3D6FB

Crystal structure of human caspase-1 with a naturally-occurring arg240->gln substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever).
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3d6fB00
2H4WB 5K20B 2XYGB 2H65B 1SC1B 4DCOB 3GJTB 2CNKB 3IBCB 1RHJB 1QDUB 3R5JB 2C2KB 3GJRB 1RWKB 4ZVSB 2H48B 3KJFB 2HBQB 3GJSB 4ZVRB 1BMQB 4DCJB 3QNWB 3R7NB 2C1EB 2QL5B 2DKOB 2QLFB 1RWVB 2CNOB 1RE1B 1PYOB 1SC4B 2H5IB 3R6GB 2XZTB 3P45B 2CDRB 2QL7B 2HBZB 3KJNB 3RJMB 1SC3B 1GFWB 1RHRB 2Y1LB 3NS7B 3EDQB 1RHKB 1IBCB 2H51B 2QL9B 2XYPB 1NMEB 2H5JB 2C2OB 4ZVQB 3SIPB 2C2ZB 3EDRB 1RWPB 4ZVTB 4ZVOB 2CJXB 4JB8B 2XZDB 1RHQB 1RWMB 2CNLB 4LSZB 2CJYB 1QTNB 1PAUB 3IBFB 1I51B 2QLBB 2CNNB 2QLJB 1RWOB 4ZVPB 3D6MB 2HBYB 5IC6B 2FQQB 1F9EB 3R7BB 3R7SB 3GJQB 4DCPB 2P2CB 1RHUB 1RWNB 2HBRB 3D6HB 2H54B 1RWWB 4ZVUB 5IC4B 3D6FB 1I3OB 2XYHB 2Y0BB 2H4YB 2C2MB 1RHMB 3KJQB 3R6LB 1ICEB 3P4UB 1RWXB
chains in the Genus database with same CATH superfamily
3UI3A 5I3QA 2V63A 5DDQC 4C4WA 3GJTB 4W92B 4CP5A 4UOGA 2GJFA 4MYTA 2VBZA 3FSIA 1RXOB 5KFSA 2LDYA 3R2CJ 3PY8A 1DQAA 1MLAA 1UWBB 4NYPA 5LSLA 4UF4A 1FD2A 3K5NA 4ANDA 5T14A 1XMOJ 3CIMA 3GONA 2KTQA 1V3SA 4H4KA 3PR4A 2HFNA 2IVFB 1HHQA 1LW0A 1PC5A 4RWXA 3TA2A 1HBOA 1HNXJ 2PE8A 2RHSB 3R1HA 2N4CA 1U1NA 2AYBA 1MMLA 2BJ7A 4NA1A 5L1JA 4LF6J 5B08A 1N34J 2E7XA 2MXYA 1ULRA 3PYEA 2V9WA 1HW9A 3FCHA 3FBFA 1XMOF 4DPXA 2FUG9 2KI2A 2BOAA 1O5JA 1FK9A 4XPCA 3T41A 4ED5A 3OJUA 1SJ3P 3W5YA 1SH3A 1HNXF 3ZC4A 3F73A 4LSNA 1YI2S 4C97A 3GIJA 4X4VA 4LF6F 3D3BJ 4C0OC 3DI6B 1WC6A 3RAMA 3BYPA 4NCGA 3H2UB 2RF2B 4QZVB 3ENAA 3SBMA 4IOBA 1M5VC 2IMWP 1F5CA 2HBZB 4URSA 1EETB 2D41A 3AOCA 3IM9A 1WNEA 1RT4B 3VF0B 2IJNA 4H4MB 1JXVA 3M2VA 2POKA 3KLIB 1T03A 2MB0B 4OYIA 4NRUA 4RU2A 5LSRA 1RWMB 1VQYA 4NLVA 4RW9B 1TL1B 2B9EA 3CNQP 2L48A 4P2MA 2IDLA 3AOAA 3P49B 2O3DA 4P2SA 1RWNB 4O0IA 3QT8A 1RTJB 2HPUA 2DR9A 3UW1A 4O3NA 3R6LB 4K4VA 1RT2B 1UFKA 1BHNA 4NLSA 2J6TA 2KJWA 2LLZA 1GT8A 4J37A 3WBZA 2ROPA 2RUGA 2VASA 4B3RJ 1TL7B 4V19J 1X0PA 4GC6A 3VQSA 3JYTA 1YDLA 4RJVA 4ERDA 1VOMA 2YKNA 1XTZA 2KYZA 3M8PA 1C0UA 3T1YJ 3G86A 2LEBA 2YKPA 2Z2MA 2HVIA 1JX4A 2HHVA 1ZYQA 1H38A 1HNIA 3GZ7A 2KH9A 4HYKA 1WHXA 2CQ1A 1R0AA 4DCPB 3IR7B 4B3RF 3ISNC 2MZTA 3N01A 3RBEA 2P6TA 3S1TA 4PABA 5KFCA 4AUKA 4DV5F 3PW2A 4IFYB 2J0SD 3T1YF 5HJYA 4B3TJ 1EZZB 1U2CA 3PHTA 4IG3B 3LP0A 3ILJA 3WX8A 2Q6BA 2QMUB 1C4AA 1J5EJ 2DHAA 3NRBA 4F0KA 3V81B 5F8HA 2BA9A 2JEIA 1F9HA 4QU6A 2P5VA 3CJ2A 5A0YB 2G2ZA 2W9CA 3LA0A 3R5AA 1S1TB 3OVAA 1GMWA 3IO1A 3MOZA 3C6UA 1B99A 4OIXA 2XC9A 4WKRA 3OSNA 2V2ZA 1OPZA 1QVGR 4B3TF 2ZNYA 4I2QB 2WONA 3NBPB 3KG0A 2VJVA 3DOLB 5CYMA 1FNMA 1J5EF 3I4PA 1RHQB 3WIVA 4USIA 2UVUA 4TKTA 3R7BB 4DG1A 3NWRA 1DFDA 5E3PA 3HI9A 5C42A 2LVWA 1UVIA 4WCEQ 1X4DA 4DLEA 4NLGA 3V2UC 2CPXA 1FCAA 4P73A 3NGKA 1GXTA 5CYQB 3A8IA 4FBTA 1O0PA 2MYFA 2XNQA 3OLAA 2LU1A 4Y0FA 1QAJA 2ZHOA 2BQ3A 1WF1A 5IWAJ 1V6HA 4UT4A 4ZJOA 4DV1F 3L7UA 2GMJA 2HGNA 2ZEJA 1VISA 1DTQA 4AL7A 2DGVA 1VBZA 3DFEA 3MPYA 4M5DB 3HVRA 2XG8A 3EPIA 2R8IA 4B9LA 1SKRA 4WFZA 1NEEA 3CXCR 2DNYA 4DI6A 3IA0A 5K8PA 4RUBA 2WSFC 4NCAA 1QTNB 1WC1A 4V1Ak 5KG5A 1FEEA 1TL3A 3PNIA 4ECYA 2ZWOA 5IWAF 1SPBP 3M8ZA 1RCOB 1MROA 4ZK7M 2YWHA 2L9WA 3GWCA 2VIHA 1Q79A 2WVFA 2CZ9A 1FKPA 2WW4A 3KWMA 3O3LA 5D4LA 4B3MJ 2JRSA 2GO8A 4HACB 1K1QA 3T1HJ 5DQHA 1VQ8S 2J6SA 1S1UB 3OL7A 2MLXA 2OAUA 1CPZA 3PO5A 3TAPA 2XSJA 4JI3J 3DU5A 4U8YA 4ELVA 4O3OA 3TVYA 3ZZUA 2CUYA 3CCES 2F8EX 1TTHB 3S8SA 1R0BG 1J5OA 3VGUA 4K4TA 2N82B 3MR7A 3A13A 4OYMA 3BYRA 2L9DA 3CJ4A 2AQ4A 3Q2TC 1RWPB 1NDKA 4B3MF 1LW2B 1XMBA 1BQNB 3D66A 5CCMA 1FRKA 3DLBA 4B9VA 1Y3JA 1RTZA 4LSZB 2VC0A 1ZA2B 3BH7B 3T1HF 4MIBA 5H9FJ 4HI1A 2JJ4D 4X64J 2VPYB 3HHNB 2KVIA 4Y28C 3ENQA 4JI3F 2Y9HA 3DGPB 1KQGB 2WSEC 2HKEA 2NCKL 1M5OC 5B0CA 4DQQA 1PCAA 1RHMB 1LFPA 5HO4A 2IRUA 1F3VA 1VGYA 2PD1A 2CRLA 3LANA 1GTHA 1ZA1B 1R27B 3UVJB 1QDUB 2W7PA 1VQKS 2XMVA 2HURA 3HD1A 4GMKA 2RRNA 2X3DA 3HO1A 3OUYB 4X64F 2ACYA 4B3SJ 3BGFA 5F8MA 1VJQA 1NDPA 2AEMA 5FD1A 4Z2XA 5KOXA 1Z2ZA 4Q0BA 5KOWA 5CABA 4CIOA 2A6MA 2DRAA 1I51B 1KNZA 2EC0A 4OJ1A 3PRBA 4DN9A 5A8KA 4B3SF 1RWWB 2JVOA 5J1EA 2AYGA 2YWFA 4DJBA 3FVYA 2O67A 4JI4J 4PYDA 4WPAA 3NMRA 1Q4RA 4ZLPA 5E5NA 3RAQA 1VC5A 1HFEL 1SH0A 5KT6A 1X5SA 2QFIA 4GO5X 1LXJA 3SSRA 2DXDA 3D3CJ 2ZUAA 2W2QP 2DXEA 4DU8A 2DT9A 3DHWC 4LREA 2OSQA 1P1LA 4MJKA 3MEEA 3GE9A 4Z37A 2F8MA 3MM7B 2ILZA 3PV8A 3RUBL 1U1LA 2Q3PA 2EG2A 3BBFA 3M1VB 1SL0A 1RHKB 5D3GB 3FBBA 3J7Z5 2ZD1B 4U95A 1X5TA 2OPRA 3MMAA 4JI4F 5IQ6A 3JSYA 3D0HE 4M5JA 2VBWA 1S9FA 4DSEA 3QRPA 3FCWA 2GS8A 1BXNA 2HZCA 1JLBA 1FKOB 1N0UA 3QGPA 2H3EB 2GC8A 3DRSA 3WC2A 4JI8J 2KZMA 3QFWA 3G96A 4DV2J 2XWXA 1O8BA 2UUWA 2PEHA 1SVDA 1AA1B 2CQ3A 2IAJB 3PRVA 4F4AA 4IR1A 5G4DA 1ZTWA 1LWCB 2AWZA 1RAFB 2FJAB 2WOMA 5ETOA 1B70B 4Z7YA 3R8YA 3B82A 1KRPA 3DLGB 4X62J 2UXCJ 4JI8F 3BKTA 2GVDB 1HBUA 3TAMB 2AZ3A 3VHQA 3EDQB 4DV2F 4KPCA 1CQNA 5CD4A 3T5JA 3K17A 3CGIA 3V6JA 2OPSA 3SIPB 4P72A 1HBNB 1U25A 3AD9C 5F8IA 3BO2A 2DYAA 3HZEA 4R25A 1IM4A 3A8KA 2FGOA 1WEZA 4ENOA 4G1PA 3DLLQ 4IH7A 1WOSA 2ZZNA 2I2YA 4DR2J 2VQFJ 3JQKA 1YTYA 4X62F 3H5XA 2RNEA 2CA9A 1RT5B 3UD4P 2IRYA 2A3JA 1YHQS 1FRXA 4H4OB 4QCLA 2YNFA 4YR3A 3H5SA 1Q5VA 1C1CB 3HVTA 3O1LA 1L3VA 4LR8A 3TI0A 1FNOA 5DZ6A 4OJGA 5HMXA 2QYGA 3W7BA 3KJFB 2R7TA 1X4GA 2XS2A 2RUSA 3N28A 4OHVA 3EWGA 4OLPA 3EE3A 2VDHA 1SL1A 4B08A 4DV0J 4TU8A 3CCRS 4ICLB 4DR2F 1FJEB 1KKHA 2WVEA 3BGRB 4YDDB 3FSXA 5LT5A 4JI6J 2M4MA 1SIZA 4PXBA 1IJFB 2MHNA 3THPA 3BBBA 2QLBB 1VHFA 4YEAA 1MMNA 1UCNA 3OFEA 5I42A 2R2SA 1IBKJ 4DR5J 3VAJA 2G1HA 3PO4A 2DJWA 4CNYA 4DV0F 4YQWA 4L6V3 4GKKJ 5KFRA 2HFOA 5T7LB 2R8HA 2GA7A 2I38A 2W2OP 5J2PA 3BF4A 5FDLB 3PM9A 3QJJA 3OXFA 4OHWA 2YKAA 3W9IA 1PG5B 4RZRA 1S99A 3OTBA 3BS9A 4GO7X 4CRJA 3M32A 5J2QB 2XMJA 4ED4A 3PJ9A 2V4QA 5D8HB 2ZC4A 3ZFVA 3C19A 2V4RA 5DLFA 5KFIA 4DR5F 4OJHA 4XIUA 1SUQA 4ECQA 3MR3A 4RNNA 3QJLA 3OXGA 2FLPA 2OMOA 2Q43A 2MKIA 1M5KC 4GKKF 4WIIA 3HVWA 2ZH5A 4Q7AA 1B0TA 3DOMA 2E1MC 4LFCJ 1TKXB 2OGUA 4Y6IA 5HMYA 2BKPA 5DJBA 5F8LA 3JXOA 3PW4A 3BO4A 2D74B 2YBVA 3TANA 4WFXA 3TZWA 2N3OA 4UUWA 4PQUB 5C5JA 1ACMB 1FO1A 2VL1A 5KG6A 4WFAQ 1WDDA 4Y2MA 4F50A 5HROA 3DN9A 1NHUA 1KHWA 2U2FA 3U1LA 3KLGB 3GSDA 2HQ3A 1X4BA 3BREA 1K47A 5IT9U 3LAKA 