RD5C 2QO3A 1X60A 4RUHA 1F1BB 3S6EA 4OJ3A 2XLIA 2JLEA 5KG6A 4RR5A 3QATA 1VBZA 8ATCB 4DR4J 1K1SA 1H74A 5KG4A 5IFMA 4C97A 2UUBF 1VK3A 2LVWA 4A8MP 4X4TA 3QQCD 2H9ZA 3GG1A 2HBYB 2MZRA 3AA8A 3HK2A 2VG7B 3OXGA 4ILRA 3QO9A 4USUA 1T8EA 5A8RA 2IDEA 2CPXA 2FUG9 1EJ7L 2LXFA 2OO4A 2ZVIA 4PPDA 1IWAA 4FF3A 4DL5A 4B3RJ 1HYSA 2WVCA 3W5ZA 3UN2A 3CJ0A 3PJ9A 1BXNA 1U2RA 2OELA 3M7VA 3G6ES 5KOXA 4JI1F 2J8SA 1L3UA 4M5HA 4LIWA 2X3GA 3AODA 2KHCA 2Q43A 1F6TA 1FE0A 1LWEA 3BR8A 3CW2C 1UVJA 1SKUB 4Z37A 2VG5B 2HWHA 3MMJA 2W7AA 1TVRB 2MTLA 1HWUA 1HNZF 5DG9A 1F60B 1WOOA 1D8ZA 2AV5A 4ZPCA 1YJ9S 1UAWA 1HMVB 2ATCB 2HGMA 1UEKA 4CT8A 3W7BA 1VQ7S 1F9HA 1C4AA 4RUBA 2G9OA 3HPOA 1NJYA 1KHWA 2RF2B 3O44A 1U1NA 5DQIA 1WACA 5CYMA 3D0HE 1X0FA 4I6YA 1Q4RA 3HKZD 3AOCA 3HHLD 2FTRA 1REVA 1C0UA 2R8HA 2UUBJ 5DQGA 4KR0B 2IJFA 2DIUA 4IFVB 2VHGA 1YI2S 3J81U 4DX7A 4CM2A 3MMBB 4QWCA 3CDEA 4PXDA 1DZ5A 1S48A 2WSCC 3LP0A 4N7TA 1AUDA 4ZS6A 1V9OA 3OFHA 5F8IA 3HVTA 5KFOA 4ED8A 1UMJA 4PQAA 3EGNA 5L9NA 1GX5A 3R5AA 3DOLA 2AU0A 2D9PA 2BJ9A 5F8NA 5KFFA 5J2PB 2IBKA 4JI1J 4DFMA 1BQNB 3KUHA 1X4CA 3GSDA 2QIFA 2GO8A 2ZH8A 4LBHA 4KV8A 3DHXA 3TARA 1U47A 3W63A 1XMOF 2AKWB 4K2JA 1HNZJ 3BPDA 2BJ7A 4IG0B 1SC1B 2B5JB 4F4WA 2KXHA 3OTBA 4HACB 2WVDA 3BB5A 4ECVA 3BKFA 4CZCA 4ENOA 3H40A 1EETA 4DX5A 3ZTPA 2H5EA 1U7LA 3K5MA 3FDSA 2GAGC 5IC4B 4USIA 1S4EA 4DF4A 1U48A 4A8XA 3GCWP 2F65A 1SJRA 2R8KA 1X5SA 2HGNA 2WOMB 4B3MF 1S1TA 4K4VA 4OZNA 2OJ3A 2L3MA 5JJBA 5A8WB 1MWQA 3R6GB 2RNEA 3I6PA 4WE1A 5D6GA 1Q8IA 3TEGA 3I56S 1B99A 4TY8A 4DV6F 2FJVA 1AYEA 4V19X 1UKUA 1S6PA 2JX2A 4LSNB 3KUEA 3QAUA 3CD7A 1M1HA 2F1FA 4W90B 1QDUB 1MNEA 3NWGA 5KFUA 3QRPA 1NHUA 1D3WA 1U1RA 3C16A 1NHVA 3GJTB 2PMWA 1XMOJ 3B78A 2AYMA 5F0WA 3L7OA 1WI6A 2NZCA 3IAM9 1CULA 5CCLA 4O4RA 4OLPA 2H54B 1HKAA 1X9WA 3UPFA 3J7ZT 3CXCR 2Q3PA 1GAOA 2LXIA 3RBXA 4DL0C 3L95X 4D3GA 3W60A 3O1LA 2XCAA 3OL8A 3HHNB 4G1IA 4B3MJ 2IA6A 4FN5A 3G8TA 3RB6A 2ZKUA 3M32B 3UN5A 3SQGA 5B08A 1HBOB 3BS9A 1FKOB 1XBWA 3ZTQA 4Q44A 3SYZA 2JH3A 3FUYA 2CQDA 4B3TF 2M9KA 2VC1A 2FYXA 2DCLA 2EC2A 2AX0A 4BBYA 3FCVA 1G4CA 3PIOQ 2VG6A 5EWGA 3UDEA 1IJFB 2IMWP 4KJIA 3MD1A 5THWA 3V6HA 2NXCA 3M9NB 1BMQB 3BGRA 3JXOA 5FIIA 1S6UA 4ZVUB 4K4TA 3CCMS 3DRPB 2OD4A 4MAKA 4H4OA 1UETA 3PR5B 5KFWA 4PYAA 4FS1A 1UJ4A 4OJ1A 2WSEC 5CYQA 2O5DA 4DR5F 2ZH1A 4YY3F 4KH1B 2E9TA 1FFGB 3NGKA 4FBTA 2J9CA 3NCRA 5LMUJ 2ZWOA 3KG4A 3L7UA 5D3GA 4NPOA 3VQTA 2C42A 1QVFR 3FZ2A 4F0KA 4ES2A 1LV5A 4ZLJA 4F8RA 4I2QA 1DAXA 1OY9A 2V6AA 4ZJLA 4V19J 3NGUA 4TKTA 2C3UA 1I1GA 3OVAA 1LWFB 1G3OA 1U8SA 3TWZA 3N28A 4DWIA 2EI5A 3DRSB 4PABA 3H7HB 3RR7A 4DCPB 2VDIA 1X9SA 3JSMA 4QU6A 2J6UA 4ECSA 3M2RA 5GAEI 1TZ0A 4MK7A 1AFIA 5KT7A 1UFLA 4B3TJ 1U6ZA 5G0RA 3FBFA 2CNOB 3TP2A 2V2QA 5KT4A 2BOPA 3G9CA 3VQSA 2UXDF 4EO6A 4HDHA 3CWJA 1WSRA 4DV5F 1RSCA 1PCAA 1E6YB 2GFFA 3T1YF 1RTJA 2YWWA 4RW4B 1UPMB 2LDYA 4KB7A 2EFGA 3V6DB 3VAHA 3EZUA 1LKZA 4QJVA 2ZBRA 2D3O1 1E6VB 2DNHA 3T9NA 4F4ZA 3DU6A 2XI2A 2HFNA 3PW7A 4DR5J 1C4CA 3M6XA 2AF6A 2HEKA 1P1TA 3LWLA 1XC9A 3QRQA 1OYDA 4ZHRA 1FVQA 2HHUA 3N0VA 2E7XA 2ZVSA 2B9XA 1NJXA 3ZZZA 2LCWA 1U0SA 1IBKF 3R1HA 3I96A 5L8RC 1FXRA 1PG5B 4JOUA 3HFZB 2GQQA 2O66A 1U8WA 1HWJA 3FVYA 4I7FA 4G1QB 1N54B 2GMLA 4QWEA 4WTYA 3FFIB 1R3NA 4NLQA 4PUOA 2HFZA 3MPDA 4CRJA 4C0BA 2AIRB 1U6FA 5HMYA 4FKYA 3ZZYA 2LEPA 2ZH4A 3UW1A 2U1AA 2RQ4A 3NY0A 2UXDJ 2CQ3A 4OJHA 1WEYA 4DV5J 3RG6A 2J7UA 5FLXY 1NCLA 1ZETA 3T1YJ 3KLGA 3MM9B 4LUBA 1T11A 3M1VB 2JVRA 1HIYA 1LWCB 1TKDA 2O01C 4O3QA 2PGCA 3LF0A 5B09A 5IS2A 1NK8A 2AJQA 1NO8A 5BYSA 5CQGA 3DDKA 4OI6A 2UXCF 3W2VA 1RWXB 1HWIA 4MTPA 1XNRF 3QAEA 1N52B 3EPGA 4ZJOA 4NZ6A 4O44A 1PBAA 3H0PA 4F02A 1X5OA 1WEXA 2IIHA 3KTQA 1R8PA 3A3OB 3B54A 2MSSA 2AP6A 2VDHA 2LLZA 4PWDA 2JEJA 4J9OA 4HDGA 3NAIA 4NCGB 1F3VA 2YKMA 1VQPS 1IBKJ 4P7TA 1IBMF 1KOHA 4DFPA 3Q83A 1NJWA 3LANA 2OPRB 1TK5A 2EPIA 4IG3B 4RNHA 4A8QA 2BKNA 1WUUA 1DBDA 1WWHA 1U6BA 1URRA 5F8LA 2OH2A 1DURA 1JJHA 4KGXB 3G4SS 4TU7A 2J0QD 2HHQA 2DR6A 2Q66A 3TZZA 1SJFA 2G2ZA 3MWBA 2JHEA 3RYLA 3HHEA 2KG0A 3GV5B 3FBCA 2XHCA 1F9EB 1NB7A 2Z0GA 4CO5A 2R2UA 3GWCA 2VODA 4X2BA 2XS2A 4ED1A 2HNZA 5D15A 4C8KA 4M5DA 3QMQA 2NXUA 2YPZA 3UCGA 2ZHAA 1OQ6A 4ECWA 3S7RA 4DQPA 3MPVA 4ERDA 1KP6A 3TVKA 1QJHA 2UXCJ 4PWWA 3NRBA 5J2QA 2BKOA 3MECA 2OTJS 3DKDA 1Y5LB 3CUNA 3MGJA 2HYIB 1HBMA 4F4KA 3DYAA 2BE2B 2I8EA 5LT5A 3IR7B 5LJ3Y 2QA4S 4Y00A 3CF5Q 3W61A 4B9UA 3UNYA 1AROP 4JI0F 5ETKA 2K06A 1IBMJ 3TAPA 5K5MA 4ID5B 2VJVA 1XIQA 4HI2A 4A8WA 2K1RB 3MI7X 3D6TB 3M8WA 2Y0BB 4NI2A 3IS9A 2HHTA 3UD5A 1SH2A 1QE1A 2B6AA 2BVZA 1TUGB 4DSJA 1N48A 1VHFA 2PFFB 4WZMA 3EE3A 3QGGA 4IOCQ 3TQEA 2F4VF 1FESA 3T41A 2QV6A 2FZKB 4R8UB 3HFVA 5HVGA 4X4SA 2N4DA 3TW0A 3D9BA 5I3UA 2RE1A 3DI6A 2VBXA 4DR2F 2FVQA 3HHKA 1XMQF 2UV8A 2KM8C 4CIOA 2C3MA 1U1MA 1YRTA 5IWAF 2AHOB 3CDUA 2ZC3A 3CJKA 4MKAA 4PG7A 3AD7C 4YR2A 1SQGA 2K7KA 3RUBL 2FJDB 5D78A 3OLBA 1RWNB 4NLSA 4ZDNA 1R89A 5KTQA 1JKHA 1IM4A 2DEJA 4ED5A 4ZVEA 2YX7A 1BC6A 1R8AA 2B0GA 4J9RA 3IXQA 1KQSR 4X4UA 1RTHA 4ZPWR 1RTIB 2IBOA 5A2QY 1OY8A 4J91A 1RE1B 2E5JA 4CM0A 1KKHA 2DEIA 2R42A 1H2VZ 2DNYA 2ROEA 1J27A 4I0WA 4K2XA 2J9EA 4JI0J 3IGNA 3SI8A 5FLXU 1MWYA 3ZXWA 4JI5F 4HHJA 3WC0A 3K5LA 5ETLA 4ICLB 2FVSA 4C8OA 3JTNA 2B7BB 3O2IA 5CCMA 2BJ8A 3MAQA 3D5MA 2CPEA 3C15A 2XSJA 1NBEB 1TKXA 3PHTA 3C14B 2FJAB 1VQ5S 5HK4A 4C8YA 3MXHP 1YGYA 3KFWX 4QR0A 4DR2J 3NBPA 2NPFA 4O4GB 2R2RA 1XMQJ 2B43A 3MM5A 1LFPA 2P5VA 4P9SA 5IWAJ 1GMVA 4CH7A 1UZHA 4QIVA 4M5IA 4XPEA 2RQCA 2MEWA 4ZOSA 1YBAA 3SDEA 4B08A 3DOKB 2E1CA 1N5SA 4IKAA 2CQHA 3DLEA 2HNYB 2GVDB 2BANA 2Q6BA 2YVSA 2GGPB 1RT1B 3CMQA 1GNKA 4M5NA 4XPCA 4N8OA 4Z2XA 1JLQB 2J76E 4FYVB 2JLGA 1S97A 4JI5J 3HHLB 1JLFB 3ISNC 2QL5B 5KFNA 2ZE2B 2YWFA 4MMOA 2XYGB 3TUZC 1OWXA 3DHWC 2HWTA 2A18A 1FJCA 1FF2A 2C2RA 1MMLA 4Y34A 1TL3A 4F36A 4KFBB 5CHCB 1YDLA 1LWXA 3GIKA 4BDPA 4B9MA 2V4JB 1RT6A 1RAOA 2QSFA 1DJ0A 3OFGA 4IH7A 2KU7A 1S1UA 5E7OB 2MZSA 5I42B 2VONA 4YB7A 4WTOB 2GQCA 3P4UB 3G8SA 2XO7A 1FDNA 3DRRB 2XM3A 3NG8A 1VR6A 1S77D 1RZMA 3WDOA 2GHWA 4ZVQB 4DDFA 2NQPA 4G6VB 1SUQA 1AT1B 2MDAA 4IDKB 3WZ0A 4ANCA 1VCTA 3ET6A 2QMXA 3KJVB 3DMJB 1NLKL 1PSDA 3K7RA 4WIQA 3SQOP 4WKRA 2HNDB 2JEFA 3DRXA 3AH6A 2WW8A 2XO6A 3CCRS 4K59A 4ALZA 3GYXB 4PEOA 4CTAA 5ETVA 1WTFA 4DZ6A 4PG8A 2NREA 5D0RA 3PDNA 3RZAA 3U1NA 3DGPB 2QZ8A 2MQMA 1R0AA 1H7WA 3J7Z5 4K0KF 1IUJA 3JYTA 3HZEA 4L73A 1Z1ZA 1FFWB 3MMAA 4NEZA 3ELHA 2FHOB 1UWAA 1S9GB 5A2QU 1HHQA 1Y4ZB 4I2PA 1T02A 4U9RA 4R25A 4DL4A 1XJWB 3FQKA 1HD1A 1LW2B 1PO6A 1NSAA 2Y1JA 2DKOB 3UVJA 1LW0B 3M8YA 3MAAA 3M8RA 1ZM2A 4L75A 2VQFF 4YN3B 4ZKAA 3BN4A 2M52A 2UUWA 2KZMA 3SIPB 1YLXA 3IBFB 2CJAA 4I1TA 1NH8A 4MT1A 4WXWA 4DQSA 2DGVA 3SFUA 1NSKL 3NEKA 1JLAA 3QRRA 3M4XA 1FERA 1X4EA 5E3RA 1XR6A 2ACMA 2GIQA 4C98A 1R8BA 1CJUB 2ZWPA 2RRBA 1HNVA 3SSSA 1VOMA 5IT9U 4URSA 4OX7A 2JFDA 2MKKA 4RW8B 1HBNA 3ILOA 1ZM9A 3D6MB 3CCJS 4GVBB 2B4UA 4C48A 2D3ZA 5C2CA 1WHYA 2CJBA 4OX9F 4K0KJ 4KHMA 2DGOA 2QLJB 3FJ2A 1WC4A 1UWBB 3DM2B 4S0MA 4ETXA 3NOGA 1RP5A 4OHYA 1H2UX 4O3NA 1NZAA 1XK8A 1C1CB 4OZ5A 2DR5A 2LQ5A 1WG1A 2ZH7A 1WC0A 3RU0A 4WP3A 1GXTA 4AL6A 2BRKA 2QL7B 1DTQB 2RH3A 3M8PA 4C3KA 5T7LB 1TK0A 4IFYA 3S8SA 1LQ9A 1T94A 4RBUA 2G2OA 4UOFA 1SI9A 1X5PA 3M6WA 3EVMA 2VQFJ 2PSZA 5M2UA 1RXOB 4U7CA 3HO1A 4V1Ak 3D3BJ 1VBXA 1F5AA 2F63A 3ZZPA 1I94F 7FDRA 4GVLA 2W8KA 3MOZA 4X64J 3ZZTA 1HW8A 2J5AA 2ZOGA 2CQ1A 1TQLA 1KR4A 3TJ8A 4KH0B 4OQJA 2XG8A 3GG0A 2BKPA 2I0XA 2XGPA 1UL3A 2HHSA 4IH6A 3DOMA 1FNMA 4YUDA 3BH7B 2YQ3A 1GMWA 2ZD1B 1VBKA 3OVSA 1S5ZA 3ITHB 4ZITA 2DXEA 5T14A 2C2KB 1XNQF 1U49A 1HWKA 5GAGU 1U45A 4OX9J 2MZ1A 2UU9F 1T05B 2CZ4A 1NNDA 1NPKA 1C1BB 2CVEA 2DD8S 5BJRA 2DO0A 3A8KA 1KLNA 3R5DA 1KLMA 4LR7A 5BYQA 1KSPA 4ED7A 3GV8B 5D77A 4P73A 1BQMA 3ZFVA 2M2BA 4EI2A 4QWDA 4I6WA 1F5BA 4AYBD 4ZVOB 4DQRA 3LO3A 3G96A 2IHR1 2B9WA 1I94J 3BBBA 1NU4A 5LL6d 1RHJB 2GW8A 4J90A 4UF4A 3CCZA 2PD1A 3AJ1A 