3D6FB

Crystal structure of human caspase-1 with a naturally-occurring arg240->gln substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever).
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3d6fB00
2DKOB 2H4YB 1RWWB 1I51B 2H65B 3KJFB 1RWKB 1RWOB 5IC6B 3D6HB 2CDRB 1RHUB 2C2OB 2C2MB 2H51B 1ICEB 2HBYB 2P2CB 4JB8B 3KJQB 2XZTB 3GJRB 4ZVOB 2C1EB 2XYHB 2QLFB 2QL5B 2XYPB 1NMEB 4ZVSB 4ZVRB 3D6FB 2QLJB 1RWPB 1IBCB 1RHMB 3R7SB 1RWMB 1RHKB 3SIPB 2CNNB 2XZDB 2QL9B 2C2KB 2H54B 2H48B 2CNKB 3IBCB 4ZVPB 3NS7B 4ZVTB 3R7NB 1SC4B 2FQQB 2CNLB 4DCPB 3P4UB 3GJTB 1I3OB 1PYOB 2H4WB 3R6GB 2C2ZB 2H5JB 1BMQB 3EDRB 2HBQB 4ZVQB 1QTNB 4LSZB 3GJQB 2XYGB 5IC4B 2HBRB 3R5JB 2CJYB 3QNWB 1RWNB 5K20B 3IBFB 1RHRB 1SC1B 2QLBB 3D6MB 3R7BB 2QL7B 1SC3B 1RHJB 1RE1B 3KJNB 1GFWB 4ZVUB 3GJSB 2Y1LB 2Y0BB 3RJMB 2HBZB 2CJXB 1PAUB 1F9EB 2H5IB 3EDQB 1RWVB 1RWXB 2CNOB 4DCJB 3P45B 1QDUB 3R6LB 4DCOB 1RHQB
chains in the Genus database with same CATH superfamily
3NKYA 4XDCA 1I51B 3V6JA 1RTHB 1HWKA 4ED1A 2CQCA 2X3GA 3DYAA 2VC1A 4IH5A 4OYBA 3S8SA 3TZZA 1WC5A 1ZBTA 5F8IA 3SQGA 5SZTA 4X4RA 1BWEA 4F0MA 3KJVB 1N0VC 3FEYB 4NLXA 4PR6A 4ILMA 1YWXA 5KFFA 1X9WA 4NLPA 3TVYA 2VFSA 3AJDA 3JQMA 4K8RA 4DV4J 1Q78A 2C3OA 4CLPA 1M90T 2HMIB 2J8SA 1IR2A 5HN0A 1DLOA 5CQGA 1MN9A 1NAQA 4G1QB 4EYHB 4ELVA 2EG1A 2BRKA 2VL1A 2DR7A 1NHVA 2D74B 2XZTB 1S9FA 3D0GE 4X65F 5LXRA 3RAXA 4ZVOB 2AIRB 3T5KA 4DI6A 2KXFA 1L3UA 3M1VB 4KV8A 1WOSA 2YX7A 5H9FJ 4JI5J 1E6YB 1VI7A 2YKNA 3SSRA 5D3GB 4OHZA 1VQNS 2GIQA 4IFVA 2D69A 4JI2F 2J9EA 1RK8A 4CZCA 2V63A 5DQIA 3M8PA 3R5BA 1IBLF 2HHUA 2OAUA 3HI9A 3M2VB 5AE3A 3LQVA 2F1FA 3QQCD 3AFGA 3R5AA 1LV5A 3B4DA 1ZZNA 3HHLC 1TKTB 2HQFA 2NYIA 3NS7B 2OUGA 4LT6A 2KB2A 3W60A 1BXNA 2ASLA 3I9V9 2OPRA 5KG3A 5B0BA 1HNXJ 1NDPA 1Q4RA 2FLPA 2R7RA 1HD0A 3AAWB 4QU6A 2O3DA 2WSEC 3O2IA 2COLA 4O3RA 1HWLA 4KB7A 3I0RA 2F40A 4NPOA 3DLBA 4GKJJ 3LGNA 5B0EA 1TK0A 3SV3A 1ZTWA 3QT6A 4X84A 4BHQA 3WX4A 2N82B 4C8KA 2FHOB 1LWXA 1M5HA 2IRYA 2X1BA 3W62A 2DR6A 2HHHJ 1DFDA 4N8NA 5B09A 2AZ3A 4G1QA 4UZBA 2MY8A 1G7CB 4MKAA 4DSLA 1C0UB 1NK5A 1IBKJ 4NLSA 1VGYA 1WG4A 1XIQA 2N4DA 2KXNB 4DR6F 3CDUA 1VK8A 5G4DA 5IXUA 3JSYA 2LU1A 1FTRA 5F0UA 4JI0F 3EUNA 1IWAA 2CA9A 2LP4A 2FHJA 2MZRA 2G1DA 3D0HE 1SJ4P 1RTDA 3VGSA 1KFSA 1UPMB 3W9HA 4WWSA 3TAMB 2H1YA 1TL3A 2XNQA 3JS9A 4ECSA 4NLOA 1UWBA 3K17A 2W4PA 3EZUA 4HI2A 1RAAB 2KJWA 5ETOA 1F9HA 3R5GA 1VBKA 2QE5A 2GV1A 7FD1A 3E51A 2CQ3A 2QFIA 2MYFA 2RT3A 1NH7A 4J91A 4TXSA 2WSFC 1VQ6S 4OX9F 1RACB 3EGVA 2MMYA 4A8KA 2FB0A 1QUPA 1R7IA 1U6BA 2FGCA 4LF9J 4TNOA 1IJEB 2R42A 3W64A 1Q8LA 2OEMA 2XMVA 5AXLA 4IDKA 1VRTA 3M8YA 4UOFA 3MF5A 3K89A 1HBUB 5KFJA 4C8MA 1DHMA 1LEOA 5HK4A 1L3TA 3EVWA 1TAQA 4USMA 3V5RA 3AOCA 2V4JB 2N3OA 2P5VA 2WVBA 5CZXA 3BKFA 1R89A 1U26A 2WZ1A 4WFBQ 5CXTA 4DG1A 1AXQA 2FHJD 5IM0B 4RU9A 4TQRA 2NYHA 3MCNA 2HNZB 2F63A 3MAHA 4A8WA 5KG6A 4K4ZA 4I7FB 4C8OA 1EX8A 2EWHA 4JI5F 5GMEA 3OXLA 4P2XA 1RWWB 4DR5J 4I2QA 5I4MA 3DLHA 1QY7A 3T5LA 2EW9A 2RDJA 4JI7F 3IC1A 3W2VA 1S97A 2Q6CA 2HHTA 1D9DA 4NRTA 2VFRA 5IV3A 4DFKA 5J2QA 2X1FA 4RW6B 1S6OA 5GVQA 1IBLJ 1B64A 4OZNA 1SPBP 5ETRA 4KTQA 1UP1A 4USIA 1RHUB 4IG3B 4NLQA 2XLKA 3MMCB 2OTLS 4PUOA 3Q2TC 3MZIA 3ZFVA 1I5OB 1ZTTA 3C2PA 1UKUA 3D5MA 2R8IA 1X9SA 1YG0A 4X4SA 1N5YA 5A8RB 1X5SA 1CSJA 4ZK7M 1V5VA 2A3JA 3MEKA 3J7AN 2XWXA 4OV1A 5CYJA 2RHQB 3CJ8A 3KJQB 5SUHA 4LQ9A 4ED7A 3V4IB 2MHNA 2DY1A 2QIFA 1GX5A 2A2DA 2VFTA 4K5SA 1S1TB 5I3UB 4O3OA 2FLNA 3PNIA 3RTVA 1WEYA 4JI3J 4KKOB 3MPUB 4W4MA 3HLUA 4NA3A 5GAGU 1KS2A 3GWCA 2XYPB 1NMEB 3H5SA 1HPZB 3QGGA 2HQCA 4KGMA 1PAEX 3D1HA 3SDEB 2LCWA 2Q79A 5JXSA 4IOCQ 2GAGC 5F41A 1JKHA 1HL6A 3QJJA 3M8WA 1GX6A 4LVOP 3E3XA 4R5PB 2PI5A 4EZ6A 3M8QA 1FDDA 1S59A 2GNKA 5J2MB 2KM8B 4HDGA 4I56A 2YKMB 2XO6A 3ZZ0A 3U1MA 2ZJQQ 1J5OA 2VB6A 8ATCB 1OQ3A 3G6VA 1P1LA 1RA6A 3VCDA 4DQPA 2DTJA 1S6UA 1HI1A 2CZ4A 3G9CA 3DI6A 2KKHA 2IM1A 2ALZA 2XCPA 4OYIA 1KHVA 3IAS9 4K2JA 3EWGA 1RABB 1VR6A 2D7SA 2M7SA 3I56S 5T41A 1DTQA 4AQYJ 1PYOB 2ZH5A 3M2RB 2W7AA 4LRFA 4DPTA 2C3UA 1TMJA 2QX0A 2K1RA 3PYFA 4OHYA 1CVJA 4JV5J 2XMTA 4AL5A 4MKVA 3SQGB 4I6YA 2WAQD 3EDRB 5C7PA 3MURP 4ZVQB 3G71S 2R2TA 4ZP7A 1RXOB 2ZITA 4CO2A 1HD1A 1SIWB 1RZMA 3FC9A 2R2RA 1XBWA 2XMMA 3SBMA 1Y3KA 4PG5A 4ATNA 1S76D 2HFSA 3X1LB 3K8WA 1BC6A 1JMTA 1WHYA 2CPEA 2EKNA 4LR9A 2GVDA 5KFDA 2IM2A 4I6WA 4EEYA 1M1GA 3FQKA 5D4PA 3CCES 1UVKA 2ATLA 2FJWA 2MQ8A 4FYWB 2W9BB 3IG1B 3VAGA 4DV7F 3T6JA 2DGXA 3R1LA 3MM5A 5C25B 3P3DA 2GIRA 3RU0A 2UUTA 2ILYA 4Q2MA 2EKYA 3VAIA 3IR5B 2ZOMA 2CZVC 1U8SA 2FVPA 3RJMB 3ILOA 4J9QA 1TQLA 3GPAA 4CDIA 5C42B 2XB2D 1ZZFA 2L9DA 2MGZA 4Q8FA 1YGYA 2I8EA 2LQJA 4N7TA 4TN2A 3LA0A 3HHDA 4O4GA 3AOBA 4A46A 4A8OA 5ETVA 4CNZA 3NCPA 3BSNA 2NREA 2BJ7A 1T03A 4MKYA 2ZD1A 3U1LA 1F2HA 1X5PA 5IWAF 1S6PB 4E0DA 4M95A 3ZZYA 4IR1A 4WTYA 2OH2A 5KFSA 4RW8A 3H98A 5A0YA 2KXHA 1B70B 1CJUB 1UFLA 3A8KA 3ILLA 3W2VB 2CQ1A 2FY1A 1OMSA 4B3MF 2C3YA 1GEHA 3F41A 4ZCKA 2MKHA 4CO1A 2D1CA 4ZS6A 2VQEF 5KFXA 2RE1A 2F4VJ 3HJFA 1HNZF 3PXGa 4LRBA 3QT8A 3H59A 4OJHA 1MMLA 4YHHJ 2YH1A 1FF2A 2V34A 3DM2B 2CQIA 3OSNA 2BQ3A 2KHCA 2PA8D 3MTJA 5LSLA 5KFHA 4KHRA 1HNWF 5F9NA 5DLFA 3Q8SB 4OX7A 2HGNA 3LP2A 1ZPWX 4PAAA 2AJ2A 3KFWX 4CTAA 3DGVA 4B17A 4LF7F 1IN0A 3DHWC 1N6QB 4OYZA 4OI0A 5H9FK 3CCLS 3NOCA 2WVCA 3J7YI 1FXLA 3H42A 4PG4A 3THTA 4OZJA 1UTAA 4M5MA 4DFJA 3HD2A 4MFBA 5H9EJ 2RILA 2VIHA 4I7FA 2OSRA 4ZVGA 3C46A 2ZBPA 3RRHA 2UVVA 2DGOA 1Q8IA 4WFAQ 2R4FA 4HHJA 2HHPA 1YIJS 3ONQA 1H2VZ 4FPRA 4JV5F 2M70A 1BQNB 5E7OB 3T5JA 3W9JA 1REVA 3PIOQ 5IT0A 1PKUA 3VALA 1KVIA 3Q8UA 2I2YA 3UPFA 1XNRF 1DBDA 2LVWA 3PHTA 2E9TA 4LF2A 4J90A 1RWMB 1CLFA 1V3ZA 1Y5NB 2JLFA 1FRHA 1MWYA 2AX0A 2XMAA 2A0FB 2PT0A 3CMQA 2QA4S 4KPYA 5HQMA 2WONA 1FNXH 1Q7LB 4R8UA 1U09A 2W1BA 2EBEA 3HCXA 2KTQA 3W2WA 1GMWD 4RLEA 2JZ5A 1FJGJ 2DK2A 1XN9A 4C8NA 3CMAS 2ZH6A 5JVHQ 4EZ9A 5I42B 1N32F 1RT3B 2D3ZA 5L9NA 1FRIA 2DYAA 2F7VA 3K8VA 2RUGA 1MROA 3BKUA 4DS4A 2Y1JA 2HFZA 4MTPA 1HA1A 4A8QA 1N6QA 2HIQA 2FJDB 1YRUA 3GONA 2RU3A 2XY7A 4NZ0A 4U67Q 2DHHA 2KJVA 3A8EA 2ADBA 4ELUA 1IUJA 2AHOB 4WP9A 1AZSB 3CO9A 1V9OA 1R3NA 3G2XA 3M30A 2ATCB 3BO4A 2LXUA 3H5UA 5GADU 2Q1LA 2O01C 3WC2A 1YLXA 4DLEA 5IC4B 3CCSS 4X4TA 2HKEA 4R0EA 4FZVA 3TX8A 4F2RA 1AW0A 1ITPA 2KG1A 3OVSA 4C11B 3EGNA 2NR0A 1RWNB 3HVTB 4DQQA 1NJWA 5CAAA 5J2QB 3Q24A 1W2BR 1URRA 3GYXB 4MK9A 4Y2IA 1IKVB 1URNA 4IRDA 3GB0A 2DJWA 3QO9A 2ACYA 4Q0BA 1B7YB 3BGRA 1S77D 1S9EA 3KJNB 3MEDA 2CPZA 2GVZA 5F8NA 2Y1RI 4TKTA 1CULB 4KGVB 2XSJA 4YB7A 5D4LA 2IDEA 3OTEA 2OTJS 1TKTA 3VGVA 2GA7A 5B0DA 4HYKA 1RT2B 5HL7Q 5LSRA 3TAPA 2KRRA 2HS0A 2MSTA 4LSLA 1RT6B 1HYSB 3FSYA 2BM0A 4X4NA 4NWBA 1H0HB 2BKPA 2HYIB 2CWKA 4NLVA 1LQ9A 4JV2A 3UVJA 4LFAF 3MTKA 3KLGA 3H40A 3I82A 2W7OA 2ZHAA 4K5RA 4QWEA 1B0PA 3O6QA 3HXMA 3DRPA 1RADB 4WTOB 4H4OB 3LTOA 2B7CB 2C2RA 3GILA 3V81B 2W9CA 4V19X 4I64A 2IDLA 2B3TB 3LALA 1UEVA 3N0VA 3F73A 4DR4F 4ECRA 1TKZB 2R8KA 2Z8QA 5KT5A 2HMIA 4B9MA 4IRKA 1A0OB 3SSQA 1NKCA 1VLYA 4JI7J 4ITSA 1Y9OA 3KWMA 4G6VB 4UY8T 3ZO7A 4K4VA 2R7OA 2QFJA 2GGPB 2FVQA 3BDPA 1U1MA 2Y3YA 3WC0A 3OD2A 4PRFA 4UOHA 5J1EA 5K8OA 4ZDNA 4RNHA 4YFUA 2J6SA 2VKZG 1XEZA 3T9NA 1HHQA 2DEIA 3GR0A 5KFKA 3JYTA 3KUEA 4C8LA 1QAJA 1RTHA 4J7CA 2FHKA 1JJ2R 1C0TB 3ETMA 2XY6A 2EC0A 1F60B 4P9SA 2VJVA 4A8MP 4KO0B 4YEAA 1N33J 4PWWA 4HKQA 3HVRA 2KYXA 2B9XA 4HACA 5F8GA 1JLBA 2K2PA 4FNHA 2QYCA 3IBWA 3US5A 2RKIB 2JEGA 2WVFA 4NI2B 1VBYA 1FJEB 1H98A 1PG5B 3BR8A 4GMKA 5A2QU 1VBXA 1RYRA 1K73T 2MGZB 3GV7B 5HLFA 4WFXA 1VQ5S 4Y34A 4U8VA 4LR8A 3TUPA 5KT6A 1VQOS 3GCWP 4ZMMA 2DCLA 1AFIA 2VPXB 4DSEA 4DR1F 2H48B 2CNKB 4O3NA 5A76A 4ED0A 2AF6A 3D68A 3FBEA 4DU7A 3ENWA 1D0EA 4AYBD 4A8YA 4DQRA 3CCRS 1U0SA 3OPKA 4RW8B 3ZZZA 5L1IA 3CSKA 2RIJA 3K5PA 5DGAA 2CPJA 2XWYA 1UJ4A 1G4CA 1S1UA 1YRXA 2XHCA 3IM9A 3CC2S 3V6DA 3BGRB 2BOPA 2UXDJ 4ZLJA 1FNOA 3NOGA 1JLFB 4NA2A 4IUFA 1S0MA 4DR6J 3TA0A 1XTZA 4J9SA 2I38A 4FXWA 5F3ZA 4RU2A 2IC3A 5E3QA 4C11A 3GE9A 1VJWA 1VQKS 1C0TA 5DG8A 1X4AA 2WOMA 5KG2A 2DO4A 4URSA 2ZDOA 1S1TA 4ZKAA 4LSZB 4KFBB 2DRBA 2YX4A 3GQCA 1LNQA 2W4CA 1Y00A 4C0BA 4N47A 3CIZA 2BV3A 2QYGA 4JBCA 4KBIA 4E8UA 2JEJA 2JH3A 1R31A 2GGPA 1FJ7A 3R5JB 1BE4A 5LXYA 4DV3F 2EI5A 1QUVA 1Y3JA 5D15A 4ED4A 2OJ3A 3DLGB 5THWA 3VVUA 2OMOA 3KLIA 3RYLA 2CJKA 1U6FA 2CQ0A 4K4UA 2AW0A 3BR9A 1MROB 1UWAA 1MSWD 4UOGA 2GCFA 1T9UA 3O8WA 4LR7A 2DGVA 2IVYA 3OR1A 4QIEA 4YR0A 1NK9A 1SC3B 2W9CB 4Q5VA 3CD0A 2FC8A 3NGUA 4YQWA 3DI6B 4V19J 4B3SF 5M2RA 1KTQA 2R7QA 3VF0B 4RUCA 1SUQA 3TAQA 1SUQB 3EGZA 1N5TA 1TV6A 1JXVA 2VKRA 2Y0BB 4RBUA 2UZAA 5K5MA 5KFZA 3LO3A 1OYDA 4NLYA 3FCHA 2ZBQA 3HK2A 1WEXA 2GS8A 2Q43A 2YQ3A 3IXQA 4ZPTR 1U4BA 2RF2B 2M9KA 1ZM3A 3SCLE 3Q8QB 2ZZTA 1HNVA 1GH8A 3L9ZA 1ZS6A 2AMCB 4F04B 4CO5A 2GMHA 2H5EA 4J9UE 4PG6A 2IAJB 2KZZA 1WTFA 4ETXA 4LRDA 1RT2A 2E1AA 2DPJA 4JUZA 2KHDA 3P6YC 1CEZA 2HS4A 2VPZB 1QM9A 2HQIA 2OPQB 4I2PA 1L3VA 4IDKB 4RNOA 4CLLA 1SKWA 4YB1P 3I9ZA 3JXOA 5D4NA 2BXJA 1VOMA 2H4YB 2YPYA 1Y5IB 4EFAC 2RQCA 3T1YJ 2Y9HA 1EQ0A 1OSDA 2JNJA 1IJFB 2AKWB 4MMOA 4K4WA 4AL6A 4DR3F 4FS2A 2BX6A 1R8PA 1NSKL 3JQJA 3OVAA 3LWMA 5IT9Y 3PKMA 1KBRA 2I9SA 5FDLA 2DCUB 5J1PA 3LPEA 1DJ0A 2NUHA 3PHEA 5D4OA 4QPTA 4ZA1A 5ETQA 3ZTOA 1Q8BA 4LF4J 1TAUA 1BUXA 2B56A 2V50A 2ZOFA 2J9DA 1JK9B 4QR1A 4UT4A 4LF7J 2FJEB 2DNMA 2BE2B 2VDHA 3T9ZA 1HFEL 5KFYA 3KG0A 2CPDA 2M88A 1S0OA 4DEZA 3NAHA 4ECXA 3Q22A 2ROPA 4JI1J 2F8HA 3EX7B 4ZPDA 1J27A 2H3EB 3UD4P 3MCSA 4OJGA 4X62F 1UEUA 1NB2A 1DTTB 2C3MA 3TWZA 4QWAA 2FJXA 4UQGA 4TYBA 2R7UA 1ZH5A 4FXDA 3M2UB 2EFGA 1N34J 1S6PA 2QGFB 4ZVRB 2HVZA 1D8YA 2ZUGA 1B7FA 4DSKA 4O44B 4X64F 2UXCJ 1HBOA 2MKSA 3ISND 1KONA 1IKWA 4A4JA 4N56A 2G2OA 2ZH7A 1U0HA 4IKAA 1WOOA 1Y5LB 4CLUA 3T6BA 1NJYA 1T8EA 3V6DB 3CMES 2PGCA 1FRKA 1SQFA 2ACMA 2CNNB 3EVMA 4GRSA 1UFWA 2DNHA 3DRRB 4M1KA 3MR7A 3I55S 1L3SA 2DD8S 4GVBB 4DX7A 5E5NA 1WG1A 3IM8A 1WKJA 4ZVPB 4I6AA 1NSQA 1Q7YT 4U7CA 1T3OA 3UI3A 1SVDA 1WUUA 1FJGF 4PYDA 2L41A 2C2EA 3W7BA 3QLHA 2JC1A 2ZVSA 3C16A 1KOHA 1FX2A 4NYPA 5K14A 3W63A 4C3MA 4TQSA 1DQ8A 3B54A 5DM7Q 2CIMA 1PJ5A 2AJ4A 2VPWB 2UV8A 4RW9A 4YR2A 1XMQF 4YUDA 2L9WA 1LWEA 3PYGA 5J2PA 2AX1A 2GVDB 2QMWA 1JLBB 3NGTA 4DX8H 2DY9A 4HT7A 6FD1A 1NNDA 4DV6J 4NLGA 3PCOB 3NS6A 1C0UA 1IXKA 2IMOA 4URQU 3WBZA 2ZM6F 1AUDA 2W8KA 2HGLA 1NK4A 3POTA 4AXJA 5JMNA 2JHEA 2HBRB 4X66F 3OR1B 5LMNJ 1F6TA 3UR3C 5K8NA 2CJYB 1UL3A 5FLXY 1UZDA 