3QBCA 4DL0C 1NJIT 3SV3A 3L7OA 3JTNA 4LFCF 2DEJA 5AXNA 4LBIA 3J80U 1LFWA 3VWSA 1NDCA 2UVRA 4ETXA 2BKOA 4RNFA 4HHUA 1KONA 5F41A 2YX4A 3K5OA 3FEYB 4YDXA 2X3GA 3R6GB 2RRAA 4J9MA 1TK0A 4ECUA 1P8GA 4WBFA 4KFBB 2BOPA 3KLHB 5A8WA 4K4ZA 5HMWA 3KNGA 4I56A 3GYXB 4WTYA 1R8PA 3CD5A 5GMDA 3OPKA 1FDDA 1S48A 4OZ2A 4BWMA 3VAMA 1FVSA 4A4JA 1U7LA 4J90A 4KSEB 4M5GA 1R0CB 3PR5B 1VHIA 1VBKA 3NAHA 3OVSA 1S0NA 1IR1A 2AF6A 4DZDA 5IXUA 4ZCKA 3ZZ0A 4BDPA 4ATNA 2CAJA 3I0RA 4A8XA 1N32J 1OJ4A 1J2VA 3W65A 1UEKA 1N48A 1ELOA 5E0OA 4CYUB 2DNNA 8AT1B 1N56A 1L3KA 3MM5B 2R7WA 2D3OR 1N8RT 1JLAA 1UFWA 4K0KJ 2Q66A 2MKKA 2NZCA 3KLFB 2P9GA 2K7KA 2W7AA 2G13A 4ZOSA 3TO8A 1A7GE 3HHDA 3JSMA 4ED8A 2BJ9A 1FRMA 3GQCA 3OVBA 1L3SA 3CWJA 2IA6A 1S4FA 5GVQA 5I3UB 3GR1A 7AT1B 1H7XA 2B56A 4RW8A 4N8OA 3HFZB 2RQ4A 2ACMA 1HI1A 2AGPA 3VVTA 3K57A 5A8RA 4K0KF 4ECVA 1EAYC 2LQ8A 1NK8A 4ZVGA 2AX0A 3R5BA 1UP1A 1X60A 2JHEA 2BZ2A 4DL3A 1SH2A 2GHWA 1N4LA 3PEJA 4LRAA 4FF1A 2EC2A 3AA8A 4L3KA 3Q8YA 2YKOA 2VG6A 2CG8A 2AYEA 2W2NP 1RYSA 4UQTA 5MAOA 4DR1J 1RBLA 6AT1B 1QSSA 1SJFA 3GFZA 3K89A 1UTAA 4USWA 3I32A 1FJ7A 1EP4B 2DHSA 2IIHA 5IS2A 3E8OA 2J76E 4O3RA 1LK7A 3B54A 4RUCA 3V4MA 4JV2A 1X0FA 4WWSA 4PXEA 3W66A 3ZTPA 4GKJJ 1WTBA 3DC2A 2HG4A 3FCVA 4YB5A 4IH5A 2W1BA 5B0GA 4O3QA 1IBCB 1VIOA 1KFSA 3KJVB 4A48A 2GJ2A 1FERA 3HK2A 2LA6A 5K9FA 3E3XA 2AV5A 4DR1F 2QV6A 4ZVPB 3LUYA 3HP6A 4F4XA 1HL6A 2BRLA 2F63A 3W5ZA 1H74A 1RA7A 1U0HB 3TYTA 3AB4B 1S6QA 4U6PA 2NSCA 3MECA 1YJ7A 3CPWR 3TUPA 4AQYF 4TNOA 4JI5J 2IM0A 2EW9A 1RT3A 3EGVA 2XS5A 3H7HB 3HX9A 4N47A 3OTOJ 4QOTA 2QLXA 4QQBA 4ANEA 4HDHA 3KG4A 5C24A 5HK4A 5KT7A 2R7OA 2YY3A 2KRRA 4I6AA 5H9EK 1N5VA 1PJ6A 2YNGB 4JUZA 3HF5A 4WP8A 2RRBA 3EYZA 4Q45A 4QW8A 2M52A 2V8GA 4USUA 1WDTA 2CQ0A 2XGQA 2OPPA 5EUHA 5ETMA 2JH3A 1LK5A 2FHKA 2CADA 3TVZA 1LEOA 4USJC 1NH8A 4F8RA 2WCXA 3PDNA 2FGCA 1RWOB 3OTOF 4RW6A 2ZVIA 2ZBPA 2ZM6J 2CG4A 3LPYA 2E5IA 3I31A 3NMAA 3ZZOA 1QVFR 2XB2D 1CLFA 2CYYA 4DV4J 1S7IA 3IRXB 2B9XA 4I68A 2BEFA 2MKCA 1Z2LA 2CQ2A 4IDKB 3MMBA 3HD2A 1ICEB 1R6VA 3VZHA 4KV8B 2IC3A 2GMLA 5KG3A 2RD5C 1NZAA 5EX3A 4G65A 3SCKE 3OR2B 3H4BA 1U8SA 2OSRA 1RADB 4M5LA 2ZM6F 4CLUA 4EWTA 2HQCA 5L39A 4RNHA 2DH8A 3J7A1 1M1GA 2CDRB 3MEDB 2R2UA 3NOCA 1UETA 2JZ5A 4I1TA 2MY7A 3SFUA 1VIXA 1E6VB 1Y5IB 2DBBA 1CJKA 1YJNS 5E41A 2IFXA 4PEOA 1U4BA 5BYRA 1VJWA 1BWVA 2IMOA 3SYZA 2B0GA 4DQSA 2OD4A 1ZAWA 2P2CB 1XWLA 4DPTA 5D6GA 4F3MA 1HBMB 4NLXA 4MKVA 4RBUA 1IUJA 4O44B 3MUTP 4DN0A 1HI8A 2G4BA 2HVHA 2CJ9A 2QX0A 5HJXA 3D28A 3UR0A 3OHBA 1VRTB 1N54B 4ZDNA 2GVZB 2DR8A 1X9SA 1XNRJ 1XNQJ 4DMZA 1HQEA 3MI7X 1T3NA 1XERA 1N6QB 1RGVA 2ZJRQ 2FHOB 5A2QU 2VV5A 2IA0A 3CJQA 3MM8B 4KGVB 3W61A 4LF5J 2F5GA 1S10A 2KRBA 2DKOB 3HM9A 2K1RB 3IG1A 4YUDA 4CTAB 4J9QA 2NSBA 3CC7S 1R89A 4CLTA 3VTIA 3KJNB 3RTVA 3C15A 3Q23A 3V6KA 1T7PA 4ILMA 2D69A 4MKYA 1GXUA 1XNRF 1XNQF 4YMEA 2B9WA 2N3LA 2B6AA 5HBMA 1TK5A 1A0OB 4ID8A 4PR6A 4LF5F 2HW3A 4L74A 3CCQS 2F65A 3D6HB 1UA0A 5A6WA 2PSZA 1UL3A 3CCUS 4FKXA 3FQLA 1Y5NB 2HMIA 3UD3P 2HRTA 3B6BA 2RIJA 3PIPQ 5HP1B 1C2PA 2EKNA 4DSLA 2H65B 3TW0A 4QU7A 3IGNA 3C6TA 4F4ZA 3KK3A 2M8HA 4LF8J 1HPZB 2FHMA 2BJ1A 1HNZJ 2CQ4A 1K44A 3D67A 1TV6A 1M1KT 4NYOA 1Z1ZA 2DY9A 4ZN1A 4O4RA 1UZHA 4BHQA 4Y2IA 3TP2A 2HS4A 3MM9B 5IM0B 2DB1A 1AUSL 2E44A 3ZTQA 2UP1A 4R5PA 4PRFA 5B09A 2FLOA 1N5TA 4CCHA 4WJBA 5D0HA 4C8ZA 1FDNA 2FC8A 4KH1B 1JLFB 4MFBB 5AXKA 1CG2A 1Q7LB 4QPTA 3MD3A 1M5SA 1JXEA 3LGHA 3TEHB 4FN5A 5IC6B 1F9EB 4HR2A 1FFGB 2MQNA 1DAXA 3AJ1A 3RBXA 1S9GA 2MSTA 5G0RA 3RRKA 1PSDA 2E1PA 1EX8A 3CIZA 1JJ2R 2I9SA 3W9HA 3I0RB 4JI2J 3NNAA 3ZTOA 4Z7CA 2WB1D 1QUVA 3IBCB 2NREA 5L9XA 3DLKA 1DRZA 1KR4A 1WUUA 4KJIA 5KAKA 4BC9A 4DV6J 2C1EB 4OZ0A 1T94A 1TP7A 4Y2AA 5CQGA 2N4DA 2RDDA 4C8KA 4EK2A 4PQAA 4PAAA 3QO9B 1YJTA 1PIEA 4YB6A 2MZJA 1D3WA 2FVCA 3ET6A 4TY8B 4JP8A 4C8NA 1URNA 4I6YA 1NHKL 2OHDA 4TU7A 3NGDA 1NK6A 1YK9A 2OPQA 4JI2F 2RQCA 2BANA 3Q22A 2B51A 1DLOB 4WXOA 3I0SB 1EIYB 3RW6A 4F25A 2XBPA 3R7SB 2J9DE 3G8SA 4DV6F 2YNHB 1JXLA 1V5IB 4GRSA 4C0HA 3PIOQ 4C8YA 2QLWA 3H4DA 2HK2A 1RZMA 3IAM9 2QN6B 4J9OA 3VAIA 4LQ3A 3J81U 4NLUA 2GGPA 4DSIA 1HNVA 2ZJPQ 4AFFA 2DNOA 1RAOA 1S9EB 5B0EA 1FT8A 1QAXA 3M8QB 3PW7A 4NI2A 2QA4G 3W60A 3IBWA 3P45B 1M90T 4TVAB 5L8RC 4CT8A 4OI3A 3RJMB 1SC3B 2OEMA 2XZWA 1PYSB 2HNZB 3CD6S 2MQOA 3CJKA 1TELA 2KXNB 2JC1A 4K4SA 3BZQA 4FXWA 3H5UA 3PW0A 2XMMA 3C3LA 1VC0A 5JMNA 2C2DA 3SSQA 5CH7B 4MH8A 1U8WA 2K3KA 3PW5A 4O3SA 4CH1A 3JTPA 4C48A 1P9YA 2XGPA 3P5TL 2HHUA 1YGYA 4NE9C 3G9CA 3R5CA 3W2WA 3MM6B 3DKDA 3KLEA 2AU0A 1YSJA 1HARA 3D9BA 2GNKA 2UUBJ 1FX4A 3JAMU 3OLBA 3K5LA 3L3CA 4RW4A 1LWFA 3KDOA 3I5CA 1RUSA 5F8JA 4C3KA 2JFDA 3MMCA 1M1HA 4I7FB 4UW2A 4F3QA 1ZZFA 4LSLB 2YXLA 1ZAVA 2YKQA 5LL6d 2FHJD 4J7CA 1TKTA 3CDWA 4DR3J 3HJVA 1D9AA 2FPHX 5C25B 3A3NB 1KBRA 3RB6A 3HDSA 1RU2A 2ZH3A 4ZITA 5EWEA 3DLHA 2EPIA 2VG5B 4PXCA 3GPAA 2VG7B 2ZHBA 3MCMA 2UUBF 3MUVP 4N5SA 1RWUA 2RE1A 3HT3A 2FY1A 4DS5A 3CUNA 2IM3A 3SFGA 2UV8A 1NK0A 3JTOA 4EMDA 2GQ2A 4LIRA 3V4IA 1TUWA 2C3YA 4HDGA 2RSQA 3RR8A 1IBMJ 1WACA 1VR6A 5ETKA 4AL5A 4C11A 3HT0A 3GIKA 4DFKA 3CE8A 3OJSA 4K2XA 1SXLA 3VAFA 1R43A 4JV1A 3CDBA 1RT1B 4KIAA 2RKIB 3I4HX 3DRRA 2QYCA 2FZKB 3CW2C 1YG0A 1JLCB 1OO0B 2PMWA 1IWAA 4EYIB 4A8OA 2FVSA 4QR1A 3L4BC 1XIQA 1JB0C 1T3OA 3X1LB 3RG6A 3AODA 2HFSA 1S4EA 2RAQA 1L3TA 4DFJA 3NGSA 3LP2B 4NASA 3M6UA 1VQNS 3NS7B 1PYTA 4KO0A 1HYSA 2W4PA 2D9OA 1JKHB 2HFUA 1U2FA 1CJKB 3GSIA 1EKSA 1Q5YA 2EFOA 1PO6A 1TVRA 4K7QA 1NK4A 5IZHA 4BWJA 2G0CA 1U1QA 2KDOA 1RHUB 2LXIA 1CJUB 3WDOA 2VODA 3FFIB 3TZYA 4LBHA 2MJNA 1TKZA 3TRGA 4K5RA 2H1YA 3N6LA 3ONQA 5J2NA 2LCWA 2KO1A 1Y00A 3DRXA 4C3MA 2F3JA 1N5YA 2WZ1A 5HQ8A 4KKOA 1CJVB 1KLMB 4CQ1A 2WK4A 1DBDA 4DS4A 1MWQA 2WW8A 1RAGB 1F0XA 2Y8YA 1BQMB 3H5YA 4ZIWA 4KH0B 3FK4A 4Y00A 2LP4A 1R8BA 1GX5A 2FD2A 4DX8H 1VCTA 2UZAA 2U1AA 2MGZB 4O4GA 2GAHC 4ID5A 1DURA 4KTQA 3MD1A 1NMEB 2HHWA 3A3OB 5KG1A 2BJDA 3NGTA 1TR0A 4YY3J 2AD9A 1C1BA 1H2UX 2GZOA 4X65J 1ZETA 3R2DJ 3M30B 1P27B 4U96A 2HVDA 3NOGA 4EO6A 2NUHA 2DTJA 2Q79A 4JOUA 4M5HA 5HSPA 5KG0A 2HZAA 2O66A 1X5OA 1YX2A 4KRWA 3MR5A 3BO3A 2Y0SD 1WORA 2FYXA 3FRYA 4KHRA 2QA2A 3OFHA 3BM7A 2VC1A 3CJ3A 3OD2A 4HTJA 4ECZA 1FJCA 1NSKL 2ILYA 3ZNUA 1GMVA 4YY3F 4RR5A 1NCLA 1FHTA 4IR9A 2J5AA 4ZPCA 4X65F 3GJSB 