2C2MB 1FK9A 1VQMS 4MIBA 1R27B 3PRVA 2DNPA 2FHJA 4LQ3A 3Q8PB 4LRAA 1HPZB 4QW9A 2D7SA 2DNQA 2Z57B 3EMTA 1S7IA 3MEGA 4BWMA 2W9BB 4HTJA 4U7UD 2GS8A 3OJSA 4PXCA 4AFFA 2IAJA 1XNQJ 2XZDB 5ETQA 4U8VA 2I5JA 3C6TB 3AD9C 3PACA 3KK1A 2UU9J 1Z2ZA 4J9UE 1KHVA 3HFKA 2BBEA 4CI0B 3V6KA 1SL1A 1HNIB 3MM6B 2KO1A 4E2FB 5K8OA 1RT2B 2IJRA 1V6HA 1ZYQA 2RDDA 2V0NA 3CJTA 5CZVA 1R6VA 2OPPA 2WTFA 3CC2S 3KHGA 4OHVA 2FZCB 3TAMB 2OPQB 4IO9Q 4FBUA 3KK2A 1AW0A 4DS4A 2ZDOA 1YZ7A 2QEXS 3DLKB 2X1FA 2QA4G 3IWXA 2BW7A 4DLEA 4CCHA 1P9QC 3GPAA 3J7AN 4K4XA 2V94A 1UCNA 4LSLA 4O0NA 4NWBA 3T1HF 4KO0B 2OSRA 3ISND 1TL4A 4JI3F 2MKYA 4ECUA 4OI2A 3GONA 2P9GA 2RUSA 3C2PA 3Q89A 4LT6A 4RBVA 4Y2MA 5B0AA 2KFNA 3MEDB 2AJ1A 4FXDA 4OZJA 1S1WB 2HS0A 3I0SA 1FXDA 5KG0A 4J9KA 3OQ2A 3QZ8A 3HULA 1KBRA 2EFQA 2K2PA 1HQEA 3W1YC 4OFZA 4FVCA 3OL9A 4ZLLA 2XMUA 1K1QA 2W4PA 3GTYX 1EP4A 5F8JA 1JLEB 4A8OA 1JJCB 2VU5A 3E51A 2EFPA 4YQWA 3OL7A 1IR1A 1KTQA 1KQGB 4DOZA 1NDKA 1KC8T 1F2GA 4WP8A 5JXSA 4DL2A 2ZBPA 2ADBA 1NSQA 1S1XA 4UTGA 2ZJQQ 1EB0A 1OPZA 2HHHF 4PQUA 3NGDA 2VC0A 4PPZA 1WNEA 5KOWA 2CRLA 3CCQS 3LP2A 3MCOA 3L7PA 5HLFB 4CNYA 3T1HJ 1M90T 1VC0A 2DH7A 2W2QP 2YQ0A 2C2OB 2Z2LA 4JI3J 1RDRA 1YJ7A 1Y5NB 4RLEA 1NJIT 4A8YA 4MKYA 2QRRA 1VQLS 3QO9B 5A8RB 4HEA9 2ZHOA 3W2WA 2SXLA 2V8DA 2QLFB 4Q2MA 4TYBA 1RA7A 2QA2A 5FJ4A 4RWWA 4M5JA 3T5KA 5H9FK 4I4BA 1FDAA 5KG5A 3BF4A 4ZP7A 4RPFA 2OI2A 3DLLQ 4DU7A 2CJXB 3HT0A 3IA0A 2YXLA 5ETNA 3PX4A 4C6AA 3P8BB 5DZ6A 2J7WA 2DXDA 4LF7J 2IMOA 2J0XA 1VGYA 3SMZA 2I2YA 2NUUG 3TA1A 2IRYA 4ED0A 1FO1A 1JB0C 1KOOA 2VIHA 4DPOA 2WBMA 2C28A 1S6QB 1HNWF 2IM0A 2W8LA 2XY7A 2E7WA 2XHWA 2ZC4A 2I6WA 3MPYA 2M7SA 2VG7A 1S79A 3AQPA 4HVZA 4KGZB 3NL0A 3I82A 1OYEA 4Q45A 5IOLA 1WHVA 1REVB 3RB0A 1HA1A 3TJAA 1IKVA 2RQKA 5IV3A 1UFKA 1D0EA 1Y3JA 2EG2A 4P7VA 4NASA 1U02A 4U7UK 2W2OP 4ZIVA 3LA0A 4RKUC 3VALA 3BR9A 3D6FB 4C9DA 1TVRA 1Q82T 1CPZA 2QJ3A 3AY0A 2YWGA 1NPPA 1VLOA 3M8QA 1YIJS 5KFEA 2QX0A 4HKQA 1HMVA 5HQ8A 3PIPQ 2HRYA 3O6QA 5KFVA 4IR9A 4DFJA 3RJMB 1HARA 2YWKA 4KV8B 4L3NA 2MJUA 4H54A 3EGWB 4M8LA 4WYWA 1KFDA 2CG4A 3FCHA 5F8GA 2UZAA 2ZUAA 3POTB 1Q7LB 1UVLA 2LFVA 1BGXT 4KPYA 2NXJA 5F3ZA 4WK1A 4ZVHA 2VD3A 2MKHA 4KAIA 1JLGB 2DHHA 3C19A 1EETB 3MMBA 4DL3A 3SEOA 2CQ0A 2BQRA 1W25A 2LA6A 2OSQA 5IXUA 3JQJA 2ZBCA 5CXTA 1PILA 1FD2A 2FLLA 4J9QA 3J80Y 4ECQA 2Z2ZA 4YEAA 1SKWA 4DJBA 1IWGA 4ATNA 5J2PA 2RT3A 1BQNA 1QTNB 1S1TB 3LALA 1GEHA 3KLIB 2CJYB 3RRGA 4WE1B 4OIXA 1X4DA 5CA5A 1XTZA 4ID8A 3OL6A 1OSDA 2DRDA 2P9CA 2YNIB 4CQ1A 2GX8A 4TY8B 1KWMA 4LFAF 3EDRB 4EBDA 2M3DA 2KJWA 4RBTA 3KHHA 1RWVB 4Y0FA 2DR8A 1VQSA 1WJ9A 1RBLA 4HACA 5E3QA 1XR7A 5I3PA 4J5OA 4KY3A 1M0SA 3WIUA 2MLXA 1KVKA 4J9PA 1Q5YA 2ZOMA 2B4VA 5AE1A 2Z2MA 4DZDA 1DQAA 3K59A 2DK2A 2CJKA 1VHIA 1FXLA 2RDIA 4MIAA 2CADA 4OX6A 5GAHU 5ADZA 4H4KC 1SV5A 2HFOA 4F67A 1SKRA 4EWTA 3MURP 2UUTA 2HURA 4ZPDA 4FF1A 2B51A 1WF0A 3QPIA 1HR0F 2F5GA 3ZC4A 4B3OB 1EHWA 5DZ7A 4JYAF 1YG0A 3UCUP 3GE9A 2G0JA 5J2MA 4ILMA 1B0PA 4UOCA 1RHMB 2GA7A 3WX4A 4LSNA 3HHLC 1CEZA 4DR6J 5C5JA 3ZNUA 1TMMA 2X7IA 3VHQA 3SQGB 3HD2A 4NL5A 2GJ2A 3M8SA 2GZOA 2YNGB 5K20B 2EFVA 5KFHA 3AOAA 2FJWA 2KG1A 4LFAJ 1HBUB 2IM3A 1WI8A 3AXMA 2XWXA 3HD1A 5JMNA 5A6WA 5GMDA 4NLXA 2AGOA 2AQ4A 3VAJA 4KHPF 3Q0AA 5GADU 2VASA 3ISZA 2NXEA 4J9LA 4LF4F 2VG6B 2HQFA 2VBWA 5B0FA 1GTHA 4ELUA 1L3SA 2YWEA 1Q7YT 3AAWB 1WKKA 3BGRB 2B9EA 3GJSB 2B7CB 3GFYA 3OXFA 1GX6A 4H4OB 1RWOB 4IO1A 2PEHA 1O6XA 4NLRA 1BQXA 2B4PA 4F3MA 4N56A 2PDAA 2Z58B 4ZVFA 3PO5A 5CYQB 2C2ZB 3IG1A 1HR0J 3M32A 1Y9OA 3C8YA 3PYGA 2JEIA 1HBOA 4Z7YA 2ZJPQ 1RTDA 2LEAA 3KJQB 4JYAJ 2HQDA 5DS7A 2FC8A 3VCDA 4C11A 1TL7B 1SPBP 2VF3A 2PI4A 3H5SA 4P2FA 4M1KA 2ZFHA 4I2QB 1PBUA 1O8BA 5D0EA 2R7OA 4PG5A 5JVHQ 2NCKL 1B7FA 3U27A 1UP1A 2W4CA 3J7YU 3JSMB 2QLXA 1Q95G 2YKQA 3DRPA 4AL5A 3UD4P 3FBBA 1SH3A 1WHWA 2OKQA 2IVMA 2VA3A 5G0RB 4MFBB 4D3HA 4KHPJ 2FB0A 1FRMA 2FVPA 4LF4J 3J80U 2BA9A 4ED2A 1NAQA 1T0TV 1HL6A 4DV1F 1RTJB 3H59A 3A8EA 3K58A 1XMBA 1UW9A 2KYZA 4C3LA 2XNQA 2Z8QA 2NUHA 3C6UB 3JAMY 5IC6B 2CWXA 1T7PA 2V34A 3KK3B 4R0JA 2K3IA 2FHJD 4NRTA 2R7TA 8RUCA 3DRSA 4ZPTR 3W5YA 3IO1A 2EG1A 2W1BA 3CD0A 4LIRA 1F3FA 2R2TA 1ZAWA 4GO7X 2PE8A 1J5OA 1QUPA 5KT3A 2W9CA 5E2QA 1WDTA 2WCXA 2JVOA 5H9FJ 4DX8H 4YDXA 4KBIA 4DSEA 4I7FB 2OD6A 4YFUA 3K89A 2YNFA 5KAKA 3D3CJ 4RW4A 5F8HA 4IUFA 3MPUB 5MAOA 2N4CA 2J0SD 3NNAA 4A46A 3NGRA 3CO0P 2DNOA 4DSLA 4JI8F 2L41A 4CLPA 2A0FB 3TVZA 5KFJA 2GNKA 3KLHA 3LPEA 3ZZ0A 4DV1J 4LR9A 1S4FA 3KLGB 5L1IA 4DV7F 4L3KA 4NLGA 3MTJA 2LQBA 5KT6A 3IRXB 5KFLA 1IR2A 1WC3A 1SB6A 3PEJA 5E3AA 3I31A 2XZWA 2HZAA 2ZBQA 1F0XA 1QUVA 2I1RA 3W2VB 3F41A 3L09A 1DRZA 1D9AA 4O23A 1ITPA 1RISA 4DI6A 3BM7A 5IQ6A 1OY6A 1QSSA 4WP9A 4PWDB 1HD0A 2UVRA 2M88A 5LM7E 4DMZA 2YKMB 2R7QA 3AT1B 3R2CJ 4IR1A 2C1EB 3BEGB 1IBCB 1KD1T 3VVTA 3DCAA 3GJRB 3QZ7A 3OXLA
chains in the Genus database with same CATH topology
3D6FB 1PAUB 1RHJB 2CJXB 2Y0BB 2H4YB 2XYHB 1QTNB 4DCOB 1SC4B 3R5JB 2QLBB 1SC3B 4ZVQB 4JB8B 1F9EB 2CJYB 2QLJB 2C2ZB 2Y1LB 1NMEB 2DKOB 2H48B 2C2MB 1RHMB 2C2KB 1RWMB 1RHQB 3KJNB 1QDUB 3EDRB 2CDRB 3RJMB 4ZVSB 2P2CB 3KJQB 1RWVB 1SC1B 3R6LB 3R7BB 3D6HB 1GFWB 5IC6B 1RWXB 2QL7B 1I3OB 4ZVTB 2QL5B 2HBYB 3GJTB 3SIPB 2XYGB 2XYPB 1RHUB 5K20B 1RHRB 2XZDB 4ZVRB 1RWKB 3IBFB 3QNWB 4DCPB 3P45B 2CNNB 2C2OB 3IBCB 1RHKB 2FQQB 1RWNB 5IC4B 2XZTB 1BMQB 2H5IB 3R7SB 3EDQB 2CNOB 4ZVUB 2H54B 2H4WB 3GJQB 3NS7B 2QLFB 1RWWB 1ICEB 4ZVOB 4LSZB 2H5JB 4ZVPB 2CNLB 2QL9B 4DCJB 2HBZB 2H65B 3R6GB 2C1EB 2HBRB 3GJSB 1IBCB 3D6MB 1RE1B 2H51B 3GJRB 3P4UB 1PYOB 1RWPB 3KJFB 2CNKB 3R7NB 1RWOB 1I51B 2HBQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6F B;  1PAU B;  1RHJ B;  2CJX B;  2Y0B B;  2H4Y B;  2XYH B;  1QTN B;  4DCO B;  1SC4 B;  3R5J B;  2QLB B;  1SC3 B;  4ZVQ B;  4JB8 B;  1F9E B;  2CJY B;  2QLJ B;  2C2Z B;  2Y1L B;  1NME B;  2DKO B;  2H48 B;  2C2M B;  1RHM B;  2C2K B;  1RWM B;  1RHQ B;  3KJN B;  1QDU B;  3EDR B;  2CDR B;  3RJM B;  4ZVS B;  2P2C B;  3KJQ B;  1RWV B;  1SC1 B;  3R6L B;  3R7B B;  3D6H B;  1GFW B;  5IC6 B;  1RWX B;  2QL7 B;  1I3O B;  4ZVT B;  2QL5 B;  2HBY B;  3GJT B;  3SIP B;  2XYG B;  2XYP B;  1RHU B;  5K20 B;  1RHR B;  2XZD B;  4ZVR B;  1RWK B;  3IBF B;  3QNW B;  4DCP B;  3P45 B;  2CNN B;  2C2O B;  3IBC B;  1RHK B;  2FQQ B;  1RWN B;  5IC4 B;  2XZT B;  1BMQ B;  2H5I B;  3R7S B;  3EDQ B;  2CNO B;  4ZVU B;  2H54 B;  2H4W B;  3GJQ B;  3NS7 B;  2QLF B;  1RWW B;  1ICE B;  4ZVO B;  4LSZ B;  2H5J B;  4ZVP B;  2CNL B;  2QL9 B;  4DCJ B;  2HBZ B;  2H65 B;  3R6G B;  2C1E B;  2HBR B;  3GJS B;  1IBC B;  3D6M B;  1RE1 B;  2H51 B;  3GJR B;  3P4U B;  1PYO B;  1RWP B;  3KJF B;  2CNK B;  3R7N B;  1RWO B;  1I51 B;  2HBQ B; 
#chains in the Genus database with same CATH topology