1R43A 3CJ5A 2RH3A 1GXTA 4YP3A 2CZ9A 4UOCA 1TVRA 3JQKA 3TUJC 4O4RA 3J7A1 2WB1D 2WB4A 3QPIA 1FKAF 4FPIA 1QAIA 2HK3A 1DTQB 4I69A 4WFZA 3HX9A 4XPCA 1RAHB 4C3LA 3LGMA 4DUZJ 3V6KA 2MLYA 1RLDA 5HVFA 2CG4A 4ZVUB 2MQQA 1JLGA 1HI8A 4Q2LA 2X3DA 2MZ1A 4L3NA 2UVWA 2VQFJ 2GVZB 1C1CA 2EXUA 2POKA 4J5OA 4DZ6A 1HHSA 3N4WA 1AUSL 2WW8A 2RNEA 2OD6A 2RRBA 3D67A 4H4OA 3QO9B 3V4MA 4ZIVA 4NXMF 4OYAA 4YDDB 4FYYB 2FPHX 2NXJA 2FYXA 2A6MA 4NXNF 1N36J 4M8LA 2W9AA 4UY85 5GAEU 2QA4G 4OI2A 4OV6A 3I32A 5T7LA 3KLHB 2ZH9A 5LJ3Y 3LP1B 4CO4A 5CCLA 3RBDA 1RAEB 3KHRA 4L73A 3OTDA 2CUYA 1SKRA 1GK8A 2XQCA 1SKSA 1OS5A 4DWIA 3C19A 3AD8C 4B3OB 1VHFA 4LFBJ 2K3IA 4X4OA 2QA1A 3GYGA 3HKZD 5AE2A 5IV4A 4X62J 4ECUA 1CPZA 3OFHA 3R27A 4OZ2A 5DG9A 1RA7A 1D1UA 4NCBA 1QD1A 2OEJA 5KG7A 4IFVB 9RUBA 2ZH3A 4EI2A 4FF2A 1XNQJ 4Y0FA 2VC0A 1FKPA 3D54A 2KO1A 1EARA 4K2XA 4C98A 5HVHA 1A7GE 2VA2A 3M1VA 3MEGB 1YJUA 3Q83A 1SH2A 4KV8B 1FXRA 1U1LA 4FBUA 3PEJA 1VFJA 1PJ7A 3CCZA 2RHSB 2CQGA 1L5UA 2XULA 2RVJA 1KSPA 3Q8RB 2JJ4D 3OXGA 4RWXA 4ZOSA 2R8GA 1HNXF 1QVFR 3LANA 3PG9A 2P8IA 2GFFA 2HIYA 2PEBA 3AD7C 1KVJA 3HHEA 2VICA 3O1LA 4LIWA 4NA1A 4ZVHA 3WZ0A 3SQOP 2U1AA 3G6XA 3UD3P 5LL6d 4DS5A 2AYMA 2C1EB 2LMIA 3R3TA 5EN1A 1LW0B 2OI2A 2QLFB 3G8QA 2BR0A 1RBOB 3BKTA 5ETPA 3UD5A 1FK9A 3J80U 1FK9B 1U7LA 2M5YA 2WSCC 2HS3A 4ES2A 3KYLA 2HHHF 2BANB 3MM8A 3K0JA 2BJEA 3D6FB 3PR5B 2ZZMA 2WCXA 1IBCB 2CVEA 4HH0A 2X7IA 4PEOA 1R0AB 1R8HA 2I5JA 5K8MA 4HT5A 2D41A 2RF2A 1UVMA 3GR1A 2W2NP 5GAHI 3J7YU 3W5XA 4X66J 3CUNA 5LMNF 1S57A 2H54B 5L8RC 4DR4J 3AY0A 1K8AT 4JI0J 4G3IA 2I0XA 1TKXA 3VQTA 1TKXB 3NWRA 4CLSA 1Q86T 3HHKA 3R7NB 1CJVA 3VZHA 3O3LA 3PRDA 1S1XA 2JLEA 2CFXA 2DXFA 2OHDA 1SBRA 2F3JA 3T5HA 2IA0A 5BXIA 4DN0A 4M5HA 4KE5A 5KFLA 1K44A 4BDPA 4RPFA 1S5ZA 3ZTPA 2BJ3A 3DKDA 1WC1A 1YBUA 5KFBA 3DCAA 1FVQA 1S0VA 7AT1B 2A6OA 3DLGA 4A8FA 1CBKA 3B78A 3GG1A 5HMZA 2HBQB 4ILLA 5KFVA 3FCWA 2PD1A 2N7YA 5JUMA 2BEFA 3FEZA 4NLWA 1NSPA 2GJFA 4MYUA 2QT7A 3D9BA 3MPWA 3M9OB 3OL8A 4KFBA 2UUCJ 4DX5A 3QIPB 5F8LA 1VISA 1W26A 5DQHA 4JI8F 3WQPA 1KR4A 1WWHA 2XTJP 3EZ5A 2W8LA 2MKCA 2J0SD 2EFOA 1FT8A 4PPDA 3MR2A 1SC1B 4Y28C 2GHPA 2DNQA 3MEEB 3A3NB 4ZPCA 5IFMA 5LMUF 1U1NA 4LQ3A 2DRAA 3P49B 2E7VA 3CD6S 3KK3A 4DR5F 3H2UB 3NGRA 2HGMA 4LFAJ 4CRJA 4RBVA 4FF4A 4ELTA 2CQBA 2N4CA 4PKDB 3HT0A 5C42A 2BBEA 4U9RA 5CYQA 5GMKa 3SV4A 4F3OA 5F8JA 1HKAA 3EM1A 4LF5F 2DNLA 4USVA 2DXEA 3CD7A 2MZTA 1FRJA 2F4FA 2GAHC 3MFIA 1RT1A 4QIVA 4Y2KA 3MUVP 4C8YA 3W8PA 2DH7A 3Q89A 1NDLA 2G13A 2J0WA 4TLRA 5IQQA 5A8WB 2QRRA 3TUIC 2B9EA 1RTIB 1HQ2A 2G2ZA 3R6LB 5B7WA 1Q5VA 4ZITA 5B08A 4P7TA 5CYMA 2IA6A 4JOUA 1TL7A 4JI3F 3DDIA 4QWDA 1NKBA 2XMJA 1MMDA 1S1VB 1C1CB 1U2CA 2CYYA 4FVMA 3RB6A 1O5JA 4RZRA 1JLGB 2DRDA 1F0XA 3CJSA 3T3FA 1X4BA 2LU2A 4ID5B 1NPKA 4LF8J 1RLCL 4HVZA 5F0WA 2E66A 4DF8A 2LA4A 3JAMY 4MAKA 3CDAA 2XEXA 4NLUA 3TQ1A 2IMWP 2UUBJ 3BH6B 3TJ8A 1BHNA 1W2IA 2L3MA 1VQPS 2J6TA 4CLKA 2ZFHA 1X5TA 1PO6A 3GZ7A 3DN9A 4YOEA 4BC7A 4TY9A 2XLIA 3GSIA 1HBNA 3OUYB 1WEZA 3OL6A 3OHAA 4XK8C 2FZCB 3JSMA 1VQ8S 4J9PA 1W25A 3R9LA 1N56A 1Z4UA 2CQHA 2P9EA 2XYHB 1GXLA 5DO2A 1WDTA 2BABA 2ZH2A 2HG4A 2AJFE 2FVCA 1LWEB 3QBCA 1FKPB 1DTTA 4ZVSB 3LWLA 2YTCA 2PSZA 4NL5A 1S72S 1N34F 3LP0A 2B6AB 1VMBA 2A18A 1R6VA 2PMHA 2E1CA 2KT3A 3C14A 3CGIA 2XZDB 4BWJA 2N3LA 1EETA 2J9CA 3ITHB 4DX6A 3MFHA 3HFKA 2X1AA 2ZJRQ 3GFZA 1G3OA 4JI8J 8AT1B 3ZXWA 3FMWA 2EVZA 2XSJB 3KDNA 2R2SA 1LOUA 1H6KX 2QG9B 1SC4B 1RCXB 2FQQB 2PEHA 2YWFA 3OTBA 3TZYA 3M9MB 4OI3A 2MZJA 3R2DJ 1NHUA 3VAKA 4DXLA 3M8QB 1U0HB 2FVRA 2BQUA 4XTTA 1AROP 1HARA 3D66A 1U02A 4QJVA 4Y6IA 4WXOA 2EPIA 2AEJA 1VRUA 2SXLA 2BACA 4OZ5A 4HL9A 1HNIA 5KFUA 4CLWA 1Y10A 2G4BA 2KH9A 3PW2A 2CJ9A 3P8BB 4FNIA 3LAMA 1GTHA 3UQSA 3MR6A 1FI4A 3IWLA 4M5JA 2IJRA 1VC5A 3K5MA 1PIEA 4KJIA 2PA3A 4W90B 1RU2A 4DV6F 1EAYC 2E9RX 5AT1B 2LXFA 3M6VA 5KFIA 2PE8A 2XYGB 3E01A 1VJQA 2YY3A 5G0RB 2AYEA 1JJHA 4WU2A 5D0HA 4CLTA 4I67A 3CCTA 2GQCA 4NYOA 2OO4A 3T1HF 3OL7A 1CQMA 2HVEA 3FEXB 1S12A 3H4DA 2FHMA 4O0NA 2IRXA 3V2UC 4HH1A 3AA8A 3I5AA 3MHYA 1RTJB 3PIPQ 1IWGA 3CJ3A 1PYTA 1T02A 2B0GA 1KQGB 4CNYA 5KOWA 1J5EF 3QATA 2QSFA 2VH7A 1L3KA 2ZWPA 3KNGA 4YR3A 3JTNA 2CQ4A 3ZTQA 2ASJA 1UETA 5E0OA 4LF9F 1S0NA 1VLOA 2I5JB 1CS4B 2W2PP 1QTMA 3IMQJ 2XO7A 5DDRC 2UUBF 3KXDA 3N6NA 4NZ7A 3I5CA 1XMOJ 1UZHA 2FY8A 3CCWA 3I5BA 4CI0B 2ZOGA 4DCJB 2GHWA 2RMLA 4X4VA 2ZH8A 1FHTA 4CM2A 3TAMA 5KG0A 4QIWD 3TA2A 4LF5J 3JAMU 1HBUA 3FQLA 1J5OB 2J6UA 1DZ5A 4X4QA 5J2NA 2XM3A 2NSCA 3DMJA 4ED3A 3GIRA 2IC3B 4ECTA 2R7VA 2H65B 1TUWA 2GX8A 3BV8A 1OY9A 1T95A 1SQGA 1RI7A 3CJ2A 3NBPA 2FJBB 4O44A 4B3RF 2JEIA 2HNDB 2ZDPA 2MKKA 2ZJPQ 3TYTA 2AT1B 5KFRA 4ICLB 4PXBA 5E41A 4P75A 1T9YA 2W2QP 2VFVA 2HVHA 1UWBB 1E6VB 1SXLA 3D6TB 3DOMB 1MW7A 4MT1A 3MWBA 4N77A 2DBBA 3H25A 2OFHX 1MU2A 2F9DA 2XHWA 3TVKA 4F0HA 1YJ7A 4OYMA 2QJ3A 2ASDA 5A8RA 1IKYB 4DN9A 5KT4A 4NE9C 1KKHA 3GJRB 4FDFA 5DZ7A 4XO0A 1SL2A 3TZXA 4DV1F 4Q8EA 1RT7B 1WHXA 4NLRA 5KOXA 4OI1A 4MIBA 3I6PA 3VR1A 3SYZA 4QR0A 4B9TA 2QZ8A 4LFCJ 2CXEA 1JLQA 4P74A 4J9OA 4PWDA 2BOAA 2ZVIA 4YB5A 2FLOA 4CT8A 1N0UA 4J9VA 4LSNA 3IRXA 4Y00A 3LAKA 2M8DB 3OFFA 4F02A 1R8CA 3IRWP 4W92B 2R7SA 2KFZA 4KGXB 3BQ0A 1UVNA 4LRAA 1IKXA 2OPSA 3IP0A 2LQ8A 5HATA 5U47A 1RUSA 2IIHA 4PG7A 3H4BA 5E3RA 3QRRA 3P5TL 2GJ2A 1TVRB 3IS9A 3PX0A 2MJUA 4IH7A 2VASA 2CQPA 3I4HX 3MOJB 2ZE2A 3JSBA 1TK5A 4WYWA 4F4YA 3OXFA 3KLEB 1VK3A 1WKKA 3R97A 3RB4A 4BWMA 3UN5A 1U1KA 5F8HA 3KJVA 1P9YA 2OPPA 4ZPWR 2EFVA 3I0SB 3NBPB 1QTNB 5KFQA 3MR3A 1D9AA 5IZHA 2UUAJ 1UMJA 2MKYA 3IGVA 1S6QA 1FCAA 3AJ1A 2ZHOA 2ALYB 4NCGB 4DV7J 4F4XA 4FYDA 5KFAA 1FVSA 1GXUA 2CDQA 4X2BA 1KHWA 1SJQA 3UNYA 1WC6A 4TLQA 2W25A 5KFOA 4P2FA 4CH1A 2YWKA 3EE3A 4ECYA 3P5BP 1HNZJ 3DDNA 3IBFB 4DOZA 1R0AA 3OR2A 4CO3A 1HYSA 1YJTA 4NXMJ 1TUVA 1VBZA 1RKIA 2JVOA 3MPYA 4ECWA 3CULA 2V9KA 1YBTA 2E5GA 3KUGA 3DGPB 4RKUC 4IFYA 1TL7B 4UQTA 1QSSA 4JYAJ 1LW0A 3OSPA 2DPIA 5DM6Q 2OFGX 4NXNJ 2BMBA 3AT1B 3QZ7A 4Z37A 1TKZA 1WC3A 1WOPA 5IT4A 5DS7A 1GAOA 5L39A 3NGDA 4LBIA 1A9NB 3X3UA 1RTIA 2OELA 2E1PA 3TVZA 4EYIB 1FJCA 3DLEA 4DSIA 1CC8A 2KRBA 2JDJA 4WFYA 4ED2A 1M5KC 4PWDB 3Q8PB 3D3BJ 1U47A 1P1TA 1HR0F 4M5LA 3C6UA 1C2PA 1CJTA 1MWZA 1YKWA 3MM6B 3PDNA 2J0XA 3CJTA 5A8WA 3CCJS 1OWXA 4D3HA 4CH0S 1F5AA 1D8ZA 5ETMA 4ZN3A 3J81j 2WTFA 2FZKB 1B4SA 2ROEA 3L7OA 2HAFA 2MKJA 5L9XA 2R8HA 1O8BA 1IKYA 3EJMA 4I0WA 4A47A 4LSLB 1REGX 1F2GA 2HWTA 2XMKA 3J81Y 1VQMS 1FWKA 4QZVB 3GU0A 5GAEI 1XMOF 2DKOB 3EMTA 3AOAA 5HBMB 4CM0A 2P6TA 4EGLA 2EK6A 3HP6A 4A8XA 1HQEB 2MLXA 5AJ3J 3Q8VA 4F4ZA 3OW2R 4ER8A 1C1BB 1UFKA 2YKOA 3KUHA 2DH8A 1DRZA 3CIMA 3OT9A 4MK8A 1UJ5A 1FDAA 5D78A 4HACB 2AEFA 3TOQA 1N32J 1F1BB 2NPIA 2V0NA 4Q45A 3MCOA 3UNGC 2UUWA 2ZD1B 3OL9A 2JL9A 4C48A 4P10A 2QMUB 4KYZA 2CJQA 3W2WB 2KI2A 3MM7A 5K8PA 3EZOA 6FDRA 1DLOB 4NOHA 1RT5B 2IJNA 1H73A 1Q16B 1X4HA 3VAHA 1ZA1B 3TR5A 2GZOA 4USUA 3PEHA 1VCTA 3EPGA 1LFPA 1SJRA 4ZPVR 2DNKA 1LW2B 1Q0NA 1WF2A 5F9LA 5L1JA 1OSCA 1TL5A 1WF1A 1YDLA 2RSQA 3F44A 3IWXA 3QWUA 3CDWA 4AD6A 3VAJA 2V9WA 4JV1A 1VQYA 2KFNA 1N54B 1P8GA 1RU1A 2HFUA 3IR6B 3MMAB 4UUXA 1CJVB 1NJZA 5AXKA 2PMWA 2E5HA 4AXIA 3TP2A 3L3CA 2U2FA 2VBWA 1K9MT 4ED8A 2F5GA 2C2KB 1FD2A 5F8MA 5CA5A 2AP6A 3PW7A 4KH1B 3AQPA 4M5IA 3WX8A 1JLEB 4OZ1A 2BJ8A 4RW4B 4Z2XA 5KFNA 2YVSA 3BSCA 1M5VC 4QCLA 2CAJA 1MMNA 2E29A 2O67A 3OLBA 3FZBA 3DRYA 3BBFA 2UV8G 5EWFA 1NHKL 4P2MA 2R9LA 3UCUP 3KMSA 1RT6A 2DNYA 1BQNA 2G0IA 3KMQA 4JI4F 2N7CA 4DR2F 1RAGB 1RT5A 3QJLA 1X9MA 5IOLA 2AYGA 4CH7A 1AB8A 3GJQB 5EWGA 2G2YA 2YPZA 1ZAWA 5KFMA 3CCVS 3K58A 4WE1A 2OD4A 3RZAA 4ENOA 1YQHA 4USKA 2XBPA 4LSNB 4O3QA 1HNIB 4KT0C 1UVLA 1R6YA 1YHQS 2HZVA 3FRYA 3RGIA 4WZQA 2VBZA 5K20B 5HO4A 4S0MA 4DPYA 5KT3A 2VHGA 4C6AA 4QQBA 4JI6F 3ZZTA 1KN6A 4ECZA 4KAIA 4MKBA 2VD3A 1JIHA 2QLBB 2HHQA 3DLEB 1H7WA 4CO0A 3ADAC 1FX4A 2NQPA 5A6PA 1JB0C 1GMVA 2B5JB 2YQ1A 3G86A 4KR0B 5ETLA 3G8TA 1RT4B 2B7BB 1S10A 1R0BG 3KDOA 3HM9A 5HP1B 3HKWA 5DG7A 2YWHA 4PQUB 1Z2ZA 1CJKA 4I68A 3GIKA 3A8IA 3KG4A 3MM5B 5C25A 4M63A 3LP0B 3FBFA 3W65A 4OLOA 4P52A 3WIUA 4F3QA 4F8RA 2W2OP 3U02A 3CE8A 2W9BA 1KEKA 3M8PB 1HWIA 3KK3B 3CCQS 1NDCA 5ETSA 3ETOA 3FDSA 2WW4A 4GVLA 3VAMA 2XGQA 2ZHBA 2VPYB 2B4OA 3WDOA 3A3OB 4Z7YA 2KG0A 2ZH1A 3PVXA 2GHVC 5FDLB 2YKQA 4PQAA 3DFEA 2V8DA 2M8HA 5KFGA 4DUYF 2O66A 3KHGA 1JLCB 3WIVA 3GIIA 4B9LA 4F50A 2C22A 3OUYA 1KVKA 2YNFB 4OJ1A 1ZPVA 3BN4A 2DNPA 1GT8A 4WPAA 3KK2B 2B8QA 1BQXA 2M0GB 3OBIA 4QYZJ 5J2NB 1HI0P 3AJ2A 2JSXA 3KJFB 4QPXA 4DR1J 3BYPA 3RR8A 4DQIA 2E7WA 1HIYA 1EKSA 3IS9B 3CTRA 1KLNA 1FNMA 2K3KA 4DV0J 3GIMA 2AJ1A 4ICLA 3QRPA 2A10A 3NRBA 2NSBA 3NMAA 1SV5A 3K2YA 3C3LA 2BW7A 3N5FA 4WYLA 1HNVB 2C2MB 1FWLA 3QMQA 3ENVA 5D0RA 3B4MA 2OEKA 3I0SA 2M52A 3FFIB 4H4MB 3KG1A 2RDDA 1NO8A 5AJ3F 1UVIA 3A12A 1MN7A 2VG5B 1GNKA 4RW7B 1KD1T 2CKWA 2F65A 2JFKA 1BY9A 2IRUA 2V8HA 3C15B 3OHBA 1WNEA 1WHWA 3OFEA 4WK3A 2ZC4A 3KLGB 1WACA 1NBEB 3GG0A 3SI8A 2W24A 3L7PA 3DM2A 2DXDA 5EX3A 1RAJA 2NXCA 4OZ0A 1RISA 3ZC4A 2PN6A 4WJBA 4PXDA 3LPYA 1IR1A 2MDAA 3W3SA 4DL6A 3HF5A 2R7XA 1AYEA 3RRKA 2H9ZA 5DLGA 5GAGI 2D9PA 1HQUB 4EO8A 3OVBA 2MB0B 5A0YB 4RW7A 4B3SJ 1N5SA 4LMZA 2PO4A 1U1OA 1JLQB 1TTHB 2VG7A 2WOMB 3GTYX 3HVAA 1XR5A 3MGJA 1JJ4A 5CCMA 2LECA 1SC6A 5L46A 1I6JA 2A2CA 2VOPA 3TNVA 1NU4A 2M2BA 2APOA 2HRYA 2V6AA 2YNHB 5BR8F 2R2UA 2UXDF 4GKKF 2HNYA 3LH2S 1YJVA 4ZJOA 4UW2A 4K7QA 3UCZP 2CWXA 3MD1A 3TA1A 2AU0A 1FE0A 2RDIA 3PO4A 1T05A 4I1TA 3FVYA 1SKUB 1WDDA 5DZ6A 1XWLA 4U95A 1WHVA 4L74A 2XC9A 3H7HB 5A8KB 5A8KA 5H1SV 5C2CA 4LJMA 2MQNA 4C2MA 3PKYA 1EZZB 2BJDA 2W7PA 2DIVA 1H38A 4CCHA 1X0PA 4DJBA 1RSCA 3SZ2A 1NK6A 2J0QD 1AFJA 1Q1KA 1NSAA 2G9OA 2V2KA 4M5GA 3PRVA 2NZCA 3H2VE 1IM6A 1S79A 3G8SA 3TRGA 4QIGA 1T94A 4ANDA 4C7QA 4KHPJ 3EPIA 4C3KA 3MM9A 1CS4A 2A1BA 1U24A 3H90A 3PW5A 1OJ4A 3P96A 1KQFB 2C2DA 3C6UB 3O44A 2ZEJA 2HK2A 3GJSB 2GIFA 1M1HA 4IG0B 1PILA 3JTPA 2L9NA 4Q44A 3W5YA 3W61A 5K9FA 3V6HA 1VHIA 4PG8A 3E2EA 1XNQF 3VGTA 5I3PA 1HBNB 1HHTP 4PXEA 1PAUB 3C14B 5BJRA 4DV0F 1V3RA 4KH0B 2H5IB 3EDQB 1JQGA 3FMBA 3QYYA 1LFWA 4IOBA 3CJ0A 4Z7CA 3K57A 1YSJA 1FFWB 3L7UA 3M2RA 1RWXB 4IFYB 1PC4A 3M7VA 4AUKA 5EHHA 4J9LA 3MR5A 2CPXA 4ZVFA 1D9FA 3T1AA 2MZQA 1JLEA 3ILJA 4RW4A 4CLYA 4GC7A 3SSSA 1SJFA 3D3CJ 1PC5A 4DCOB 1RBLA 2UXCF 2LDIA 2CPIA 3CEDA 1NH8A 1UW9A 5D0EA 1RTJA 3DC2A 4KGKA 3DDKA 4L72B 4PCQA 1RKJA 1YVFA 3FFIA 4OI6A 2B51A 4H4KC 1Q82T 3ILIA 2IM0A 