3C16A 1RTDA 2YH0A 2BW7A 3DRPB 4ZHRB 3Q8QB 3KHRA 2KKHA 4MIWA 4NOHA 1FWKA 2KG1A 2AIRB 4IFVB 1OYDA 4OZJA 2FJXA 2CZ4A 1MU2B 5KT2A 4DFMA 3J7YU 5AXLA 4ZVTB 3D1HA 1IKWB 3OR1A 1R7IA 4KBIA 4N8NA 4Q2MA 4HH0A 3PYFA 3BPSP 1LNQA 5L1LA 1SBRA 4ECTA 2K7JA 1S9GB 2C3MA 3GR0A 4ZVUB 1RACB 1S1XB 2D3O1 2RQKA 4WE1B 1VBXA 1T05B 1AB8A 1DTTA 3VAGA 3M6WA 2I5JB 2BMBA 4EBCA 1KTVA 3CCVS 3RRHA 2CIMA 1JJ4A 2NXUA 1S1WB 2X1FA 4MTPA 1VK3A 2IM1A 3BN7A 2V6AA 4AE5A 3MEGA 3UN3A 4DUYJ 3KYLA 1RSCA 2XMWA 2COLA 1UJ5A 3ET6B 4DFPA 2VB6A 1ROFA 1Q8BA 2JVRA 2PC6A 3ZO7A 2KXHA 1YITS 3E01A 5K8OA 1T0TV 5KFGA 2ADCA 4OJ3A 3HHKA 4FDFA 1KQKA 2M2BA 3UDCA 4RLEA 3P6YC 1WEYA 4DUYF 5KFNA 2HZVA 3KJQB 1NM2A 1U6ZA 3MAHA 3QGHA 2BX6A 1NKBA 1JLQA 4WIQA 1FE4A 2CPJA 1YBTA 1WWHA 4P2FA 3BQ2A 3BJYA 4CM0A 3D5MA 2CVEA 2MZQA 4F3OA 2GHPA 4IQMA 2ZOGA 3BGOP 5IQQA 5LJ5Y 4DR7J 2KT2A 3QQCD 2LEPA 4BBYA 1U1OA 3MAAA 1JIHA 2V4JA 1U02A 1WC4A 4Y2CA 3THVA 2HQIA 2ZJQQ 3A3PB 1X5PA 2R8KA 4K4YA 1FEHA 1RABB 3CVKA 4OZLA 4WYLA 4ZJLA 3PFOA 2CPDA 5K14A 2ZITA 1Y11A 1WSVA 2DNPA 3VVUA 3NGUA 2BJEA 1JJHA 1C0TA 1S5ZA 3LW5C 3DLEA 5E2QA 3DYAA 1NHVA 4DR7F 3CC4S 3W62A 3WQPA 1KC8T 1FJGJ 1S79A 1GAOA 3PTWA 2ABYA 3UDLA 3BEGB 3GB0A 4WK1A 5LMNJ 1UPMB 3QRRA 3P5BP 2MKHA 4YS2A 3DM2B 1D1UA 3CCWA 2VOPA 1HWLA 4TLQA 4JV0A 1UVKA 5CCLA 1HI0P 2VFRA 2ATLA 1T9XA 2V69A 4IUFA 3SCJE 1Q0NA 3SQGA 3AH6A 2GW8A 1CC7A 1MG7A 1NLKL 1AZSB 4F0MA 5HLFB 3CMAS 1CULA 3KHLA 2QL7B 1QY7A 1SJ1A 4G1QA 4X2BA 2JEFA 3TA1A 1RT6A 5EDWA 1FJGF 2HAIA 4IQXA 2FHJA 5GADU 5LMNF 5DGBA 3FGVA 1SCJB 2X7IA 1D0EA 1B7FA 3KK2B 1Q8IA 1UFLA 2DNKA 1WI6A 5E3QA 2V2KA 3IWLA 1KSPA 5KFVA 3M7VA 5CD4H 2QTWA 5KFUA 2YNIA 4I4BA 1FI4A 2KN4A 5F3TA 3BH6B 3O44A 2W2MP 3HHLD 4IG0A 2E5JA 2XO7A 1VBYA 1W2IA 3G82B 4UOCA 3MZIA 4C9DA 1SI9A 4KGXB 3KK1A 5J2MA 1RTHB 1K1SA 2QLFB 2UUAJ 1IKVA 2B5JA 1JLGB 3FQKA 2XZTB 4B02A 2W24A 3D54A 4ELUA 2BE2A 3K5PA 2KFZA 1E6YB 2KZZA 3EXCX 1WG5A 4D3HA 2HIYA 2W4DA 4TYAA 2QSWA 4N77A 2XSFA 5D4NA 2C2OB 1T9WA 2EXUA 2DITA 1JLEA 3TA0A 2AW0A 2CKWA 2HGMA 4ETZA 3EZOA 4I69A 4UZBA 4BC7A 3RW7A 2UUAF 1YBUA 5E33A 4YN3B 3HVAA 1SV5B 3OFGA 4NXMJ 5L9NA 1WSRA 4Y65A 2YPZA 1A6LA 4R8UB 5KFKA 2AT1B 1N34F 4F4KA 4FS1A 5HL7Q 2ZWPA 1SQGA 3Q2SC 2VOOA 1BC6A 2ZE2A 3U27A 3QIPB 1DJ0A 2J8SA 4ZS6A 5KFBA 1P6TA 4NLPA 4ZP9A 1VS3A 4A8YA 2LFVA 1D9FA 3DMJB 4FF2A 1EB0A 2QC3A 3NXZA 3C14A 4HVZA 4UOHA 3DGVA 3JB9k 1T02A 3TJ8A 3QATA 1XC9A 2IM2A 4PUOB 1VQ6S 4NZ6A 4NXMF 3CMQA 2JOQA 1RB0A 4GVBB 9RUBA 2E9ZA 5I4MA 1WG1A 1REVA 3MR6A 3POTB 5H9FK 3RBDA 1Y5LB 3H2VE 4X4SA 4M94A 4C0BA 1RCXB 5EX0A 3HHLB 5H9EJ 1TL4A 3W2VB 1AUDA 4L72B 2ASLA 2CJQA 2B8PA 2UU9J 3KMQA 4F0HA 2W4CA 2OTLS 3TJ9A 2XYHB 2CQDA 4G6VB 2I0XA 5D0EA 4NLWA 5U47A 1VDHA 4HTIA 4CO1A 2LA4A 2A0FB 3I5BA 1S1VA 4RW7B 4PWDA 3ENVA 1H2VZ 2CFXA 2JLFA 1MN7A 2MQPA 1XR6A 2HNYA 3V6DA 1MMDA 4TLRA 2PIIA 1IJEB 3M2UB 1F5BA 4RL1A 2E1RA 4AXJA 2HBQB 2Z4PA 2C3UA 1J27A 3FBEA 4B3OA 4C7QA 2X1AA 1TFYA 2KJVA 1CS4A 2UU9F 1ZM2A 3UN2A 2CQIA 3EICA 1W25A 3C66A 3FRZA 3DDNA 3ZTRA 4KHPJ 1SKUB 2XY5A 2V50A 2MPUA 3CULA 2E29A 2ASDA 1S77D 1HQUB 3IS9A 1NJYA 3G8QA 3LGNA 5HI7A 2BKNA 1VRUA 3SDEA 4LVNP 4OYZA 3I6PA 5LOQA 4FF3A 1VQ5S 3VV2B 4I2PA 4DX5A 2Z57B 1FTCA 3LO3A 1Q8LA 5DQGA 1QSLA 1G4CA 3NCPA 1LOUA 4F7VA 4L76A 3RYLA 5DDOC 3MTJA 2J8AA 1S6PA 1DTTB 3VGSA 5H1SV 5C2GA 2BV3A 3DXSX 2VBXA 3KLVA 2H4WB 1MWZA 3DOKA 1OWXA 1S6OA 3I96A 5E3RA 1HMVB 2GQCA 2FJVA 2AJFE 1S76D 3QT7A 5T41A 3Q89A 4O23A 1IN0A 1S59A 1RKIA 2BJ8A 3D68A 4HKQA 3CD7A 4CO4A 5E7OB 4ER8A 3D7SB 1R8CA 1V9OA 1S57A 4Y34A 2HQDA 1H73A 1X9MA 4AD6A 4OI1A 4RUAA 3F56A 4ZMMA 4HEA9 2XY7A 4DSJA 2LECA 2MQMA 1PBUA 3B8HA 4MKAA 5DQIA 5IT4A 3HJFA 5DG7A 4YB1P 3QLHA 2N7CA 4X4RA 2KXFA 2LQJA 3N0VA 2MZ1A 1Y3KA 4IOAQ 3N9UC 1CJTB 1RT7B 4QYZK 4OYPA 1LV5A 2LQBA 4AL6A 1T9UA 3I87A 2B7CB 3AQPA 2DRBA 2R4FA 2YX1A 3LGMA 2HQGA 3J7YI 3CTRA 1QE1A 3NS6A 4RX6A 3T6JA 4MK8A 2BQRA 3AJ2A 4ZP6A 2CVIA 3HSGA 1VQSA 4NLRA 5A76A 3HFVA 3RU0A 4Q2LA 3BQ0A 4CLKA 3HSDA 2NS1B 3H2LA 4NL5A 1V5VA 3FUYA 2OMLA 4HT7A 4YOEA 3ITHA 4QWCA 3QZ7A 1VQLS 1YIJS 1RTIB 1JNZB 4NYZA 3QT6A 1U1PA 4ZLNA 4NZ7A 2WBRA 5ETTA 1PAEX 3GV5B 2VH7A 2E7VA 2M5YA 2B3TB 3TX0A 2RDIA 2HEKA 4LF2A 1H6KX 2QLJB 3RBZA 3ZXWA 1KFDA 1UJ6A 4CLZA 2AGOA 1IWGA 2W9BB 4IO9Q 3ZNJ1 3MFHA 4K50A 4K5SA 3DU6A 1LWEB 2K8GA 3IP0A 3UNGC 5HMZA 4J9UE 4QIEA 3G87A 3C8YA 2F8HA 3MCOA 1SL2A 1IR2A 3HCXA 1FXLA 1SJ4P 3FZBA 3FNNA 3NS5A 3LP1B 4E98A 3M2RB 3K5MA 3M8RA 4A8SA 4CZCA 4U7CA 2A1BA 2JNJA 4LF1A 2R7QA 1WJ9A 4Q43A 4WK3A 3K8VA 3ZZTA 4N56A 4WKYA 1G6BA 2YKMB 3FMBA 1IKYB 2B4OA 2HLTA 4FYWB 1RYRA 2WAQD 5AE2A 2ZBCA 3DI6A 3UWTA 5KFYA 4PWUA 2XMKA 2RF2A 5KG2A 1QAYA 2JEJA 2BVZA 1NO8A 1U24A 4URQU 5E3CA 1BWEA 1EETA 1B0PA 1HW8A 1X4FA 4DHVA 2Z2ZA 4ED0A 1RT4A 1SIWB 4H4MA 1NBEB 3M6XA 3IC1A 3KLIA 2E5LJ 3EVMA 3KUGA 1WKJA 2VJUA 4DF4A 1MWYA 3ICLA 4KY3A 2ZOMA 3UE2A 1S49A 4RW9A 1TL1A 5FLXU 2YX7A 2QG9B 1TZ0A 2LDIA 2FVRA 3LWLA 1RTJA 1LW0B 4OLOA 4ZVSB 3SMZA 4WU2A 3B4MA 2D1CA 4NRTA 2ZH1A 1RT2A 1VI7A 2XWYA 1QLNA 4WZQA 1HBOB 1AROP 1L3UA 5BYQA 4DX7A 2XI3A 1U26A 1KWMA 1WKKA 2E5LF 2ZKUA 2IBKA 5JJBA 4FPIA 5IFMA 1KVJA 2OI2A 4IH6A 3VGVA 1TL7A 3JSBA 4A8KA 4J91A 1F9FA 3CJ5A 2BE9B 1FK9B 1GNKA 3IN5A 3L7PA 3N4WA 2WSCC 3TR5A 5BYSA 4PG8A 4LSNB 4DPUA 4FVCA 4A8WA 3TARA 3HXMA 1U1KA 2H4YB 4LF4J 4Y3CA 2AKWB 4NCGB 2DD8S 1HR0J 3W1YC 4QWEA 4UY85 3GU0A 4QWDA 5GADI 2QGFB 3N5FA 4DEZA 1YJVA 4BLGA 2IVYA 1HHSA 1ZM3A 2G2YA 3G2XA 3CC2S 4USMA 4IFYA 3UCZP 3MXHP 2LQ9A 4IG3A 3M2VB 2MMYA 1T03B 1C4CA 2AJ4A 3UDEA 1XMQJ 1RDRA 3NL0A 2G2OA 4C6AA 2MLZA 1GMWD 4Q8FA 4I6WA 3Q86A 2Y1RI 5DGAA 3A8JA 1P9QC 2QMXA 3V81A 1RHRB 4LF4F 4K2JA 3G6XA 4PKDB 4HT5A 5A0YA 1HR0F 4H4KC 4FXVA 2VUGA 3AQOA 3QGIA 3CJTA 1S1TA 1WOOA 2DNZA 1NK5A 3LALA 2HWHA 1FD8A 4FYDA 5ETNA 1UPPA 4I2QA 1EHWA 2M70A 1XMQF 3IXQA 3NBPA 3CDAA 3DRYA 3DOLA 2EFGA 2ZBIA 5L38A 5DS7A 4P2XA 5IT9Y 3I9ZA 3T6BA 2J7KA 3MPUB 4E2FB 2NPFA 1GMUA 3JYTB 3I82A 2EFVA 5DM7Q 4X4PA 2YKNB 1YWXA 1FRHA 4EBDA 2WHOA 3J80Y 4W4MA 3M8PB 1C0UB 4OHXA 2UUTA 3Q8PB 2CNOB 4XO0A 1HNIB 3KOAA 2FIUA 5CYQA 3ADAC 4NZ0A 1UJ4A 4OI2A 4CM2A 1R0AB 2G0IA 9ATCB 1Y9OA 2HVZA 2H51B 5F8GA 1NU4A 2DISA 3BDPA 1XK8A 2LXFA 4QIFA 3GCWP 2PEBA 2XCPA 2UXCF 1NSPA 3RB4A 2ASYA 2GIQA 2AX1A 2Z58B 1T11A 4G1IA 4M5DA 3LP0B 3UCGA 2XHWA 2K06A 