 3K2Y A;  3TVY A;  3BH6 B;  3DU5 A;  3ZO7 A;  2G2Y A;  1ZAV A;  3QLH A;  4PYD A;  2CA9 A;  4RNN A;  2G4B A;  1VJW A;  1LWC A;  3NXZ A;  1PYS B;  1NPR A;  2HLT A;  3QT7 A;  2DT9 A;  3MM7 A;  2AEF A;  4OHZ A;  3KG0 A;  3HZG A;  3R5C A;  4X4O A;  2V8V A;  4TVA B;  3A4T A;  2GC8 A;  4JI8 J;  4RUA A;  3PHE A;  3UN3 A;  4X66 F;  1K73 T;  3QGH A;  2HNZ B;  5B0B A;  1NK4 A;  3IN5 A;  5D8H B;  2PC6 A;  4M5D B;  4DV7 J;  1DFD A;  4P52 A;  3LPY A;  3M2U A;  1PC4 A;  2MQQ A;  1QVG R;  4KGM A;  1KFS A;  4QIE A;  4NCG A;  5KG1 A;  2ROG A;  2Y8W A;  5GME A;  4I64 A;  2H4W B;  3AXK A;  3VR1 A;  2PFD A;  2W7O A;  2XB2 D;  4FXW A;  3BRE A;  3OD2 A;  2CXE A;  3JQK A;  5J2Q B;  3MEC B;  4U6P A;  2OEM A;  4IG3 A;  3R27 A;  2CQ4 A;  5B0G A;  4F7V A;  3DYA B;  4RW6 A;  5KFI A;  2CNK B;  4PXE A;  1OIA A;  4K4U A;  5A8K A;  2LQ8 A;  1B0T A;  3N79 A;  3RAX A;  2M8D B;  4OLO A;  4QIF A;  2ZNY A;  2DJW A;  1FDB A;  2M0G B;  4P75 A;  1IN0 A;  4EYI B;  2FGO A;  4WKY A;  3R97 A;  2DIT A;  3TRG A;  5H9E J;  1CBK A;  2WON A;  4NI2 B;  3IS9 B;  2CJQ A;  4DL6 A;  1WF1 A;  1CC7 A;  2B6A B;  1GFW B;  2FD2 A;  4N5S A;  4NXM F;  3RBZ A;  4DPW A;  1IQT A;  1NDP A;  3K5O A;  4E98 A;  5AXN A;  4HHH A;  5F9L A;  4JUZ A;  3LGH A;  1RAG B;  1R43 A;  2O3D A;  3T19 A;  2EFN A;  2XS7 A;  1R8C A;  4K4Y A;  1FRI A;  5I3U B;  4DBQ A;  3IWN C;  5DG7 A;  2DGS A;  4X66 J;  4DLG A;  5C24 B;  3BJY A;  1OO0 B;  3PO4 A;  3IP0 A;  1A7G E;  2KXF A;  4HHU A;  3HSZ A;  2BE2 A;  3CJK B;  2IA0 A;  2KJV A;  1TR0 A;  3KNA A;  3FBE A;  2YKP A;  3W64 A;  1D09 B;  1JKH B;  1HI8 A;  1FCA A;  3MF5 A;  1PYO B;  3CJR A;  3N6L A;  2UP1 A;  2DNN A;  1I51 B;  4FF2 A;  1U0H A;  2DHA A;  1MU2 A;  3W62 A;  4AL7 A;  2K1R A;  1QAJ A;  1SC4 B;  1NKE A;  2Y3Y A;  3GU0 A;  2XMV A;  3KOA A;  4AXJ A;  2YWH A;  1RCX B;  2DNM A;  2HIY A;  1I5O B;  3AHP A;  1FKP B;  2GAH C;  3HVW A;  4LRC A;  1X4F A;  3ETM A;  4AT1 B;  1FTC A;  5J2N A;  3H4B A;  5RUB A;  4RW7 A;  4K4Z A;  1RAD B;  1EX8 A;  1QAY A;  4P2S A;  2RVJ A;  4Q0B B;  2DO4 A;  1RQ0 A;  2F3J A;  2XY6 A;  4NXM J;  2RHQ B;  3C15 B;  2XSJ B;  3CJS A;  3EVO A;  3ICL A;  3VAF A;  4LRD A;  4TQS A;  4NRU A;  4B3S F;  3SBM A;  3GMG A;  4CLF A;  1VBY A;  1Q8B A;  2BJ3 A;  1U1O A;  3EX7 B;  1RB0 A;  1L3V A;  1TL5 A;  3BV8 A;  1T3O A;  5EX0 A;  2A6O A;  1FWP A;  4EU0 A;  4F3Q A;  3NBP B;  1B4S A;  1FKA F;  1YX2 A;  1ZA1 B;  5E3P A;  4GO5 X;  4JBC A;  4KKO A;  3MM5 B;  2LA4 A;  4DSI A;  1KN6 A;  2GO9 A;  4LVN P;  3V5R A;  3PJX A;  1AXQ A;  2GHP A;  2BMB A;  2IC3 A;  4W92 B;  1RLC L;  2R7V A;  1UPP A;  4FYX B;  3SDE B;  1N5V A;  2CQP A;  4KC5 A;  1F9F A;  4QU7 A;  1U1K A;  3HSD A;  3MR2 A;  3QGI A;  2C2E A;  3DLE B;  4CLY A;  3CC4 S;  1R31 A;  2P2C B;  1QSL A;  3A12 A;  4ICL A;  1XWL A;  2BAN B;  5F41 A;  1DLO B;  1YJU A;  3GCX P;  1CS4 B;  2GHV C;  3Q8R B;  4ED6 A;  4OHX A;  1NH7 A;  1NZ8 A;  2WHO A;  3CCS S;  1M5V C;  1YJT A;  4QIW D;  2D9O A;  2MHE A;  2WZ1 A;  3M6V A;  1S0N A;  5HRO B;  2PMH A;  2YH0 A;  1VQ9 S;  2UXB F;  3K0J A;  1L3T A;  3UO0 A;  4O4G A;  1TL3 B;  4QBU A;  4YP3 A;  5CAA A;  1V5I B;  1N56 A;  2Z4P A;  3G86 A;  4USH A;  4DCJ B;  5DM6 Q;  4JV1 A;  4PXB A;  4DV4 F;  1SQF A;  3MOJ B;  4CWB A;  1TL1 A;  2R8I A;  4B3S J;  2ADC A;  1RT6 B;  2MQP A;  4B9T A;  3BGU A;  4JI2 F;  1S1U B;  4H4K A;  5LSO A;  3DOK A;  5KT2 A;  1S76 D;  1YRU A;  3I87 A;  1WOP A;  2OHD A;  4Y65 A;  1Y0H A;  2XSF A;  4YR0 A;  3OFE A;  2CPI A;  4DV2 F;  2KN4 A;  3P5B P;  2HNY A;  2QFI A;  3B6B A;  3I4P A;  5E33 A;  1M5P C;  3L9Z A;  2GGP A;  2G0I A;  3MR5 A;  4UQG A;  2V63 A;  4ZPV R;  4EMD A;  1SUQ B;  2Q1L A;  4ZVT B;  3ET6 B;  4PR6 A;  3NOC A;  3AJD A;  5IZH A;  1TKT A;  5HP1 B;  1N34 F;  5LMU F;  4K5S A;  3PFO A;  1RI7 A;  3D7S B;  1VRU B;  1YWX A;  1SKS A;  1N36 J;  1FI4 A;  4CTA B;  1RCO B;  2DGQ A;  1XQI A;  1WOR A;  2V4J A;  3B8H A;  4UZB A;  1RA6 A;  2X1A A;  4Q5V A;  2PEB A;  2NYH A;  4M95 A;  1RLD A;  5I42 A;  3P96 A;  4WK3 A;  1YQH A;  2UXB J;  1SJ3 P;  2VOP A;  1FTR A;  5LSR A;  2HLU A;  3MFI A;  1R0A B;  3D0G E;  3H5Y A;  1R0C B;  4ED3 A;  3D0I E;  4IOB A;  1KRP A;  4XDD A;  4ZN1 A;  4HT5 A;  2JDJ A;  5EUH A;  4QOT A;  4RU9 A;  3JYT B;  1HFE L;  1ZAX A;  4DV4 J;  1FRH A;  5U47 A;  1VYA A;  4URQ U;  2ILY A;  4IDK A;  1VQ6 S;  4JI2 J;  4NLP A;  4I2P B;  1N0U A;  3O5T B;  4UOG A;  4DV2 J;  4OZ1 A;  3UDC A;  2V2K A;  2WVF A;  3CCU S;  4F4X A;  1T95 A;  3UVJ B;  1GTE A;  1U26 A;  3CSK A;  1MN9 A;  3VAM A;  3G2X A;  2C2N A;  3QGP A;  3EXY A;  1M5S A;  1PJ6 A;  2CQG A;  4ZPB A;  3GIL A;  1NK6 A;  5A76 A;  1MSW D;  3DGV A;  3DGP A;  3SSR A;  1N34 J;  2MKS A;  2EVZ A;  3BZQ A;  3K8W A;  4O3P A;  2RS2 A;  3MMC A;  3MHY A;  4OMF G;  3HP6 A;  2MB0 B;  1DTT A;  4LBI A;  2BEF A;  2HHX A;  1VC5 A;  3D66 A;  5D4N A;  4GMK A;  1EAY C;  2YPY A;  2Z2Y B;  1CQN A;  2OEK A;  2CJ9 A;  3TUI C;  5ETT A;  4P2X A;  5ETR A;  4RNM A;  2W01 A;  3M30 B;  1HBN B;  4DV0 J;  2HQI A;  2V8H A;  2JZ5 A;  2XGQ A;  4QCL A;  2D69 A;  1NB2 A;  3G87 A;  1PAE X;  1LW0 A;  5CH7 B;  3D2W A;  2MGZ A;  3OR2 B;  2OPS A;  2C3Y A;  4Q8F A;  2XNR A;  3HF5 A;  2IFX A;  2APO A;  2UUA F;  1LXJ A;  2RRA A;  3FEZ A;  5HMW A;  3N9U C;  4WII A;  2Q79 A;  3AJ2 A;  3M8P B;  4J9N A;  4IFY B;  5KFP A;  3SFG A;  3LGM A;  1FEE A;  5K14 A;  1C2P A;  1L5U A;  3NMA A;  2CPF A;  2OMO A;  2V9K A;  1TV6 B;  3NS5 A;  3VGU A;  1Q81 T;  2P6T A;  2EK6 A;  3MM8 A;  1LOU A;  3UQS A;  2MXY A;  5E0O A;  2MPU A;  4F2R A;  2KFY A;  2ZUG A;  2ZH3 A;  5B7W A;  2BJ1 A;  1X4B A;  1SC3 B;  5FDL A;  1ZM4 A;  4KRW A;  4X65 F;  1DQ9 A;  3QJJ A;  4HI1 A;  2KKH A;  1OPI A;  3DM2 A;  3KJN B;  1FX2 A;  3ILL A;  1C1C A;  5HSP A;  5E41 A;  3M8Z A;  2BE9 B;  4UOH A;  4NLU A;  2GVZ A;  5F9N A;  4A4J A;  4DUY F;  1JIH A;  2F8M A;  1H3D A;  2HMI A;  1TKZ A;  4RWX A;  1Q0N A;  2UVV A;  4DPU A;  1V5V A;  1LXN A;  3K5P A;  2VQE F;  4K5R A;  5L1K A;  4QPX A;  4LF9 J;  2UUA J;  2IRX A;  3TI0 A;  1QM9 A;  2QYC A;  2VFR A;  1JX4 A;  3EPI A;  4FVM A;  5KFT A;  4NLT A;  1KLM B;  1PC5 A;  3HLU A;  5M2R A;  1KNZ A;  1CQM A;  3TQ1 A;  4XAK A;  2MST A;  2AX1 A;  4F25 A;  5HAN A;  4OZ2 A;  1ZPW X;  5HJX A;  2JNJ A;  4F26 A;  4H4M B;  3PV8 A;  2V4R A;  4QIG A;  3OSP A;  3A8I A;  2U2F A;  4DS5 A;  3MUV P;  2ZD1 A;  1S0O A;  1SIZ A;  1EQM A;  4NZ0 A;  1TMJ A;  3ZZU A;  2HZC A;  5C25 B;  2JL9 A;  4X65 J;  3HMJ G;  2B8P A;  4P71 A;  1T05 A;  5G4D A;  1IM6 A;  3MD3 A;  1FK9 B;  4TU8 A;  4CLS A;  5BXI A;  3LTO A;  3U1M A;  1NDL A;  1Y11 A;  3OV7 A;  1RK8 A;  2G1H A;  4DR3 F;  1HW9 A;  2LU1 A;  3LUY A;  2QE5 A;  4X4V A;  1M5O C;  2M4M A;  3H4D A;  2RQM A;  2IAJ B;  5CD4 A;  1T9Y A;  3TR5 A;  2I5J B;  4C8M A;  4DUY J;  2W2N P;  3KK1 B;  4ECY A;  3KLE A;  2XMK A;  2VQE J;  3QT8 A;  3OHB A;  3QJP A;  4MIW A;  3W66 A;  1WEL A;  4BC9 A;  1X5T A;  3BQ2 A;  2ASL A;  5K8P A;  1FNO A;  1D9F A;  3EVW A;  4X62 F;  5AE2 A;  3CCL S;  2EFO A;  4R5P A;  5AXM A;  3PXG a;  2OPP B;  4B9N A;  3CC7 S;  3R5J B;  5EWE A;  2DNR A;  4JI6 F;  3KK2 B;  1FEH A;  1ULR A;  3TA0 A;  3FNN A;  2CQ2 A;  2JFK A;  4TU9 A;  3KLV A;  3CD6 S;  4ELV A;  3I9Z A;  3Q2S C;  4CP5 A;  1N33 F;  3CD5 A;  1YVF A;  4LQ9 A;  3KG1 A;  2W9B A;  4IH5 A;  4Q8E A;  3SZ2 A;  3I0R A;  1RHU B;  1APS A;  4O3O A;  1S49 A;  2YNH B;  3FCW A;  4LSL B;  3BBC A;  4USM A;  2KT3 A;  2KYX A;  4MK8 A;  3GR1 A;  2PI5 A;  4F0H A;  1JXV A;  1UVM A;  1RT7 A;  3WHI A;  3TEH B;  2FDN A;  4GKJ F;  2KB2 A;  3NP5 A;  3C46 A;  5ITH A;  3ENW A;  2ILZ A;  3PW4 A;  4DR3 J;  5GVQ A;  1MWZ A;  1RWW B;  3KUG A;  1HWL A;  2XS5 A;  2BQU A;  3D1O A;  3I0S B;  2ZH9 A;  3TAM A;  3CB4 A;  2VJU A;  3ENA A;  4MYT A;  2IYI A;  4GRS A;  2RU3 A;  3K57 A;  1AFJ A;  2KH9 A;  4IOA Q;  4WU3 A;  3MEE A;  4WU2 A;  1UTA A;  3V4I A;  3LW5 C;  1FHT A;  2BM0 A;  2VUG A;  4NCA A;  2H48 B;  4J9S A;  3UFC X;  2MY7 A;  4X62 J;  3TOQ A;  1RKJ A;  5DDQ C;  1VQO S;  3D6H B;  4DN9 A;  4JI6 J;  1S1X B;  3BGL A;  4FZV A;  3HVA A;  3OR1 B;  4AUK A;  2MYF A;  4RL1 A;  5B0C A;  3E01 B;  5LOQ A;  4PQU B;  4OL8 A;  4L74 A;  1N33 J;  4UZC A;  4WCE Q;  2XLK A;  2WSF C;  3GYN A;  3FRZ A;  3T5J A;  4KSE B;  3LP2 B;  4F2S A;  4FNI A;  3H8Y A;  1SIW B;  2BOA A;  1S1W A;  4IYQ A;  5HMZ A;  3LP1 A;  1H98 A;  4LSZ B;  5KFM A;  3H5X A;  3AD8 C;  3PEH A;  4HH0 A;  3U1L A;  1BD6 A;  3UDV A;  4EFA C;  1SCJ B;  1YJV A;  4GKJ J;  3KJF B;  3W2W B;  3GR0 A;  5HN0 A;  4IRC A;  1WEZ A;  2HBQ B;  5DET A;  1B64 A;  4USV A;  1YHQ S;  2FJX A;  1B3T A;  3EGV A;  2VPW B;  4B9L A;  4CYU A;  1KS2 A;  4WFB Q;  4ZK7 M;  2MY8 A;  1HNX F;  1YJN S;  1AZS A;  5HBM B;  3EZO A;  3FSY A;  1FX4 A;  3UDL A;  1YIT S;  1KTV A;  1K0T A;  1U1Q A;  2VBZ A;  2F8E X;  3DNC A;  5GAG I;  1QSY A;  1Y3K A;  3EIC A;  4BC7 A;  2ZH2 A;  3I4H X;  2WRM A;  4ANE