1QLNA 1OPZA 2OPPB 1X8DA 3ZZPA 3AB2B 3G4SS 4A8SA 3OTCA 1LWFB 1XQIA 5DJBA 3RBXA 3VAFA 2IFXA 3FCVA 3PRBA 1RAOA 4DV4F 5HI7A 5MAOA 2C28A 4DL4A 2C2OB 5I3UA 2LEAA 3HSGA 3GFXA 1H72C 3BGUA 2J7WA 4YB6A 4LF4F 2QLWA 2JRSA 1EJ7L 4OX8A 5HBMA 4EWTA 2H51B 1DQ9A 2HBYB 2YQ0A 2FVSA 4I4BA 1J2VA 3AQOA 1NK7A 1JX4A 3PV8A 3BGLA 4DV5J 1FFGB 2OLWA 3QSIA 5KG1A 3Q0AA 3EYZA 3PY8A 2LQ9A 2WBMA 4PPZA 2V8GA 4LIRA 4OZLA 3VGUA 5BR8J 2YNHA 4ECQA 4QU7A 1Y0HA 2B5JA 3A4TA 4UF4A 2CQ2A 5CH7B 3THVA 4DL2A 3NMRA 1B0TA 3LOUA 4PYAA 4ETZA 2EFPA 3DLKA 1HQEA 4FXVA 1GQEA 1UA0A 1IKVA 1YJWS 2XCAA 3DOLA 1VRQC 3RAMA 1RHMB 1S1WB 4PWUA 4ZVEA 1FA0A 1XERA 1RHKB 1I1GA 1SCJB 2FIUA 4CWBA 2MQPA 3GFHA 1PBAA 5F3TA 5KFEA 3MXHP 2KFYA 2KZMA 4ZCIA 4ZLLA 3BSAA 1YBAA 4WIQA 3FJ2A 4F26A 3KK1A 3KK1B 2RS2A 4RO0A 2Z2YB 2AJ0A 1RT4A 4DV2J 4K0KJ 3BGFA 2B9WA 3FBBA 2F8MA 5A6WA 2VQFF 3MECA 2HSEB 3RBZA 4E2FB 2BE7D 2FTRA 2ZNZA 1VIXA 2X1GA 3MEEA 2UUCF 2Z58B 5C24B 3OTOJ 2V4RA 2GMJA 1IQZA 2QA2A 2DT9A 3AHPA 3I31A 3R6GB 4MJKA 4M5NA 2VUGA 4RUHA 3ULHA 3DLLQ 5HVGA 4L6V3 1S1XB 4RWWA 2YNGB 2V68A 4MH8A 4HHHA 3TX0A 2DR9A 2UU9J 1MLAA 2HQDA 3KLFB 2BQRA 1XMBA 4J9MA 5FIIA 2AV5A 2K8GA 3SEOA 1SV5B 4GKKJ 1S49A 4BCAA 1OYEA 4DU8A 5D6GA 2ZM6J 2AGPA 3ET6B 1U1PA 4E98A 3GSDA 3C66A 1X5OA 4ZIWA 3BJYA 2X51A 4XPEA 3ISNC 2KT5A 3BQ2A 3BN7A 4DUZF 1R0CB 3G87A 1U49A 1RWUA 2QO3A 2DNOA 3GLJA 4DSJA 1NPRA 3MMAA 1HBMB 3M32B 4JP8A 5E2QA 4ANCA 4OX9J 2C42A 1UVJA 3KK2A 4IQMA 3A8JA 2MLZA 3JB9k 4K4YA 5B0AA 3DYAB 2BE9B 2BUNA 2BW2A 1CULA 2VF3A 3FK4A 3WHIA 1JLAA 3CDBA 1Q8KA 4LRCA 3HPOA 4ED6A 3HULA 2JFDA 3MPDA 1ACMB 2EEYA 3B82A 3NCQA 2XMUA 3I4PA 4NZ6A 4CYUA 4R5PA 3DOLB 4O23A 3M6UA 1LWCB 1RWVB 2DHSA 5C24A 5FLXU 3CD5A 4JV0A 1D09B 3TANA 1FESA 2BANA 3MM8B 2YNIA 2KN4A 3UVJB 2F8EX 4KKOA 1XR7A 3BPDA 3CC7S 1IVZA 1X0FA 1UJ6A 2OPRB 1N5VA 2OP5A 1Y4ZB 3HSDA 3HVWA 1Y11A 3MAQA 1XMQJ 4USWA 5HAOA 4AFFA 1SH0A 3BB5A 3PJWA 2YBVA 4ZJLA 3R8YA 5AXNA 4IRCA 1WORA 1VS3A 3UW1A 1YTYA 1JXEA 3QIDA 4Q7AA 4C9DA 2DGTA 5KFCA 1RWKB 1RP5A 2IBKA 2PIIA 2ZBCA 1T05B 1RWOB 3S1TA 2VZ9A 3S7RA 4ALZA 4K50A 1ZYQA 8RUCA 1JJCB 4Q0BB 3G82B 3G82A 2K7KA 1UAWA 3IR7B 2HNYB 3D6HB 1RBAA 1DQAA 3ENAA 3QIPA 3PACA 4LBPA 1JLFA 4WE1B 1CJTB 2BZ2A 5KFTA 2HRTA 1C4AA 3CNQP 5CD4H 3DOKA 5HJXA 4X4PA 1SJ3P 1VQSA 4WP8A 3SMZA 4K0KF 1NEEA 4FP9A 2MKIA 4IYQA 1QE1B 2HWIA 2VV5A 5M2UA 1N88A 2B4VA 2OPQA 3M8ZA 1JWWA 4B3OA 2DHGA 1DAXA 1RAFB 4A48A 1B99A 4XDDA 1KQKA 3K59A 1JNRB 1TZ0A 3DLJA 4F4WA 1RB0A 3LP1A 4F4AA 1S48A 3B8HA 2CRLA 3G6YA 4R25A 3IG1A 3DXSX 4DV5F 3A13A 4P2SA 2DITA 3N01A 3IFEA 3MMBB 4LBHA 1WSVA 2F9JA 2IVMA 4YS2A 4QYZK 3AB4B 5DRKA 1SIZA 1TU0B 1V3SA 3FSXA 2GW8A 4OYWA 3JSRA 5ETKA 1T9VA 2FJAB 3E8OA 1HMVA 2V2QA 1HQUA 1S7IA 3MI7X 4ZP9A 4ZVTB 3OV7A 3BEGB 3M8RA 1K0TA 3GP9A 2HFNA 4NLTA 4BBYA 2JLGA 3MEGA 2GJIA 3QGPA 4ECVA 3GJTB 2HHWA 1LK5A 2HLTA 2CVIA 2H4WB 2K1RB 4RUBA 4AE5A 5HMYA 4RUAA 2XNRA 3R2CJ 2BDPA 4WU3A 4F36A 2RRAA 3DRSA 1REVB 2V67A 4WP3A 4ZPBA 3HMJG 2MQOA 3A1YG 2NZ4A 4L3KA 5D8HB 1FEHA 5GAHU 3BZQA 4QOTA 1NJXA 1RCOB 4TU9A 3C15A 2RQ4A 2Z0GA 4B9VA 3D1QA 2LLZA 1S6QB 2ADCA 1S1VA 5LOQA 3RR7A 3B6BA 2Z57B 1F5CA 1EP4A 4PZVA 3SFUA 1NB7A 5T7LB 2M3DA 5CABA 3L4BC 3KLHA 3ZZRA 2B4UA 4OX6A 4QR2A 3EICA 5FD1A 3W9IA 1F3FA 2OGUA 1RHRB 3TZWA 1VQ9S 3DHXA 1TL4A 2RS8A 3HZGA 1Q79A 3QFHA 1D3WA 2E5LF 2LEBA 5K14B 2Z56B 3EVOA 3R7BB 3OLAA 2Q66A 5GMDA 2W4DA 3E01B 4MIWA 4KHPF 4WIIA 2B9YA 1T3NA 5H9EK 2IYGA 4DPOA 1S4EA 2IJFA 2DNZA 3IAM9 4EO6A 1NZ8A 2Y1LB 3U27A 2VODA 4Y2MA 2JWNA 4Y3CA 3VWSA 4M5DB 1XR6A 3RRGA 1TP7A 3HSZA 2YKPA 4USHA 2D3O1 2B6AA 3CCUS 2FDNA 1HW8A 1IBKF 2AQ4A 3TEHB 3C6TA 1P27B 1U2RA 1UCNA 3CJRA 1M5PC 1O0PA 4RNNA 4O4GB 2DH9A 3DLKB 2YKNB 5BYQA 2RU9A 4DFMA 2RAQA 5D3GA 1EHWA 1FE4A 1FWPA 1KWMA 1U25A 2YH0A 1SL0A 3DNCA 2IM3A 1VDHA 2QMXA 4DFPA 2C3PA 2MPUA 4KO0A 2XZWA 1XNRJ 1EETB 3ISZA 4DR7F 5E3AA 3ZTRA 1EP4B 1T11A 2EBGA 4YHHF 1ZAXA 3JYTB 3EGWB 3TI0A 1Q95G 3HHLD 1ZA2B 3M05A 3DRSB 1P6TA 2YWWA 1HNWJ 3OR2B 3M30B 4EBCA 5L1LA 5LMUJ 3QAEA 1GTEA 3CVKA 3QLHB 1UW4A 4NEZA 3TJAA 3UDVA 3HHNB 4LF8F 4MYTA 4D3GA 2VJUA 1LWFA 3LUYA 2V2ZA 2XY5A 2BYCA 5B0GA 3QAUA 1HWUA 2Q6BA 1ICEB 1NJIT 3D4JA 2QN6B 3UN3A 5ADZA 2ZNYA 3CW2C 3UDEA 1YI2S 4J9NA 2CG8A 5ITHA 3OJSA 3I87A 1JLCA 4TYAA 1FFSB 3DRPB 5MLCV 2L48A 2W2MP 5IWAJ 2ZE2B 2ZKUA 4DUTA 3FSIA 5KT2A 1WI6A 2BM1A 1NRKA 1V5IB 2XMWA 3ZZOA 4ED5A 4B3TJ 2BKOA 1RT1B 3FRZA 5KG4A 1AA1B 1YJRA 2NXNA 1H7XA 1IM4A 2KVIA 1TL3B 2QLJB 4B3MJ 1SQEA 5KT7A 5I3QA 1ZM4A 5L38A 3K5OA 4DL3A 4DL5A 2F4VF 3DRRA 4WK1A 3BO3A 3W8GA 1ZOTA 4V1Ak 2IPOB 3IBCB 3PO5A 4IOAQ 2D9OA 2LQ5A 4OJ3A 5RUBA 1Q81T 1JKHB 1QE1A 4LUBA 1FDBA 5HMWA 4H4KA 1WSRA 2DISA 3NLCA 3P4UB 2GO8A 4G1PA 4DV2F 1ZAVA 3SCKE 2EG2A 5DDPC 1MNEA 2ZH4A 5J2MA 4QW9A 4EMDA 2LFVA 1I3OB 3BYRA 4G1IA 3K7RA 4ZCMA 4IQXA 1Y7PA 2MZSA 2V8PA 2J9DE 4LF6F 3NNAA 4CTAB 1KP6A 3KLIB 2NS1B 1HW9A 3L95X 1M5OC 5CYQB 3L09A 1G1XA 4RBTA 3H20A 4RX6A 2D3UA 4YY3F 4OQJA 2RQKA 2HNZA 2RUSA 4RR5A 1OO0B 2CPYA 4QIFA 1HR0J 3DOMA 2JOQA 1UPPA 3GCXP 3ITHA 1IBMF 4LVNP 2W01A 1PSDA 5HSPA 2NPFA 1U45A 1S99A 2YNIB 1BGXT 3TUZC 3RB0A 1CJUA 3HZEA 3QT5A 2XS7A 4KPCA 2ZZNA 4B3RJ 2J7UA 4PXCA 3PW0A 4URGA 5EX0A 1NUEA 2BVZA 1FTCA 3MUTP 4ZJQA 5B0FA 3FUYA 4CP5A 1UA1A 1AT1B 2YKAA 2MQLA 1NK0A 4OHVA 3I96A 2KDOA 2HZAA 2XSFA 1IR0A 2E44A 3C8YA 3H8YA 4P6QA 4CYUB 3QT7A 3CXCR 2CJXB 1J5EJ 2Y8WA 3AODA 1I94F 4KSEB 1MWQA 2XLJA 2I1RA 1HBMA 3M32A 3MAAB 1B3TA 3PTWA 2DVIA 4O3SA 4U8YA 3BBCA 1YZ6A 2RQMA 1TKDA 4ERDA 9ATCB 4DV1J 5CHCB 3UDCA 3N6LA 4NI2A 4DMZA 1X60A 2RRNA 2V4JA 3RUBL 3W5ZA 4CT9A 3TO8A 3KLVA 3NP5A 2LA6A 5A2QY 3QRQA 2ABYA 2HQ3A 5AE1A 4ID5A 4LFCF 3ZZUA 3KLFA 3K5LA 2R7WA 2MTLA 3BS9A 3D7SB 2LQBA 2YNGA 3ET6A 4FYVB 3JSMB 1U6ZA 2HEKA 2V94A 3U1NA 3MMBA 3M4XA 3MM7B 1APSA 3T1HJ 1X7VA 4GO5X 1BQMB 3V81A 4OMFG 2J8AA 1KLMB 4W98A 4F25A 5M2PA 4NEYA 2Z2MA 2QEXS 4R0JA 4OIXA 2OMLA 2QTWA 2ZBIA 4OYXA 4ZPAA 3KHLA 3QSYB 4M94A 3CT9A 2MEWA 1TK8A 4NASA 1LW2A 1T9WA 3HFVA 2YXLA 1CQNA 4X4UA 5G0RA 2R8JA 1PJ6A 3GMGA 1QSYA 1YRTA 1X31C 2IBOA 2B4PA 3UO0A 1G6BA 2PC6A 3MECB 4KY3A 4DDFA 3PFEA 1IKXB 2OPSB 4WZMA 3RW7A 3N28A 4K4TA 4C8ZA 4ZHRB 2D3OR 5JJBA 2AJQA 5LT5A 1VRUB 4GVBA 1DURA 3IO1A 3MEDB 1NPPA 1Z2LA 2RKIA 3W1YC 2OSQA 2BJ1A 2Y8YA 1ROFA 4JI4J 1TELA 3BF4A 1ZM9A 2ZC3A 3R5DA 4KRWA 2AYBA 1SI9A 2VG6B 2Z2ZA 3Q2SC 3EXCX 3Q86A 4OI4A 4YY3J 4U7UD 2BA9A 2MY7A 4ES1A 2LEPA 1FD8A 2Z30B 5JVGQ 1TFYA 5DGBA 3HO1A 3ICLA 3C6TB 3BPSP 1G2EA 2DGWA 2OKQA 2QLXA 3SIPB 4K4XA 1N4LA 1MG7A 3OTOF 1RT7A 3HDSA 1FXDA 2CADA 3OFGA 4AL7A 1X4CA 1HLWA 4Y65A 3G6ES 4TY8A 4EBDA 4TY8B 3UDLA 2BJ9A 3PYDA 3CC4S 4RL1A 1RAIB 4B3TF 3K5NA 2GO9A 2HRUA 2CJBA 1GMWA 4JI2J 4C4WA 4JI6J 2B43A 2RB7A 2Y1IA 4PABA 2ILZA 2UU9F 3MM6A 4ZP8A 1YITS 1BWVA 3GIJA 5HROB 2XGPA 2HWHA 3QFWA 3RBEA 5C2GA 3LGHA 1E6VA 3MPVA 3HJVA 2Y0SD 2HAIA 2YWEA 3NXZA 4OZ3A 4QWBA 3SFGA 2C2ZB 4M5KA 1LXNA 3DXBA 3HVTA 2DHAA 1U2FA 5DDQC 4P73A 1RTZA 3J7Z5 1RT3A 2E9ZA 2HNDA 1I94J 1T7PA 1EIYB 1JNZB 1BD6A 2GMLA 2GQQA 2LDYA 2V2VA 4C0HA 3M9NB 2DGUA 2J5AA 2UUAF 3DGPA 2MQMA 1OPIA 1SB6A 4R8UB 1FKOA 1TL1B 1VIOA 4FKXA 4F67A 5HQ8A 1BLUA 1PCAA 3KLEA 3KTQA 3QNWB 4KIAA 3ELHA 1N52B 5AXMA 5HJYA 3UE2A 2RD5C 3M6WA 4XAKA 3T1YF 3NNCA 3NEKA 1ULRA 1RJJA 3DRXA 4ID8A 2G0JA 3C16B 2EK1A 4DPUA 1SL1A 4N41A 3T41A 1X4FA 2BRLA 2VU5A 4UTGA 1NZAA 3POTB 1RHJB 3TW0A 3J81U 1FRMA 2P6SA 2V5HG 1GMUA 4RJVA 3D2WA 1KLMA 4IG0A 4BLGA 2AD9A 4EU0A 3S01A 4FS1A 4QBUA 2V69A 1K1QA 4NRUA 3RB3A 1N8RT 1KNZA 3PM9A 2GQ2A 4J9KA 4MFBB 4N76A 4WKRA 2AGQA 1VC6A 1P9QC 4USJC 3J7ZT 4F2SA 2WHOA 1WELA 4BS2A 2UXBJ 3BBBA 2KVQE 1X4GA 3H5YA 3BDEA 2CNOB 1EKRA 1S7HA 3M2UA 5EDWA 1VC0A 5EUHA 1TFWA 5C5JA 4B08A 4U6PA 4P7VA 5DDOC 1M1KT 2VBXA 4PQUA 3MDFA 4RNMA 4TVAB 4HI1A 2ERRA 1H3DA 1X4DA 1R8AA 2VFUA 3N9UC 4P72A 3VTIA 1RHQB 3MAAA 3NAIA 5T14A 3M8SA 4OYOA 1K47A 2EFNA 1S9EB 1KRPA 4DR7J 3HT3A 1N5YB 4FYXB 3Q23A 4QW8A 2BE2A 1MU2B 2Z4PA 3FGVA 4HLBA 3DOKB 2DHXA 4DPXA 1QJHA 2LXIA 4L76A 1FEEA 3H2LA 2J7KA 4Y2CA 1IQTA 1U1RA 3GV5B 2WVDA 5IC6B 4JYAF 3CDEA 1K1SA 3LP2B 3MM9B 5LM7E 3LW5C 2P9CA 2E7XA 3Q8YA 4HTJA 4B02A 1NK8A 3VV2B 4NMXA 1EQMA 4F4KA 3NGSA 2QC3A 3NNHA 1KTVA 2DEJA 2M4MA 4HR2A 4J37A 1XC9A 2IY5B 4ILRA 3DMJB 2P2CB 3FNNA 2AZ1A 1RYSA 1KDNA 4NMLA 6AT1B 2VG7B 3QWPA 4JB8B 2WVEA 4F3MA 1M0SA 3M6XA 4DZDA 1EB0A 2J76E 4I2PB 4M5DA 5KTQA 4X65J 3PW4A 5IM0A 4IO9Q 3R1HA 1UEKA 3PJXA 4B9UA 5E33A 3RAQA 2IAJA 3AD9C 2QL5B 2MSSA 1X4EA 1B0VA 3SXLA 3SCJE 5E3PA 1VQLS 2VDIA 3VHQA 3MMJA 4F0KA 4EBEA 2G0CA 3QJPA 4IO1A 2Z2LA 4WKYA 1RWPB 2R7TA 4YDXA 1LWCA 2HVDA 2KL8A 4K4SA 3LF0A 2VOOA 3IA0A 5BYRA 1Q53A 5EGYA 2WONB 3VVTA 2PFFB 2QL9B 4NCAA 2UXBF 1S4FA 2DNNA 2JX2A 1JLAB 1SJ1A 2VG5A 3DU6A 4F7VA 4OHWA 2JC0A 3IN5A 5IT9U 4DCPB 4ZN1A 7FDRA 3PZPA 2PFDA 4H4MA 4CIOA 4GKJF 3BO2A 3PYEA 4J9RA 4DL0C 4ZLNA 1N33F 2HHXA 2UP1A 3CJKB 3UN2A 3HHLA 3TEGA 3HSJA 4IR9A 3NCRA 2AGOA 4DHVA 3BH7B 2FLLA 3KOAA 1FKOB 1FO1A 1TL1A 1H2TZ 3MCMA 4ZLPA 2P9GA 2K06A 5CZVA 4LF6J 1FERA 1YZ7A 2HLUA 3BGOP 4AT1B 2NLWA 4FF3A 4CLFA 4OHXA 4DR2J 1WTBA 4USTA 4AQYF 1VQ7S 2E5LJ 4FF1A 5DETA 1KQSR 1M5SA 3AA9A 3DU5A 4EUVA 3FBCA 1T9TA 3NG8A 2YKMA 1YX2A 1XK8A 4HEA9 3U7JA 1T9XA 5B0CA 2VA3A 1FDNA 5ETNA 5J2PB 4X64J 1IBMJ 2DR8A 2VONA 1S9GB 4TU7A 4OYPA 1IKWB 2UVRA 2E5JA 3UWTA 3GV8B 2FJVA 3IGNA 1F9FA 4DF4A 3N5BA 5D0GA 1S1UB 1U1QA 3IWNC 3D6MB 4OL8A 1ZETA 1XJWB 2QL7B 5DQGA 5GADI 1NXIA 2HVIA 1FRXA 5HQLA 3NY0A 2K7JA 2KYZA 5KFPA 4DSFA 4YMEA 2HQGA 1QAYA 2DGQA 4FN5A 2HHSA 3VZIA 1WJ9A 5HMXA 3KKFA 4KHMA 4ANEA 4DQSA 1TUGB 3FZ2A 1KFDA 1NM2A 2JVRA 2V4QA 3GYNA 1F9EB 2AEMA 3QGIA 5CYMB 4C0OC 5HANA 4NLDA 4IH6A 1S1WA 3CB4A 3MMCA 3UR0A 4PUOB 4N5SA 3AH6A 3HFZB 1ZM2A 3SDEA 4DV3J 1NCLA 1YJ9S 2FD2A 1KC8T 1PYSB 2VBYA 2XG8A 4DPWA 1RDRA 4G65A 3P45B 1NLKL 4L75A 5KAKA 3TARA 2ROGA 2KT2A 3KNAA 1WF0A 4LFBF 4ZHRA 2ZUAA 2HFVA 3NGKA 4HTIA 3HD1A 4DUYJ 2AWZA 3BREA 2NCKL 3MOZA 2DNGA 2O5DA 3NWGA 3JTOA 2DO0A 4Y2AA 3BQ1A 2G1HA 4QWCA 4KGZB 4P71A 5FJ4A 2E1MC 2QSWA 4EK2A 3AXKA 3AXMA 1T0TV 2WBRA 4OFZA 2HZCA 1C4CA 1DY3A 2WK4A 5E3CA 4ZCLA 3TQEA 4DG1B 1LKZA 1TR0A 1AZSA 4NX9A 4YN3B 2PMZD 2HHVA 3NL0A 5CD4A 5IS2A 4Q43A 2B8PA 2E1RA 3OJUA 3RW6A 4RW6A 2YWGA 2CDRB 2OIHA 4MIAA 2VQEJ 1TMMA 5ETTA 3A3PB 1BQMA 1RQ0A 4LREA 1VYAA 4U96A 2L08A 4LF1A 3T19A 1PBUA 3PR4A 1VRTB 2ASYA 3CF5Q 4OLPA 1PGZA 4WF9Q 2KU7A 2MJNA 3D0IE 3PX4A 2R3VA 1Z1ZA 4O3PA 1WI8A 2CJAA 2LYVA 4RW9B 4ZP6A 1ELOA 2LKZA 3SCIE 1N36F 3HHLB 4UUWA 1OY8A 3S6EA 1FRLA 2DNRA 1HPZA 3CO0P 3QGHA 5KG5A 4FKYA 1WC0A 3OQ2A 1QAXA 1A6LA 1H74A 1RGVA 2IYIA 2YX1A 4DR3J 3RG6A 4GC6A 1U8WA 4B9SA 4C97A 3CJKA 5J1NA 3R7SB 4BC9A 2HURA 2QV6A 3BSOA 3V4IA 4TU8A 1DARA 4DL7A 3H5XA 3IRXB 3W66A 1OQ6A 1W7WA 2YNFA 4GO7X 2O1PA 3MUMP 3F56A 3QZ8A 3N79A 1U48A 1NKEA 3UCGA 4FVCA 4XIUA 1TV6B 4RNFA 1WD6A 1HBOB 2RJZA 2CQDA 1OIAA 2CNLB 2I6WA 2HFOA 2EC2A 3GFYA 5BYSA 4NYZA 4CLZA 3PFOA 4JI1F 1K0VA 3R5CA 3O5TB 2IHR1 4HDHA 2DR5A 2C2NA 1Q5YA 5D77A 1N48A 2KM8C 5HROA 1OY6A 1LK7A 4I2QB 1JXLA 1RTDB 1CJKB 2PDAA 2IVFB 1VQ4S 1C1BA 2H5JB 1BMQB 3F0NA 4WFNQ 2NUUG 4CQ1A 2E5IA 3CJ4A 5HP1A 1WKLA 3TJ9A 2HPUA 4K59A 1NDKA 4ES3A 2FC9A 1YK9A 4WCEQ 1KOOA 2CPFA 2EFQA 2FZGB 4H54A 5LJ5Y 2MXYA 4B9NA 4IG3A 1CC7A 2ZWOA 2DIUA 3MD3A 3N6MA 2PI4A 2MHEA 5LSOA 5IQ6A 2DGSA 2GC8A 1YJNS 2XS5A 3THPA 2ZKTA 1SH3A 4UZCA 5L1KA 3ZNJ1 2VG6A 4FBTA 3KHHA 2JEFA 2XS2A 4WBFA 5I42A 3I0RB 3G96A 4DBQA 1N5QA 3ENQA 4O0IA 3BM7A 1E6YA 1QSLA 2ZBRA 1RE1B 1T03B 2UVUA 1LXJA 1QVGR 1GFWB 3FKBA 4MK7A 4KQZA 3UFCX 3ZTSA 1R27B 3CJQA 1WG5A 1O51A 3J80Y 2HBZB 2CPHA 5EWEA 1V6HA 2V8VA 3VQSA 3D1OA 4QYRA 3CCMS 1R8BA 3PX6A 3CWJA 3M2VA 4KC5A 3H0PA 2Q3PA 3ZNUA 5HLFB 2BKNA 2XI3A 4N8OA 5J1EB 3NS5A 2NXUA 4DLGA 2HW3A 3EXYA 4U7UK 1F3VA 1QDUB 1CG2A 1H2UX 1HWJA 2NXEA 2XI2A 2FGOA 1HMVB 1S9GA 3D28A 2DB1A 1WC4A 2FUG9 5KFWA 3CPWR 3PJ9A 1O6XA 4WXWA 2WRMA 4HHUA 4NCGA 1F5BA