2YQ0A 5ETSA 3ELHA 1FF2A 1NPRA 2ZDOA 1D9DA 2XI2A 1M0SA 1A9NB 5M2PA 4B9SA 2QJ3A 2EBEA 4L75A 2W9CB 2V0NA 2RU3A 1PJ7A 2PA8D 3SXLA 2VQFF 4U9RA 3C6UB 1H72C 4PXDA 2LEAA 2RS2A 2ZBQA 5DG8A 2EG1A 1N5SA 3J7AN 3W8GA 4LUBA 3ILLA 1WD6A 4OYXA 1NKCA 4L73A 1TK8A 2WONB 1SC6A 3B78A 8ATCB 3H98A 5CYMB 5KFFA 2G1DA 4HACA 4MK7A 1JWWA 1X8DA 3BR9A 1S1UA 4EYHB 1U09A 4RU9A 2XMUA 2K3IA 4DG1B 3AD7C 4ECXA 2BABA 4ZLJA 2FJWA 3GIRA 2EKYA 3QPIA 2ERRA 2DNHA 5C42B 1R3NA 3PKYA 4DL2A 4YR0A 3CJ8A 5DETA 5B0DA 2AJ0A 4JI6F 2QT7A 1VFJA 1XJWB 1K73T 2DNGA 3D1OA 2XEXA 4ZKAA 2ZBRA 2ZZTA 1LW2A 3VGTA 1BQNA 3TOQA 1UVMA 2HHXA 4P6QA 2A18A 2GQQA 3NCRA 4ZP7A 1FDBA 2B43A 2YQ3A 4ZP8A 4YFUA 4ZPWR 1IBKF 1ZPWX 3DGPA 1Y10A 1DTQB 1FTRA 3OL6A 4PG4A 3FJ2A 3MCNA 3PJWA 4EU0A 2SXLA 4PWWA 4PPZA 3AB2B 2XLKA 1B4SA 2ALZA 5JXSA 3UVJA 5KFDA 1WG4A 3D2WA 5B7WA 1SQEA 5LXYA 1NB2A 3ITHB 1U0SA 3LTOA 2PO4A 1TL3B 1Y7PA 2HGLA 2QMWA 3BV8A 4M8LA 4RPFA 3OUYA 1DQ8A 2ZH9A 1RAAB 3UDVA 2V68A 1MROB 3LAMA 2V9KA 3BPDA 3PZPA 3M9OB 2ALYB 1FFWB 2VA3A 1NK7A 1AFIA 1FKPB 2KVQE 4NPOA 3GFXA 4ILRA 3HSZA 1WC0A 3FZ2A 2ZC3A 4DL6A 2XLJA 3MPDA 4CLSA 1AW0A 2XSJB 2C3PA 1F3FA 3BGUA 2ZZMA 4S0MA 1FVQA 3HZGA 3CCLS 4UTGA 3O6QA 3GTYX 1J5OB 2PFDA 1KQFB 2GAGC 1I1GA 5KG7A 2XNRA 1FESA 3CSKA 2FZCB 3CCSS 1WF2A 4UUXA 3TEGA 3TAQA 2ZH4A 2A2DA 4LR7A 3NG8A 2M88A 3CDEA 2VKZG 1HIYA 3MM7A 1CC8A 2D3UA 3DNCA 4F4YA 2G9OA 3SCIE 1S0VA 4I0WA 4B9NA 2EK1A 3M1VA 5D3GA 1IQZA 1JMTA 2Z2YB 4DL4A 3OTCA 1KOHA 2ZD1A 4OX9J 1QUPA 3NNCA 4QIWD 5DG9A 3QGGA 4KT0C 3QYYA 3K58A 3G8TA 1IR0A 3RAXA 4ZJQA 2ROGA 1FKOA 5KFXA 4KGZB 2W8KA 1VK8A 1NJZA 2QA4S 1HD0A 3GJRB 1PBAA 2IYGA 1F2GA 1LQ9A 1SJQA 3G71S 2CDQA 3I55S 1HWKA 5KFAA 4N76A 3M9NB 4JYAJ 4Q0BB 1N32F 3FMWA 3OTEA 1YJUA 4OX9F 1GX6A 4CDIA 3HULA 2IAJA 4K4WA 2PMHA 4G3IA 3O5TB 1O51A 2EK6A 2DGWA 3IR5B 1LWCA 1Q7YT 3AHPA 3N6NA 3UO0A 2CQHA 4OYAA 5A8KB 1U1MA 3QMQA 3PJXA 3DLGA 5F3ZA 3OV7A 4DV5J 5J1EB 2JLEA 4A8FA 2GVDA 4UOFA 3TAMA 2FQQB 2XQCA 1FDAA 1Q53A 4PG6A 4JYAF 2M9KA 1HBNA 1RAIB 5CXTA 2VFVA 2V8HA 3ETOA 4ECSA 2ZDPA 4ES3A 4IRKA 2CPFA 3CCTA 1ZPVA 3MEEB 1AXQA 4WP9A 2DO4A 2OD6A 4KAIA 5D0RA 4YHHJ 2JFKA 2UV8G 4DLGA 2I1RA 4X4NA 4DSKA 3CJSA 5A2QY 1RT5A 4A8MP 2C28A 4DCJB 3QNWB 2VKRA 4H4OA 1AT1B 3PEHA 4QYRA 1REGX 2OPRB 1C1CA 3MMAB 1QTMA 4ED2A 2E66A 2KHDA 3M9MB 4DDFA 5D78A 2YWGA 1JLBB 4OI6A 3PHEA 3LF0A 3VZIA 2W2PP 3SI8A 4FNIA 2I8EA 1OSDA 2ZVSA 1HWJA 2JDJA 2DNMA 2F40A 3DRSB 2VDIA 4AYBD 2DGUA 4ICLA 1NAQA 2VPXB 4GKJF 3BGRA 4YHHF 3MDFA 1ZM4A 2XULA 4ZPVR 4B9MA 2PI4A 3GMGA 3H90A 2B4PA 3ZTSA 1HWIA 5HQMA 1JK9B 2OJ3A 4DU7A 2VONA 4PG7A 3GCXP 1CEZA 4ELTA 4I64A 2HHPA 4Y2KA 1VQOS 3QAUA 1XR5A 2WOMB 2J0XA 2ZH6A 4FF4A 2V8DA 4DV1J 3TUZC 4P74A 2PFFB 2FTRA 2WVCA 3V6HA 1G1XA 1HBUB 2RDJA 5KT5A 2PN6A 2RJZA 3LQVA 4FYXB 4DR4J 5T7LA 4NEYA 2OPSB 5FDLA 1NDLA 4JI5F 4ZLLA 3MR2A 2DRDA 2BRKA 2CPZA 4ZCLA 2JC0A 4QJVA 3MPWA 5JVGQ 1OY8A 5F9LA 1UKUA 1YRTA 3KNAA 3GFHA 5J2QA 4DWIA 5THWA 4FPRA 2EBGA 4RO0A 1PKUA 3T3FA 2OO4A 5DM6Q 2CNLB 4OYBA 2RT3A 2X1BA 2YNFB 5J1NA 5F0UA 4DR4F 4YP3A 3HVTB 1VYAA 2CXEA 1IKXA 1TKXA 3AJDA 3AAWB 4ED1A 4M5IA 2DCUB 4PQUA 5IV3A 1UMJA 2MEWA 4CLWA 3AOBA 2IVMA 1S6UA 4DV4F 2XY6A 1FE0A 3KLGA 2J9DA 2JEGA 4LFAJ 4EGLA 5CZXA 4M95A 2DPIA 3WIUA 4F04B 4IRCA 5EWFA 1VQ9S 3E2EA 4J9VA 2F1FA 5EHHA 4WTOB 4LRCA 2VPZB 3QJPA 2BBEA 3K8WA 4P75A 3UNYA 5GMEA 5I42B 3NLCA 1WKLA 2DNRA 4ZVQB 4NLDA 4PPDA 1UEVA 4OI0A 3DXBA 2LYVA 4KFBA 2B9YA 2NXJA 3KLHA 1S0MA 1NK9A 4LFAF 4F4WA 3BDEA 2OFHX 1NJWA 5J2PB 1N36J 3M8YA 4A46A 1Q86T 2NR0A 2HYIB 2HHQA 2GHVC 4QIVA 5L1KA 2W8LA 2CQBA 2FVQA 3M32B 3VR1A 2YVSA 2NYHA 4WZMA 2NUUG 2IYIA 1SUQB 4V19X 2JSXA 3J81Y 1T9VA 4LRDA 2IBOA 2R8JA 2ZNZA 5C2CA 2R42A 4FXDA 1VRQC 1BMQB 1RI7A 3DOMB 4HL9A 1N36F 2DR7A 3S6EA 3LWMA 2O1PA 4CYUA 3U7JA 2FB0A 4HLBA 3T9ZA 1I5OB 3MM5A 4C8MA 2FDNA 4LF9J 3EXYA 5HROB 4TY9A 2ZHAA 3R27A 1ZBTA 1NSAA 2DNLA 3ENWA 3KLFA 4XPEA 1PAUB 3KHGA 5ADZA 3R5DA 5K8MA 2Z0GA 3PKMA 1B64A 5GAGU 4OYWA 4DQRA 1NPKA 2PA3A 2VFTA 5BJRA 7FDRA 2QO3A 5I3UA 4DV7J 2MY8A 3VQTA 1S12A 1AYEA 2QRRA 3JAMY 3EGWB 4LF9F 3R3TA 4USKA 1SC1B 2W01A 5KFTA 2R7XA 1CSJA 2F4FA 1FRLA 3BSNA 3BR8A 5SZTA 5A8WB 3PCOB 3IMQJ 4N41A 3F41A 3KDNA 2A2CA 1N33J 5DDRC 4WP3A 3WZ0A 2D3ZA 2MHEA 5L1IA 2MQLA 1SB6A 4LF8F 4GVLA 2LXUA 3QIDA 2Y3YA 5BR8J 4DV7F 1HNZF 2ZOFA 5ETRA 1EP4A 1YRXA 2WRMA 3H59A 3PYDA 4QBUA 3NEKA 4MKBA 4J9KA 4OZ5A 2L08A 4NWBA 5E3AA 1N33F 4ED6A 1OMSA 3GFYA 1UVNA 3KJVA 4EO8A 4FS2A 4YB7A 2WB4A 3AXKA 1NKEA 4FVMA 3ZZZA 1YJ9S 2V8VA 2LKZA 1KOOA 1RWXB 5BR8F 4J5OA 1JLAB 3AT1B 4MYUA 2BXJA 3OW2R 1TAUA 1IBLJ 4P7VA 4EFAC 1U0HA 1ZH5A 2DPJA 4URGA 2BR0A 3HLUA 2F4VJ 1IXKA 2C2EA 4RKUC 2VZ9A 2B7BB 2F9DA 4M5NA 3GIIA 4CLLA 1FA0A 3JSMB 4QYZJ 2J7WA 2MTLA 3BN4A 5HVHA 3TX8A 4RW8B 3TJAA 1FRJA 1KVKA 1Q16B 4NMXA 2M7SA 5DDPC 5A8RB 3TQEA 2MDAA 4X4QA 1UWAA 4ZVOB 4XDCA 7FD1A 2YNGA 1IBLF 4C8LA 2FJEB 2F4VF 4DX6A 1FX2A 2AMCB 1FWLA 3QWUA 2FVPA 2VG6B 5IC4B 1I3OB 3R5GA 3DDKA 1HQ2A 1GEHA 2PGCA 5FJ4A 2UVWA 4J9LA 3E51A 3IRXA 1QAIA 4IRDA 2MQQA 1FXDA 2W9AA 3O2IA 3JSRA 3D0GE 4IDKA 3V5RA 2BYCA 4KV8A 1VQPS 2HRUA 1SC4B 4JI1J 1WEXA 5AJ3J 3OR2A 3CD0A 4P10A 4B9TA 2EFQA 1XR7A 3KTQA 2MKJA 1H2TZ 3AD8C 3BQ1A 5AT1B 3GIMA 4LMZA 3R97A 1YJRA 2QIFA 1KD1T 3GG0A 1GTEA 3KHHA 3BKFA 2J9CA 5IV4A 3EJMA 4RBVA 4ILLA 2OFGX 1S6QB 3MEDA 2NXEA 3BKUA 3MECB 3I5AA 1L5UA 2MSSA 3HFKA 1RLDA 2DO0A 1SJRA 1E6VA 3CMES 1X4HA 1RT3B 2RH3A 4NEZA 1VC6A 4JI1F 5AJ3F 1N5QA 2QA1A 1F1BB 3P4UB 2DHXA 5C24B 2R7UA 1HHTP 1HBMA 4DUTA 2FZGB 1RHJB 3Q8UA 5K5MA 4O44A 5FIIA 1WC3A 3SEOA 3G6ES 2MKSA 2EI5A 5KFWA 3AXMA 3CCMS 2OPPB 3ILIA 1VRTA 2EEYA 3UR3C 1T9TA 4CLPA 1I6JA 2GVZA 2BM1A 4OI4A 1APSA 4XAKA 1GH8A 2PDAA 4OL8A 3CO0P 4CI0B 2VICA 1R6YA 1N6QA 3UD5A 4DR6J 4RW6B 3MM8A 2EFPA 3K7RA 3MMJA 1HNWJ 2F9JA 4NA3A 2QL9B 1HD1A 2K1RA 2CPHA 3NAIA 4K59A 4DR3F 2DVIA 4CTAA 1EQ0A 3G6VA 3DLJA 4DV3J 3QSYB 3MMBB 4KPYA 3MPVA 1VQ4S 1HKAA 2IC3B 1ZM9A 2RS8A 3IWXA 1TUGB 2PI5A 3UFCX 1IKXB 2P6SA 4KYZA 1TMJA 4ZVFA 2KU7A 2ADBA 2V8PA 8RUCA 4PCQA 4PZVA 1XEZA 3I56S 4DR6F 3MGJA 4LR9A 3A1YG 1RAEB 3WHIA 5F0WA 1HNWF 1IBMF 2HHHJ 1WOPA 5KFZA 2DGXA 5KFOA 3BSCA 4DV3F 3PX6A 1F5AA 5CA5A 2E9RX 3OXLA 4ZVRB 4OV6A 3OBIA 3G6YA 2Y1IA 3IR6B 3MFIA 4EUVA 5HP1A 1Y4ZB 4C3LA 4UZCA 1M5PC 3F44A 1QD1A 3U1MA 2UUCJ 1K0VA 4CLYA 