A;  5HLF A;  3MR6 A;  1SVD A;  1O0P A;  2DRA A;  1Q5V A;  5KFD A;  4HL9 A;  2GMH A;  3BO4 A;  2RIJ A;  2OLW A;  3M05 A;  2AJ2 A;  2ASY A;  2QMW A;  5D0G A;  3MDF A;  2LQJ A;  5AJ3 J;  3LWM A;  2ZJR Q;  2A3J A;  1T9U A;  1PJ5 A;  3PRB A;  1PGZ A;  4MKV A;  3A8J A;  4KTQ A;  3OFF A;  2ZM6 F;  3VGT A;  1U24 A;  1IKY A;  3PCO B;  4OZL A;  2L9N A;  1C0T B;  1IKV B;  1VQK S;  2V2V A;  3A3N B;  4ZCK A;  4NOH A;  4QWA A;  1U2C A;  2V8P A;  2Y1L B;  4OYO A;  1IKW A;  4EO8 A;  2DHG A;  4DPX A;  2ZIT A;  1JK9 B;  1CC8 A;  3D67 A;  3IM9 A;  5B0E A;  4N47 A;  2DHS A;  2DCU B;  3G82 B;  3M8Q B;  3A13 A;  5CZX A;  2VFS A;  2DIS A;  1S6Q A;  5DGA A;  3DLG B;  2CWK A;  1RT4 A;  4RZR A;  1HNX J;  4CLL A;  1J5E F;  5AXK A;  3CCE S;  2VBY A;  3Q2T C;  1FWL A;  2QTW A;  3RRH A;  1H73 A;  5HQM A;  1BE4 A;  5A6P A;  5LMN F;  3SCK E;  5L39 A;  1X4H A;  4EUV A;  2ZH6 A;  1N88 A;  3I5C A;  1MMN A;  3EUN A;  2A10 A;  1PJ7 A;  4RJV A;  3BSC A;  2HAI A;  1OJ4 A;  5KG2 A;  1Y5I B;  4LR8 A;  4NLV A;  1CJK A;  3X3U A;  2N7C A;  5K9F A;  5E3C A;  2W25 A;  1AA1 B;  4IQM A;  2XTJ P;  3W9J A;  1WD6 A;  2QLB B;  2DRB A;  2HVZ A;  3ILI A;  3KMS A;  1WDD A;  5ETS A;  5HAO A;  1S59 A;  2ZM6 J;  2AZ3 A;  2EBG A;  5L1L A;  2XY5 A;  2GIF A;  5A0Y B;  2YTC A;  1Q78 A;  4FYW B;  3TO8 A;  3ZTS A;  2E29 A;  5EX3 A;  4IQX A;  3QWU A;  4NLW A;  3G6Y A;  2DPJ A;  1HQU A;  2LKZ A;  2CZV C;  1W2B R;  1JLB B;  4DSF A;  1RT3 A;  2EBE A;  3IBC B;  3POT A;  3A3P B;  4JV0 A;  2MZJ A;  4OYX A;  2OUG A;  3X1L B;  1JLG A;  2KFZ A;  3MFH A;  1Q86 T;  1J5E J;  2D41 A;  4FDF A;  4YS2 A;  5LMN J;  3H42 A;  7AT1 B;  4LFB F;  1TTH B;  5KG7 A;  4UST A;  2HS4 A;  3G8Q A;  3UI3 A;  1PYT A;  4HH1 A;  1SV5 B;  4WWS A;  3MUM P;  1ZZN A;  2J6T A;  3KLI A;  1NME B;  4TNO A;  2E1P A;  1S1V A;  3CME S;  1IKX A;  2DTJ A;  4AD6 A;  1U1L A;  1T03 A;  2YNI A;  2M5Y A;  4X64 F;  1QLN A;  5J2M B;  4QYR A;  1S0V A;  2V5H G;  3PKM A;  1VQ4 S;  3TZY A;  3CJ4 A;  2R7U A;  3EJM A;  3W3S A;  3FRY A;  3QFH A;  2CNN B;  4ZP6 A;  2VPX B;  2FPH X;  2NZ4 A;  2VPY B;  2XZT B;  2XQC A;  3GIM A;  1ZBT A;  3GFZ A;  2NPI A;  4DV3 F;  3GJQ B;  4DUZ F;  4QZV B;  1WHX A;  2LU2 A;  3P5T L;  5BR8 F;  4Y28 C;  2YY3 A;  4RW9 A;  4Y2C A;  3TZX A;  2E5H A;  4DSK A;  3VAK A;  4CO0 A;  2KVQ E;  4X4Q A;  1EQ0 A;  4B3O A;  3QIP A;  2BYC A;  4OJG A;  3Q23 A;  1Z2L A;  2OTL S;  1VRT A;  5HO4 A;  4XK8 C;  3CJ2 A;  4ES1 A;  2MZQ A;  2VB6 A;  4LFB J;  4PAA A;  1TAU A;  3ZTO A;  3KYL A;  4EBE A;  2VA2 A;  2UV8 G;  1MLA A;  3FMB A;  2FHM A;  2V8G A;  1TFW A;  1RBO B;  4WJB A;  2HAF A;  1JJ2 R;  2XMM A;  3IG1 B;  2OFH X;  4YR3 A;  4XO0 A;  4PZV A;  4HYK A;  1S57 A;  4NLD A;  1RYR A;  4LF6 F;  2YNG A;  3J81 j;  3OTD A;  1RTD B;  2X1B A;  4DX6 A;  3QID A;  4DV6 J;  4C11 B;  3HSG A;  2V4Q A;  1NDC A;  1HBU A;  1V3Z A;  3W8G A;  3R7S B;  4P72 A;  1S9E A;  1I6J A;  2V50 A;  4NYO A;  3E2E A;  1RKI A;  4BHQ A;  2EKN A;  4OYI A;  4BWJ A;  3BDE A;  5SUH A;  4DV3 J;  4DUZ J;  3R7N B;  1WF2 A;  1WKL A;  5IM0 A;  1XN9 A;  2MQL A;  2DY1 A;  5BR8 J;  2HVI A;  3OUY A;  2MJN A;  4FF4 A;  2RKI A;  3SSQ A;  5LXR A;  1QAI A;  4NYZ A;  5IV4 A;  2H1Y A;  4U95 A;  4OZ0 A;  1FJ7 A;  1UW4 A;  1NM2 A;  3MZI A;  2W4D A;  3CED A;  4FPR A;  3CTR A;  1TL7 A;  3US5 A;  2ATL A;  2MKC A;  4ZLN A;  2RSQ A;  4A8K A;  5IQQ A;  3W9I A;  2ASJ A;  3J7A 1;  1N5Y A;  1N6Q B;  3K5N A;  4FXV A;  1K0V A;  3PW2 A;  3SV4 A;  1Z4U A;  2XC9 A;  4LF6 J;  5AT1 B;  1TU0 B;  2IVF B;  4FPI A;  2N3O A;  2WVE A;  2Z56 B;  3M2V B;  4K8R A;  1T9V A;  5CAB A;  3RR8 A;  4ER8 A;  3CJQ A;  4ZVP B;  5KFK A;  1GXU A;  1H6K X;  2CNL B;  1HI0 P;  1J5O B;  2W9C B;  1P8G A;  2ZNZ A;  4MYU A;  2R3V A;  4MFB A;  1KEK A;  1VS3 A;  5KFG A;  5KT5 A;  1SJ4 P;  1PAU B;  4I6A A;  1WG4 A;  2UVU A;  1YK9 A;  2L48 A;  3OJU A;  1CJV B;  1MRO A;  2YNF B;  1T9W A;  4HTI A;  1H72 C;  2HIQ A;  2EXU A;  3WBZ A;  2FZG B;  4EGL A;  9RUB A;  1R8H A;  5DO2 A;  2HKE A;  1D1U A;  3C6U A;  5C42 A;  3SV3 A;  4NA2 A;  3NLC A;  4DEZ A;  4WZQ A;  3KLF A;  3RGI A;  4YY3 J;  2NSC A;  3F44 A;  2AWZ A;  7FD1 A;  3KK3 A;  3KLH B;  3QNW B;  2GJI A;  4OI3 A;  4NMX A;  3R2D J;  1RU1 A;  3GLJ A;  3CCW A;  3NWR A;  4OI0 A;  5J1E B;  1B70 B;  4N8N A;  3SCI E;  3ZZR A;  2YBV A;  4NEY A;  1FRJ A;  3HDS A;  3M9M B;  2E5L F;  2HQ3 A;  1N5Q A;  3UR0 A;  3H2L A;  2IJN A;  1AUS L;  1SC6 A;  4WFA Q;  2UUC F;  3D68 A;  2AEJ A;  4ES3 A;  1WC5 A;  2MZT A;  5GAH I;  3O8W A;  4KYZ A;  3I55 S;  4M5G A;  2BV3 A;  3PG9 A;  1WOS A;  1H38 A;  2V69 A;  1P9Y A;  1KDN A;  3HXM A;  4C0O C;  3IWL A;  1TAQ A;  3PW5 A;  2W24 A;  4ZA1 A;  3VTI A;  3QSI A;  2R7X A;  3IC1 A;  4M94 A;  2FLO A;  3Q8S B;  1UJ5 A;  2HQC A;  1S99 A;  1O51 A;  3QLH B;  4CLU A;  1K44 A;  3NAH A;  3PY8 A;  2HWI A;  3PX6 A;  1W2I A;  3IRX A;  1NSP A;  3IR6 B;  1X4A A;  3P45 B;  2IRU A;  1YSJ A;  3MM7 B;  1TEL A;  2HG4 A;  4QPT A;  2H5I B;  2BAB A;  4XIU A;  5SZT A;  2YKO A;  4FYD A;  1M1K T;  1UEV A;  4ITS A;  3CE8 A;  4LF7 F;  1VJQ A;  4NX9 A;  4RUC A;  2OIH A;  4FYY B;  3H90 A;  1S7H A;  2ZDP A;  1IVZ A;  2J8A A;  1RU2 A;  3M2U B;  2E9R X;  4ECT A;  6FD1 A;  4USW A;  3ETO A;  5GAD I;  3KKF A;  3OHA A;  2PA8 D;  3W9H A;  3PYD A;  1UEU A;  3TYT A;  1X31 C;  2E5L J;  5H1S V;  2D3U A;  2ZZN A;  5CYJ A;  1HLW A;  5M2P A;  1RT5 A;  2UUC J;  1X4G A;  3P3D A;  3R5G A;  1QD1 A;  1RYS A;  4RW6 B;  3PFE A;  4DG1 A;  5A8K B;  2AD9 A;  3E3X A;  4JV2 A;  3ZTR A;  1URN A;  1LK5 A;  5CD4 H;  3R6L B;  2BR0 A;  4F04 B;  1T9X A;  2FC9 A;  3OPK A;  2DIV A;  1AB8 A;  4DUT A;  5KFY A;  5EWF A;  2VH7 A;  1JLC A;  4R0E A;  3V2U C;  3RW7 A;  2WON B;  2IDL A;  2R7R A;  4WFY A;  1NK9 A;  2H3E B;  3V81 A;  2Y8Y A;  5T41 A;  2DB1 A;  1RAB B;  3CMA S;  1HYS B;  1RAF B;  4YB5 A;  1CJT A;  3IR5 B;  3D1H A;  2XMA A;  3CCV S;  4C8N A;  2YKN A;  1LWE B;  4CLK A;  3NNH A;  2ERR A;  4B17 A;  2VL1 A;  1XNR J;  3C66 A;  2HBZ B;  3J7Y I;  1BUX A;  1PKU A;  1A9N B;  2K7J A;  1H0H B;  2W9A A;  1WKJ A;  1RAJ A;  2KL8 A;  2L9W A;  1N4L A;  2MQ8 A;  5DJB A;  1G2E A;  3EM1 A;  4N77 A;  1QY7 A;  5ETP A;  2I38 A;  2CYY A;  4JI4 F;  2XMT A;  4KPC A;  1U0H B;  4NYP A;  2HZV A;  1DAR A;  3BKT A;  4OYB A;  1MU2 B;  2YQ1 A;  1XR5 A;  5CYM B;  4X4N A;  3JSB A;  3UNG C;  3B82 A;  2E7V A;  1C0U B;  4J9V A;  2HVH A;  3FSI A;  4P74 A;  4EBC A;  2LP4 A;  2AGQ A;  1H7X A;  2O67 A;  5DDO C;  3C3L A;  1HHS A;  1ZTW A;  2QYG A;  5J2N B;  2J9D A;  2FQQ B;  1CLF A;  4RW7 B;  2WBR A;  2CQC A;  4OYM A;  3PM9 A;  3LP0 B;  2CVI A;  2VG5 A;  5C24 A;  3PJW A;  3HVT B;  3NS7 B;  3N5F A;  4AE5 A;  5HL7 Q;  3DOL B;  2DXF A;  4ECX A;  5DG8 A;  1XER A;  3Q86 A;  2GMJ A;  2FLN A;  3ONQ A;  2CZ9 A;  4ZP9 A;  4YDD B;  4LMZ A;  3MEK A;  3T1A A;  1VFJ A;  2RF2 A;  3VAG A;  2NS1 B;  3H20 A;  3CGI A;  5KFB A;  2DNZ A;  2E44 A;  4KKO B;  1SXL A;  4LF8 F;  3PYE A;  2FVC A;  1FKP A;  3IFE A;  1F5C A;  2RDJ A;  2RU9 A;  2IC3 B;  4IFV A;  4P10 A;  5GAE U;  1RAE B;  2N7Y A;  4JI4 J;  5HI7 A;  3BSA A;  4YHH F;  1S10 A;  3G6X A;  1FA0 A;  2FIU A;  2EEY A;  3B4D A;  4Q0B A;  4CO4 A;  2B56 A;  4CNZ A;  4RU2 A;  3M9O B;  3MCS A;  1K47 A;  3EGZ A;  3R3T A;  2ROP A;  2C3O A;  3EDQ B;  3F0N A;  2P8I A;  2F4V J;  4QWB A;  2QGF B;  1TFY A;  2CG8 A;  2ALZ A;  4DR6 F;  3G71 S;  1T9T A;  1V3S A;  1VQN S;  1S0M A;  1W7W A;  1PIE A;  4NML A;  4HR2 A;  1MW7 A;  2MKJ A;  3GII A;  2IVY A;  2HFU A;  2KRR A;  3LOU A;  3NCP A;  5IT9 Y;  3MPW A;  2HSE B;  4IG0 A;  3GV7 B;  8AT1 B;  1GH8 A;  1S6P B;  1L3K A;  3WQP A;  2B5J A;  3MUT P;  5K8M A;  1TL1 B;  4MJK A;  5E5N A;  3WIV A;  1H2T Z;  3VZH A;  1EKR A;  2WAQ D;  4K50 A;  5HMX A;  1JXL A;  2NLW A;  3K17 A;  3C16 B;  3H25 