chains in the Genus database with same CATH topology
2DKOB 2H4YB 1RWWB 1I51B 2H65B 3KJFB 1RWKB 1RWOB 5IC6B 3D6HB 2CDRB 1RHUB 2C2OB 2C2MB 2H51B 1ICEB 2HBYB 2P2CB 4JB8B 3KJQB 2XZTB 3GJRB 4ZVOB 2C1EB 2XYHB 2QLFB 2QL5B 2XYPB 1NMEB 4ZVSB 4ZVRB 3D6FB 2QLJB 1RWPB 1IBCB 1RHMB 3R7SB 1RWMB 1RHKB 3SIPB 2CNNB 2XZDB 2QL9B 2C2KB 2H54B 2H48B 2CNKB 3IBCB 4ZVPB 3NS7B 4ZVTB 3R7NB 1SC4B 2FQQB 2CNLB 4DCPB 3P4UB 3GJTB 1I3OB 1PYOB 2H4WB 3R6GB 2C2ZB 2H5JB 1BMQB 3EDRB 2HBQB 4ZVQB 1QTNB 4LSZB 3GJQB 2XYGB 5IC4B 2HBRB 3R5JB 2CJYB 3QNWB 1RWNB 5K20B 3IBFB 1RHRB 1SC1B 2QLBB 3D6MB 3R7BB 2QL7B 1SC3B 1RHJB 1RE1B 3KJNB 1GFWB 4ZVUB 3GJSB 2Y1LB 2Y0BB 3RJMB 2HBZB 2CJXB 1PAUB 1F9EB 2H5IB 3EDQB 1RWVB 1RWXB 2CNOB 4DCJB 3P45B 1QDUB 3R6LB 4DCOB 1RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKO B;  2H4Y B;  1RWW B;  1I51 B;  2H65 B;  3KJF B;  1RWK B;  1RWO B;  5IC6 B;  3D6H B;  2CDR B;  1RHU B;  2C2O B;  2C2M B;  2H51 B;  1ICE B;  2HBY B;  2P2C B;  4JB8 B;  3KJQ B;  2XZT B;  3GJR B;  4ZVO B;  2C1E B;  2XYH B;  2QLF B;  2QL5 B;  2XYP B;  1NME B;  4ZVS B;  4ZVR B;  3D6F B;  2QLJ B;  1RWP B;  1IBC B;  1RHM B;  3R7S B;  1RWM B;  1RHK B;  3SIP B;  2CNN B;  2XZD B;  2QL9 B;  2C2K B;  2H54 B;  2H48 B;  2CNK B;  3IBC B;  4ZVP B;  3NS7 B;  4ZVT B;  3R7N B;  1SC4 B;  2FQQ B;  2CNL B;  4DCP B;  3P4U B;  3GJT B;  1I3O B;  1PYO B;  2H4W B;  3R6G B;  2C2Z B;  2H5J B;  1BMQ B;  3EDR B;  2HBQ B;  4ZVQ B;  1QTN B;  4LSZ B;  3GJQ B;  2XYG B;  5IC4 B;  2HBR B;  3R5J B;  2CJY B;  3QNW B;  1RWN B;  5K20 B;  3IBF B;  1RHR B;  1SC1 B;  2QLB B;  3D6M B;  3R7B B;  2QL7 B;  1SC3 B;  1RHJ B;  1RE1 B;  3KJN B;  1GFW B;  4ZVU B;  3GJS B;  2Y1L B;  2Y0B B;  3RJM B;  2HBZ B;  2CJX B;  1PAU B;  1F9E B;  2H5I B;  3EDQ B;  1RWV B;  1RWX B;  2CNO B;  4DCJ B;  3P45 B;  1QDU B;  3R6L B;  4DCO B;  1RHQ B; 
#chains in the Genus database with same CATH topology
 3NKY A;  4XDC A;  1I51 B;  3V6J A;  1RTH B;  1HWK A;  4ED1 A;  2CQC A;  2X3G A;  3DYA A;  2VC1 A;  4IH5 A;  4OYB A;  3S8S A;  3TZZ A;  1WC5 A;  1ZBT A;  5F8I A;  3SQG A;  5SZT A;  4X4R A;  1BWE A;  4F0M A;  3KJV B;  1N0V C;  3FEY B;  4NLX A;  4PR6 A;  4ILM A;  1YWX A;  5KFF A;  1X9W A;  4NLP A;  3TVY A;  2VFS A;  3AJD A;  3JQM A;  4K8R A;  4DV4 J;  1Q78 A;  2C3O A;  4CLP A;  1M90 T;  2HMI B;  2J8S A;  1IR2 A;  5HN0 A;  1DLO A;  5CQG A;  1MN9 A;  1NAQ A;  4G1Q B;  4EYH B;  4ELV A;  2EG1 A;  2BRK A;  2VL1 A;  2DR7 A;  1NHV A;  2D74 B;  2XZT B;  1S9F A;  3D0G E;  4X65 F;  5LXR A;  3RAX A;  4ZVO B;  2AIR B;  3T5K A;  4DI6 A;  2KXF A;  1L3U A;  3M1V B;  4KV8 A;  1WOS A;  2YX7 A;  5H9F J;  4JI5 J;  1E6Y B;  1VI7 A;  2YKN A;  3SSR A;  5D3G B;  4OHZ A;  1VQN S;  2GIQ A;  4IFV A;  2D69 A;  4JI2 F;  2J9E A;  1RK8 A;  4CZC A;  2V63 A;  5DQI A;  3M8P A;  3R5B A;  1IBL F;  2HHU A;  2OAU A;  3HI9 A;  3M2V B;  5AE3 A;  3LQV A;  2F1F A;  3QQC D;  3AFG A;  3R5A A;  1LV5 A;  3B4D A;  1ZZN A;  3HHL C;  1TKT B;  2HQF A;  2NYI A;  3NS7 B;  2OUG A;  4LT6 A;  2KB2 A;  3W60 A;  1BXN A;  2ASL A;  3I9V 9;  2OPR A;  5KG3 A;  5B0B A;  1HNX J;  1NDP A;  1Q4R A;  2FLP A;  2R7R A;  1HD0 A;  3AAW B;  4QU6 A;  2O3D A;  2WSE C;  3O2I A;  2COL A;  4O3R A;  1HWL A;  4KB7 A;  3I0R A;  2F40 A;  4NPO A;  3DLB A;  4GKJ J;  3LGN A;  5B0E A;  1TK0 A;  3SV3 A;  1ZTW A;  3QT6 A;  4X84 A;  4BHQ A;  3WX4 A;  2N82 B;  4C8K A;  2FHO B;  1LWX A;  1M5H A;  2IRY A;  2X1B A;  3W62 A;  2DR6 A;  2HHH J;  1DFD A;  4N8N A;  5B09 A;  2AZ3 A;  4G1Q A;  4UZB A;  2MY8 A;  1G7C B;  4MKA A;  4DSL A;  1C0U B;  1NK5 A;  1IBK J;  4NLS A;  1VGY A;  1WG4 A;  1XIQ A;  2N4D A;  2KXN B;  4DR6 F;  3CDU A;  1VK8 A;  5G4D A;  5IXU A;  3JSY A;  2LU1 A;  1FTR A;  5F0U A;  4JI0 F;  3EUN A;  1IWA A;  2CA9 A;  2LP4 A;  2FHJ A;  2MZR A;  2G1D A;  3D0H E;  1SJ4 P;  1RTD A;  3VGS A;  1KFS A;  1UPM B;  3W9H A;  4WWS A;  3TAM B;  2H1Y A;  1TL3 A;  2XNQ A;  3JS9 A;  4ECS A;  4NLO A;  1UWB A;  3K17 A;  2W4P A;  3EZU A;  4HI2 A;  1RAA B;  2KJW A;  5ETO A;  1F9H A;  3R5G A;  1VBK A;  2QE5 A;  2GV1 A;  7FD1 A;  3E51 A;  2CQ3 A;  2QFI A;  2MYF A;  2RT3 A;  1NH7 A;  4J91 A;  4TXS A;  2WSF C;  1VQ6 S;  4OX9 F;  1RAC B;  3EGV A;  2MMY A;  4A8K A;  2FB0 A;  1QUP A;  1R7I A;  1U6B A;  2FGC A;  4LF9 J;  4TNO A;  1IJE B;  2R42 A;  3W64 A;  1Q8L A;  2OEM A;  2XMV A;  5AXL A;  4IDK A;  1VRT A;  3M8Y A;  4UOF A;  3MF5 A;  3K89 A;  1HBU B;  5KFJ A;  4C8M A;  1DHM A;  1LEO A;  5HK4 A;  1L3T A;  3EVW A;  1TAQ A;  4USM A;  3V5R A;  3AOC A;  2V4J B;  2N3O A;  2P5V A;  2WVB A;  5CZX A;  3BKF A;  1R89 A;  1U26 A;  2WZ1 A;  4WFB Q;  5CXT A;  4DG1 A;  1AXQ A;  2FHJ D;  5IM0 B;  4RU9 A;  4TQR A;  2NYH A;  3MCN A;  2HNZ B;  2F63 A;  3MAH A;  4A8W A;  5KG6 A;  4K4Z A;  4I7F B;  4C8O A;  1EX8 A;  2EWH A;  4JI5 F;  5GME A;  3OXL A;  4P2X A;  1RWW B;  4DR5 J;  4I2Q A;  5I4M A;  3DLH A;  1QY7 A;  3T5L A;  2EW9 A;  2RDJ A;  4JI7 F;  3IC1 A;  3W2V A;  1S97 A;  2Q6C A;  2HHT A;  1D9D A;  4NRT A;  2VFR A;  5IV3 A;  4DFK A;  5J2Q A;  2X1F A;  4RW6 B;  1S6O A;  5GVQ A;  1IBL J;  1B64 A;  4OZN A;  1SPB P;  5ETR A;  4KTQ A;  1UP1 A;  4USI A;  1RHU B;  4IG3 B;  4NLQ A;  2XLK A;  3MMC B;  2OTL S;  4PUO A;  3Q2T C;  3MZI A;  3ZFV A;  1I5O B;  1ZTT A;  3C2P A;  1UKU A;  3D5M A;  2R8I A;  1X9S A;  1YG0 A;  4X4S A;  1N5Y A;  5A8R B;  1X5S A;  1CSJ A;  4ZK7 M;  1V5V A;  2A3J A;  3MEK A;  3J7A N;  2XWX A;  4OV1 A;  5CYJ A;  2RHQ B;  3CJ8 A;  3KJQ B;  5SUH A;  4LQ9 A;  4ED7 A;  3V4I B;  2MHN A;  2DY1 A;  2QIF A;  1GX5 A;  2A2D A;  2VFT A;  4K5S A;  1S1T B;  5I3U B;  4O3O A;  2FLN A;  3PNI A;  3RTV A;  1WEY A;  4JI3 J;  4KKO B;  3MPU B;  4W4M A;  3HLU A;  4NA3 A;  5GAG U;  1KS2 A;  3GWC A;  2XYP B;  1NME B;  3H5S A;  1HPZ B;  3QGG A;  2HQC A;  4KGM A;  1PAE X;  3D1H A;  3SDE B;  2LCW A;  2Q79 A;  5JXS A;  4IOC Q;  2GAG C;  5F41 A;  1JKH A;  1HL6 A;  3QJJ A;  3M8W A;  1GX6 A;  4LVO P;  3E3X A;  4R5P B;  2PI5 A;  4EZ6 A;  3M8Q A;  1FDD A;  1S59 A;  2GNK A;  5J2M B;  2KM8 B;  4HDG A;  4I56 A;  2YKM B;  2XO6 A;  3ZZ0 A;  3U1M A;  2ZJQ Q;  1J5O A;  2VB6 A;  8ATC B;  1OQ3 A;  3G6V A;  1P1L A;  1RA6 A;  3VCD A;  4DQP A;  2DTJ A;  1S6U A;  1HI1 A;  2CZ4 A;  3G9C A;  3DI6 A;  2KKH A;  2IM1 A;  2ALZ A;  2XCP A;  4OYI A;  1KHV A;  3IAS 9;  4K2J A;  3EWG A;  1RAB B;  1VR6 A;  2D7S A;  2M7S A;  3I56 S;  5T41 A;  1DTQ A;  4AQY J;  1PYO B;  2ZH5 A;  3M2R B;  2W7A A;  4LRF A;  4DPT A;  2C3U A;  1TMJ A;  2QX0 A;  2K1R A;  3PYF A;  4OHY A;  1CVJ A;  4JV5 J;  2XMT A;  4AL5 A;  4MKV A;  3SQG B;  4I6Y A;  2WAQ D;  3EDR B;  5C7P A;  3MUR P;  4ZVQ B;  3G71 S;  2R2T A;  4ZP7 A;  1RXO B;  2ZIT A;  4CO2 A;  1HD1 A;  1SIW B;  1RZM A;  3FC9 A;  2R2R A;  1XBW A;  2XMM A;  3SBM A;  1Y3K A;  4PG5 A;  4ATN A;  1S76 D;  2HFS A;  3X1L B;  3K8W A;  1BC6 A;  1JMT A;  1WHY A;  2CPE A;  2EKN A;  4LR9 A;  2GVD A;  5KFD A;  2IM2 A;  4I6W A;  4EEY A;  1M1G A;  3FQK A;  5D4P A;  3CCE S;  1UVK A;  2ATL A;  2FJW A;  2MQ8 A;  4FYW B;  2W9B B;  3IG1 B;  3VAG A;  4DV7 F;  3T6J A;  2DGX A;  3R1L A;  3MM5 A;  5C25 B;  3P3D A;  2GIR A;  3RU0 A;  2UUT A;  2ILY A;  4Q2M A;  2EKY A;  3VAI A;  3IR5 B;  2ZOM A;  2CZV C;  1U8S A;  2FVP A;  3RJM B;  3ILO A;  4J9Q A;  1TQL A;  3GPA A;  4CDI A;  5C42 B;  2XB2 D;  1ZZF A;  2L9D A;  2MGZ A;  4Q8F A;  1YGY A;  2I8E A;  2LQJ A;  4N7T A;  4TN2 A;  3LA0 A;  3HHD A;  4O4G A;  3AOB A;  4A46 A;  4A8O A;  5ETV A;  4CNZ A;  3NCP A;  3BSN A;  2NRE A;  2BJ7 A;  1T03 A;  4MKY A;  2ZD1 A;  3U1L A;  1F2H A;  1X5P A;  5IWA F;  1S6P B;  4E0D A;  4M95 A;  3ZZY A;  4IR1 A;  4WTY A;  2OH2 A;  5KFS A;  4RW8 A;  3H98 A;  5A0Y A;  2KXH A;  1B70 B;  1CJU B;  1UFL A;  3A8K A;  3ILL A;  3W2V B;  2CQ1 A;  2FY1 A;  1OMS A;  4B3M F;  2C3Y A;  1GEH A;  3F41 A;  4ZCK A;  2MKH A;  4CO1 A;  2D1C A;  4ZS6 A;  2VQE F;  5KFX A;  2RE1 A;  2F4V J;  3HJF A;  1HNZ F;  3PXG a;  4LRB A;  3QT8 A;  3H59 A;  4OJH A;  1MML A;  4YHH J;  2YH1 A;  1FF2 A;  2V34 A;  3DM2 B;  2CQI A;  3OSN A;  2BQ3 A;  2KHC A;  2PA8 D;  3MTJ A;  5LSL A;  5KFH A;  4KHR A;  1HNW F;  5F9N A;  5DLF A;  3Q8S B;  4OX7 A;  2HGN A;  3LP2 A;  1ZPW X;  4PAA A;  2AJ2 A;  3KFW X;  4CTA A;  3DGV A;  4B17 A;  4LF7 F;  1IN0 A;  3DHW C;  1N6Q B;  4OYZ A;  4OI0 A;  5H9F K;  3CCL S;  3NOC A;  2WVC A;  3J7Y I;  1FXL A;  3H42 A;  4PG4 A;  3THT A;  4OZJ A;  1UTA A;  4M5M A;  4DFJ A;  3HD2 A;  4MFB A;  5H9E J;  2RIL A;  2VIH A;  4I7F A;  2OSR A;  4ZVG A;  3C46 A;  2ZBP A;  3RRH A;  2UVV A;  2DGO A;  1Q8I A;  4WFA Q;  2R4F A;  4HHJ A;  2HHP A;  1YIJ S;  3ONQ A;  1H2V Z;  4FPR A;  4JV5 F;  2M70 A;  1BQN B;  5E7O B;  3T5J A;  3W9J A;  1REV A;  3PIO Q;  5IT0 A;  1PKU A;  3VAL A;  1KVI A;  3Q8U A;  2I2Y A;  3UPF A;  1XNR F;  1DBD A;  2LVW A;  3PHT A;  2E9T A;  4LF2 A;  4J90 A;  1RWM B;  1CLF A;  1V3Z A;  1Y5N