2Z30B 2H5EA 1HPZA 4KGKA 3QWPA 1RP5A 2XYPB 2CPIA 3K0JA 3EVWA 1W7WA 1U6BA 3MM9A 5IM0A 3EDRB 2IHR1 2HHHF 4KQZA 1FKAF 2XZDB 2Q6CA 1LKZA 3IRWP 2KB2A 2DY1A 2HS0A 1HQEB 2HBRB 1JNRB 3A12A 1JLFA 1N0VC 4MFBA 3HKZD 2J0QD 1VLYA 2UUCF 5LMUJ 1IM6A 1BE4A 3DDIA 3HMJG 2JWNA 5F9NA 1DARA 1U1RA 3TUJC 2RU9A 2RB7A 3IG1B 5CZVA 3PX4A 1R8HA 2I6WA 4CO5A 4M1KA 1H3DA 1ZTTA 1XQIA 2NXNA 3C15B 3KG1A 2VHGA 3T19A 4TN2A 1IQTA 1X7VA 4WU3A 1OY9A 5ETLA 1KVIA 2GV1A 2W7OA 2B6AB 5HBMB 2NPIA 4CWBA 4U67Q 6FD1A 3D6TB 5LMUF 3H25A 2ZUGA 4NLQA 4LRFA 1QJHA 5D77A 2HFVA 1N88A 4K4UA 3A4TA 5L46A 2CJYB 3QO9A 2HMIB 2BJ3A 2NQPA 3MWBA 4TY8A 3GYGA 2P9CA 3GJQB 5KFMA 3TNVA 3C6TB 3KK3B 3MAQA 1OS5A 4M63A 1QSYA 1DLOA 2P9EA 2ROEA 1KTQA 2QSFA 4X4OA 5I3PA 3I0SA 1TV6B 4E0DA 4IO1A 1KN6A 2E5HA 2OKQA 2YNHA 3QRQA 1RU1A 4WFNQ 4R5PB 3W9JA 4X84A 1PJ5A 4MAKA 3GV8B 5K8NA 4HH1A 3ULHA 2RMLA 2W25A 2MZRA 5CHCB 2BW2A 4USHA 4C8OA 1FFSB 1LWXA 5D4PA 4U7UD 2Z8QA 1S9EA 3M4XA 2A6OA 3MUMP 2KG0A 3M8QA 1EJ7L 5G0RB 2UXBJ 4W98A 2OH2A 2B4UA 2YTCA 4E8UA 1KHVA 2HNZA 4ES2A 4AQYJ 4OZ1A 4JI0J 2V2VA 2KT5A 1OQ6A 2WVBA 2NZ4A 3DLKB 3EUNA 2IJFA 4R0JA 1SQFA 1U48A 2EWHA 1B7YB 5GMKa 2HK3A 4DCOB 3D0IE 4ECRA 1VMBA 2VA2A 4UQGA 1S7HA 2UXBF 4XTTA 4ED7A 5HN0A 1TL5A 3MM6A 4Q44A 1U6FA 1X9WA 3NKYA 5HANA 4I67A 4OX7A 2CQPA 4NLOA 2MKYA 2OPQB 4LBPA 2BANB 2KL8A 4JI0F 3PXGa 4JI7J 1RJJA 4A8QA 2DGQA 1NPPA 4I7FA 5GAGI 4LSLA 5D0GA 3O8WA 4WXWA 4LFBJ 1HA1A 1U45A 1BY9A 2BQUA 5BXIA 5C25A 5KFJA 3BGLA 3NWGA 2HAFA 1F2HA 1I94J 2VG5A 4EBEA 1SKWA 2VG7A 3EVOA 1S0OA 4DQPA 5AE1A 4QWAA 3GV7B 1Z4UA 1TMMA 5KFPA 3C2PA 4WFYA 2NLWA 4IYQA 2AJ1A 2E5GA 2GGPB 1XBWA 1YKWA 5ITHA 4DQIA 2HS3A 5KG4A 4JI7F 1HNVB 1NXIA 4OHYA 3OHAA 3CT9A 5DZ7A 1TFWA 4LFBF 2M3DA 5B0FA 2ATCB 2P8IA 4NI2B 2V5HG 1KEKA 1KQSR 1S97A 4IKAA 1B3TA 1RWKB 5F8NA 5AXMA 3Q8RB 1I94F 1H98A 3H0PA 2IJRA 3CJKB 4DXLA 2ASJA 1RT1A 1RLCL 3BBCA 4WFBQ 2RKIA 3FEZA 3OFFA 3CO9A 1RAHB 4TU9A 1JLCA 3H20A 3IGVA 4QWBA 3QFHA 4DZ6A 2CPEA 1NSQA 4QW9A 2JX2A 3W2WB 1HLWA 3H40A 3KLEB 1T95A 2YH1A 3LP2A 4F2RA 2NYIA 3A8EA 5ETQA 2OEKA 4K4XA 3CJRA 4RW4B 3H8YA 1KS2A 1V3RA 1LWFB 1WI8A 3L95X 1H0HB 2WVDA 3MURP 1JKHA 1S72S 3MMCB 5B0AA 4MIAA 4H54A 1PC4A 1KP6A 2GFFA 4OZNA 3AFGA 1G3OA 2HLUA 2LMIA 5DRKA 1TKTB 2GX8A 2AEFA 2HRYA 5GAHU 4M5KA 3N79A 3R9LA 3TQ1A 1CJUA 1K8AT 2MJUA 4J9RA 3SCLE 3FFIA 1NRKA 1FNXH 3JQMA 3GLJA 4LJMA 3R7NB 2PMZD 3GILA 4TQSA 5RUBA 2E1CA 1CJVA 1KLMA 3D4JA 2Q1LA 3V4IB 1JQGA 4MK9A 5EN1A 3DCAA 1BQMA 1G7CB 1YLXA 4ZA1A 3NY0A 4C11B 1AFJA 5EWGA 2X1GA 2Z2LA 2IRXA 3OL9A 2CNNB 2MGZA 4K8RA 5IOLA 2CWXA 5KFHA 2HIQA 1D8ZA 3IM8A 3OT9A 4ZCMA 3UQSA 3DRRB 2HHTA 1BQXA 2ZH2A 3M30A 1OY6A 1WTFA 2AHOB 5K20B 2KYXA 2ZH8A 2GMHA 4R0EA 4RUHA 2H48B 1WHVA 2MLYA 4LF7J 4KO0B 4CO2A 1HYSB 4BS2A 3SV4A 1BD6A 3ZZYA 4OV1A 5LM7E 1RE1B 3CF5Q 1RA6A 4GC7A 1O6XA 1Q8KA 3MEKA 1DY3A 3MHYA 1TVRB 2AGQA 1DZ5A 4CLFA 3DRPA 4ZHRA 3VCDA 2DGTA 1YBAA 2DR5A 1X4CA 5KFQA 2N7YA 2CQCA 2HNDA 3EPGA 4JB8B 2IDEA 1TKZB 3NP5A 4ZVEA 5A6PA 5J2NB 3US5A 4IFVA 2C3OA 1MSWD 5J1PA 4RWWA 4LF7F 4ZIVA 3EX7B 2Y8WA 1MU2A 4ZPTR 5GAEU 4NCBA 4IOCQ 3VAKA 1RKJA 1N5YB 1TQLA 4KKOB 3AY0A 3CCJS 4A47A 3CEDA 1IKWA 4DPYA 2FJBB 1VQMS 3EMTA 4OX8A 4Q8EA 3IWNC 4C2MA 4LRBA 5JVHQ 4FP9A 2EFNA 1KLNA 2C2KB 4X66J 1S1XA 4O4GB 2YQ1A 4ID5B 4WE1A 4ZPBA 3THTA 2DIUA 1T05A 1YRUA 3LH2S 5MLCV 3VAHA 2I5JA 4ZPDA 3PFEA 1OSCA 1RWVB 1U47A 4FNHA 1C1BB 5HAOA 4USTA 4FYVB 3C46A 3EZ5A 4DOZA 5LXRA 1S1WA 5M2UA 4CNZA 1TKDA 1VQ7S 2J6UA 2DH7A 4DBQA 5C7PA 1ZZNA 1PILA 2GIRA 1UW4A 2Y1JA 1XN9A 1WC5A 3R1LA 1GXLA 2CJXB 4X66F 3EM1A 3FDSA 3OQ2A 3HSJA 3D6MB 2ZFHA 4TYBA 1TU0B 3X3UA 2BM0A 3MF5A 2H54B 3GP9A 2OLWA 5IT0A 1W2BR 3C16B 1RTDB 2HWIA 2DXFA 3TUIC 2R7SA 3AA9A 4DPOA 2E9TA 4W90B 2FLLA 2HFZA 3J81j 3TZZA 1BUXA 3ZZRA 3RZAA 4LQ9A 3W3SA 4QPXA 4N7TA 1DQ9A 5AE3A 2ZH7A 2CZVC 1GQEA 4OYOA 4F36A 3HPOA 4J9PA 3OR1B 3EGZA 2XCAA 2QE5A 2R7RA 2AP6A 3QAEA 4KE5A 2DHGA 2XO6A 2C2RA 3LPEA 3SQOP 3W8PA 3IBFB 5KT4A 4KHPF 2HBYB 4U7UK 4F02A 5KFEA 1ZOTA 4ED3A 2VPWB 3FKBA 4HHHA 1ITPA 3NGRA 4ZVHA 3HHLC 1RK8A 1G2EA 2CWKA 2B4VA 5EGYA 2R2TA 3KMSA 3T9NA 5FLXY 5JUMA 2Z56B 2XYGB 3BSOA 2HQFA 3K2YA 3MEGB 2XLIA 2QFJA 2JL9A 4U8VA 4ES1A 5LSOA 1U2RA 3RGIA 1DHMA 4QR2A 3LOUA 4J9NA 2L9NA 3KFWX 2L41A 2NXCA 2G0JA 2DNQA 4ECWA 1PYOB 3DM2A 1NUEA 2KT3A 3E01B 2HHSA 4KHMA 5KFLA 2OUGA 5D15A 3KKFA 2V67A 2CPYA 1WELA 2BDPA 1AZSA 3MTKA 3WC0A 5B0BA 5HLFA 4EEYA 1WHYA 2BE7D 1Q1KA 2QZ8A 4DPWA 3W5XA 4WF9Q 1UW9A 1JLQB 4NLYA 2OIHA 1PGZA 3M8SA 2AJ2A 1F6TA 2BACA 2XTJP 4ZPAA 3KK2A 4XDDA 5CYJA 3IAS9 2R8GA 2XM3A 3T5KA 1WHWA 3QSIA 3KXDA 4JV5J 2D9PA 2A10A 3MAAB 1LXNA 2VQEJ 2V4JB 3G4SS 1KDNA 1R8AA 1UWBA 2O5DA 3G82A 1MW7A 4FZVA 4TQRA 1X4AA 3RB0A 1Q82T 5M2RA 2GCFA 5K14B 2D7SA 3KUEA 3L9ZA 1C0TB 4O0NA 1RTHA 3N6MA 1T8EA 3DLEB 2KFNA 3DYAB 1JLGA 4PYAA 1RBAA 1QM9A 2FY8A 4JV5F 4P71A 4OFZA 2R2RA 2FJDB 2VQEF 1E6YA 2EVZA 2YWEA 4FBUA 1NZ8A 2BUNA 1Y0HA 3CJ0A 5HATA 3TWZA 3PYGA 3EZUA 1W26A 4UY8T 1RAJA 1X31C 3OSPA 2XHCA 1MNEA 3SQGB 4QIGA 3WX4A 5DO2A 2H9ZA 1JJCB 4ZCIA 5HVGA 3QZ8A 1CULB 1SV5A 2DH9A 4OX6A 3OTDA 4TXSA 3J7ZT 2VFSA 3CB4A 4G1QB 4OQJA 1RT6B 4R8UA 3FC9A 3L09A 1URRA 4ALZA 3W64A 3Q0AA 2O01C 3QIPA 4DL7A 1F60B 4EZ6A 3B4DA 3DMJA 4FKYA 2YNIB 1RISA 3H42A 1VLOA 4KR0B 4NXNJ 1N52B 2C2ZB 4BCAA 1EQMA 3S7RA 4F26A 4B9UA 3CCZA 4PUOA 4LT6A 2DK2A 1Q81T 2V34A 4IG0B 2XS7A 1YZ7A 4GVBA 2L3MA 2M0GB 2UVVA 1RQ0A 4YR2A 2CQGA 3PRDA 3M8WA 3PX0A 1K9MT 3POTA 5KTQA 3RRGA 3KK1B 3HHLA 3HHEA 4MT1A 3CDUA 3BB5A 1EARA 1D8YA 5J2MB 4X4TA 3W2VA 3HKWA 1IKVB 2KM8B 2RHQB 3ISZA 4CH0S 2B5JB 5HQLA 4RNMA 4NXNF 1BGXT 2FLNA 4AXIA 2BE2B 1YZ6A 2UXDJ 2J7UA 2DGSA 2ZKTA 4AT1B 2XMTA 2YPYA 3NCQA 1T9YA 4EZ9A 2QL5B 4RW7A 2C42A 1B0VA 3F0NA 2H5IB 1UA1A 1UVLA 2AJQA 1JLEB 5LJ3Y 4C98A 1NNDA 3M2UA 3PG9A 3SZ2A 1D09B 2J0WA 2H5JB 4ZN3A 3KUHA 4MMOA 2X51A 2HNDB 2J9EA 3Q83A 3M05A 4P52A 5GAHI 4CT9A 2V94A 1SKSA 2VFUA 2UXDF 1YVFA 4USVA 1HQUA 2ZE2B 3TVKA 1ZS6A 2HVEA 3GG1A 4DL5A 2DHHA 3T1AA 1CBKA 3C14B 3PVXA 2APOA 5CAAA 2M8DB 3I9V9 2WBMA 3JS9A 6FDRA 3R5JB 1M5HA 3P8BB 2AYMA 2C22A 3P3DA 2R7VA 3IFEA 1CVJA 1REVB 2HSEB 2PT0A 2LU2A 3UPFA 4M5MA 2MZSA 2OELA 1YJWS 1HMVA 2R3VA 4RNOA 1GFWB 2Y1LB 2VF3A 3ZZPA 2KM8C 2IY5B 2FC9A 4P9SA 2JLGA 1U49A 2WTFA 4Q5VA 1HWUA 2LQ5A 4LIWA 2DGOA 4OMFG 4XK8C 4HHJA 