A;  2GV1 A;  1DLO A;  1GT8 A;  3CO9 A;  3QSY B;  4LF8 J;  3MCM A;  3BPS P;  4DFK A;  1CS4 A;  2PII A;  1REG X;  1CUL B;  2WOM A;  2J6S A;  3NCQ A;  1EKS A;  5A8W A;  4F0M A;  2ASD A;  4YHH J;  4WYL A;  1TKT B;  5HRO A;  1S72 S;  1BWE A;  2Y9H A;  3O3L A;  1B0V A;  3DXS X;  4DXL A;  1U25 A;  1ICE B;  1M5K C;  2LEB A;  5DM7 Q;  2W2P P;  1N8R T;  3SXL A;  3R8Y A;  5D4O A;  2DR7 A;  4I68 A;  4GC6 A;  4DR7 F;  2QA1 A;  4K4W A;  4LRF A;  4C2M A;  3S1T A;  1G7C B;  1NUE A;  3NGS A;  3UCZ P;  2RUG A;  2HK3 A;  3D54 A;  3QYY A;  3FMW A;  3FEY B;  3KXD A;  4NCB A;  1S9F A;  3KDN A;  1GK8 A;  4LJM A;  4OHW A;  5F0U A;  2CDR B;  5HVF A;  2AGP A;  4WXO A;  1JWW A;  3V6J A;  1ZTT A;  2XCP A;  4F4A A;  4FKX A;  2AZ1 A;  1FRL A;  5D4L A;  5KFQ A;  2Y0S D;  3LAM A;  3GZ7 A;  3BYP A;  1WSV A;  2BUN A;  1FRX A;  5HP1 A;  2KXN B;  2Y1I A;  3LH2 S;  3S01 A;  4KGV B;  2R8G A;  4ZN3 A;  4ELT A;  3EZ5 A;  2VFV A;  2ZOF A;  3JS9 A;  2HHV A;  1VRU A;  3Q22 A;  3ENV A;  3FSX A;  3W5X A;  4DPY A;  3RAM A;  2FY8 A;  2BE7 D;  3JSY A;  3KNG A;  4CO3 A;  4YB1 P;  3GFH A;  2JEG A;  3H2U B;  1CVJ A;  5L38 A;  2JC0 A;  4FNH A;  1LNQ A;  2FGC A;  4ZLP A;  5JUM A;  1FKO A;  2DVI A;  3MMC B;  2XMJ A;  1GMW D;  1TP7 A;  5D3G B;  2MHN A;  3BGO P;  1DTT B;  1S6O A;  4YB6 A;  4QYZ K;  1VQ8 S;  3KWM A;  4J7C A;  4DR7 J;  4WFZ A;  2F7V A;  1RHQ B;  2HW3 A;  2DY9 A;  4K7Q A;  3MR3 A;  1R6Y A;  4ZPA A;  2EWH A;  2YX4 A;  1YZ6 A;  3CDB A;  1FT8 A;  5GMK a;  4OYA A;  1N32 F;  4E8U A;  3M2R B;  3AQO A;  1GXL A;  4C0H A;  2MGZ B;  3NS6 A;  2OPS B;  2MKI A;  2QG9 B;  2OAU A;  4AXI A;  2XLJ A;  3G6V A;  2CIM A;  1Q16 B;  1EIY B;  2HVE A;  3DRY A;  4WF9 Q;  4DU8 A;  2BDP A;  2G13 A;  6AT1 B;  3RB3 A;  3WX8 A;  2LQ9 A;  1W26 A;  1YKW A;  1RBA A;  5K14 B;  3NKY A;  1BWV A;  5EN1 A;  2CFX A;  1JNZ B;  2R7W A;  1FFS B;  2B4O A;  5AE3 A;  2MQO A;  3MM8 B;  4OZ3 A;  3R1L A;  4B9V A;  3M30 A;  1LWF A;  1WC6 A;  2F9J A;  2FJE B;  4RNO A;  2VFU A;  4ZHR B;  1IBL F;  5I3Q A;  4ZVS B;  3IMQ J;  4BS2 A;  5FDL B;  4QW8 A;  2CPZ A;  4TQR A;  3DN9 A;  3OR2 A;  4GKK F;  4W98 A;  1YTY A;  5DRK A;  2FY1 A;  1FE4 A;  2XMW A;  2IM2 A;  2ACY A;  2ZHB A;  2LYV A;  2HFS A;  4NXN F;  3UR3 C;  1E6Y A;  3QT5 A;  3GP9 A;  1ZM3 A;  3W65 A;  1N32 J;  4PUO B;  4KE5 A;  2GVZ B;  5L46 A;  4ETZ A;  2ALY B;  1SH0 A;  2HMI B;  1TKZ B;  2VIC A;  1UA0 A;  1V3R A;  3V6D A;  3T5H A;  3HM9 A;  2CUY A;  4TY9 A;  2H5J B;  4JV5 F;  1TV6 A;  3HCX A;  2BQ3 A;  1BY9 A;  3CJ5 A;  3OBI A;  4CLT A;  1E6V A;  2R4F A;  5J1P A;  1FWK A;  2E66 A;  2D74 B;  2P6S A;  1RWU A;  4Z7C A;  1FRK A;  4UUX A;  3TUP A;  2JC1 A;  3OTO F;  1TUW A;  3Q8V A;  1HHT P;  3MAH A;  4ZJQ A;  2MLZ A;  2AEM A;  6FDR A;  4B02 A;  1KQF B;  4CO1 A;  4N76 A;  2PMZ D;  3U7J A;  3UWT A;  5EDW A;  3KMQ A;  1P1L A;  4USK A;  2WVB A;  4U8Y A;  1QAX A;  3PYF A;  2J7K A;  2DPI A;  1OSC A;  2FHK A;  4RX6 A;  4O44 B;  4G1Q A;  3OTE A;  1UVN A;  1A0O B;  1IBL J;  4UY8 T;  4ZMM A;  4Y3C A;  3RB4 A;  1Q8L A;  3FFI A;  1YJW S;  5J1N A;  3QFW A;  4DQI A;  3UD3 P;  2E1R A;  4JP8 A;  4FP9 A;  1OQ3 A;  5DLG A;  4GKK J;  2ZBI A;  4KHR A;  4LF1 A;  2RHS B;  1NHK L;  5ETM A;  1SL0 A;  5B0D A;  2RIL A;  3JTO A;  4NXN J;  2J9D E;  3HI9 A;  3MM9 A;  2G0C A;  3M1V A;  5ETO A;  2MQN A;  4WFX A;  3KLE B;  1Y10 A;  4JV5 J;  2BXJ A;  4DCO B;  4H4M A;  1VQY A;  3DC2 A;  1ZH5 A;  1RTZ A;  4J37 A;  1M5H A;  2PN6 A;  1KQK A;  3I32 A;  4N41 A;  4R5P B;  3VGV A;  3THT A;  3OTO J;  3CDA A;  4LRB A;  1VIS A;  2RAQ A;  2B8Q A;  1BLU A;  1GQE A;  4USJ C;  4TLR A;  2RS8 A;  4X4P A;  1I3O B;  5C25 A;  4JI7 F;  3T3F A;  1XEZ A;  3H2V E;  3OLA A;  2OPR A;  2N82 B;  2KZZ A;  4BLG A;  2J0W A;  1HQ2 A;  2IYG A;  4M63 A;  2JLF A;  1G1X A;  1DQ8 A;  1HBM B;  3I0R B;  4XDC A;  3RW6 A;  3NMR A;  2WB4 A;  4GC7 A;  3TAN A;  4FS2 A;  4OYW A;  1VLY A;  5I4M A;  1UVI A;  4QR1 A;  3IAS 9;  2RB7 A;  1TK8 A;  1RT7 B;  3Q8Q B;  3GYG A;  3DFE A;  3DDN A;  1JNR B;  2V2Z A;  3N6N A;  2RJZ A;  2W2M P;  3OW2 R;  2BM1 A;  3BSO A;  2R8J A;  3EXC X;  4OI1 A;  5K8N A;  2HGL A;  2V67 A;  1QE1 B;  5DDR C;  2A2C A;  2AT1 B;  3IRW P;  3Q8U A;  3JAM U;  4U96 A;  4K4S A;  3N5B A;  3VZI A;  3MEE B;  3GQC A;  5LXY A;  3V4I B;  3PW0 A;  5KFC A;  3EYZ A;  2NYI A;  1VIO A;  5LSL A;  3VV2 B;  3DI6 B;  4LF2 A;  9ATC B;  1QTM A;  3D28 A;  3L4B C;  3F73 A;  1X7V A;  1NK5 A;  3PNI A;  2HQG A;  4CT9 A;  4RO0 A;  3BGF A;  2HK2 A;  2YNH A;  3FGV A;  4DQQ A;  4EYH B;  4BCA A;  4CDI A;  4JI7 J;  2G1D A;  2E1A A;  2VZ9 A;  4ID5 A;  2AMC B;  1RTH B;  4X84 A;  4PG4 A;  4O3R A;  1T3N A;  1JQG A;  1S12 A;  1UZD A;  3LP1 B;  2H51 B;  4DF8 A;  3P49 B;  3A1Y G;  2NR0 A;  3PTW A;  3T9Z A;  3ADA C;  4OV1 A;  4R8U A;  4LF5 F;  1O5J A;  3I5B A;  4AND A;  2IPO B;  1D8Y A;  2DGW A;  3HJF A;  4OV6 A;  3HT3 A;  2DHX A;  1DHM A;  2C22 A;  4ZVG A;  4OYP A;  1JJ4 A;  1ZA2 B;  1NXI A;  3CJ3 A;  3R7B B;  4EEY A;  3HJV A;  1VI7 A;  2FLP A;  3CT9 A;  2EW9 A;  4PG6 A;  4CYU B;  1N0V C;  3PVX A;  1TKX B;  4ZVR B;  2HFV A;  2C2D A;  2QC3 A;  2QLW A;  3KHL A;  1Q79 A;  2JWN A;  1AZS B;  3OR1 A;  2KTQ A;  4LFC F;  2POK A;  3RAQ A;  3PX0 A;  3E01 A;  3T5L A;  1J2V A;  2MMY A;  2VFT A;  3SCL E;  1RTI A;  3N4W A;  1IXK A;  2PA3 A;  3RRK A;  2LDI A;  1Q8K A;  3TA2 A;  3CUL A;  3M6U A;  4G1P A;  2ZZM A;  4I56 A;  3CJ8 A;  2ZKT A;  4OX8 A;  4O3S A;  3I5A A;  1FJE B;  4PKD B;  2F9D A;  1YBT A;  3THV A;  3QWP A;  1K8A T;  4QYZ J;  1P6T A;  1LFW A;  3E8O A;  1VDH A;  4NLY A;  4QQB A;  1FJG F;  4LRE A;  4HLB A;  3L3C A;  2L08 A;  2ZZT A;  2DBB A;  1LEO A;  1N36 F;  3CIZ A;  1IKY B;  3JB9 k;  2CPH A;  1EAR A;  1NK7 A;  4A8F A;  2BZ2 A;  3BO2 A;  4ZCI A;  3C14 A;  4LF5 J;  1JXE A;  3DLH A;  1VK8 A;  3VF0 B;  5HBM A;  4UT4 A;  2Z30 B;  1BHN A;  1IKW B;  2CPD A;  4M5M A;  1IR0 A;  2DH9 A;  2YH1 A;  4KT0 C;  3THP A;  5KFS A;  1RUS A;  3EWG A;  3V4M A;  1UJ6 A;  4CH0 S;  1K9M T;  1NK0 A;  2CPY A;  5HJY A;  3ENQ A;  3GIJ A;  2HHP A;  1RT4 B;  1SJ1 A;  4ED4 A;  4TLQ A;  5DLF A;  2BJE A;  1TUV A;  2YKA A;  4LBP A;  4LFC J;  2HHH J;  3W8P A;  1Y7P A;  2JOQ A;  4YME A;  2XUL A;  2DYA A;  2GVD A;  2H65 B;  3TX8 A;  2V9W A;  1NKC A;  4J9M A;  3GSI A;  4XTT A;  1RGV A;  2LMI A;  1RT1 A;  2O1P A;  3TJ9 A;  5EHH A;  2GCF A;  5AXL A;  4TXS A;  4I67 A;  3LGN A;  5L9X A;  4KGK A;  2UVW A;  1FDD A;  2YX1 A;  1VMB A;  2R7S A;  1C0T A;  2F40 A;  2BX6 A;  1JLQ A;  4MH8 A;  3PKY A;  1ELO A;  3HHL A;  1CJK B;  1JLF A;  4DPT A;  2ZE2 A;  2CQI A;  5HVH A;  2JJ4 D;  1FVS A;  3D4J A;  1MN7 A;  3PR4 A;  1N5T A;  1FJG J;  2XWY A;  4KFB A;  4UQT A;  4DR1 F;  2FVR A;  3G82 A;  4UUW A;  4C8L A;  5D4P A;  3RBD A;  2DGX A;  5JVG Q;  1RJJ A;  3FEX B;  3DLG A;  1IQZ A;  4KQZ A;  1KON A;  1ZS6 A;  3GIR A;  2Q6C A;  4ZCM A;  3RTV A;  3GFX A;  4CLZ A;  1HQU B;  3DLB A;  2V68 A;  4DV0 F;  2VKZ G;  2HRU A;  4ECZ A;  1RT3 B;  4ZP8 A;  5DGB A;  3DRR A;  4L76 A;  4X4R A;  2KT5 A;  3H98 A;  3IM8 A;  4NE9 C;  3LQV A;  4EZ6 A;  1HNW J;  3BO3 A;  2F4F A;  3KHR A;  1MMD A;  1RAA B;  2DNG A;  3MMA B;  3HHD A;  2DH8 A;  3VGS A;  1CG2 A;  3PRD A;  4C7Q A;  2L9D A;  2HHW A;  2KRB A;  4Y2A A;  3KJV A;  2B9Y A;  3DMJ A;  1RAH B;  2H4Y B;  2XYH B;  1EZZ B;  1B7Y B;  2X3D A;  3SCJ E;  2HND A;  1G6B A;  4F4Y A;  4OYZ A;  3T6B A;  1F2H A;  3BQ0 A;  4B9S A;  2HPU A;  3MAA B;  4M5L A;  1WC1 A;  1OS5 A;  5A0Y A;  2CDQ A;  2DGT A;  3FQL A;  4AQY F;  4A47 A;  4YOE A;  1X9M A;  2AW0 A;  3NGT A;  1S1V B;  2RRN A;  5KFR A;  3BYR A;  3FK4 A;  1IKX B;  2COL A;  1JLB A;  1T03 B;  4G65 A;  2PO4 A;  4O0I A;  5DQH A;  1RHK B;  2A2D A;  1JLA B;  4DR1 J;  3GB0 A;  3AB4 B;  1A6L A;  5H9E K;  4NA1 A;  3TUJ C;  1FD8 A;  5L1J