B;  2JLF A;  1FRH A;  1MWY A;  2AX0 A;  2XMA A;  2A0F B;  2PT0 A;  3CMQ A;  2QA4 S;  4KPY A;  5HQM A;  2WON A;  1FNX H;  1Q7L B;  4R8U A;  1U09 A;  2W1B A;  2EBE A;  3HCX A;  2KTQ A;  3W2W A;  1GMW D;  4RLE A;  2JZ5 A;  1FJG J;  2DK2 A;  1XN9 A;  4C8N A;  3CMA S;  2ZH6 A;  5JVH Q;  4EZ9 A;  5I42 B;  1N32 F;  1RT3 B;  2D3Z A;  5L9N A;  1FRI A;  2DYA A;  2F7V A;  3K8V A;  2RUG A;  1MRO A;  3BKU A;  4DS4 A;  2Y1J A;  2HFZ A;  4MTP A;  1HA1 A;  4A8Q A;  1N6Q A;  2HIQ A;  2FJD B;  1YRU A;  3GON A;  2RU3 A;  2XY7 A;  4NZ0 A;  4U67 Q;  2DHH A;  2KJV A;  3A8E A;  2ADB A;  4ELU A;  1IUJ A;  2AHO B;  4WP9 A;  1AZS B;  3CO9 A;  1V9O A;  1R3N A;  3G2X A;  3M30 A;  2ATC B;  3BO4 A;  2LXU A;  3H5U A;  5GAD U;  2Q1L A;  2O01 C;  3WC2 A;  1YLX A;  4DLE A;  5IC4 B;  3CCS S;  4X4T A;  2HKE A;  4R0E A;  4FZV A;  3TX8 A;  4F2R A;  1AW0 A;  1ITP A;  2KG1 A;  3OVS A;  4C11 B;  3EGN A;  2NR0 A;  1RWN B;  3HVT B;  4DQQ A;  1NJW A;  5CAA A;  5J2Q B;  3Q24 A;  1W2B R;  1URR A;  3GYX B;  4MK9 A;  4Y2I A;  1IKV B;  1URN A;  4IRD A;  3GB0 A;  2DJW A;  3QO9 A;  2ACY A;  4Q0B A;  1B7Y B;  3BGR A;  1S77 D;  1S9E A;  3KJN B;  3MED A;  2CPZ A;  2GVZ A;  5F8N A;  2Y1R I;  4TKT A;  1CUL B;  4KGV B;  2XSJ A;  4YB7 A;  5D4L A;  2IDE A;  3OTE A;  2OTJ S;  1TKT A;  3VGV A;  2GA7 A;  5B0D A;  4HYK A;  1RT2 B;  5HL7 Q;  5LSR A;  3TAP A;  2KRR A;  2HS0 A;  2MST A;  4LSL A;  1RT6 B;  1HYS B;  3FSY A;  2BM0 A;  4X4N A;  4NWB A;  1H0H B;  2BKP A;  2HYI B;  2CWK A;  4NLV A;  1LQ9 A;  4JV2 A;  3UVJ A;  4LFA F;  3MTK A;  3KLG A;  3H40 A;  3I82 A;  2W7O A;  2ZHA A;  4K5R A;  4QWE A;  1B0P A;  3O6Q A;  3HXM A;  3DRP A;  1RAD B;  4WTO B;  4H4O B;  3LTO A;  2B7C B;  2C2R A;  3GIL A;  3V81 B;  2W9C A;  4V19 X;  4I64 A;  2IDL A;  2B3T B;  3LAL A;  1UEV A;  3N0V A;  3F73 A;  4DR4 F;  4ECR A;  1TKZ B;  2R8K A;  2Z8Q A;  5KT5 A;  2HMI A;  4B9M A;  4IRK A;  1A0O B;  3SSQ A;  1NKC A;  1VLY A;  4JI7 J;  4ITS A;  1Y9O A;  3KWM A;  4G6V B;  4UY8 T;  3ZO7 A;  4K4V A;  2R7O A;  2QFJ A;  2GGP B;  2FVQ A;  3BDP A;  1U1M A;  2Y3Y A;  3WC0 A;  3OD2 A;  4PRF A;  4UOH A;  5J1E A;  5K8O A;  4ZDN A;  4RNH A;  4YFU A;  2J6S A;  2VKZ G;  1XEZ A;  3T9N A;  1HHQ A;  2DEI A;  3GR0 A;  5KFK A;  3JYT A;  3KUE A;  4C8L A;  1QAJ A;  1RTH A;  4J7C A;  2FHK A;  1JJ2 R;  1C0T B;  3ETM A;  2XY6 A;  2EC0 A;  1F60 B;  4P9S A;  2VJV A;  4A8M P;  4KO0 B;  4YEA A;  1N33 J;  4PWW A;  4HKQ A;  3HVR A;  2KYX A;  2B9X A;  4HAC A;  5F8G A;  1JLB A;  2K2P A;  4FNH A;  2QYC A;  3IBW A;  3US5 A;  2RKI B;  2JEG A;  2WVF A;  4NI2 B;  1VBY A;  1FJE B;  1H98 A;  1PG5 B;  3BR8 A;  4GMK A;  5A2Q U;  1VBX A;  1RYR A;  1K73 T;  2MGZ B;  3GV7 B;  5HLF A;  4WFX A;  1VQ5 S;  4Y34 A;  4U8V A;  4LR8 A;  3TUP A;  5KT6 A;  1VQO S;  3GCW P;  4ZMM A;  2DCL A;  1AFI A;  2VPX B;  4DSE A;  4DR1 F;  2H48 B;  2CNK B;  4O3N A;  5A76 A;  4ED0 A;  2AF6 A;  3D68 A;  3FBE A;  4DU7 A;  3ENW A;  1D0E A;  4AYB D;  4A8Y A;  4DQR A;  3CCR S;  1U0S A;  3OPK A;  4RW8 B;  3ZZZ A;  5L1I A;  3CSK A;  2RIJ A;  3K5P A;  5DGA A;  2CPJ A;  2XWY A;  1UJ4 A;  1G4C A;  1S1U A;  1YRX A;  2XHC A;  3IM9 A;  3CC2 S;  3V6D A;  3BGR B;  2BOP A;  2UXD J;  4ZLJ A;  1FNO A;  3NOG A;  1JLF B;  4NA2 A;  4IUF A;  1S0M A;  4DR6 J;  3TA0 A;  1XTZ A;  4J9S A;  2I38 A;  4FXW A;  5F3Z A;  4RU2 A;  2IC3 A;  5E3Q A;  4C11 A;  3GE9 A;  1VJW A;  1VQK S;  1C0T A;  5DG8 A;  1X4A A;  2WOM A;  5KG2 A;  2DO4 A;  4URS A;  2ZDO A;  1S1T A;  4ZKA A;  4LSZ B;  4KFB B;  2DRB A;  2YX4 A;  3GQC A;  1LNQ A;  2W4C A;  1Y00 A;  4C0B A;  4N47 A;  3CIZ A;  2BV3 A;  2QYG A;  4JBC A;  4KBI A;  4E8U A;  2JEJ A;  2JH3 A;  1R31 A;  2GGP A;  1FJ7 A;  3R5J B;  1BE4 A;  5LXY A;  4DV3 F;  2EI5 A;  1QUV A;  1Y3J A;  5D15 A;  4ED4 A;  2OJ3 A;  3DLG B;  5THW A;  3VVU A;  2OMO A;  3KLI A;  3RYL A;  2CJK A;  1U6F A;  2CQ0 A;  4K4U A;  2AW0 A;  3BR9 A;  1MRO B;  1UWA A;  1MSW D;  4UOG A;  2GCF A;  1T9U A;  3O8W A;  4LR7 A;  2DGV A;  2IVY A;  3OR1 A;  4QIE A;  4YR0 A;  1NK9 A;  1SC3 B;  2W9C B;  4Q5V A;  3CD0 A;  2FC8 A;  3NGU A;  4YQW A;  3DI6 B;  4V19 J;  4B3S F;  5M2R A;  1KTQ A;  2R7Q A;  3VF0 B;  4RUC A;  1SUQ A;  3TAQ A;  1SUQ B;  3EGZ A;  1N5T A;  1TV6 A;  1JXV A;  2VKR A;  2Y0B B;  4RBU A;  2UZA A;  5K5M A;  5KFZ A;  3LO3 A;  1OYD A;  4NLY A;  3FCH A;  2ZBQ A;  3HK2 A;  1WEX A;  2GS8 A;  2Q43 A;  2YQ3 A;  3IXQ A;  4ZPT R;  1U4B A;  2RF2 B;  2M9K A;  1ZM3 A;  3SCL E;  3Q8Q B;  2ZZT A;  1HNV A;  1GH8 A;  3L9Z A;  1ZS6 A;  2AMC B;  4F04 B;  4CO5 A;  2GMH A;  2H5E A;  4J9U E;  4PG6 A;  2IAJ B;  2KZZ A;  1WTF A;  4ETX A;  4LRD A;  1RT2 A;  2E1A A;  2DPJ A;  4JUZ A;  2KHD A;  3P6Y C;  1CEZ A;  2HS4 A;  2VPZ B;  1QM9 A;  2HQI A;  2OPQ B;  4I2P A;  1L3V A;  4IDK B;  4RNO A;  4CLL A;  1SKW A;  4YB1 P;  3I9Z A;  3JXO A;  5D4N A;  2BXJ A;  1VOM A;  2H4Y B;  2YPY A;  1Y5I B;  4EFA C;  2RQC A;  3T1Y J;  2Y9H A;  1EQ0 A;  1OSD A;  2JNJ A;  1IJF B;  2AKW B;  4MMO A;  4K4W A;  4AL6 A;  4DR3 F;  4FS2 A;  2BX6 A;  1R8P A;  1NSK L;  3JQJ A;  3OVA A;  3LWM A;  5IT9 Y;  3PKM A;  1KBR A;  2I9S A;  5FDL A;  2DCU B;  5J1P A;  3LPE A;  1DJ0 A;  2NUH A;  3PHE A;  5D4O A;  4QPT A;  4ZA1 A;  5ETQ A;  3ZTO A;  1Q8B A;  4LF4 J;  1TAU A;  1BUX A;  2B56 A;  2V50 A;  2ZOF A;  2J9D A;  1JK9 B;  4QR1 A;  4UT4 A;  4LF7 J;  2FJE B;  2DNM A;  2BE2 B;  2VDH A;  3T9Z A;  1HFE L;  5KFY A;  3KG0 A;  2CPD A;  2M88 A;  1S0O A;  4DEZ A;  3NAH A;  4ECX A;  3Q22 A;  2ROP A;  4JI1 J;  2F8H A;  3EX7 B;  4ZPD A;  1J27 A;  2H3E B;  3UD4 P;  3MCS A;  4OJG A;  4X62 F;  1UEU A;  1NB2 A;  1DTT B;  2C3M A;  3TWZ A;  4QWA A;  2FJX A;  4UQG A;  4TYB A;  2R7U A;  1ZH5 A;  4FXD A;  3M2U B;  2EFG A;  1N34 J;  1S6P A;  2QGF B;  4ZVR B;  2HVZ A;  1D8Y A;  2ZUG A;  1B7F A;  4DSK A;  4O44 B;  4X64 F;  2UXC J;  1HBO A;  2MKS A;  3ISN D;  1KON A;  1IKW A;  4A4J A;  4N56 A;  2G2O A;  2ZH7 A;  1U0H A;  4IKA A;  1WOO A;  1Y5L B;  4CLU A;  3T6B A;  1NJY A;  1T8E A;  3V6D B;  3CME S;  2PGC A;  1FRK A;  1SQF A;  2ACM A;  2CNN B;  3EVM A;  4GRS A;  1UFW A;  2DNH A;  3DRR B;  4M1K A;  3MR7 A;  3I55 S;  1L3S A;  2DD8 S;  4GVB B;  4DX7 A;  5E5N A;  1WG1 A;  3IM8 A;  1WKJ A;  4ZVP B;  4I6A A;  1NSQ A;  1Q7Y T;  4U7C A;  1T3O A;  3UI3 A;  1SVD A;  1WUU A;  1FJG F;  4PYD A;  2L41 A;  2C2E A;  3W7B A;  3QLH A;  2JC1 A;  2ZVS A;  3C16 A;  1KOH A;  1FX2 A;  4NYP A;  5K14 A;  3W63 A;  4C3M A;  4TQS A;  1DQ8 A;  3B54 A;  5DM7 Q;  2CIM A;  1PJ5 A;  2AJ4 A;  2VPW B;  2UV8 A;  4RW9 A;  4YR2 A;  1XMQ F;  4YUD A;  2L9W A;  1LWE A;  3PYG A;  5J2P A;  2AX1 A;  2GVD B;  2QMW A;  1JLB B;  3NGT A;  4DX8 H;  2DY9 A;  4HT7 A;  6FD1 A;  1NND A;  4DV6 J;  4NLG A;  3PCO B;  3NS6 A;  1C0U A;  1IXK A;  2IMO A;  4URQ U;  3WBZ A;  2ZM6 F;  1AUD A;  2W8K A;  2HGL A;  1NK4 A;  3POT A;  4AXJ A;  5JMN A;  2JHE A;  2HBR B;  4X66 F;  3OR1 B;  5LMN J;  1F6T A;  3UR3 C;  5K8N A;  2CJY B;  1UL3 A;  5FLX Y;  1UZD A;  1R43 A;  3CJ5 A;  2RH3 A;  1GXT A;  4YP3 A;  2CZ9 A;  4UOC A;  1TVR A;  3JQK A;  3TUJ C;  4O4R A;  3J7A 1;  2WB1 D;  2WB4 A;  3QPI A;  1FKA F;  4FPI A;  1QAI A;  2HK3 A;  1DTQ B;  4I69 A;  4WFZ A;  3HX9 A;  4XPC A;  1RAH B;  4C3L A;  3LGM A;  4DUZ J;  3V6K A;  2MLY A;  1RLD A;  5HVF A;  2CG4 A;  4ZVU B;  2MQQ A;  1JLG A;  1HI8 A;  4Q2L A;  2X3D A;  2MZ1 A;  4L3N A;  2UVW A;  2VQF J;  2GVZ B;  1C1C A;  2EXU A;  2POK A;  4J5O A;  4DZ6 A;  1HHS A;  3N4W A;  1AUS L;  2WW8 A;  2RNE A;  2OD6 A;  2RRB A;  3D67 A;  4H4O A;  3QO9 B;  3V4M A;  4ZIV A;  4NXM F;  4OYA A;  4YDD B;  4FYY B;  2FPH X;  2NXJ A;  2FYX A;  2A6M A;  4NXN F;  1N36 J;  4M8L A;  2W9A A;  4UY8 5;  5GAE U;  2QA4 G;  4OI2 A;  4OV6 A;  3I32 A;  5T7L A;  3KLH B;  2ZH9 A;  5LJ3 Y;  3LP1 B;  4CO4 A;  5CCL A;  3RBD A;  1RAE B;  3KHR A;  4L73 A;  3OTD A;  2CUY A;  1SKR A;  1GK8 A;  2XQC A;  1SKS A;  1OS5 A;  4DWI A;  3C19 A;  3AD8 C;  4B3O B;  1VHF A;  4LFB J;  2K3I A;  4X4O A;  2QA1 A;  3GYG A;  3HKZ D;  5AE2 A;  5IV4 A;  4X62 J;  4ECU A;  1CPZ A;  3OFH A;  3R27 A;  4OZ2 A;  5DG9 A;  1RA7 A;  1D1U A;  4NCB A;  1QD1 A;  2OEJ A;  5KG7 A;  4IFV B;  9RUB A;  2ZH3 A;  4EI2 A;  4FF2 A;  1XNQ J;  4Y0F A;  2VC0 A;  1FKP A;  3D54 A;  2KO1 A;  1EAR A;  4K2X A;  4C98 A;  5HVH A;  1A7G E;  2VA2 A;  3M1V A;  3MEG B;  1YJU A;  3Q83 A;  1SH2 A;  4KV8 B;  1FXR A;  1U1L A;  4FBU A;  3PEJ A;  1VFJ A;  1PJ7 A;  3CCZ A;  2RHS B;  2CQG A;  1L5U A;  2XUL A;  2RVJ A;  1KSP A;  3Q8R B;  2JJ4 D;  3OXG A;  4RWX A;  4ZOS A;  2R8G A;  1HNX F;  1QVF R;  3LAN A;  3PG9 A;  2P8I A;  2GFF A;  2HIY A;  2PEB A;  3AD7 C;  1KVJ A;  3HHE A;  2VIC A;  3O1L A;  4LIW A;  4NA1 A;  4ZVH A;  3WZ0 A;  3SQO P;  2U1A A;  3G6X A;  3UD3 P;  5LL6 d;  4DS5 A;  2AYM A;  2C1E B;  2LMI A;  3R3T A;  5EN1 A;  1LW0 B;  2OI2 A;  2QLF B;  3G8Q A;  2BR0 A;  1RBO B;  3BKT A;  5ETP A;  3UD5 A;  1FK9 A;  3J80 U;  1FK9 B;  1U7L A;  2M5Y A;  2WSC C;  2HS3 A;  4ES2 A;  3KYL A;  2HHH F;  2BAN B;  3MM8 A;  3K0J A;  2BJE A;  3D6F B;  3PR5 B;  2ZZM A;  2WCX A;  1IBC B;  2CVE A;  4HH0 A;  2X7I A;  4PEO A;  1R0A B;  1R8H A;  2I5J A;  5K8M A;  4HT5 A;  2D41 A;  2RF2 A;  1UVM A;  3GR1 A;  2W2N P;  5GAH I;  3J7Y U;  3W5X A;  4X66 J;  3CUN A;  5LMN F;  1S57 A;  2H54 B;  5L8R C;  4DR4 J;  3AY0 A;  1K8A T;  4JI0 J;  4G3I A;  2I0X A;  1TKX A;  3VQT A;  1TKX B;  3NWR A;  4CLS A;  1Q86 T;  3HHK A;  3R7N B;  1CJV A;  3VZH A;  3O3L A;  3PRD A;  1S1X A;  2JLE A;  2CFX A;  2DXF A;  2OHD A;  1SBR A;  2F3J A;  3T5H A;  2IA0 A;  5BXI A;  4DN0 A;  4M5H A;  4KE5 A;  5KFL A;  1K44 A;  4BDP A;  4RPF A;  1S5Z A;  3ZTP A;  2BJ3 A;  3DKD A;  1WC1 A;  1YBU A;  5KFB A;  3DCA A;  1FVQ A;  1S0V A;  7AT1 B;  2A6O A;  3DLG A;  4A8F A;  1CBK A;  3B78 A;  3GG1 A;  5HMZ A;  2HBQ B;  4ILL A;  5KFV A;  3FCW A;  2PD1 A;  2N7Y A;  5JUM A;  2BEF A;  3FEZ A;  4NLW A;  1NSP A;  2GJF A;  4MYU A;  2QT7 A;  3D9B A;  3MPW A;  3M9O B;  3OL8 A;  4KFB A;  2UUC J;  4DX5 A;  3QIP B;  5F8L A;  1VIS A;  1W26 A;  5DQH A;  4JI8 F;  3WQP A;  1KR4 A;  1WWH A;  2XTJ P;  3EZ5 A;  2W8L A;  2MKC A;  2J0S D;  2EFO A;  1FT8 A;  4PPD A;  3MR2 A;  1SC1 B;  4Y28 C;  2GHP A;  2DNQ A;  3MEE B;  3A3N B;  4ZPC A;  5IFM A;  5LMU F;  1U1N A;  