2OTJS 4D3GA 2MQ8A 3S01A 1S1VB 2VD3A 4PWDB 2C2NA 3U02A 3SSSA 3U1NA 2HNYB 3V6DB 2HWTA 1NB7A 3MOJB 4ANCA 5KT3A 2DEIA 4FYYB 4B3OB 2CJBA 1EKRA 4F2SA 4KB7A 2CJAA 1CS4B 4X4UA 2KHCA 4PG5A 5ETVA 2CNKB 4O3PA 2GJIA 2DR6A 5SUHA 3K59A 1CJTA 4WYWA 1RT7A 1V3ZA 2VBYA 3GYNA 2YWKA 2AZ1A 1NH7A 4KC5A 2R9LA 4CH7A 1NJXA 2OP5A 3IS9B 3UCUP 3FBCA 1CQMA 1VRUB 2DCLA 1K0TA 3SDEB 2V2QA 5GAEI 1UVJA 4ITSA 1H7WA 2QEXS 3ETMA 4NMLA 1BLUA 2AEJA 4P7TA 4I2PB 4B17A 2DIVA 1Q78A 3M6VA 4J9SA 2OEJA 4DSFA 5HVFA 1S6PB 2E1AA 1FWPA 1RTIA 2VU5A 3RB3A 1OPIA 3N5BA 3DOKB 3P96A 4HI2A 3DHXA 2B8QA 1MN9A 1FRIA 2RVJA 3EGNA 3D6FB 3QT5A 3UN5A 5D4OA 2Y0BB 2YWWA 2C2MB 3VALA 2E7WA 4CO3A 1UAWA 3TZXA 3OL8A 1X4EA 4QR0A 2W9BA 3PACA 2XMAA 2RILA 3W63A 3FSYA 1LWEA 3BSAA 3D1QA 1R31A 1YQHA 2GO9A 4DUZJ 1Q95G 2CJKA 2IPOB 3Q8VA 3ILOA 3LP1A 4LVOP 5DLGA 1OIAA 3M2RA 3MCSA 3T5LA 1RBOB 1FXRA 1ZAXA 2KFYA 3NNHA 1P1TA 4L3NA 2RQMA 1OQ3A 1TUVA 2F7VA 3Q8SB 3QLHB 4KGMA 1TAQA 3JQJA 4CO0A 4EI2A 3ISND 2YKMA 1IKYA 4RBTA 4F67A 4DF8A 4OZ3A 1OYEA 3T5HA 2GIFA 4JBCA 4OHZA 1UEUA 3FEXB 1UZDA 4DUZF 1WF0A 3RR7A 3Q24A 5ETPA 2K2PA 1GK8A 1QE1B 4NA2A 4NLTA 4NX9A 1IVZA
chains in the Genus database with same CATH topology
2H4WB 5K20B 2XYGB 2H65B 1SC1B 4DCOB 3GJTB 2CNKB 3IBCB 1RHJB 1QDUB 3R5JB 2C2KB 3GJRB 1RWKB 4ZVSB 2H48B 3KJFB 2HBQB 3GJSB 4ZVRB 1BMQB 4DCJB 3QNWB 3R7NB 2C1EB 2QL5B 2DKOB 2QLFB 1RWVB 2CNOB 1RE1B 1PYOB 1SC4B 2H5IB 3R6GB 2XZTB 3P45B 2CDRB 2QL7B 2HBZB 3KJNB 3RJMB 1SC3B 1GFWB 1RHRB 2Y1LB 3NS7B 3EDQB 1RHKB 1IBCB 2H51B 2QL9B 2XYPB 1NMEB 2H5JB 2C2OB 4ZVQB 3SIPB 2C2ZB 3EDRB 1RWPB 4ZVTB 4ZVOB 2CJXB 4JB8B 2XZDB 1RHQB 1RWMB 2CNLB 4LSZB 2CJYB 1QTNB 1PAUB 3IBFB 1I51B 2QLBB 2CNNB 2QLJB 1RWOB 4ZVPB 3D6MB 2HBYB 5IC6B 2FQQB 1F9EB 3R7BB 3R7SB 3GJQB 4DCPB 2P2CB 1RHUB 1RWNB 2HBRB 3D6HB 2H54B 1RWWB 4ZVUB 5IC4B 3D6FB 1I3OB 2XYHB 2Y0BB 2H4YB 2C2MB 1RHMB 3KJQB 3R6LB 1ICEB 3P4UB 1RWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H4W B;  5K20 B;  2XYG B;  2H65 B;  1SC1 B;  4DCO B;  3GJT B;  2CNK B;  3IBC B;  1RHJ B;  1QDU B;  3R5J B;  2C2K B;  3GJR B;  1RWK B;  4ZVS B;  2H48 B;  3KJF B;  2HBQ B;  3GJS B;  4ZVR B;  1BMQ B;  4DCJ B;  3QNW B;  3R7N B;  2C1E B;  2QL5 B;  2DKO B;  2QLF B;  1RWV B;  2CNO B;  1RE1 B;  1PYO B;  1SC4 B;  2H5I B;  3R6G B;  2XZT B;  3P45 B;  2CDR B;  2QL7 B;  2HBZ B;  3KJN B;  3RJM B;  1SC3 B;  1GFW B;  1RHR B;  2Y1L B;  3NS7 B;  3EDQ B;  1RHK B;  1IBC B;  2H51 B;  2QL9 B;  2XYP B;  1NME B;  2H5J B;  2C2O B;  4ZVQ B;  3SIP B;  2C2Z B;  3EDR B;  1RWP B;  4ZVT B;  4ZVO B;  2CJX B;  4JB8 B;  2XZD B;  1RHQ B;  1RWM B;  2CNL B;  4LSZ B;  2CJY B;  1QTN B;  1PAU B;  3IBF B;  1I51 B;  2QLB B;  2CNN B;  2QLJ B;  1RWO B;  4ZVP B;  3D6M B;  2HBY B;  5IC6 B;  2FQQ B;  1F9E B;  3R7B B;  3R7S B;  3GJQ B;  4DCP B;  2P2C B;  1RHU B;  1RWN B;  2HBR B;  3D6H B;  2H54 B;  1RWW B;  4ZVU B;  5IC4 B;  3D6F B;  1I3O B;  2XYH B;  2Y0B B;  2H4Y B;  2C2M B;  1RHM B;  3KJQ B;  3R6L B;  1ICE B;  3P4U B;  1RWX B; 
#chains in the Genus database with same CATH topology
 3UI3 A;  5I3Q A;  2V63 A;  5DDQ C;  4C4W A;  3GJT B;  4W92 B;  4CP5 A;  4UOG A;  2GJF A;  4MYT A;  2VBZ A;  3FSI A;  1RXO B;  5KFS A;  2LDY A;  3R2C J;  3PY8 A;  1DQA A;  1MLA A;  1UWB B;  4NYP A;  5LSL A;  4UF4 A;  1FD2 A;  3K5N A;  4AND A;  5T14 A;  1XMO J;  3CIM A;  3GON A;  2KTQ A;  1V3S A;  4H4K A;  3PR4 A;  2HFN A;  2IVF B;  1HHQ A;  1LW0 A;  1PC5 A;  4RWX A;  3TA2 A;  1HBO A;  1HNX J;  2PE8 A;  2RHS B;  3R1H A;  2N4C A;  1U1N A;  2AYB A;  1MML A;  2BJ7 A;  4NA1 A;  5L1J A;  4LF6 J;  5B08 A;  1N34 J;  2E7X A;  2MXY A;  1ULR A;  3PYE A;  2V9W A;  1HW9 A;  3FCH A;  3FBF A;  1XMO F;  4DPX A;  2FUG 9;  2KI2 A;  2BOA A;  1O5J A;  1FK9 A;  4XPC A;  3T41 A;  4ED5 A;  3OJU A;  1SJ3 P;  3W5Y A;  1SH3 A;  1HNX F;  3ZC4 A;  3F73 A;  4LSN A;  1YI2 S;  4C97 A;  3GIJ A;  4X4V A;  4LF6 F;  3D3B J;  4C0O C;  3DI6 B;  1WC6 A;  3RAM A;  3BYP A;  4NCG A;  3H2U B;  2RF2 B;  4QZV B;  3ENA A;  3SBM A;  4IOB A;  1M5V C;  2IMW P;  1F5C A;  2HBZ B;  4URS A;  1EET B;  2D41 A;  3AOC A;  3IM9 A;  1WNE A;  1RT4 B;  3VF0 B;  2IJN A;  4H4M B;  1JXV A;  3M2V A;  2POK A;  3KLI B;  1T03 A;  2MB0 B;  4OYI A;  4NRU A;  4RU2 A;  5LSR A;  1RWM B;  1VQY A;  4NLV A;  4RW9 B;  1TL1 B;  2B9E A;  3CNQ P;  2L48 A;  4P2M A;  2IDL A;  3AOA A;  3P49 B;  2O3D A;  4P2S A;  1RWN B;  4O0I A;  3QT8 A;  1RTJ B;  2HPU A;  2DR9 A;  3UW1 A;  4O3N A;  3R6L B;  4K4V A;  1RT2 B;  1UFK A;  1BHN A;  4NLS A;  2J6T A;  2KJW A;  2LLZ A;  1GT8 A;  4J37 A;  3WBZ A;  2ROP A;  2RUG A;  2VAS A;  4B3R J;  1TL7 B;  4V19 J;  1X0P A;  4GC6 A;  3VQS A;  3JYT A;  1YDL A;  4RJV A;  4ERD A;  1VOM A;  2YKN A;  1XTZ A;  2KYZ A;  3M8P A;  1C0U A;  3T1Y J;  3G86 A;  2LEB A;  2YKP A;  2Z2M A;  2HVI A;  1JX4 A;  2HHV A;  1ZYQ A;  1H38 A;  1HNI A;  3GZ7 A;  2KH9 A;  4HYK A;  1WHX A;  2CQ1 A;  1R0A A;  4DCP B;  3IR7 B;  4B3R F;  3ISN C;  2MZT A;  3N01 A;  3RBE A;  2P6T A;  3S1T A;  4PAB A;  5KFC A;  4AUK A;  4DV5 F;  3PW2 A;  4IFY B;  2J0S D;  3T1Y F;  5HJY A;  4B3T J;  1EZZ B;  1U2C A;  3PHT A;  4IG3 B;  3LP0 A;  3ILJ A;  3WX8 A;  2Q6B A;  2QMU B;  1C4A A;  1J5E J;  2DHA A;  3NRB A;  4F0K A;  3V81 B;  5F8H A;  2BA9 A;  2JEI A;  1F9H A;  4QU6 A;  2P5V A;  3CJ2 A;  5A0Y B;  2G2Z A;  2W9C A;  3LA0 A;  3R5A A;  1S1T B;  3OVA A;  1GMW A;  3IO1 A;  3MOZ A;  3C6U A;  1B99 A;  4OIX A;  2XC9 A;  4WKR A;  3OSN A;  2V2Z A;  1OPZ A;  1QVG R;  4B3T F;  2ZNY A;  4I2Q B;  2WON A;  3NBP B;  3KG0 A;  2VJV A;  3DOL B;  5CYM A;  1FNM A;  1J5E F;  3I4P A;  1RHQ B;  3WIV A;  4USI A;  2UVU A;  4TKT A;  3R7B B;  4DG1 A;  3NWR A;  1DFD A;  5E3P A;  3HI9 A;  5C42 A;  2LVW A;  1UVI A;  4WCE Q;  1X4D A;  4DLE A;  4NLG A;  3V2U C;  2CPX A;  1FCA A;  4P73 A;  3NGK A;  1GXT A;  5CYQ B;  3A8I A;  4FBT A;  1O0P A;  2MYF A;  2XNQ A;  3OLA A;  2LU1 A;  4Y0F A;  1QAJ A;  2ZHO A;  2BQ3 A;  1WF1 A;  5IWA J;  1V6H A;  4UT4 A;  4ZJO A;  4DV1 F;  3L7U A;  2GMJ A;  2HGN A;  2ZEJ A;  1VIS A;  1DTQ A;  4AL7 A;  2DGV A;  1VBZ A;  3DFE A;  3MPY A;  4M5D B;  3HVR A;  2XG8 A;  3EPI A;  2R8I A;  4B9L A;  1SKR A;  4WFZ A;  1NEE A;  3CXC R;  2DNY A;  4DI6 A;  3IA0 A;  5K8P