A;  4NZ7 A;  4L72 B;  2A1B A;  3F56 A;  2XI3 A;  2B3T B;  5IT4 A;  1HNV B;  3ULH A;  1S9G A;  4F50 A;  1YJR A;  2DR9 A;  1WG5 A;  2HRT A;  3P6Y C;  1LW2 A;  1NJZ A;  2EKY A;  2F8H A;  4QR2 A;  3FKB A;  2D3O R;  1D9D A;  4ILL A;  2LXU A;  4P6Q A;  3FC9 A;  3OTC A;  4WPA A;  2FJB B;  2N3L A;  4PWU A;  5KG3 A;  3CDW A;  4Y2K A;  1VC6 A;  3DDI A;  3MCN A;  5MLC V;  4RW9 B;  4Q43 A;  4A8S A;  4DN0 A;  4LF9 F;  2JSX A;  5F8M A;  5KFX A;  3WC2 A;  4M5K A;  5D0H A;  3QIP B;  1VRT B;  3T6J A;  2VV5 A;  1NRK A;  3IBW A;  3LAK A;  1U1P A;  1ZOT A;  2R9L A;  2RML A;  2W7P A;  4AQY J;  1CJU A;  2DNK A;  5FD1 A;  1P27 B;  2K8G A;  5IT0 A;  2ZEJ A;  4C4W A;  4RW8 A;  3BSN A;  4UW2 A;  3TX0 A;  2WB1 D;  2XEX A;  4GVB A;  3CVK A;  4I69 A;  4F3O A;  2IY5 B;  2P9E A;  2QL9 B;  2OP5 A;  2K3K A;  4HT7 A;  3TZW A;  2KVI A;  3TNV A;  1S9E B;  1M1G A;  4CH1 A;  1RWP B;  1UWB A;  3JQM A;  2EK1 A;  4IRD A;  3DOM B;  1JMT A;  4LVO P;  1RAI B;  2DNL A;  3IGV A;  5HQL A;  3JTP A;  2QMU B;  2PT0 A;  2DGU A;  1DTQ A;  5T7L A;  2BAC A;  5IM0 B;  4PRF A;  1RWM B;  4G3I A;  5LJ5 Y;  3BDP A;  2GJF A;  4C8Z A;  3OUY B;  3D1Q A;  3HSJ A;  1ZZF A;  2RKI B;  3AA9 A;  4TYA A;  1CSJ A;  4WBF A;  2CKW A;  3MR7 A;  2CAJ A;  4URG A;  2E5G A;  3KDO A;  3UE2 A;  3U02 A;  3I9V 9;  2AYE A;  4Y6I A;  4U67 Q;  1BQM B;  3FZB A;  2GQ2 A;  3AFG A;  3ZNJ 1;  2R2S A;  4TN2 A;  1U2F A;  1N5Y B;  4E0D A;  3DXB A;  2BJD A;  3ZZO A;  1FNX H;  3QT6 A;  2NXN A;  2IM1 A;  1SBR A;  4P2M A;  4A48 A;  3ITH A;  2CQB A;  2AJF E;  1NKB A;  4W4M A;  3HKW A;  4OI4 A;  2OFG X;  1KVJ A;  2I9S A;  2E1M C;  3TAQ A;  3VWS A;  2Y1R I;  2AYG A;  1ROF A;  3OSN A;  1HI1 A;  2KHD A;  1C1B A;  2KI2 A;  4L6V 3;  4CLW A;  3MEG B;  3N01 A;  1R0B G;  2VPZ B;  2MLY A;  4WFN Q;  1MRO B;  1Q1K A;  2WW4 A;  1MG7 A;  3OVB A;  2QSW A;  3Q8Y A;  1DY3 A;  4IRK A;  3K8V A;  4EZ9 A;  2CPJ A;  4UY8 5;  3R5B A;  5C42 B;  2OML A;  1N6Q A;  3KLF B;  4Q7A A;  1Y00 A;  4MK9 A;  3M2V A;  2E5I A;  5KFA A;  3B4M A;  1UFW A;  2E9Z A;  1KVI A;  1RAC B;  1IJE B;  4C3M A;  2QN6 B;  2VKR A;  1YBU A;  3HVR A;  4EK2 A;  1HPZ A;  4CO2 A;  1X0P A;  4ZIW A;  1CJV A;  2HS3 A;  2KT2 A;  3HX9 A;  3AOB A;  3R9L A;  3ILJ A;  2C3P A;  2JRS A;  5F3T A;  5C7P A;  4NLO A;  3BBF A;  3C6T A;  1X8D A;  3CCT A;  3PZP A;  3H5U A;  2M8H A;  3DLJ A;  4DL7 A;  2LEC A;  5HAT A;  1U4B A;  2XYP B;  1HNI A;  1RWK B;  3MM6 A;  2GIR A;  1SJQ A;  5KFZ A;  3Q24 A;  1RT2 A;  3J81 Y;  2AYB A;  3BQ1 A;  3OT9 A;  1R7I A;  3BKU A;  3JSR A;  2HVD A;  2KM8 B;  2OPQ A;  5BYR A;  3NNC A;  1ACM B;  5J1E A;  3BN7 A;  1GMU A;  1SQE A;  1U09 A;  2AJ0 A;  1HQE B;  3DLK A;  2XBP A;  4MKB A;  2A6M A;  3MTK A;  2OGU A;  3CPW R;  1EP4 B;  2HBR B;  3QBC A;  4DR4 F;  1OMS A;  2M70 A;  2ABY A;  1WTB A;  3AB2 B;  4KO0 A;  3VVU A;  3RBE A;  3N6M A;  4JB8 B;  1UVK A;  2EC0 A;  3VAI A;  1UA1 A;  4RNF A;  5AJ3 F;  4Q2L A;  5C2G A;  1RT5 B;  4PCQ A;  3MED A;  2BRL A;  2WK4 A;  4DG1 B;  4B3R F;  1RHR B;  4NA3 A;  4Y2I A;  2AJ4 A;  1ZPV A;  1YRX A;  3CNQ P;  2QT7 A;  5EGY A;  2OEJ A;  1JLC B;  1LK7 A;  2D1C A;  4KIA A;  1JLE A;  3V81 B;  4DHV A;  2BW2 A;  5DDP C;  2QFJ A;  2KDO A;  1NEE A;  3QJL A;  1VIX A;  2X1G A;  2VOO A;  2X51 A;  2ZH5 A;  1CJT B;  4ECR A;  2NSB A;  4ZCL A;  2YKN B;  1SL2 A;  3CIM A;  1Q53 A;  1VRQ C;  2RD5 C;  2QO3 A;  1X60 A;  4RUH A;  1F1B B;  3S6E A;  4OJ3 A;  2XLI A;  2JLE A;  5KG6 A;  4RR5 A;  3QAT A;  1VBZ A;  8ATC B;  4DR4 J;  1K1S A;  1H74 A;  5KG4 A;  5IFM A;  4C97 A;  2UUB F;  1VK3 A;  2LVW A;  4A8M P;  4X4T A;  3QQC D;  2H9Z A;  3GG1 A;  2HBY B;  2MZR A;  3AA8 A;  3HK2 A;  2VG7 B;  3OXG A;  4ILR A;  3QO9 A;  4USU A;  1T8E A;  5A8R A;  2IDE A;  2CPX A;  2FUG 9;  1EJ7 L;  2LXF A;  2OO4 A;  2ZVI A;  4PPD A;  1IWA A;  4FF3 A;  4DL5 A;  4B3R J;  1HYS A;  2WVC A;  3W5Z A;  3UN2 A;  3CJ0 A;  3PJ9 A;  1BXN A;  1U2R A;  2OEL A;  3M7V A;  3G6E S;  5KOX A;  4JI1 F;  2J8S A;  1L3U A;  4M5H A;  4LIW A;  2X3G A;  3AOD A;  2KHC A;  2Q43 A;  1F6T A;  1FE0 A;  1LWE A;  3BR8 A;  3CW2 C;  1UVJ A;  1SKU B;  4Z37 A;  2VG5 B;  2HWH A;  3MMJ A;  2W7A A;  1TVR B;  2MTL A;  1HWU A;  1HNZ F;  5DG9 A;  1F60 B;  1WOO A;  1D8Z A;  2AV5 A;  4ZPC A;  1YJ9 S;  1UAW A;  1HMV B;  2ATC B;  2HGM A;  1UEK A;  4CT8 A;  3W7B A;  1VQ7 S;  1F9H A;  1C4A A;  4RUB A;  2G9O A;  3HPO A;  1NJY A;  1KHW A;  2RF2 B;  3O44 A;  1U1N A;  5DQI A;  1WAC A;  5CYM A;  3D0H E;  1X0F A;  4I6Y A;  1Q4R A;  3HKZ D;  3AOC A;  3HHL D;  2FTR A;  1REV A;  1C0U A;  2R8H A;  2UUB J;  5DQG A;  4KR0 B;  2IJF A;  2DIU A;  4IFV B;  2VHG A;  1YI2 S;  3J81 U;  4DX7 A;  4CM2 A;  3MMB B;  4QWC A;  3CDE A;  4PXD A;  1DZ5 A;  1S48 A;  2WSC C;  3LP0 A;  4N7T A;  1AUD A;  4ZS6 A;  1V9O A;  3OFH A;  5F8I A;  3HVT A;  5KFO A;  4ED8 A;  1UMJ A;  4PQA A;  3EGN A;  5L9N A;  1GX5 A;  3R5A A;  3DOL A;  2AU0 A;  2D9P A;  2BJ9 A;  5F8N A;  5KFF A;  5J2P B;  2IBK A;  4JI1 J;  4DFM A;  1BQN B;  3KUH A;  1X4C A;  3GSD A;  2QIF A;  2GO8 A;  2ZH8 A;  4LBH A;  4KV8 A;  3DHX A;  3TAR A;  1U47 A;  3W63 A;  1XMO F;  2AKW B;  4K2J A;  1HNZ J;  3BPD A;  2BJ7 A;  4IG0 B;  1SC1 B;  2B5J B;  4F4W A;  2KXH A;  3OTB A;  4HAC B;  2WVD A;  3BB5 A;  4ECV A;  3BKF A;  4CZC A;  4ENO A;  3H40 A;  1EET A;  4DX5 A;  3ZTP A;  2H5E A;  1U7L A;  3K5M A;  3FDS A;  2GAG C;  5IC4 B;  4USI A;  1S4E A;  4DF4 A;  1U48 A;  4A8X A;  3GCW P;  2F65 A;  1SJR A;  2R8K A;  1X5S A;  2HGN A;  2WOM B;  4B3M F;  1S1T A;  4K4V A;  4OZN A;  2OJ3 A;  2L3M A;  5JJB A;  5A8W B;  1MWQ A;  3R6G B;  2RNE A;  3I6P A;  4WE1 A;  5D6G A;  1Q8I A;  3TEG A;  3I56 S;  1B99 A;  4TY8 A;  4DV6 F;  2FJV A;  1AYE A;  4V19 X;  1UKU A;  1S6P A;  2JX2 A;  4LSN B;  3KUE A;  3QAU A;  3CD7 A;  1M1H A;  2F1F A;  4W90 B;  1QDU B;  1MNE A;  3NWG A;  5KFU A;  3QRP A;  1NHU A;  1D3W A;  1U1R A;  3C16 A;  1NHV A;  3GJT B;  2PMW A;  1XMO J;  3B78 A;  2AYM A;  5F0W A;  3L7O A;  1WI6 A;  2NZC A;  3IAM 9;  1CUL A;  5CCL A;  4O4R A;  4OLP A;  2H54 B;  1HKA A;  1X9W A;  3UPF A;  3J7Z T;  3CXC R;  2Q3P A;  1GAO A;  2LXI A;  3RBX A;  4DL0 C;  3L95 X;  4D3G A;  3W60 A;  3O1L A;  2XCA A;  3OL8 A;  3HHN B;  4G1I A;  4B3M J;  2IA6 A;  4FN5 A;  3G8T A;  3RB6 A;  2ZKU A;  3M32 B;  3UN5 A;  3SQG A;  5B08 A;  1HBO B;  3BS9 A;  1FKO B;  1XBW A;  3ZTQ A;  4Q44 A;  3SYZ A;  2JH3 A;  3FUY A;  2CQD A;  4B3T F;  2M9K A;  2VC1 A;  2FYX A;  2DCL A;  2EC2 A;  2AX0 A;  4BBY A;  3FCV A;  1G4C A;  3PIO Q;  2VG6 A;  5EWG A;  3UDE A;  1IJF B;  2IMW P;  4KJI A;  3MD1 A;  5THW A;  3V6H A;  2NXC A;  3M9N B;  1BMQ B;  3BGR A;  3JXO A;  5FII A;  1S6U A;  4ZVU B;  4K4T A;  3CCM S;  3DRP B;  2OD4 A;  4MAK A;  4H4O A;  1UET A;  3PR5 B;  5KFW A;  4PYA A;  4FS1 A;  1UJ4 A;  4OJ1 A;  2WSE C;  5CYQ A;  2O5D A;  4DR5 F;  2ZH1 A;  4YY3 F;  4KH1 B;  2E9T A;  1FFG B;  3NGK A;  4FBT A;  2J9C A;  3NCR A;  5LMU J;  2ZWO A;  3KG4 A;  3L7U A;  5D3G A;  4NPO A;  3VQT A;  2C42 A;  1QVF R;  3FZ2 A;  4F0K A;  4ES2 A;  1LV5 A;  4ZLJ A;  4F8R A;  4I2Q A;  1DAX A;  1OY9 A;  2V6A A;  4ZJL A;  4V19 J;  3NGU A;  4TKT A;  2C3U A;  1I1G A;  3OVA A;  1LWF B;  1G3O A;  1U8S A;  3TWZ A;  3N28 A;  4DWI A;  2EI5 A;  3DRS B;  4PAB A;  3H7H B;  3RR7 A;  4DCP B;  2VDI A;  1X9S A;  3JSM A;  4QU6 A;  2J6U A;  4ECS A;  3M2R A;  5GAE I;  1TZ0 A;  4MK7 A;  1AFI A;  5KT7 A;  1UFL A;  4B3T J;  1U6Z A;  5G0R A;  3FBF A;  2CNO B;  3TP2 A;  2V2Q A;  5KT4 A;  2BOP A;  3G9C A;  3VQS A;  2UXD F;  4EO6 A;  4HDH A;  3CWJ A;  1WSR A;  4DV5 F;  1RSC A;  1PCA A;  1E6Y B;  2GFF A;  3T1Y F;  1RTJ A;  2YWW A;  4RW4 B;  1UPM B;  2LDY A;  4KB7 A;  2EFG A;  3V6D B;  3VAH A;  3EZU A;  1LKZ A;  4QJV A;  2ZBR A;  2D3O 1;  1E6V B;  2DNH A;  3T9N A;  4F4Z A;  3DU6 A;  2XI2 A;  