4LQ3 A;  2DRA A;  3P49 B;  2E7V A;  3CD6 S;  3KK3 A;  4DR5 F;  3H2U B;  3NGR A;  2HGM A;  4LFA J;  4CRJ A;  4RBV A;  4FF4 A;  4ELT A;  2CQB A;  2N4C A;  4PKD B;  3HT0 A;  5C42 A;  2BBE A;  4U9R A;  5CYQ A;  5GMK a;  3SV4 A;  4F3O A;  5F8J A;  1HKA A;  3EM1 A;  4LF5 F;  2DNL A;  4USV A;  2DXE A;  3CD7 A;  2MZT A;  1FRJ A;  2F4F A;  2GAH C;  3MFI A;  1RT1 A;  4QIV A;  4Y2K A;  3MUV P;  4C8Y A;  3W8P A;  2DH7 A;  3Q89 A;  1NDL A;  2G13 A;  2J0W A;  4TLR A;  5IQQ A;  5A8W B;  2QRR A;  3TUI C;  2B9E A;  1RTI B;  1HQ2 A;  2G2Z A;  3R6L B;  5B7W A;  1Q5V A;  4ZIT A;  5B08 A;  4P7T A;  5CYM A;  2IA6 A;  4JOU A;  1TL7 A;  4JI3 F;  3DDI A;  4QWD A;  1NKB A;  2XMJ A;  1MMD A;  1S1V B;  1C1C B;  1U2C A;  2CYY A;  4FVM A;  3RB6 A;  1O5J A;  4RZR A;  1JLG B;  2DRD A;  1F0X A;  3CJS A;  3T3F A;  1X4B A;  2LU2 A;  4ID5 B;  1NPK A;  4LF8 J;  1RLC L;  4HVZ A;  5F0W A;  2E66 A;  4DF8 A;  2LA4 A;  3JAM Y;  4MAK A;  3CDA A;  2XEX A;  4NLU A;  3TQ1 A;  2IMW P;  2UUB J;  3BH6 B;  3TJ8 A;  1BHN A;  1W2I A;  2L3M A;  1VQP S;  2J6T A;  4CLK A;  2ZFH A;  1X5T A;  1PO6 A;  3GZ7 A;  3DN9 A;  4YOE A;  4BC7 A;  4TY9 A;  2XLI A;  3GSI A;  1HBN A;  3OUY B;  1WEZ A;  3OL6 A;  3OHA A;  4XK8 C;  2FZC B;  3JSM A;  1VQ8 S;  4J9P A;  1W25 A;  3R9L A;  1N56 A;  1Z4U A;  2CQH A;  2P9E A;  2XYH B;  1GXL A;  5DO2 A;  1WDT A;  2BAB A;  2ZH2 A;  2HG4 A;  2AJF E;  2FVC A;  1LWE B;  3QBC A;  1FKP B;  1DTT A;  4ZVS B;  3LWL A;  2YTC A;  2PSZ A;  4NL5 A;  1S72 S;  1N34 F;  3LP0 A;  2B6A B;  1VMB A;  2A18 A;  1R6V A;  2PMH A;  2E1C A;  2KT3 A;  3C14 A;  3CGI A;  2XZD B;  4BWJ A;  2N3L A;  1EET A;  2J9C A;  3ITH B;  4DX6 A;  3MFH A;  3HFK A;  2X1A A;  2ZJR Q;  3GFZ A;  1G3O A;  4JI8 J;  8AT1 B;  3ZXW A;  3FMW A;  2EVZ A;  2XSJ B;  3KDN A;  2R2S A;  1LOU A;  1H6K X;  2QG9 B;  1SC4 B;  1RCX B;  2FQQ B;  2PEH A;  2YWF A;  3OTB A;  3TZY A;  3M9M B;  4OI3 A;  2MZJ A;  3R2D J;  1NHU A;  3VAK A;  4DXL A;  3M8Q B;  1U0H B;  2FVR A;  2BQU A;  4XTT A;  1ARO P;  1HAR A;  3D66 A;  1U02 A;  4QJV A;  4Y6I A;  4WXO A;  2EPI A;  2AEJ A;  1VRU A;  2SXL A;  2BAC A;  4OZ5 A;  4HL9 A;  1HNI A;  5KFU A;  4CLW A;  1Y10 A;  2G4B A;  2KH9 A;  3PW2 A;  2CJ9 A;  3P8B B;  4FNI A;  3LAM A;  1GTH A;  3UQS A;  3MR6 A;  1FI4 A;  3IWL A;  4M5J A;  2IJR A;  1VC5 A;  3K5M A;  1PIE A;  4KJI A;  2PA3 A;  4W90 B;  1RU2 A;  4DV6 F;  1EAY C;  2E9R X;  5AT1 B;  2LXF A;  3M6V A;  5KFI A;  2PE8 A;  2XYG B;  3E01 A;  1VJQ A;  2YY3 A;  5G0R B;  2AYE A;  1JJH A;  4WU2 A;  5D0H A;  4CLT A;  4I67 A;  3CCT A;  2GQC A;  4NYO A;  2OO4 A;  3T1H F;  3OL7 A;  1CQM A;  2HVE A;  3FEX B;  1S12 A;  3H4D A;  2FHM A;  4O0N A;  2IRX A;  3V2U C;  4HH1 A;  3AA8 A;  3I5A A;  3MHY A;  1RTJ B;  3PIP Q;  1IWG A;  3CJ3 A;  1PYT A;  1T02 A;  2B0G A;  1KQG B;  4CNY A;  5KOW A;  1J5E F;  3QAT A;  2QSF A;  2VH7 A;  1L3K A;  2ZWP A;  3KNG A;  4YR3 A;  3JTN A;  2CQ4 A;  3ZTQ A;  2ASJ A;  1UET A;  5E0O A;  4LF9 F;  1S0N A;  1VLO A;  2I5J B;  1CS4 B;  2W2P P;  1QTM A;  3IMQ J;  2XO7 A;  5DDR C;  2UUB F;  3KXD A;  3N6N A;  4NZ7 A;  3I5C A;  1XMO J;  1UZH A;  2FY8 A;  3CCW A;  3I5B A;  4CI0 B;  2ZOG A;  4DCJ B;  2GHW A;  2RML A;  4X4V A;  2ZH8 A;  1FHT A;  4CM2 A;  3TAM A;  5KG0 A;  4QIW D;  3TA2 A;  4LF5 J;  3JAM U;  1HBU A;  3FQL A;  1J5O B;  2J6U A;  1DZ5 A;  4X4Q A;  5J2N A;  2XM3 A;  2NSC A;  3DMJ A;  4ED3 A;  3GIR A;  2IC3 B;  4ECT A;  2R7V A;  2H65 B;  1TUW A;  2GX8 A;  3BV8 A;  1OY9 A;  1T95 A;  1SQG A;  1RI7 A;  3CJ2 A;  3NBP A;  2FJB B;  4O44 A;  4B3R F;  2JEI A;  2HND B;  2ZDP A;  2MKK A;  2ZJP Q;  3TYT A;  2AT1 B;  5KFR A;  4ICL B;  4PXB A;  5E41 A;  4P75 A;  1T9Y A;  2W2Q P;  2VFV A;  2HVH A;  1UWB B;  1E6V B;  1SXL A;  3D6T B;  3DOM B;  1MW7 A;  4MT1 A;  3MWB A;  4N77 A;  2DBB A;  3H25 A;  2OFH X;  1MU2 A;  2F9D A;  2XHW A;  3TVK A;  4F0H A;  1YJ7 A;  4OYM A;  2QJ3 A;  2ASD A;  5A8R A;  1IKY B;  4DN9 A;  5KT4 A;  4NE9 C;  1KKH A;  3GJR B;  4FDF A;  5DZ7 A;  4XO0 A;  1SL2 A;  3TZX A;  4DV1 F;  4Q8E A;  1RT7 B;  1WHX A;  4NLR A;  5KOX A;  4OI1 A;  4MIB A;  3I6P A;  3VR1 A;  3SYZ A;  4QR0 A;  4B9T A;  2QZ8 A;  4LFC J;  2CXE A;  1JLQ A;  4P74 A;  4J9O A;  4PWD A;  2BOA A;  2ZVI A;  4YB5 A;  2FLO A;  4CT8 A;  1N0U A;  4J9V A;  4LSN A;  3IRX A;  4Y00 A;  3LAK A;  2M8D B;  3OFF A;  4F02 A;  1R8C A;  3IRW P;  4W92 B;  2R7S A;  2KFZ A;  4KGX B;  3BQ0 A;  1UVN A;  4LRA A;  1IKX A;  2OPS A;  3IP0 A;  2LQ8 A;  5HAT A;  5U47 A;  1RUS A;  2IIH A;  4PG7 A;  3H4B A;  5E3R A;  3QRR A;  3P5T L;  2GJ2 A;  1TVR B;  3IS9 A;  3PX0 A;  2MJU A;  4IH7 A;  2VAS A;  2CQP A;  3I4H X;  3MOJ B;  2ZE2 A;  3JSB A;  1TK5 A;  4WYW A;  4F4Y A;  3OXF A;  3KLE B;  1VK3 A;  1WKK A;  3R97 A;  3RB4 A;  4BWM A;  3UN5 A;  1U1K A;  5F8H A;  3KJV A;  1P9Y A;  2OPP A;  4ZPW R;  2EFV A;  3I0S B;  3NBP B;  1QTN B;  5KFQ A;  3MR3 A;  1D9A A;  5IZH A;  2UUA J;  1UMJ A;  2MKY A;  3IGV A;  1S6Q A;  1FCA A;  3AJ1 A;  2ZHO A;  2ALY B;  4NCG B;  4DV7 J;  4F4X A;  4FYD A;  5KFA A;  1FVS A;  1GXU A;  2CDQ A;  4X2B A;  1KHW A;  1SJQ A;  3UNY A;  1WC6 A;  4TLQ A;  2W25 A;  5KFO A;  4P2F A;  4CH1 A;  2YWK A;  3EE3 A;  4ECY A;  3P5B P;  1HNZ J;  3DDN A;  3IBF B;  4DOZ A;  1R0A A;  3OR2 A;  4CO3 A;  1HYS A;  1YJT A;  4NXM J;  1TUV A;  1VBZ A;  1RKI A;  2JVO A;  3MPY A;  4ECW A;  3CUL A;  2V9K A;  1YBT A;  2E5G A;  3KUG A;  3DGP B;  4RKU C;  4IFY A;  1TL7 B;  4UQT A;  1QSS A;  4JYA J;  1LW0 A;  3OSP A;  2DPI A;  5DM6 Q;  2OFG X;  4NXN J;  2BMB A;  3AT1 B;  3QZ7 A;  4Z37 A;  1TKZ A;  1WC3 A;  1WOP A;  5IT4 A;  5DS7 A;  1GAO A;  5L39 A;  3NGD A;  4LBI A;  1A9N B;  3X3U A;  1RTI A;  2OEL A;  2E1P A;  3TVZ A;  4EYI B;  1FJC A;  3DLE A;  4DSI A;  1CC8 A;  2KRB A;  2JDJ A;  4WFY A;  4ED2 A;  1M5K C;  4PWD B;  3Q8P B;  3D3B J;  1U47 A;  1P1T A;  1HR0 F;  4M5L A;  3C6U A;  1C2P A;  1CJT A;  1MWZ A;  1YKW A;  3MM6 B;  3PDN A;  2J0X A;  3CJT A;  5A8W A;  3CCJ S;  1OWX A;  4D3H A;  4CH0 S;  1F5A A;  1D8Z A;  5ETM A;  4ZN3 A;  3J81 j;  2WTF A;  2FZK B;  1B4S A;  2ROE A;  3L7O A;  2HAF A;  2MKJ A;  5L9X A;  2R8H A;  1O8B A;  1IKY A;  3EJM A;  4I0W A;  4A47 A;  4LSL B;  1REG X;  1F2G A;  2HWT A;  2XMK A;  3J81 Y;  1VQM S;  1FWK A;  4QZV B;  3GU0 A;  5GAE I;  1XMO F;  2DKO B;  3EMT A;  3AOA A;  5HBM B;  4CM0 A;  2P6T A;  4EGL A;  2EK6 A;  3HP6 A;  4A8X A;  1HQE B;  2MLX A;  5AJ3 J;  3Q8V A;  4F4Z A;  3OW2 R;  4ER8 A;  1C1B B;  1UFK A;  2YKO A;  3KUH A;  2DH8 A;  1DRZ A;  3CIM A;  3OT9 A;  4MK8 A;  1UJ5 A;  1FDA A;  5D78 A;  4HAC B;  2AEF A;  3TOQ A;  1N32 J;  1F1B B;  2NPI A;  2V0N A;  4Q45 A;  3MCO A;  3UNG C;  2UUW A;  2ZD1 B;  3OL9 A;  2JL9 A;  4C48 A;  4P10 A;  2QMU B;  4KYZ A;  2CJQ A;  3W2W B;  2KI2 A;  3MM7 A;  5K8P A;  3EZO A;  6FDR A;  1DLO B;  4NOH A;  1RT5 B;  2IJN A;  1H73 A;  1Q16 B;  1X4H A;  3VAH A;  1ZA1 B;  3TR5 A;  2GZO A;  4USU A;  3PEH A;  1VCT A;  3EPG A;  1LFP A;  1SJR A;  4ZPV R;  2DNK A;  1LW2 B;  1Q0N A;  1WF2 A;  5F9L A;  5L1J A;  1OSC A;  1TL5 A;  1WF1 A;  1YDL A;  2RSQ A;  3F44 A;  3IWX A;  3QWU A;  3CDW A;  4AD6 A;  3VAJ A;  2V9W A;  4JV1 A;  1VQY A;  2KFN A;  1N54 B;  1P8G A;  1RU1 A;  2HFU A;  3IR6 B;  3MMA B;  4UUX A;  1CJV B;  1NJZ A;  5AXK A;  2PMW A;  2E5H A;  4AXI A;  3TP2 A;  3L3C A;  2U2F A;  2VBW A;  1K9M T;  4ED8 A;  2F5G A;  2C2K B;  1FD2 A;  5F8M A;  5CA5 A;  2AP6 A;  3PW7 A;  4KH1 B;  3AQP A;  4M5I A;  3WX8 A;  1JLE B;  4OZ1 A;  2BJ8 A;  4RW4 B;  4Z2X A;  5KFN A;  2YVS A;  3BSC A;  1M5V C;  4QCL A;  2CAJ A;  1MMN A;  2E29 A;  2O67 A;  3OLB A;  3FZB A;  3DRY A;  3BBF A;  2UV8 G;  5EWF A;  1NHK L;  4P2M A;  2R9L A;  3UCU P;  3KMS A;  1RT6 A;  2DNY A;  1BQN A;  2G0I A;  3KMQ A;  4JI4 F;  2N7C A;  4DR2 F;  1RAG B;  1RT5 A;  3QJL A;  1X9M A;  5IOL A;  2AYG A;  4CH7 A;  1AB8 A;  3GJQ B;  5EWG A;  2G2Y A;  2YPZ A;  1ZAW A;  5KFM A;  3CCV S;  3K58 A;  4WE1 A;  2OD4 A;  3RZA A;  4ENO A;  1YQH A;  4USK A;  2XBP A;  4LSN B;  4O3Q A;  1HNI B;  4KT0 C;  1UVL A;  1R6Y A;  1YHQ S;  2HZV A;  3FRY A;  3RGI A;  4WZQ A;  2VBZ A;  5K20 B;  5HO4 A;  4S0M A;  4DPY A;  5KT3 A;  2VHG A;  4C6A A;  4QQB A;  4JI6 F;  3ZZT A;  1KN6 A;  4ECZ A;  4KAI A;  4MKB A;  2VD3 A;  1JIH A;  2QLB B;  2HHQ A;  3DLE B;  1H7W A;  4CO0 A;  3ADA C;  1FX4 A;  2NQP A;  5A6P A;  1JB0 C;  1GMV A;  2B5J B;  2YQ1 A;  3G86 A;  4KR0 B;  5ETL A;  3G8T A;  1RT4 B;  2B7B B;  1S10 A;  1R0B G;  3KDO A;  3HM9 A;  5HP1 B;  3HKW A;  5DG7 A;  2YWH A;  4PQU B;  1Z2Z A;  1CJK A;  4I68 A;  3GIK A;  3A8I A;  3KG4 A;  3MM5 B;  5C25 A;  4M63 A;  3LP0 B;  3FBF A;  3W65 A;  4OLO A;  4P52 A;  3WIU A;  4F3Q A;  4F8R A;  2W2O P;  3U02 A;  3CE8 A;  2W9B A;  1KEK A;  3M8P B;  1HWI A;  3KK3 B;  3CCQ S;  1NDC A;  5ETS A;  3ETO A;  3FDS A;  2WW4 A;  4GVL A;  3VAM A;  2XGQ A;  2ZHB A;  2VPY B;  2B4O A;  3WDO A;  3A3O B;  4Z7Y A;  2KG0 A;  2ZH1 A;  3PVX A;  2GHV C;  5FDL B;  2YKQ A;  4PQA A;  3DFE A;  2V8D A;  2M8H A;  5KFG A;  4DUY F;  2O66 A;  3KHG A;  1JLC B;  3WIV A;  3GII A;  4B9L A;  4F50 A;  2C22 A;  3OUY A;  1KVK A;  2YNF B;  4OJ1 A;  1ZPV A;  3BN4 A;  2DNP A;  1GT8 A;  4WPA A;  3KK2 B;  2B8Q A;  1BQX A;  2M0G B;  3OBI A;  4QYZ J;  5J2N B;  1HI0 P;  3AJ2 A;  2JSX A;  3KJF B;  4QPX A;  4DR1 J;  3BYP A;  3RR8 A;  4DQI A;  2E7W A;  1HIY A;  1EKS A;  3IS9 B;  3CTR A;  1KLN A;  1FNM A;  2K3K A;  4DV0 J;  3GIM A;  2AJ1 A;  4ICL A;  3QRP A;  2A10 A;  3NRB A;  2NSB A;  3NMA A;  1SV5 A;  3K2Y A;  3C3L A;  2BW7 A;  3N5F A;  4WYL A;  1HNV B;  2C2M B;  1FWL A;  3QMQ A;  3ENV A;  5D0R A;  3B4M A;  2OEK A;  3I0S A;  2M52 A;  3FFI B;  4H4M B;  3KG1 A;  2RDD A;  1NO8 A;  5AJ3 F;  1UVI A;  3A12 A;  1MN7 A;  2VG5 B;  1GNK A;  4RW7 B;  1KD1 T;  2CKW A;  2F65 A;  2JFK A;  1BY9 A;  2IRU A;  2V8H A;  3C15 B;  3OHB A;  1WNE A;  1WHW A;  3OFE A;  4WK3 A;  2ZC4 A;  3KLG B;  1WAC A;  1NBE B;  3GG0 A;  3SI8 A;  2W24 A;  3L7P A;  3DM2 A;  2DXD A;  5EX3 A;  1RAJ A;  2NXC A;  4OZ0 A;  1RIS A;  3ZC4 A;  2PN6 A;  4WJB A;  4PXD A;  3LPY A;  1IR1 A;  2MDA A;  3W3S A;  4DL6 A;  3HF5 A;  2R7X A;  1AYE A;  3RRK A;  2H9Z A;  5DLG A;  5GAG I;  2D9P A;  1HQU B;  4EO8 A;  3OVB A;  2MB0 B;  5A0Y B;  4RW7 A;  4B3S J;  1N5S A;  4LMZ A;  