A;  4RUB A;  2WSF C;  4NCA A;  1QTN B;  1WC1 A;  4V1A k;  5KG5 A;  1FEE A;  1TL3 A;  3PNI A;  4ECY A;  2ZWO A;  5IWA F;  1SPB P;  3M8Z A;  1RCO B;  1MRO A;  4ZK7 M;  2YWH A;  2L9W A;  3GWC A;  2VIH A;  1Q79 A;  2WVF A;  2CZ9 A;  1FKP A;  2WW4 A;  3KWM A;  3O3L A;  5D4L A;  4B3M J;  2JRS A;  2GO8 A;  4HAC B;  1K1Q A;  3T1H J;  5DQH A;  1VQ8 S;  2J6S A;  1S1U B;  3OL7 A;  2MLX A;  2OAU A;  1CPZ A;  3PO5 A;  3TAP A;  2XSJ A;  4JI3 J;  3DU5 A;  4U8Y A;  4ELV A;  4O3O A;  3TVY A;  3ZZU A;  2CUY A;  3CCE S;  2F8E X;  1TTH B;  3S8S A;  1R0B G;  1J5O A;  3VGU A;  4K4T A;  2N82 B;  3MR7 A;  3A13 A;  4OYM A;  3BYR A;  2L9D A;  3CJ4 A;  2AQ4 A;  3Q2T C;  1RWP B;  1NDK A;  4B3M F;  1LW2 B;  1XMB A;  1BQN B;  3D66 A;  5CCM A;  1FRK A;  3DLB A;  4B9V A;  1Y3J A;  1RTZ A;  4LSZ B;  2VC0 A;  1ZA2 B;  3BH7 B;  3T1H F;  4MIB A;  5H9F J;  4HI1 A;  2JJ4 D;  4X64 J;  2VPY B;  3HHN B;  2KVI A;  4Y28 C;  3ENQ A;  4JI3 F;  2Y9H A;  3DGP B;  1KQG B;  2WSE C;  2HKE A;  2NCK L;  1M5O C;  5B0C A;  4DQQ A;  1PCA A;  1RHM B;  1LFP A;  5HO4 A;  2IRU A;  1F3V A;  1VGY A;  2PD1 A;  2CRL A;  3LAN A;  1GTH A;  1ZA1 B;  1R27 B;  3UVJ B;  1QDU B;  2W7P A;  1VQK S;  2XMV A;  2HUR A;  3HD1 A;  4GMK A;  2RRN A;  2X3D A;  3HO1 A;  3OUY B;  4X64 F;  2ACY A;  4B3S J;  3BGF A;  5F8M A;  1VJQ A;  1NDP A;  2AEM A;  5FD1 A;  4Z2X A;  5KOX A;  1Z2Z A;  4Q0B A;  5KOW A;  5CAB A;  4CIO A;  2A6M A;  2DRA A;  1I51 B;  1KNZ A;  2EC0 A;  4OJ1 A;  3PRB A;  4DN9 A;  5A8K A;  4B3S F;  1RWW B;  2JVO A;  5J1E A;  2AYG A;  2YWF A;  4DJB A;  3FVY A;  2O67 A;  4JI4 J;  4PYD A;  4WPA A;  3NMR A;  1Q4R A;  4ZLP A;  5E5N A;  3RAQ A;  1VC5 A;  1HFE L;  1SH0 A;  5KT6 A;  1X5S A;  2QFI A;  4GO5 X;  1LXJ A;  3SSR A;  2DXD A;  3D3C J;  2ZUA A;  2W2Q P;  2DXE A;  4DU8 A;  2DT9 A;  3DHW C;  4LRE A;  2OSQ A;  1P1L A;  4MJK A;  3MEE A;  3GE9 A;  4Z37 A;  2F8M A;  3MM7 B;  2ILZ A;  3PV8 A;  3RUB L;  1U1L A;  2Q3P A;  2EG2 A;  3BBF A;  3M1V B;  1SL0 A;  1RHK B;  5D3G B;  3FBB A;  3J7Z 5;  2ZD1 B;  4U95 A;  1X5T A;  2OPR A;  3MMA A;  4JI4 F;  5IQ6 A;  3JSY A;  3D0H E;  4M5J A;  2VBW A;  1S9F A;  4DSE A;  3QRP A;  3FCW A;  2GS8 A;  1BXN A;  2HZC A;  1JLB A;  1FKO B;  1N0U A;  3QGP A;  2H3E B;  2GC8 A;  3DRS A;  3WC2 A;  4JI8 J;  2KZM A;  3QFW A;  3G96 A;  4DV2 J;  2XWX A;  1O8B A;  2UUW A;  2PEH A;  1SVD A;  1AA1 B;  2CQ3 A;  2IAJ B;  3PRV A;  4F4A A;  4IR1 A;  5G4D A;  1ZTW A;  1LWC B;  2AWZ A;  1RAF B;  2FJA B;  2WOM A;  5ETO A;  1B70 B;  4Z7Y A;  3R8Y A;  3B82 A;  1KRP A;  3DLG B;  4X62 J;  2UXC J;  4JI8 F;  3BKT A;  2GVD B;  1HBU A;  3TAM B;  2AZ3 A;  3VHQ A;  3EDQ B;  4DV2 F;  4KPC A;  1CQN A;  5CD4 A;  3T5J A;  3K17 A;  3CGI A;  3V6J A;  2OPS A;  3SIP B;  4P72 A;  1HBN B;  1U25 A;  3AD9 C;  5F8I A;  3BO2 A;  2DYA A;  3HZE A;  4R25 A;  1IM4 A;  3A8K A;  2FGO A;  1WEZ A;  4ENO A;  4G1P A;  3DLL Q;  4IH7 A;  1WOS A;  2ZZN A;  2I2Y A;  4DR2 J;  2VQF J;  3JQK A;  1YTY A;  4X62 F;  3H5X A;  2RNE A;  2CA9 A;  1RT5 B;  3UD4 P;  2IRY A;  2A3J A;  1YHQ S;  1FRX A;  4H4O B;  4QCL A;  2YNF A;  4YR3 A;  3H5S A;  1Q5V A;  1C1C B;  3HVT A;  3O1L A;  1L3V A;  4LR8 A;  3TI0 A;  1FNO A;  5DZ6 A;  4OJG A;  5HMX A;  2QYG A;  3W7B A;  3KJF B;  2R7T A;  1X4G A;  2XS2 A;  2RUS A;  3N28 A;  4OHV A;  3EWG A;  4OLP A;  3EE3 A;  2VDH A;  1SL1 A;  4B08 A;  4DV0 J;  4TU8 A;  3CCR S;  4ICL B;  4DR2 F;  1FJE B;  1KKH A;  2WVE A;  3BGR B;  4YDD B;  3FSX A;  5LT5 A;  4JI6 J;  2M4M A;  1SIZ A;  4PXB A;  1IJF B;  2MHN A;  3THP A;  3BBB A;  2QLB B;  1VHF A;  4YEA A;  1MMN A;  1UCN A;  3OFE A;  5I42 A;  2R2S A;  1IBK J;  4DR5 J;  3VAJ A;  2G1H A;  3PO4 A;  2DJW A;  4CNY A;  4DV0 F;  4YQW A;  4L6V 3;  4GKK J;  5KFR A;  2HFO A;  5T7L B;  2R8H A;  2GA7 A;  2I38 A;  2W2O P;  5J2P A;  3BF4 A;  5FDL B;  3PM9 A;  3QJJ A;  3OXF A;  4OHW A;  2YKA A;  3W9I A;  1PG5 B;  4RZR A;  1S99 A;  3OTB A;  3BS9 A;  4GO7 X;  4CRJ A;  3M32 A;  5J2Q B;  2XMJ A;  4ED4 A;  3PJ9 A;  2V4Q A;  5D8H B;  2ZC4 A;  3ZFV A;  3C19 A;  2V4R A;  5DLF A;  5KFI A;  4DR5 F;  4OJH A;  4XIU A;  1SUQ A;  4ECQ A;  3MR3 A;  4RNN A;  3QJL A;  3OXG A;  2FLP A;  2OMO A;  2Q43 A;  2MKI A;  1M5K C;  4GKK F;  4WII A;  3HVW A;  2ZH5 A;  4Q7A A;  1B0T A;  3DOM A;  2E1M C;  4LFC J;  1TKX B;  2OGU A;  4Y6I A;  5HMY A;  2BKP A;  5DJB A;  5F8L A;  3JXO A;  3PW4 A;  3BO4 A;  2D74 B;  2YBV A;  3TAN A;  4WFX A;  3TZW A;  2N3O A;  4UUW A;  4PQU B;  5C5J A;  1ACM B;  1FO1 A;  2VL1 A;  5KG6 A;  4WFA Q;  1WDD A;  4Y2M A;  4F50 A;  5HRO A;  3DN9 A;  1NHU A;  1KHW A;  2U2F A;  3U1L A;  3KLG B;  3GSD A;  2HQ3 A;  1X4B A;  3BRE A;  1K47 A;  5IT9 U;  3LAK A;  3QBC A;  4DL0 C;  1NJI T;  3SV3 A;  3L7O A;  3JTN A;  4LFC F;  2DEJ A;  5AXN A;  4LBI A;  3J80 U;  1LFW A;  3VWS A;  1NDC A;  2UVR A;  4ETX A;  2BKO A;  4RNF A;  4HHU A;  1KON A;  5F41 A;  2YX4 A;  3K5O A;  3FEY B;  4YDX A;  2X3G A;  3R6G B;  2RRA A;  4J9M A;  1TK0 A;  4ECU A;  1P8G A;  4WBF A;  4KFB B;  2BOP A;  3KLH B;  5A8W A;  4K4Z A;  5HMW A;  3KNG A;  4I56 A;  3GYX B;  4WTY A;  1R8P A;  3CD5 A;  5GMD A;  3OPK A;  1FDD A;  1S48 A;  4OZ2 A;  4BWM A;  3VAM A;  1FVS A;  4A4J A;  1U7L A;  4J90 A;  4KSE B;  4M5G A;  1R0C B;  3PR5 B;  1VHI A;  1VBK A;  3NAH A;  3OVS A;  1S0N A;  1IR1 A;  2AF6 A;  4DZD A;  5IXU A;  4ZCK A;  3ZZ0 A;  4BDP A;  4ATN A;  2CAJ A;  3I0R A;  4A8X A;  1N32 J;  1OJ4 A;  1J2V A;  3W65 A;  1UEK A;  1N48 A;  1ELO A;  5E0O A;  4CYU B;  2DNN A;  8AT1 B;  1N56 A;  1L3K A;  3MM5 B;  2R7W A;  2D3O R;  1N8R T;  1JLA A;  1UFW A;  4K0K J;  2Q66 A;  2MKK A;  2NZC A;  3KLF B;  2P9G A;  2K7K A;  2W7A A;  2G13 A;  4ZOS A;  3TO8 A;  1A7G E;  3HHD A;  3JSM A;  4ED8 A;  2BJ9 A;  1FRM A;  3GQC A;  3OVB A;  1L3S A;  3CWJ A;  2IA6 A;  1S4F A;  5GVQ A;  5I3U B;  3GR1 A;  7AT1 B;  1H7X A;  2B56 A;  4RW8 A;  4N8O A;  3HFZ B;  2RQ4 A;  2ACM A;  1HI1 A;  2AGP A;  3VVT A;  3K57 A;  5A8R A;  4K0K F;  4ECV A;  1EAY C;  2LQ8 A;  1NK8 A;  4ZVG A;  2AX0 A;  3R5B A;  1UP1 A;  1X60 A;  2JHE A;  2BZ2 A;  4DL3 A;  1SH2 A;  2GHW A;  1N4L A;  3PEJ A;  4LRA A;  4FF1 A;  2EC2 A;  3AA8 A;  4L3K A;  3Q8Y A;  2YKO A;  2VG6 A;  2CG8 A;  