2HFN A;  3PW7 A;  4DR5 J;  1C4C A;  3M6X A;  2AF6 A;  2HEK A;  1P1T A;  3LWL A;  1XC9 A;  3QRQ A;  1OYD A;  4ZHR A;  1FVQ A;  2HHU A;  3N0V A;  2E7X A;  2ZVS A;  2B9X A;  1NJX A;  3ZZZ A;  2LCW A;  1U0S A;  1IBK F;  3R1H A;  3I96 A;  5L8R C;  1FXR A;  1PG5 B;  4JOU A;  3HFZ B;  2GQQ A;  2O66 A;  1U8W A;  1HWJ A;  3FVY A;  4I7F A;  4G1Q B;  1N54 B;  2GML A;  4QWE A;  4WTY A;  3FFI B;  1R3N A;  4NLQ A;  4PUO A;  2HFZ A;  3MPD A;  4CRJ A;  4C0B A;  2AIR B;  1U6F A;  5HMY A;  4FKY A;  3ZZY A;  2LEP A;  2ZH4 A;  3UW1 A;  2U1A A;  2RQ4 A;  3NY0 A;  2UXD J;  2CQ3 A;  4OJH A;  1WEY A;  4DV5 J;  3RG6 A;  2J7U A;  5FLX Y;  1NCL A;  1ZET A;  3T1Y J;  3KLG A;  3MM9 B;  4LUB A;  1T11 A;  3M1V B;  2JVR A;  1HIY A;  1LWC B;  1TKD A;  2O01 C;  4O3Q A;  2PGC A;  3LF0 A;  5B09 A;  5IS2 A;  1NK8 A;  2AJQ A;  1NO8 A;  5BYS A;  5CQG A;  3DDK A;  4OI6 A;  2UXC F;  3W2V A;  1RWX B;  1HWI A;  4MTP A;  1XNR F;  3QAE A;  1N52 B;  3EPG A;  4ZJO A;  4NZ6 A;  4O44 A;  1PBA A;  3H0P A;  4F02 A;  1X5O A;  1WEX A;  2IIH A;  3KTQ A;  1R8P A;  3A3O B;  3B54 A;  2MSS A;  2AP6 A;  2VDH A;  2LLZ A;  4PWD A;  2JEJ A;  4J9O A;  4HDG A;  3NAI A;  4NCG B;  1F3V A;  2YKM A;  1VQP S;  1IBK J;  4P7T A;  1IBM F;  1KOH A;  4DFP A;  3Q83 A;  1NJW A;  3LAN A;  2OPR B;  1TK5 A;  2EPI A;  4IG3 B;  4RNH A;  4A8Q A;  2BKN A;  1WUU A;  1DBD A;  1WWH A;  1U6B A;  1URR A;  5F8L A;  2OH2 A;  1DUR A;  1JJH A;  4KGX B;  3G4S S;  4TU7 A;  2J0Q D;  2HHQ A;  2DR6 A;  2Q66 A;  3TZZ A;  1SJF A;  2G2Z A;  3MWB A;  2JHE A;  3RYL A;  3HHE A;  2KG0 A;  3GV5 B;  3FBC A;  2XHC A;  1F9E B;  1NB7 A;  2Z0G A;  4CO5 A;  2R2U A;  3GWC A;  2VOD A;  4X2B A;  2XS2 A;  4ED1 A;  2HNZ A;  5D15 A;  4C8K A;  4M5D A;  3QMQ A;  2NXU A;  2YPZ A;  3UCG A;  2ZHA A;  1OQ6 A;  4ECW A;  3S7R A;  4DQP A;  3MPV A;  4ERD A;  1KP6 A;  3TVK A;  1QJH A;  2UXC J;  4PWW A;  3NRB A;  5J2Q A;  2BKO A;  3MEC A;  2OTJ S;  3DKD A;  1Y5L B;  3CUN A;  3MGJ A;  2HYI B;  1HBM A;  4F4K A;  3DYA A;  2BE2 B;  2I8E A;  5LT5 A;  3IR7 B;  5LJ3 Y;  2QA4 S;  4Y00 A;  3CF5 Q;  3W61 A;  4B9U A;  3UNY A;  1ARO P;  4JI0 F;  5ETK A;  2K06 A;  1IBM J;  3TAP A;  5K5M A;  4ID5 B;  2VJV A;  1XIQ A;  4HI2 A;  4A8W A;  2K1R B;  3MI7 X;  3D6T B;  3M8W A;  2Y0B B;  4NI2 A;  3IS9 A;  2HHT A;  3UD5 A;  1SH2 A;  1QE1 A;  2B6A A;  2BVZ A;  1TUG B;  4DSJ A;  1N48 A;  1VHF A;  2PFF B;  4WZM A;  3EE3 A;  3QGG A;  4IOC Q;  3TQE A;  2F4V F;  1FES A;  3T41 A;  2QV6 A;  2FZK B;  4R8U B;  3HFV A;  5HVG A;  4X4S A;  2N4D A;  3TW0 A;  3D9B A;  5I3U A;  2RE1 A;  3DI6 A;  2VBX A;  4DR2 F;  2FVQ A;  3HHK A;  1XMQ F;  2UV8 A;  2KM8 C;  4CIO A;  2C3M A;  1U1M A;  1YRT A;  5IWA F;  2AHO B;  3CDU A;  2ZC3 A;  3CJK A;  4MKA A;  4PG7 A;  3AD7 C;  4YR2 A;  1SQG A;  2K7K A;  3RUB L;  2FJD B;  5D78 A;  3OLB A;  1RWN B;  4NLS A;  4ZDN A;  1R89 A;  5KTQ A;  1JKH A;  1IM4 A;  2DEJ A;  4ED5 A;  4ZVE A;  2YX7 A;  1BC6 A;  1R8A A;  2B0G A;  4J9R A;  3IXQ A;  1KQS R;  4X4U A;  1RTH A;  4ZPW R;  1RTI B;  2IBO A;  5A2Q Y;  1OY8 A;  4J91 A;  1RE1 B;  2E5J A;  4CM0 A;  1KKH A;  2DEI A;  2R42 A;  1H2V Z;  2DNY A;  2ROE A;  1J27 A;  4I0W A;  4K2X A;  2J9E A;  4JI0 J;  3IGN A;  3SI8 A;  5FLX U;  1MWY A;  3ZXW A;  4JI5 F;  4HHJ A;  3WC0 A;  3K5L A;  5ETL A;  4ICL B;  2FVS A;  4C8O A;  3JTN A;  2B7B B;  3O2I A;  5CCM A;  2BJ8 A;  3MAQ A;  3D5M A;  2CPE A;  3C15 A;  2XSJ A;  1NBE B;  1TKX A;  3PHT A;  3C14 B;  2FJA B;  1VQ5 S;  5HK4 A;  4C8Y A;  3MXH P;  1YGY A;  3KFW X;  4QR0 A;  4DR2 J;  3NBP A;  2NPF A;  4O4G B;  2R2R A;  1XMQ J;  2B43 A;  3MM5 A;  1LFP A;  2P5V A;  4P9S A;  5IWA J;  1GMV A;  4CH7 A;  1UZH A;  4QIV A;  4M5I A;  4XPE A;  2RQC A;  2MEW A;  4ZOS A;  1YBA A;  3SDE A;  4B08 A;  3DOK B;  2E1C A;  1N5S A;  4IKA A;  2CQH A;  3DLE A;  2HNY B;  2GVD B;  2BAN A;  2Q6B A;  2YVS A;  2GGP B;  1RT1 B;  3CMQ A;  1GNK A;  4M5N A;  4XPC A;  4N8O A;  4Z2X A;  1JLQ B;  2J76 E;  4FYV B;  2JLG A;  1S97 A;  4JI5 J;  3HHL B;  1JLF B;  3ISN C;  2QL5 B;  5KFN A;  2ZE2 B;  2YWF A;  4MMO A;  2XYG B;  3TUZ C;  1OWX A;  3DHW C;  2HWT A;  2A18 A;  1FJC A;  1FF2 A;  2C2R A;  1MML A;  4Y34 A;  1TL3 A;  4F36 A;  4KFB B;  5CHC B;  1YDL A;  1LWX A;  3GIK A;  4BDP A;  4B9M A;  2V4J B;  1RT6 A;  1RAO A;  2QSF A;  1DJ0 A;  3OFG A;  4IH7 A;  2KU7 A;  1S1U A;  5E7O B;  2MZS A;  5I42 B;  2VON A;  4YB7 A;  4WTO B;  2GQC A;  3P4U B;  3G8S A;  2XO7 A;  1FDN A;  3DRR B;  2XM3 A;  3NG8 A;  1VR6 A;  1S77 D;  1RZM A;  3WDO A;  2GHW A;  4ZVQ B;  4DDF A;  2NQP A;  4G6V B;  1SUQ A;  1AT1 B;  2MDA A;  4IDK B;  3WZ0 A;  4ANC A;  1VCT A;  3ET6 A;  2QMX A;  3KJV B;  3DMJ B;  1NLK L;  1PSD A;  3K7R A;  4WIQ A;  3SQO P;  4WKR A;  2HND B;  2JEF A;  3DRX A;  3AH6 A;  2WW8 A;  2XO6 A;  3CCR S;  4K59 A;  4ALZ A;  3GYX B;  4PEO A;  4CTA A;  5ETV A;  1WTF A;  4DZ6 A;  4PG8 A;  2NRE A;  5D0R A;  3PDN A;  3RZA A;  3U1N A;  3DGP B;  2QZ8 A;  2MQM A;  1R0A A;  1H7W A;  3J7Z 5;  4K0K F;  1IUJ A;  3JYT A;  3HZE A;  4L73 A;  1Z1Z A;  1FFW B;  3MMA A;  4NEZ A;  3ELH A;  2FHO B;  1UWA A;  1S9G B;  5A2Q U;  1HHQ A;  1Y4Z B;  4I2P A;  1T02 A;  4U9R A;  4R25 A;  4DL4 A;  1XJW B;  3FQK A;  1HD1 A;  1LW2 B;  1PO6 A;  1NSA A;  2Y1J A;  2DKO B;  3UVJ A;  1LW0 B;  3M8Y A;  3MAA A;  3M8R A;  1ZM2 A;  4L75 A;  2VQF F;  4YN3 B;  4ZKA A;  3BN4 A;  2M52 A;  2UUW A;  2KZM A;  3SIP B;  1YLX A;  3IBF B;  2CJA A;  4I1T A;  1NH8 A;  4MT1 A;  4WXW A;  4DQS A;  2DGV A;  3SFU A;  1NSK L;  3NEK A;  1JLA A;  3QRR A;  3M4X A;  1FER A;  1X4E A;  5E3R A;  1XR6 A;  2ACM A;  2GIQ A;  4C98 A;  1R8B A;  1CJU B;  2ZWP A;  2RRB A;  1HNV A;  3SSS A;  1VOM A;  5IT9 U;  4URS A;  4OX7 A;  2JFD A;  2MKK A;  4RW8 B;  1HBN A;  3ILO A;  1ZM9 A;  3D6M B;  3CCJ S;  4GVB B;  2B4U A;  4C48 A;  2D3Z A;  5C2C A;  1WHY A;  2CJB A;  4OX9 F;  4K0K J;  4KHM A;  2DGO A;  2QLJ B;  3FJ2 A;  1WC4 A;  1UWB B;  3DM2 B;  4S0M A;  4ETX A;  3NOG A;  1RP5 A;  4OHY A;  1H2U X;  4O3N A;  1NZA A;  1XK8 A;  1C1C B;  4OZ5 A;  2DR5 A;  2LQ5 A;  1WG1 A;  2ZH7 A;  1WC0 A;  3RU0 A;  4WP3 A;  1GXT A;  4AL6 A;  2BRK A;  2QL7 B;  1DTQ B;  2RH3 A;  3M8P A;  4C3K A;  5T7L B;  1TK0 A;  4IFY A;  3S8S A;  1LQ9 A;  1T94 A;  4RBU A;  2G2O A;  4UOF A;  1SI9 A;  1X5P A;  3M6W A;  3EVM A;  2VQF J;  2PSZ A;  5M2U A;  1RXO B;  4U7C A;  3HO1 A;  4V1A k;  3D3B J;  1VBX A;  1F5A A;  2F63 A;  3ZZP A;  1I94 F;  7FDR A;  4GVL A;  2W8K A;  3MOZ A;  4X64 J;  3ZZT A;  1HW8 A;  2J5A A;  2ZOG A;  2CQ1 A;  1TQL A;  1KR4 A;  3TJ8 A;  4KH0 B;  4OQJ A;  2XG8 A;  3GG0 A;  2BKP A;  2I0X A;  2XGP A;  1UL3 A;  2HHS A;  4IH6 A;  3DOM A;  1FNM A;  4YUD A;  3BH7 B;  2YQ3 A;  1GMW A;  2ZD1 B;  1VBK A;  3OVS A;  1S5Z A;  3ITH B;  4ZIT A;  2DXE A;  5T14 A;  2C2K B;  1XNQ F;  1U49 A;  1HWK A;  5GAG U;  1U45 A;  4OX9 J;  2MZ1 A;  2UU9 F;  1T05 B;  2CZ4 A;  1NND A;  1NPK A;  1C1B B;  2CVE A;  2DD8 S;  5BJR A;  2DO0 A;  3A8K A;  1KLN A;  3R5D A;  1KLM A;  4LR7 A;  5BYQ A;  1KSP A;  4ED7 A;  3GV8 B;  5D77 A;  4P73 A;  1BQM A;  3ZFV A;  2M2B A;  4EI2 A;  4QWD A;  4I6W A;  1F5B A;  4AYB D;  4ZVO B;  4DQR A;  3LO3 A;  3G96 A;  2IHR 1;  2B9W A;  1I94 J;  3BBB A;  1NU4 A;  5LL6 d;  1RHJ B;  2GW8 A;  4J90 A;  4UF4 A;  3CCZ A;  2PD1 A;  3AJ1 A;  2C2M B;  1FK9 A;  1VQM S;  4MIB A;  1R27 B;  3PRV A;  2DNP A;  2FHJ A;  4LQ3 A;  3Q8P B;  4LRA A;  1HPZ B;  4QW9 A;  2D7S A;  2DNQ A;  2Z57 B;  3EMT A;  1S7I A;  3MEG A;  4BWM A;  2W9B B;  4HTJ A;  4U7U D;  2GS8 A;  3OJS A;  4PXC A;  4AFF A;  2IAJ A;  1XNQ J;  2XZD B;  5ETQ A;  4U8V A;  2I5J A;  3C6T B;  3AD9 C;  3PAC A;  3KK1 A;  2UU9 J;  1Z2Z A;  4J9U E;  1KHV A;  3HFK A;  2BBE A;  4CI0 B;  3V6K A;  1SL1 A;  1HNI B;  3MM6 B;  2KO1 A;  4E2F B;  5K8O A;  1RT2 B;  2IJR A;  1V6H A;  1ZYQ A;  