2PO4 A;  1U1O A;  1JLQ B;  1TTH B;  2VG7 A;  2WOM B;  3GTY X;  3HVA A;  1XR5 A;  3MGJ A;  1JJ4 A;  5CCM A;  2LEC A;  1SC6 A;  5L46 A;  1I6J A;  2A2C A;  2VOP A;  3TNV A;  1NU4 A;  2M2B A;  2APO A;  2HRY A;  2V6A A;  2YNH B;  5BR8 F;  2R2U A;  2UXD F;  4GKK F;  2HNY A;  3LH2 S;  1YJV A;  4ZJO A;  4UW2 A;  4K7Q A;  3UCZ P;  2CWX A;  3MD1 A;  3TA1 A;  2AU0 A;  1FE0 A;  2RDI A;  3PO4 A;  1T05 A;  4I1T A;  3FVY A;  1SKU B;  1WDD A;  5DZ6 A;  1XWL A;  4U95 A;  1WHV A;  4L74 A;  2XC9 A;  3H7H B;  5A8K B;  5A8K A;  5H1S V;  5C2C A;  4LJM A;  2MQN A;  4C2M A;  3PKY A;  1EZZ B;  2BJD A;  2W7P A;  2DIV A;  1H38 A;  4CCH A;  1X0P A;  4DJB A;  1RSC A;  3SZ2 A;  1NK6 A;  2J0Q D;  1AFJ A;  1Q1K A;  1NSA A;  2G9O A;  2V2K A;  4M5G A;  3PRV A;  2NZC A;  3H2V E;  1IM6 A;  1S79 A;  3G8S A;  3TRG A;  4QIG A;  1T94 A;  4AND A;  4C7Q A;  4KHP J;  3EPI A;  4C3K A;  3MM9 A;  1CS4 A;  2A1B A;  1U24 A;  3H90 A;  3PW5 A;  1OJ4 A;  3P96 A;  1KQF B;  2C2D A;  3C6U B;  3O44 A;  2ZEJ A;  2HK2 A;  3GJS B;  2GIF A;  1M1H A;  4IG0 B;  1PIL A;  3JTP A;  2L9N A;  4Q44 A;  3W5Y A;  3W61 A;  5K9F A;  3V6H A;  1VHI A;  4PG8 A;  3E2E A;  1XNQ F;  3VGT A;  5I3P A;  1HBN B;  1HHT P;  4PXE A;  1PAU B;  3C14 B;  5BJR A;  4DV0 F;  1V3R A;  4KH0 B;  2H5I B;  3EDQ B;  1JQG A;  3FMB A;  3QYY A;  1LFW A;  4IOB A;  3CJ0 A;  4Z7C A;  3K57 A;  1YSJ A;  1FFW B;  3L7U A;  3M2R A;  1RWX B;  4IFY B;  1PC4 A;  3M7V A;  4AUK A;  5EHH A;  4J9L A;  3MR5 A;  2CPX A;  4ZVF A;  1D9F A;  3T1A A;  2MZQ A;  1JLE A;  3ILJ A;  4RW4 A;  4CLY A;  4GC7 A;  3SSS A;  1SJF A;  3D3C J;  1PC5 A;  4DCO B;  1RBL A;  2UXC F;  2LDI A;  2CPI A;  3CED A;  1NH8 A;  1UW9 A;  5D0E A;  1RTJ A;  3DC2 A;  4KGK A;  3DDK A;  4L72 B;  4PCQ A;  1RKJ A;  1YVF A;  3FFI A;  4OI6 A;  2B51 A;  4H4K C;  1Q82 T;  3ILI A;  2IM0 A;  1QLN A;  1OPZ A;  2OPP B;  1X8D A;  3ZZP A;  3AB2 B;  3G4S S;  4A8S A;  3OTC A;  1LWF B;  1XQI A;  5DJB A;  3RBX A;  3VAF A;  2IFX A;  3FCV A;  3PRB A;  1RAO A;  4DV4 F;  5HI7 A;  5MAO A;  2C28 A;  4DL4 A;  2C2O B;  5I3U A;  2LEA A;  3HSG A;  3GFX A;  1H72 C;  3BGU A;  2J7W A;  4YB6 A;  4LF4 F;  2QLW A;  2JRS A;  1EJ7 L;  4OX8 A;  5HBM A;  4EWT A;  2H51 B;  1DQ9 A;  2HBY B;  2YQ0 A;  2FVS A;  4I4B A;  1J2V A;  3AQO A;  1NK7 A;  1JX4 A;  3PV8 A;  3BGL A;  4DV5 J;  1FFG B;  2OLW A;  3QSI A;  5KG1 A;  3Q0A A;  3EYZ A;  3PY8 A;  2LQ9 A;  2WBM A;  4PPZ A;  2V8G A;  4LIR A;  4OZL A;  3VGU A;  5BR8 J;  2YNH A;  4ECQ A;  4QU7 A;  1Y0H A;  2B5J A;  3A4T A;  4UF4 A;  2CQ2 A;  5CH7 B;  3THV A;  4DL2 A;  3NMR A;  1B0T A;  3LOU A;  4PYA A;  4ETZ A;  2EFP A;  3DLK A;  1HQE A;  4FXV A;  1GQE A;  1UA0 A;  1IKV A;  1YJW S;  2XCA A;  3DOL A;  1VRQ C;  3RAM A;  1RHM B;  1S1W B;  4PWU A;  4ZVE A;  1FA0 A;  1XER A;  1RHK B;  1I1G A;  1SCJ B;  2FIU A;  4CWB A;  2MQP A;  3GFH A;  1PBA A;  5F3T A;  5KFE A;  3MXH P;  2KFY A;  2KZM A;  4ZCI A;  4ZLL A;  3BSA A;  1YBA A;  4WIQ A;  3FJ2 A;  4F26 A;  3KK1 A;  3KK1 B;  2RS2 A;  4RO0 A;  2Z2Y B;  2AJ0 A;  1RT4 A;  4DV2 J;  4K0K J;  3BGF A;  2B9W A;  3FBB A;  2F8M A;  5A6W A;  2VQF F;  3MEC A;  2HSE B;  3RBZ A;  4E2F B;  2BE7 D;  2FTR A;  2ZNZ A;  1VIX A;  2X1G A;  3MEE A;  2UUC F;  2Z58 B;  5C24 B;  3OTO J;  2V4R A;  2GMJ A;  1IQZ A;  2QA2 A;  2DT9 A;  3AHP A;  3I31 A;  3R6G B;  4MJK A;  4M5N A;  2VUG A;  4RUH A;  3ULH A;  3DLL Q;  5HVG A;  4L6V 3;  1S1X B;  4RWW A;  2YNG B;  2V68 A;  4MH8 A;  4HHH A;  3TX0 A;  2DR9 A;  2UU9 J;  1MLA A;  2HQD A;  3KLF B;  2BQR A;  1XMB A;  4J9M A;  5FII A;  2AV5 A;  2K8G A;  3SEO A;  1SV5 B;  4GKK J;  1S49 A;  4BCA A;  1OYE A;  4DU8 A;  5D6G A;  2ZM6 J;  2AGP A;  3ET6 B;  1U1P A;  4E98 A;  3GSD A;  3C66 A;  1X5O A;  4ZIW A;  3BJY A;  2X51 A;  4XPE A;  3ISN C;  2KT5 A;  3BQ2 A;  3BN7 A;  4DUZ F;  1R0C B;  3G87 A;  1U49 A;  1RWU A;  2QO3 A;  2DNO A;  3GLJ A;  4DSJ A;  1NPR A;  3MMA A;  1HBM B;  3M32 B;  4JP8 A;  5E2Q A;  4ANC A;  4OX9 J;  2C42 A;  1UVJ A;  3KK2 A;  4IQM A;  3A8J A;  2MLZ A;  3JB9 k;  4K4Y A;  5B0A A;  3DYA B;  2BE9 B;  2BUN A;  2BW2 A;  1CUL A;  2VF3 A;  3FK4 A;  3WHI A;  1JLA A;  3CDB A;  1Q8K A;  4LRC A;  3HPO A;  4ED6 A;  3HUL A;  2JFD A;  3MPD A;  1ACM B;  2EEY A;  3B82 A;  3NCQ A;  2XMU A;  3I4P A;  4NZ6 A;  4CYU A;  4R5P A;  3DOL B;  4O23 A;  3M6U A;  1LWC B;  1RWV B;  2DHS A;  5C24 A;  5FLX U;  3CD5 A;  4JV0 A;  1D09 B;  3TAN A;  1FES A;  2BAN A;  3MM8 B;  2YNI A;  2KN4 A;  3UVJ B;  2F8E X;  4KKO A;  1XR7 A;  3BPD A;  3CC7 S;  1IVZ A;  1X0F A;  1UJ6 A;  2OPR B;  1N5V A;  2OP5 A;  1Y4Z B;  3HSD A;  3HVW A;  1Y11 A;  3MAQ A;  1XMQ J;  4USW A;  5HAO A;  4AFF A;  1SH0 A;  3BB5 A;  3PJW A;  2YBV A;  4ZJL A;  3R8Y A;  5AXN A;  4IRC A;  1WOR A;  1VS3 A;  3UW1 A;  1YTY A;  1JXE A;  3QID A;  4Q7A A;  4C9D A;  2DGT A;  5KFC A;  1RWK B;  1RP5 A;  2IBK A;  2PII A;  2ZBC A;  1T05 B;  1RWO B;  3S1T A;  2VZ9 A;  3S7R A;  4ALZ A;  4K50 A;  1ZYQ A;  8RUC A;  1JJC B;  4Q0B B;  3G82 B;  3G82 A;  2K7K A;  1UAW A;  3IR7 B;  2HNY B;  3D6H B;  1RBA A;  1DQA A;  3ENA A;  3QIP A;  3PAC A;  4LBP A;  1JLF A;  4WE1 B;  1CJT B;  2BZ2 A;  5KFT A;  2HRT A;  1C4A A;  3CNQ P;  5CD4 H;  3DOK A;  5HJX A;  4X4P A;  1SJ3 P;  1VQS A;  4WP8 A;  3SMZ A;  4K0K F;  1NEE A;  4FP9 A;  2MKI A;  4IYQ A;  1QE1 B;  2HWI A;  2VV5 A;  5M2U A;  1N88 A;  2B4V A;  2OPQ A;  3M8Z A;  1JWW A;  4B3O A;  2DHG A;  1DAX A;  1RAF B;  4A48 A;  1B99 A;  4XDD A;  1KQK A;  3K59 A;  1JNR B;  1TZ0 A;  3DLJ A;  4F4W A;  1RB0 A;  3LP1 A;  4F4A A;  1S48 A;  3B8H A;  2CRL A;  3G6Y A;  4R25 A;  3IG1 A;  3DXS X;  4DV5 F;  3A13 A;  4P2S A;  2DIT A;  3N01 A;  3IFE A;  3MMB B;  4LBH A;  1WSV A;  2F9J A;  2IVM A;  4YS2 A;  4QYZ K;  3AB4 B;  5DRK A;  1SIZ A;  1TU0 B;  1V3S A;  3FSX A;  2GW8 A;  4OYW A;  3JSR A;  5ETK A;  1T9V A;  2FJA B;  3E8O A;  1HMV A;  2V2Q A;  1HQU A;  1S7I A;  3MI7 X;  4ZP9 A;  4ZVT B;  3OV7 A;  3BEG B;  3M8R A;  1K0T A;  3GP9 A;  2HFN A;  4NLT A;  4BBY A;  2JLG A;  3MEG A;  2GJI A;  3QGP A;  4ECV A;  3GJT B;  2HHW A;  1LK5 A;  2HLT A;  2CVI A;  2H4W B;  2K1R B;  4RUB A;  4AE5 A;  5HMY A;  4RUA A;  2XNR A;  3R2C J;  2BDP A;  4WU3 A;  4F36 A;  2RRA A;  3DRS A;  1REV B;  2V67 A;  4WP3 A;  4ZPB A;  3HMJ G;  2MQO A;  3A1Y G;  2NZ4 A;  4L3K A;  5D8H B;  1FEH A;  5GAH U;  3BZQ A;  4QOT A;  1NJX A;  1RCO B;  4TU9 A;  3C15 A;  2RQ4 A;  2Z0G A;  4B9V A;  3D1Q A;  2LLZ A;  1S6Q B;  2ADC A;  1S1V A;  5LOQ A;  3RR7 A;  3B6B A;  2Z57 B;  1F5C A;  1EP4 A;  4PZV A;  3SFU A;  1NB7 A;  5T7L B;  2M3D A;  5CAB A;  3L4B C;  3KLH A;  3ZZR A;  2B4U A;  4OX6 A;  4QR2 A;  3EIC A;  5FD1 A;  3W9I A;  1F3F A;  2OGU A;  1RHR B;  3TZW A;  1VQ9 S;  3DHX A;  1TL4 A;  2RS8 A;  3HZG A;  1Q79 A;  3QFH A;  1D3W A;  2E5L F;  2LEB A;  5K14 B;  2Z56 B;  3EVO A;  3R7B B;  3OLA A;  2Q66 A;  5GMD A;  2W4D A;  3E01 B;  4MIW A;  4KHP F;  4WII A;  2B9Y A;  1T3N A;  5H9E K;  2IYG A;  4DPO A;  1S4E A;  2IJF A;  2DNZ A;  3IAM 9;  4EO6 A;  1NZ8 A;  2Y1L B;  3U27 A;  2VOD A;  4Y2M A;  2JWN A;  4Y3C A;  3VWS A;  4M5D B;  1XR6 A;  3RRG A;  1TP7 A;  3HSZ A;  2YKP A;  4USH A;  2D3O 1;  2B6A A;  3CCU S;  2FDN A;  1HW8 A;  1IBK F;  2AQ4 A;  3TEH B;  3C6T A;  1P27 B;  1U2R A;  1UCN A;  3CJR A;  1M5P C;  1O0P A;  4RNN A;  4O4G B;  2DH9 A;  3DLK B;  2YKN B;  5BYQ A;  2RU9 A;  4DFM A;  2RAQ A;  5D3G A;  1EHW A;  1FE4 A;  1FWP A;  1KWM A;  1U25 A;  2YH0 A;  1SL0 A;  3DNC A;  2IM3 A;  1VDH A;  2QMX A;  4DFP A;  2C3P A;  2MPU A;  4KO0 A;  2XZW A;  1XNR J;  1EET B;  3ISZ A;  4DR7 F;  5E3A A;  3ZTR A;  1EP4 B;  1T11 A;  2EBG A;  4YHH F;  1ZAX A;  3JYT B;  3EGW B;  3TI0 A;  1Q95 G;  3HHL D;  1ZA2 B;  3M05 A;  3DRS B;  1P6T A;  2YWW A;  1HNW J;  3OR2 B;  3M30 B;  4EBC A;  5L1L A;  5LMU J;  3QAE A;  1GTE A;  3CVK A;  3QLH B;  1UW4 A;  4NEZ A;  3TJA A;  3UDV A;  3HHN B;  4LF8 F;  4MYT A;  4D3G A;  2VJU A;  1LWF A;  3LUY A;  2V2Z A;  2XY5 A;  2BYC A;  5B0G A;  3QAU A;  1HWU A;  2Q6B A;  1ICE B;  1NJI T;  3D4J A;  2QN6 B;  3UN3 A;  5ADZ A;  2ZNY A;  3CW2 C;  3UDE A;  1YI2 S;  4J9N A;  2CG8 A;  5ITH A;  3OJS A;  3I87 A;  1JLC A;  4TYA A;  1FFS B;  3DRP B;  5MLC V;  2L48 A;  2W2M P;  5IWA J;  2ZE2 B;  2ZKU A;  4DUT A;  3FSI A;  5KT2 A;  1WI6 A;  2BM1 A;  1NRK A;  1V5I B;  2XMW A;  3ZZO A;  4ED5 A;  4B3T J;  2BKO A;  1RT1 B;  3FRZ A;  5KG4 A;  1AA1 B;  1YJR A;  2NXN A;  1H7X A;  1IM4 A;  2KVI A;  1TL3 B;  2QLJ B;  4B3M J;  1SQE A;  5KT7 A;  5I3Q A;  1ZM4 A;  5L38 A;  3K5O A;  4DL3 A;  4DL5 A;  2F4V F;  3DRR A;  4WK1 A;  3BO3 A;  3W8G A;  1ZOT A;  4V1A k;  2IPO B;  3IBC B;  3PO5 A;  4IOA Q;  2D9O A;  2LQ5 A;  4OJ3 A;  5RUB A;  1Q81 T;  1JKH B;  1QE1 A;  4LUB A;  1FDB A;  5HMW A;  4H4K A;  1WSR A;  2DIS A;  3NLC A;  3P4U B;  2GO8 A;  4G1P A;  4DV2 F;  1ZAV A;  3SCK E;  2EG2 A;  5DDP C;  1MNE A;  2ZH4 A;  5J2M A;  4QW9 A;  4EMD A;  2LFV A;  1I3O B;  3BYR A;  4G1I A;  3K7R A;  4ZCM A;  4IQX A;  1Y7P A;  2MZS A;  2V8P A;  2J9D E;  4LF6 F;  3NNA A;  4CTA B;  1KP6 A;  3KLI B;  2NS1 B;  1HW9 A;  3L95 X;  1M5O C;  5CYQ B;  3L09 A;  1G1X A;  4RBT A;  3H20 A;  4RX6 A;  2D3U A;  4YY3 F;  4OQJ A;  2RQK A;  2HNZ A;  2RUS A;  4RR5 A;  1OO0 B;  2CPY A;  4QIF A;  1HR0 J;  3DOM A;  2JOQ A;  1UPP A;  3GCX P;  3ITH A;  1IBM F;  4LVN P;  2W01 A;  1PSD A;  5HSP A;  2NPF A;  1U45 A;  1S99 A;  2YNI B;  1BGX T;  3TUZ C;  3RB0 A;  1CJU A;  3HZE A;  3QT5 A;  2XS7 A;  4KPC A;  2ZZN A;  4B3R J;  2J7U A;  4PXC A;  3PW0 A;  4URG A;  5EX0 A;  1NUE A;  2BVZ A;  1FTC A;  3MUT P;  4ZJQ A;  5B0F A;  3FUY A;  4CP5 A;  1UA1 A;  1AT1 B;  2YKA A;  2MQL A;  1NK0 A;  4OHV A;  3I96 A;  2KDO A;  2HZA A;  2XSF A;  1IR0 A;  2E44 A;  3C8Y A;  3H8Y A;  4P6Q A;  4CYU B;  3QT7 A;  3CXC R;  2CJX B;  1J5E J;  2Y8W A;  3AOD A;  1I94 F;  4KSE B;  1MWQ A;  2XLJ A;  2I1R A;  1HBM A;  3M32 A;  3MAA B;  1B3T A;  3PTW A;  2DVI A;  4O3S A;  4U8Y A;  3BBC A;  1YZ6 A;  2RQM A;  1TKD A;  4ERD A;  9ATC B;  4DV1 J;  5CHC B;  3UDC A;  3N6L A;  4NI2 A;  4DMZ A;  1X60 A;  2RRN A;  2V4J A;  3RUB L;  3W5Z A;  4CT9 A;  3TO8 A;  3KLV A;  3NP5 A;  2LA6 A;  5A2Q Y;  3QRQ A;  2ABY A;  2HQ3 A;  5AE1 A;  4ID5 A;  4LFC F;  3ZZU A;  3KLF A;  3K5L A;  2R7W A;  2MTL A;  3BS9 