2RDD A;  2V0N A;  3CJT A;  5CZV A;  1R6V A;  2OPP A;  2WTF A;  3CC2 S;  3KHG A;  4OHV A;  2FZC B;  3TAM B;  2OPQ B;  4IO9 Q;  4FBU A;  3KK2 A;  1AW0 A;  4DS4 A;  2ZDO A;  1YZ7 A;  2QEX S;  3DLK B;  2X1F A;  2QA4 G;  3IWX A;  2BW7 A;  4DLE A;  4CCH A;  1P9Q C;  3GPA A;  3J7A N;  4K4X A;  2V94 A;  1UCN A;  4LSL A;  4O0N A;  4NWB A;  3T1H F;  4KO0 B;  2OSR A;  3ISN D;  1TL4 A;  4JI3 F;  2MKY A;  4ECU A;  4OI2 A;  3GON A;  2P9G A;  2RUS A;  3C2P A;  3Q89 A;  4LT6 A;  4RBV A;  4Y2M A;  5B0A A;  2KFN A;  3MED B;  2AJ1 A;  4FXD A;  4OZJ A;  1S1W B;  2HS0 A;  3I0S A;  1FXD A;  5KG0 A;  4J9K A;  3OQ2 A;  3QZ8 A;  3HUL A;  1KBR A;  2EFQ A;  2K2P A;  1HQE A;  3W1Y C;  4OFZ A;  4FVC A;  3OL9 A;  4ZLL A;  2XMU A;  1K1Q A;  2W4P A;  3GTY X;  1EP4 A;  5F8J A;  1JLE B;  4A8O A;  1JJC B;  2VU5 A;  3E51 A;  2EFP A;  4YQW A;  3OL7 A;  1IR1 A;  1KTQ A;  1KQG B;  4DOZ A;  1NDK A;  1KC8 T;  1F2G A;  4WP8 A;  5JXS A;  4DL2 A;  2ZBP A;  2ADB A;  1NSQ A;  1S1X A;  4UTG A;  2ZJQ Q;  1EB0 A;  1OPZ A;  2HHH F;  4PQU A;  3NGD A;  2VC0 A;  4PPZ A;  1WNE A;  5KOW A;  2CRL A;  3CCQ S;  3LP2 A;  3MCO A;  3L7P A;  5HLF B;  4CNY A;  3T1H J;  1M90 T;  1VC0 A;  2DH7 A;  2W2Q P;  2YQ0 A;  2C2O B;  2Z2L A;  4JI3 J;  1RDR A;  1YJ7 A;  1Y5N B;  4RLE A;  1NJI T;  4A8Y A;  4MKY A;  2QRR A;  1VQL S;  3QO9 B;  5A8R B;  4HEA 9;  2ZHO A;  3W2W A;  2SXL A;  2V8D A;  2QLF B;  4Q2M A;  4TYB A;  1RA7 A;  2QA2 A;  5FJ4 A;  4RWW A;  4M5J A;  3T5K A;  5H9F K;  4I4B A;  1FDA A;  5KG5 A;  3BF4 A;  4ZP7 A;  4RPF A;  2OI2 A;  3DLL Q;  4DU7 A;  2CJX B;  3HT0 A;  3IA0 A;  2YXL A;  5ETN A;  3PX4 A;  4C6A A;  3P8B B;  5DZ6 A;  2J7W A;  2DXD A;  4LF7 J;  2IMO A;  2J0X A;  1VGY A;  3SMZ A;  2I2Y A;  2NUU G;  3TA1 A;  2IRY A;  4ED0 A;  1FO1 A;  1JB0 C;  1KOO A;  2VIH A;  4DPO A;  2WBM A;  2C28 A;  1S6Q B;  1HNW F;  2IM0 A;  2W8L A;  2XY7 A;  2E7W A;  2XHW A;  2ZC4 A;  2I6W A;  3MPY A;  2M7S A;  2VG7 A;  1S79 A;  3AQP A;  4HVZ A;  4KGZ B;  3NL0 A;  3I82 A;  1OYE A;  4Q45 A;  5IOL A;  1WHV A;  1REV B;  3RB0 A;  1HA1 A;  3TJA A;  1IKV A;  2RQK A;  5IV3 A;  1UFK A;  1D0E A;  1Y3J A;  2EG2 A;  4P7V A;  4NAS A;  1U02 A;  4U7U K;  2W2O P;  4ZIV A;  3LA0 A;  4RKU C;  3VAL A;  3BR9 A;  3D6F B;  4C9D A;  1TVR A;  1Q82 T;  1CPZ A;  2QJ3 A;  3AY0 A;  2YWG A;  1NPP A;  1VLO A;  3M8Q A;  1YIJ S;  5KFE A;  2QX0 A;  4HKQ A;  1HMV A;  5HQ8 A;  3PIP Q;  2HRY A;  3O6Q A;  5KFV A;  4IR9 A;  4DFJ A;  3RJM B;  1HAR A;  2YWK A;  4KV8 B;  4L3N A;  2MJU A;  4H54 A;  3EGW B;  4M8L A;  4WYW A;  1KFD A;  2CG4 A;  3FCH A;  5F8G A;  2UZA A;  2ZUA A;  3POT B;  1Q7L B;  1UVL A;  2LFV A;  1BGX T;  4KPY A;  2NXJ A;  5F3Z A;  4WK1 A;  4ZVH A;  2VD3 A;  2MKH A;  4KAI A;  1JLG B;  2DHH A;  3C19 A;  1EET B;  3MMB A;  4DL3 A;  3SEO A;  2CQ0 A;  2BQR A;  1W25 A;  2LA6 A;  2OSQ A;  5IXU A;  3JQJ A;  2ZBC A;  5CXT A;  1PIL A;  1FD2 A;  2FLL A;  4J9Q A;  3J80 Y;  4ECQ A;  2Z2Z A;  4YEA A;  1SKW A;  4DJB A;  1IWG A;  4ATN A;  5J2P A;  2RT3 A;  1BQN A;  1QTN B;  1S1T B;  3LAL A;  1GEH A;  3KLI B;  2CJY B;  3RRG A;  4WE1 B;  4OIX A;  1X4D A;  5CA5 A;  1XTZ A;  4ID8 A;  3OL6 A;  1OSD A;  2DRD A;  2P9C A;  2YNI B;  4CQ1 A;  2GX8 A;  4TY8 B;  1KWM A;  4LFA F;  3EDR B;  4EBD A;  2M3D A;  2KJW A;  4RBT A;  3KHH A;  1RWV B;  4Y0F A;  2DR8 A;  1VQS A;  1WJ9 A;  1RBL A;  4HAC A;  5E3Q A;  1XR7 A;  5I3P A;  4J5O A;  4KY3 A;  1M0S A;  3WIU A;  2MLX A;  1KVK A;  4J9P A;  1Q5Y A;  2ZOM A;  2B4V A;  5AE1 A;  2Z2M A;  4DZD A;  1DQA A;  3K59 A;  2DK2 A;  2CJK A;  1VHI A;  1FXL A;  2RDI A;  4MIA A;  2CAD A;  4OX6 A;  5GAH U;  5ADZ A;  4H4K C;  1SV5 A;  2HFO A;  4F67 A;  1SKR A;  4EWT A;  3MUR P;  2UUT A;  2HUR A;  4ZPD A;  4FF1 A;  2B51 A;  1WF0 A;  3QPI A;  1HR0 F;  2F5G A;  3ZC4 A;  4B3O B;  1EHW A;  5DZ7 A;  4JYA F;  1YG0 A;  3UCU P;  3GE9 A;  2G0J A;  5J2M A;  4ILM A;  1B0P A;  4UOC A;  1RHM B;  2GA7 A;  3WX4 A;  4LSN A;  3HHL C;  1CEZ A;  4DR6 J;  5C5J A;  3ZNU A;  1TMM A;  2X7I A;  3VHQ A;  3SQG B;  3HD2 A;  4NL5 A;  2GJ2 A;  3M8S A;  2GZO A;  2YNG B;  5K20 B;  2EFV A;  5KFH A;  3AOA A;  2FJW A;  2KG1 A;  4LFA J;  1HBU B;  2IM3 A;  1WI8 A;  3AXM A;  2XWX A;  3HD1 A;  5JMN A;  5A6W A;  5GMD A;  4NLX A;  2AGO A;  2AQ4 A;  3VAJ A;  4KHP F;  3Q0A A;  5GAD U;  2VAS A;  3ISZ A;  2NXE A;  4J9L A;  4LF4 F;  2VG6 B;  2HQF A;  2VBW A;  5B0F A;  1GTH A;  4ELU A;  1L3S A;  2YWE A;  1Q7Y T;  3AAW B;  1WKK A;  3BGR B;  2B9E A;  3GJS B;  2B7C B;  3GFY A;  3OXF A;  1GX6 A;  4H4O B;  1RWO B;  4IO1 A;  2PEH A;  1O6X A;  4NLR A;  1BQX A;  2B4P A;  4F3M A;  4N56 A;  2PDA A;  2Z58 B;  4ZVF A;  3PO5 A;  5CYQ B;  2C2Z B;  3IG1 A;  1HR0 J;  3M32 A;  1Y9O A;  3C8Y A;  3PYG A;  2JEI A;  1HBO A;  4Z7Y A;  2ZJP Q;  1RTD A;  2LEA A;  3KJQ B;  4JYA J;  2HQD A;  5DS7 A;  2FC8 A;  3VCD A;  4C11 A;  1TL7 B;  1SPB P;  2VF3 A;  2PI4 A;  3H5S A;  4P2F A;  4M1K A;  2ZFH A;  4I2Q B;  1PBU A;  1O8B A;  5D0E A;  2R7O A;  4PG5 A;  5JVH Q;  2NCK L;  1B7F A;  3U27 A;  1UP1 A;  2W4C A;  3J7Y U;  3JSM B;  2QLX A;  1Q95 G;  2YKQ A;  3DRP A;  4AL5 A;  3UD4 P;  3FBB A;  1SH3 A;  1WHW A;  2OKQ A;  2IVM A;  2VA3 A;  5G0R B;  4MFB B;  4D3H A;  4KHP J;  2FB0 A;  1FRM A;  2FVP A;  4LF4 J;  3J80 U;  2BA9 A;  4ED2 A;  1NAQ A;  1T0T V;  1HL6 A;  4DV1 F;  1RTJ B;  3H59 A;  3A8E A;  3K58 A;  1XMB A;  1UW9 A;  2KYZ A;  4C3L A;  2XNQ A;  2Z8Q A;  2NUH A;  3C6U B;  3JAM Y;  5IC6 B;  2CWX A;  1T7P A;  2V34 A;  3KK3 B;  4R0J A;  2K3I A;  2FHJ D;  4NRT A;  2R7T A;  8RUC A;  3DRS A;  4ZPT R;  3W5Y A;  3IO1 A;  2EG1 A;  2W1B A;  3CD0 A;  4LIR A;  1F3F A;  2R2T A;  1ZAW A;  4GO7 X;  2PE8 A;  1J5O A;  1QUP A;  5KT3 A;  2W9C A;  5E2Q A;  1WDT A;  2WCX A;  2JVO A;  5H9F J;  4DX8 H;  4YDX A;  4KBI A;  4DSE A;  4I7F B;  2OD6 A;  4YFU A;  3K89 A;  2YNF A;  5KAK A;  3D3C J;  4RW4 A;  5F8H A;  4IUF A;  3MPU B;  5MAO A;  2N4C A;  2J0S D;  3NNA A;  4A46 A;  3NGR A;  3CO0 P;  2DNO A;  4DSL A;  4JI8 F;  2L41 A;  4CLP A;  2A0F B;  3TVZ A;  5KFJ A;  2GNK A;  3KLH A;  3LPE A;  3ZZ0 A;  4DV1 J;  4LR9 A;  1S4F A;  3KLG B;  5L1I A;  4DV7 F;  4L3K A;  4NLG A;  3MTJ A;  2LQB A;  5KT6 A;  3IRX B;  5KFL A;  1IR2 A;  1WC3 A;  1SB6 A;  3PEJ A;  5E3A A;  3I31 A;  2XZW A;  2HZA A;  2ZBQ A;  1F0X A;  1QUV A;  2I1R A;  3W2V B;  3F41 A;  3L09 A;  1DRZ A;  1D9A A;  4O23 A;  1ITP A;  1RIS A;  4DI6 A;  3BM7 A;  5IQ6 A;  1OY6 A;  1QSS A;  4WP9 A;  4PWD B;  1HD0 A;  2UVR A;  2M88 A;  5LM7 E;  4DMZ A;  2YKM B;  2R7Q A;  3AT1 B;  3R2C J;  4IR1 A;  2C1E B;  3BEG B;  1IBC B;  1KD1 T;  3VVT A;  3DCA A;  3GJR B;  3QZ7 A;  3OXL A; 
#chains in the Genus database with same CATH homology
 3D6F B;  1PAU B;  1RHJ B;  2CJX B;  2Y0B B;  2H4Y B;  2XYH B;  1QTN B;  4DCO B;  1SC4 B;  3R5J B;  2QLB B;  1SC3 B;  4ZVQ B;  4JB8 B;  1F9E B;  2CJY B;  2QLJ B;  2C2Z B;  2Y1L B;  1NME B;  2DKO B;  2H48 B;  2C2M B;  1RHM B;  2C2K B;  1RWM B;  1RHQ B;  3KJN B;  1QDU B;  3EDR B;  2CDR B;  3RJM B;  4ZVS B;  2P2C B;  3KJQ B;  1RWV B;  1SC1 B;  3R6L B;  3R7B B;  3D6H B;  1GFW B;  5IC6 B;  1RWX B;  2QL7 B;  1I3O B;  4ZVT B;  2QL5 B;  2HBY B;  3GJT B;  3SIP B;  2XYG B;  2XYP B;  1RHU B;  5K20 B;  1RHR B;  2XZD B;  4ZVR B;  1RWK B;  3IBF B;  3QNW B;  4DCP B;  3P45 B;  2CNN B;  2C2O B;  3IBC B;  1RHK B;  2FQQ B;  1RWN B;  5IC4 B;  2XZT B;  1BMQ B;  2H5I B;  3R7S B;  3EDQ B;  2CNO B;  4ZVU B;  2H54 B;  2H4W B;  3GJQ B;  3NS7 B;  2QLF B;  1RWW B;  1ICE B;  4ZVO B;  4LSZ B;  2H5J B;  4ZVP B;  2CNL B;  2QL9 B;  4DCJ B;  2HBZ B;  2H65 B;  3R6G B;  2C1E B;  2HBR B;  3GJS B;  1IBC B;  3D6M B;  1RE1 B;  2H51 B;  3GJR B;  3P4U B;  1PYO B;  1RWP B;  3KJF B;  2CNK B;  3R7N B;  1RWO B;  1I51 B;  2HBQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...