A;  3D7S B;  2LQB A;  2YNG A;  3ET6 A;  4FYV B;  3JSM B;  1U6Z A;  2HEK A;  2V94 A;  3U1N A;  3MMB A;  3M4X A;  3MM7 B;  1APS A;  3T1H J;  1X7V A;  4GO5 X;  1BQM B;  3V81 A;  4OMF G;  2J8A A;  1KLM B;  4W98 A;  4F25 A;  5M2P A;  4NEY A;  2Z2M A;  2QEX S;  4R0J A;  4OIX A;  2OML A;  2QTW A;  2ZBI A;  4OYX A;  4ZPA A;  3KHL A;  3QSY B;  4M94 A;  3CT9 A;  2MEW A;  1TK8 A;  4NAS A;  1LW2 A;  1T9W A;  3HFV A;  2YXL A;  1CQN A;  4X4U A;  5G0R A;  2R8J A;  1PJ6 A;  3GMG A;  1QSY A;  1YRT A;  1X31 C;  2IBO A;  2B4P A;  3UO0 A;  1G6B A;  2PC6 A;  3MEC B;  4KY3 A;  4DDF A;  3PFE A;  1IKX B;  2OPS B;  4WZM A;  3RW7 A;  3N28 A;  4K4T A;  4C8Z A;  4ZHR B;  2D3O R;  5JJB A;  2AJQ A;  5LT5 A;  1VRU B;  4GVB A;  1DUR A;  3IO1 A;  3MED B;  1NPP A;  1Z2L A;  2RKI A;  3W1Y C;  2OSQ A;  2BJ1 A;  2Y8Y A;  1ROF A;  4JI4 J;  1TEL A;  3BF4 A;  1ZM9 A;  2ZC3 A;  3R5D A;  4KRW A;  2AYB A;  1SI9 A;  2VG6 B;  2Z2Z A;  3Q2S C;  3EXC X;  3Q86 A;  4OI4 A;  4YY3 J;  4U7U D;  2BA9 A;  2MY7 A;  4ES1 A;  2LEP A;  1FD8 A;  2Z30 B;  5JVG Q;  1TFY A;  5DGB A;  3HO1 A;  3ICL A;  3C6T B;  3BPS P;  1G2E A;  2DGW A;  2OKQ A;  2QLX A;  3SIP B;  4K4X A;  1N4L A;  1MG7 A;  3OTO F;  1RT7 A;  3HDS A;  1FXD A;  2CAD A;  3OFG A;  4AL7 A;  1X4C A;  1HLW A;  4Y65 A;  3G6E S;  4TY8 A;  4EBD A;  4TY8 B;  3UDL A;  2BJ9 A;  3PYD A;  3CC4 S;  4RL1 A;  1RAI B;  4B3T F;  3K5N A;  2GO9 A;  2HRU A;  2CJB A;  1GMW A;  4JI2 J;  4C4W A;  4JI6 J;  2B43 A;  2RB7 A;  2Y1I A;  4PAB A;  2ILZ A;  2UU9 F;  3MM6 A;  4ZP8 A;  1YIT S;  1BWV A;  3GIJ A;  5HRO B;  2XGP A;  2HWH A;  3QFW A;  3RBE A;  5C2G A;  3LGH A;  1E6V A;  3MPV A;  3HJV A;  2Y0S D;  2HAI A;  2YWE A;  3NXZ A;  4OZ3 A;  4QWB A;  3SFG A;  2C2Z B;  4M5K A;  1LXN A;  3DXB A;  3HVT A;  2DHA A;  1U2F A;  5DDQ C;  4P73 A;  1RTZ A;  3J7Z 5;  1RT3 A;  2E9Z A;  2HND A;  1I94 J;  1T7P A;  1EIY B;  1JNZ B;  1BD6 A;  2GML A;  2GQQ A;  2LDY A;  2V2V A;  4C0H A;  3M9N B;  2DGU A;  2J5A A;  2UUA F;  3DGP A;  2MQM A;  1OPI A;  1SB6 A;  4R8U B;  1FKO A;  1TL1 B;  1VIO A;  4FKX A;  4F67 A;  5HQ8 A;  1BLU A;  1PCA A;  3KLE A;  3KTQ A;  3QNW B;  4KIA A;  3ELH A;  1N52 B;  5AXM A;  5HJY A;  3UE2 A;  2RD5 C;  3M6W A;  4XAK A;  3T1Y F;  3NNC A;  3NEK A;  1ULR A;  1RJJ A;  3DRX A;  4ID8 A;  2G0J A;  3C16 B;  2EK1 A;  4DPU A;  1SL1 A;  4N41 A;  3T41 A;  1X4F A;  2BRL A;  2VU5 A;  4UTG A;  1NZA A;  3POT B;  1RHJ B;  3TW0 A;  3J81 U;  1FRM A;  2P6S A;  2V5H G;  1GMU A;  4RJV A;  3D2W A;  1KLM A;  4IG0 A;  4BLG A;  2AD9 A;  4EU0 A;  3S01 A;  4FS1 A;  4QBU A;  2V69 A;  1K1Q A;  4NRU A;  3RB3 A;  1N8R T;  1KNZ A;  3PM9 A;  2GQ2 A;  4J9K A;  4MFB B;  4N76 A;  4WKR A;  2AGQ A;  1VC6 A;  1P9Q C;  4USJ C;  3J7Z T;  4F2S A;  2WHO A;  1WEL A;  4BS2 A;  2UXB J;  3BBB A;  2KVQ E;  1X4G A;  3H5Y A;  3BDE A;  2CNO B;  1EKR A;  1S7H A;  3M2U A;  5EDW A;  1VC0 A;  5EUH A;  1TFW A;  5C5J A;  4B08 A;  4U6P A;  4P7V A;  5DDO C;  1M1K T;  2VBX A;  4PQU A;  3MDF A;  4RNM A;  4TVA B;  4HI1 A;  2ERR A;  1H3D A;  1X4D A;  1R8A A;  2VFU A;  3N9U C;  4P72 A;  3VTI A;  1RHQ B;  3MAA A;  3NAI A;  5T14 A;  3M8S A;  4OYO A;  1K47 A;  2EFN A;  1S9E B;  1KRP A;  4DR7 J;  3HT3 A;  1N5Y B;  4FYX B;  3Q23 A;  4QW8 A;  2BE2 A;  1MU2 B;  2Z4P A;  3FGV A;  4HLB A;  3DOK B;  2DHX A;  4DPX A;  1QJH A;  2LXI A;  4L76 A;  1FEE A;  3H2L A;  2J7K A;  4Y2C A;  1IQT A;  1U1R A;  3GV5 B;  2WVD A;  5IC6 B;  4JYA F;  3CDE A;  1K1S A;  3LP2 B;  3MM9 B;  5LM7 E;  3LW5 C;  2P9C A;  2E7X A;  3Q8Y A;  4HTJ A;  4B02 A;  1NK8 A;  3VV2 B;  4NMX A;  1EQM A;  4F4K A;  3NGS A;  2QC3 A;  3NNH A;  1KTV A;  2DEJ A;  2M4M A;  4HR2 A;  4J37 A;  1XC9 A;  2IY5 B;  4ILR A;  3DMJ B;  2P2C B;  3FNN A;  2AZ1 A;  1RYS A;  1KDN A;  4NML A;  6AT1 B;  2VG7 B;  3QWP A;  4JB8 B;  2WVE A;  4F3M A;  1M0S A;  3M6X A;  4DZD A;  1EB0 A;  2J76 E;  4I2P B;  4M5D A;  5KTQ A;  4X65 J;  3PW4 A;  5IM0 A;  4IO9 Q;  3R1H A;  1UEK A;  3PJX A;  4B9U A;  5E33 A;  3RAQ A;  2IAJ A;  3AD9 C;  2QL5 B;  2MSS A;  1X4E A;  1B0V A;  3SXL A;  3SCJ E;  5E3P A;  1VQL S;  2VDI A;  3VHQ A;  3MMJ A;  4F0K A;  4EBE A;  2G0C A;  3QJP A;  4IO1 A;  2Z2L A;  4WKY A;  1RWP B;  2R7T A;  4YDX A;  1LWC A;  2HVD A;  2KL8 A;  4K4S A;  3LF0 A;  2VOO A;  3IA0 A;  5BYR A;  1Q53 A;  5EGY A;  2WON B;  3VVT A;  2PFF B;  2QL9 B;  4NCA A;  2UXB F;  1S4F A;  2DNN A;  2JX2 A;  1JLA B;  1SJ1 A;  2VG5 A;  3DU6 A;  4F7V A;  4OHW A;  2JC0 A;  3IN5 A;  5IT9 U;  4DCP B;  4ZN1 A;  7FDR A;  3PZP A;  2PFD A;  4H4M A;  4CIO A;  4GKJ F;  3BO2 A;  3PYE A;  4J9R A;  4DL0 C;  4ZLN A;  1N33 F;  2HHX A;  2UP1 A;  3CJK B;  3UN2 A;  3HHL A;  3TEG A;  3HSJ A;  4IR9 A;  3NCR A;  2AGO A;  4DHV A;  3BH7 B;  2FLL A;  3KOA A;  1FKO B;  1FO1 A;  1TL1 A;  1H2T Z;  3MCM A;  4ZLP A;  2P9G A;  2K06 A;  5CZV A;  4LF6 J;  1FER A;  1YZ7 A;  2HLU A;  3BGO P;  4AT1 B;  2NLW A;  4FF3 A;  4CLF A;  4OHX A;  4DR2 J;  1WTB A;  4UST A;  4AQY F;  1VQ7 S;  2E5L J;  4FF1 A;  5DET A;  1KQS R;  1M5S A;  3AA9 A;  3DU5 A;  4EUV A;  3FBC A;  1T9T A;  3NG8 A;  2YKM A;  1YX2 A;  1XK8 A;  4HEA 9;  3U7J A;  1T9X A;  5B0C A;  2VA3 A;  1FDN A;  5ETN A;  5J2P B;  4X64 J;  1IBM J;  2DR8 A;  2VON A;  1S9G B;  4TU7 A;  4OYP A;  1IKW B;  2UVR A;  2E5J A;  3UWT A;  3GV8 B;  2FJV A;  3IGN A;  1F9F A;  4DF4 A;  3N5B A;  5D0G A;  1S1U B;  1U1Q A;  3IWN C;  3D6M B;  4OL8 A;  1ZET A;  1XJW B;  2QL7 B;  5DQG A;  5GAD I;  1NXI A;  2HVI A;  1FRX A;  5HQL A;  3NY0 A;  2K7J A;  2KYZ A;  5KFP A;  4DSF A;  4YME A;  2HQG A;  1QAY A;  2DGQ A;  4FN5 A;  2HHS A;  3VZI A;  1WJ9 A;  5HMX A;  3KKF A;  4KHM A;  4ANE A;  4DQS A;  1TUG B;  3FZ2 A;  1KFD A;  1NM2 A;  2JVR A;  2V4Q A;  3GYN A;  1F9E B;  2AEM A;  3QGI A;  5CYM B;  4C0O C;  5HAN A;  4NLD A;  4IH6 A;  1S1W A;  3CB4 A;  3MMC A;  3UR0 A;  4PUO B;  4N5S A;  3AH6 A;  3HFZ B;  1ZM2 A;  3SDE A;  4DV3 J;  1NCL A;  1YJ9 S;  2FD2 A;  1KC8 T;  1PYS B;  2VBY A;  2XG8 A;  4DPW A;  1RDR A;  4G65 A;  3P45 B;  1NLK L;  4L75 A;  5KAK A;  3TAR A;  2ROG A;  2KT2 A;  3KNA A;  1WF0 A;  4LFB F;  4ZHR A;  2ZUA A;  2HFV A;  3NGK A;  4HTI A;  3HD1 A;  4DUY J;  2AWZ A;  3BRE A;  2NCK L;  3MOZ A;  2DNG A;  2O5D A;  3NWG A;  3JTO A;  2DO0 A;  4Y2A A;  3BQ1 A;  2G1H A;  4QWC A;  4KGZ B;  4P71 A;  5FJ4 A;  2E1M C;  2QSW A;  4EK2 A;  3AXK A;  3AXM A;  1T0T V;  2WBR A;  4OFZ A;  2HZC A;  1C4C A;  1DY3 A;  2WK4 A;  5E3C A;  4ZCL A;  3TQE A;  4DG1 B;  1LKZ A;  1TR0 A;  1AZS A;  4NX9 A;  4YN3 B;  2PMZ D;  2HHV A;  3NL0 A;  5CD4 A;  5IS2 A;  4Q43 A;  2B8P A;  2E1R A;  3OJU A;  3RW6 A;  4RW6 A;  2YWG A;  2CDR B;  2OIH A;  4MIA A;  2VQE J;  1TMM A;  5ETT A;  3A3P B;  1BQM A;  1RQ0 A;  4LRE A;  1VYA A;  4U96 A;  2L08 A;  4LF1 A;  3T19 A;  1PBU A;  3PR4 A;  1VRT B;  2ASY A;  3CF5 Q;  4OLP A;  1PGZ A;  4WF9 Q;  2KU7 A;  2MJN A;  3D0I E;  3PX4 A;  2R3V A;  1Z1Z A;  4O3P A;  1WI8 A;  2CJA A;  2LYV A;  4RW9 B;  4ZP6 A;  1ELO A;  2LKZ A;  3SCI E;  1N36 F;  3HHL B;  4UUW A;  1OY8 A;  3S6E A;  1FRL A;  2DNR A;  1HPZ A;  3CO0 P;  3QGH A;  5KG5 A;  4FKY A;  1WC0 A;  3OQ2 A;  1QAX A;  1A6L A;  1H74 A;  1RGV A;  2IYI A;  2YX1 A;  4DR3 J;  3RG6 A;  4GC6 A;  1U8W A;  4B9S A;  4C97 A;  3CJK A;  5J1N A;  3R7S B;  4BC9 A;  2HUR A;  2QV6 A;  3BSO A;  3V4I A;  4TU8 A;  1DAR A;  4DL7 A;  3H5X A;  3IRX B;  3W66 A;  1OQ6 A;  1W7W A;  2YNF A;  4GO7 X;  2O1P A;  3MUM P;  3F56 A;  3QZ8 A;  3N79 A;  1U48 A;  1NKE A;  3UCG A;  4FVC A;  4XIU A;  1TV6 B;  4RNF A;  1WD6 A;  1HBO B;  2RJZ A;  2CQD A;  1OIA A;  2CNL B;  2I6W A;  2HFO A;  2EC2 A;  3GFY A;  5BYS A;  4NYZ A;  4CLZ A;  3PFO A;  4JI1 F;  1K0V A;  3R5C A;  3O5T B;  2IHR 1;  4HDH A;  2DR5 A;  2C2N A;  1Q5Y A;  5D77 A;  1N48 A;  2KM8 C;  5HRO A;  1OY6 A;  1LK7 A;  4I2Q B;  1JXL A;  1RTD B;  1CJK B;  2PDA A;  2IVF B;  1VQ4 S;  1C1B A;  2H5J B;  1BMQ B;  3F0N A;  4WFN Q;  2NUU G;  4CQ1 A;  2E5I A;  3CJ4 A;  5HP1 A;  1WKL A;  3TJ9 A;  2HPU A;  4K59 A;  1NDK A;  4ES3 A;  2FC9 A;  1YK9 A;  4WCE Q;  1KOO A;  2CPF A;  2EFQ A;  2FZG B;  4H54 A;  5LJ5 Y;  2MXY A;  4B9N A;  4IG3 A;  1CC7 A;  2ZWO A;  2DIU A;  3MD3 A;  3N6M A;  2PI4 A;  2MHE A;  5LSO A;  5IQ6 A;  2DGS A;  2GC8 A;  1YJN S;  2XS5 A;  3THP A;  2ZKT A;  1SH3 A;  4UZC A;  5L1K A;  3ZNJ 1;  2VG6 A;  4FBT A;  3KHH A;  2JEF A;  2XS2 A;  4WBF A;  5I42 A;  3I0R B;  3G96 A;  4DBQ A;  1N5Q A;  3ENQ A;  4O0I A;  3BM7 A;  1E6Y A;  1QSL A;  2ZBR A;  1RE1 B;  1T03 B;  2UVU A;  1LXJ A;  1QVG R;  1GFW B;  3FKB A;  4MK7 A;  4KQZ A;  3UFC X;  3ZTS A;  1R27 B;  3CJQ A;  1WG5 A;  1O51 A;  3J80 Y;  2HBZ B;  2CPH A;  5EWE A;  1V6H A;  2V8V A;  3VQS A;  3D1O A;  4QYR A;  3CCM S;  1R8B A;  3PX6 A;  3CWJ A;  3M2V A;  4KC5 A;  3H0P A;  2Q3P A;  3ZNU A;  5HLF B;  2BKN A;  2XI3 A;  4N8O A;  5J1E B;  3NS5 A;  2NXU A;  4DLG A;  2HW3 A;  3EXY A;  4U7U K;  1F3V A;  1QDU B;  1CG2 A;  1H2U X;  1HWJ A;  2NXE A;  2XI2 A;  2FGO A;  1HMV B;  1S9G A;  3D28 A;  2DB1 A;  1WC4 A;  2FUG 9;  5KFW A;  3CPW R;  3PJ9 A;  1O6X A;  4WXW A;  2WRM A;  4HHU A;  4NCG A;  1F5B A; 
#chains in the Genus database with same CATH homology
 2DKO B;  2H4Y B;  1RWW B;  1I51 B;  2H65 B;  3KJF B;  1RWK B;  1RWO B;  5IC6 B;  3D6H B;  2CDR B;  1RHU B;  2C2O B;  2C2M B;  2H51 B;  1ICE B;  2HBY B;  2P2C B;  4JB8 B;  3KJQ B;  2XZT B;  3GJR B;  4ZVO B;  2C1E B;  2XYH B;  2QLF B;  2QL5 B;  2XYP B;  1NME B;  4ZVS B;  4ZVR B;  3D6F B;  2QLJ B;  1RWP B;  1IBC B;  1RHM B;  3R7S B;  1RWM B;  1RHK B;  3SIP B;  2CNN B;  2XZD B;  2QL9 B;  2C2K B;  2H54 B;  2H48 B;  2CNK B;  3IBC B;  4ZVP B;  3NS7 B;  4ZVT B;  3R7N B;  1SC4 B;  2FQQ B;  2CNL B;  4DCP B;  3P4U B;  3GJT B;  1I3O B;  1PYO B;  2H4W B;  3R6G B;  2C2Z B;  2H5J B;  1BMQ B;  3EDR B;  2HBQ B;  4ZVQ B;  1QTN B;  4LSZ B;  3GJQ B;  2XYG B;  5IC4 B;  2HBR B;  3R5J B;  2CJY B;  3QNW B;  1RWN B;  5K20 B;  3IBF B;  1RHR B;  1SC1 B;  2QLB B;  3D6M B;  3R7B B;  2QL7 B;  1SC3 B;  1RHJ B;  1RE1 B;  3KJN B;  1GFW B;  4ZVU B;  3GJS B;  2Y1L B;  2Y0B B;  3RJM B;  2HBZ B;  2CJX B;  1PAU B;  1F9E B;  2H5I B;  3EDQ B;  1RWV B;  1RWX B;  2CNO B;  4DCJ B;  3P45 B;  1QDU B;  3R6L B;  4DCO B;  1RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...