2AYE A;  2W2N P;  1RYS A;  4UQT A;  5MAO A;  4DR1 J;  1RBL A;  6AT1 B;  1QSS A;  1SJF A;  3GFZ A;  3K89 A;  1UTA A;  4USW A;  3I32 A;  1FJ7 A;  1EP4 B;  2DHS A;  2IIH A;  5IS2 A;  3E8O A;  2J76 E;  4O3R A;  1LK7 A;  3B54 A;  4RUC A;  3V4M A;  4JV2 A;  1X0F A;  4WWS A;  4PXE A;  3W66 A;  3ZTP A;  4GKJ J;  1WTB A;  3DC2 A;  2HG4 A;  3FCV A;  4YB5 A;  4IH5 A;  2W1B A;  5B0G A;  4O3Q A;  1IBC B;  1VIO A;  1KFS A;  3KJV B;  4A48 A;  2GJ2 A;  1FER A;  3HK2 A;  2LA6 A;  5K9F A;  3E3X A;  2AV5 A;  4DR1 F;  2QV6 A;  4ZVP B;  3LUY A;  3HP6 A;  4F4X A;  1HL6 A;  2BRL A;  2F63 A;  3W5Z A;  1H74 A;  1RA7 A;  1U0H B;  3TYT A;  3AB4 B;  1S6Q A;  4U6P A;  2NSC A;  3MEC A;  1YJ7 A;  3CPW R;  3TUP A;  4AQY F;  4TNO A;  4JI5 J;  2IM0 A;  2EW9 A;  1RT3 A;  3EGV A;  2XS5 A;  3H7H B;  3HX9 A;  4N47 A;  3OTO J;  4QOT A;  2QLX A;  4QQB A;  4ANE A;  4HDH A;  3KG4 A;  5C24 A;  5HK4 A;  5KT7 A;  2R7O A;  2YY3 A;  2KRR A;  4I6A A;  5H9E K;  1N5V A;  1PJ6 A;  2YNG B;  4JUZ A;  3HF5 A;  4WP8 A;  2RRB A;  3EYZ A;  4Q45 A;  4QW8 A;  2M52 A;  2V8G A;  4USU A;  1WDT A;  2CQ0 A;  2XGQ A;  2OPP A;  5EUH A;  5ETM A;  2JH3 A;  1LK5 A;  2FHK A;  2CAD A;  3TVZ A;  1LEO A;  4USJ C;  1NH8 A;  4F8R A;  2WCX A;  3PDN A;  2FGC A;  1RWO B;  3OTO F;  4RW6 A;  2ZVI A;  2ZBP A;  2ZM6 J;  2CG4 A;  3LPY A;  2E5I A;  3I31 A;  3NMA A;  3ZZO A;  1QVF R;  2XB2 D;  1CLF A;  2CYY A;  4DV4 J;  1S7I A;  3IRX B;  2B9X A;  4I68 A;  2BEF A;  2MKC A;  1Z2L A;  2CQ2 A;  4IDK B;  3MMB A;  3HD2 A;  1ICE B;  1R6V A;  3VZH A;  4KV8 B;  2IC3 A;  2GML A;  5KG3 A;  2RD5 C;  1NZA A;  5EX3 A;  4G65 A;  3SCK E;  3OR2 B;  3H4B A;  1U8S A;  2OSR A;  1RAD B;  4M5L A;  2ZM6 F;  4CLU A;  4EWT A;  2HQC A;  5L39 A;  4RNH A;  2DH8 A;  3J7A 1;  1M1G A;  2CDR B;  3MED B;  2R2U A;  3NOC A;  1UET A;  2JZ5 A;  4I1T A;  2MY7 A;  3SFU A;  1VIX A;  1E6V B;  1Y5I B;  2DBB A;  1CJK A;  1YJN S;  5E41 A;  2IFX A;  4PEO A;  1U4B A;  5BYR A;  1VJW A;  1BWV A;  2IMO A;  3SYZ A;  2B0G A;  4DQS A;  2OD4 A;  1ZAW A;  2P2C B;  1XWL A;  4DPT A;  5D6G A;  4F3M A;  1HBM B;  4NLX A;  4MKV A;  4RBU A;  1IUJ A;  4O44 B;  3MUT P;  4DN0 A;  1HI8 A;  2G4B A;  2HVH A;  2CJ9 A;  2QX0 A;  5HJX A;  3D28 A;  3UR0 A;  3OHB A;  1VRT B;  1N54 B;  4ZDN A;  2GVZ B;  2DR8 A;  1X9S A;  1XNR J;  1XNQ J;  4DMZ A;  1HQE A;  3MI7 X;  1T3N A;  1XER A;  1N6Q B;  1RGV A;  2ZJR Q;  2FHO B;  5A2Q U;  2VV5 A;  2IA0 A;  3CJQ A;  3MM8 B;  4KGV B;  3W61 A;  4LF5 J;  2F5G A;  1S10 A;  2KRB A;  2DKO B;  3HM9 A;  2K1R B;  3IG1 A;  4YUD A;  4CTA B;  4J9Q A;  2NSB A;  3CC7 S;  1R89 A;  4CLT A;  3VTI A;  3KJN B;  3RTV A;  3C15 A;  3Q23 A;  3V6K A;  1T7P A;  4ILM A;  2D69 A;  4MKY A;  1GXU A;  1XNR F;  1XNQ F;  4YME A;  2B9W A;  2N3L A;  2B6A A;  5HBM A;  1TK5 A;  1A0O B;  4ID8 A;  4PR6 A;  4LF5 F;  2HW3 A;  4L74 A;  3CCQ S;  2F65 A;  3D6H B;  1UA0 A;  5A6W A;  2PSZ A;  1UL3 A;  3CCU S;  4FKX A;  3FQL A;  1Y5N B;  2HMI A;  3UD3 P;  2HRT A;  3B6B A;  2RIJ A;  3PIP Q;  5HP1 B;  1C2P A;  2EKN A;  4DSL A;  2H65 B;  3TW0 A;  4QU7 A;  3IGN A;  3C6T A;  4F4Z A;  3KK3 A;  2M8H A;  4LF8 J;  1HPZ B;  2FHM A;  2BJ1 A;  1HNZ J;  2CQ4 A;  1K44 A;  3D67 A;  1TV6 A;  1M1K T;  4NYO A;  1Z1Z A;  2DY9 A;  4ZN1 A;  4O4R A;  1UZH A;  4BHQ A;  4Y2I A;  3TP2 A;  2HS4 A;  3MM9 B;  5IM0 B;  2DB1 A;  1AUS L;  2E44 A;  3ZTQ A;  2UP1 A;  4R5P A;  4PRF A;  5B09 A;  2FLO A;  1N5T A;  4CCH A;  4WJB A;  5D0H A;  4C8Z A;  1FDN A;  2FC8 A;  4KH1 B;  1JLF B;  4MFB B;  5AXK A;  1CG2 A;  1Q7L B;  4QPT A;  3MD3 A;  1M5S A;  1JXE A;  3LGH A;  3TEH B;  4FN5 A;  5IC6 B;  1F9E B;  4HR2 A;  1FFG B;  2MQN A;  1DAX A;  3AJ1 A;  3RBX A;  1S9G A;  2MST A;  5G0R A;  3RRK A;  1PSD A;  2E1P A;  1EX8 A;  3CIZ A;  1JJ2 R;  2I9S A;  3W9H A;  3I0R B;  4JI2 J;  3NNA A;  3ZTO A;  4Z7C A;  2WB1 D;  1QUV A;  3IBC B;  2NRE A;  5L9X A;  3DLK A;  1DRZ A;  1KR4 A;  1WUU A;  4KJI A;  5KAK A;  4BC9 A;  4DV6 J;  2C1E B;  4OZ0 A;  1T94 A;  1TP7 A;  4Y2A A;  5CQG A;  2N4D A;  2RDD A;  4C8K A;  4EK2 A;  4PQA A;  4PAA A;  3QO9 B;  1YJT A;  1PIE A;  4YB6 A;  2MZJ A;  1D3W A;  2FVC A;  3ET6 A;  4TY8 B;  4JP8 A;  4C8N A;  1URN A;  4I6Y A;  1NHK L;  2OHD A;  4TU7 A;  3NGD A;  1NK6 A;  1YK9 A;  2OPQ A;  4JI2 F;  2RQC A;  2BAN A;  3Q22 A;  2B51 A;  1DLO B;  4WXO A;  3I0S B;  1EIY B;  3RW6 A;  4F25 A;  2XBP A;  3R7S B;  2J9D E;  3G8S A;  4DV6 F;  2YNH B;  1JXL A;  1V5I B;  4GRS A;  4C0H A;  3PIO Q;  4C8Y A;  2QLW A;  3H4D A;  2HK2 A;  1RZM A;  3IAM 9;  2QN6 B;  4J9O A;  3VAI A;  4LQ3 A;  3J81 U;  4NLU A;  2GGP A;  4DSI A;  1HNV A;  2ZJP Q;  4AFF A;  2DNO A;  1RAO A;  1S9E B;  5B0E A;  1FT8 A;  1QAX A;  3M8Q B;  3PW7 A;  4NI2 A;  2QA4 G;  3W60 A;  3IBW A;  3P45 B;  1M90 T;  4TVA B;  5L8R C;  4CT8 A;  4OI3 A;  3RJM B;  1SC3 B;  2OEM A;  2XZW A;  1PYS B;  2HNZ B;  3CD6 S;  2MQO A;  3CJK A;  1TEL A;  2KXN B;  2JC1 A;  4K4S A;  3BZQ A;  4FXW A;  3H5U A;  3PW0 A;  2XMM A;  3C3L A;  1VC0 A;  5JMN A;  2C2D A;  3SSQ A;  5CH7 B;  4MH8 A;  1U8W A;  2K3K A;  3PW5 A;  4O3S A;  4CH1 A;  3JTP A;  4C48 A;  1P9Y A;  2XGP A;  3P5T L;  2HHU A;  1YGY A;  4NE9 C;  3G9C A;  3R5C A;  3W2W A;  3MM6 B;  3DKD A;  3KLE A;  2AU0 A;  1YSJ A;  1HAR A;  3D9B A;  2GNK A;  2UUB J;  1FX4 A;  3JAM U;  3OLB A;  3K5L A;  3L3C A;  4RW4 A;  1LWF A;  3KDO A;  3I5C A;  1RUS A;  5F8J A;  4C3K A;  2JFD A;  3MMC A;  1M1H A;  4I7F B;  4UW2 A;  4F3Q A;  1ZZF A;  4LSL B;  2YXL A;  1ZAV A;  2YKQ A;  5LL6 d;  2FHJ D;  4J7C A;  1TKT A;  3CDW A;  4DR3 J;  3HJV A;  1D9A A;  2FPH X;  5C25 B;  3A3N B;  1KBR A;  3RB6 A;  3HDS A;  1RU2 A;  2ZH3 A;  4ZIT A;  5EWE A;  3DLH A;  2EPI A;  2VG5 B;  4PXC A;  3GPA A;  2VG7 B;  2ZHB A;  3MCM A;  2UUB F;  3MUV P;  4N5S A;  1RWU A;  2RE1 A;  3HT3 A;  2FY1 A;  4DS5 A;  3CUN A;  2IM3 A;  3SFG A;  2UV8 A;  1NK0 A;  3JTO A;  4EMD A;  2GQ2 A;  4LIR A;  3V4I A;  1TUW A;  2C3Y A;  4HDG A;  2RSQ A;  3RR8 A;  1IBM J;  1WAC A;  1VR6 A;  5ETK A;  4AL5 A;  4C11 A;  3HT0 A;  3GIK A;  4DFK A;  3CE8 A;  3OJS A;  4K2X A;  1SXL A;  3VAF A;  1R43 A;  4JV1 A;  3CDB A;  1RT1 B;  4KIA A;  2RKI B;  3I4H X;  3DRR A;  2QYC A;  2FZK B;  3CW2 C;  1YG0 A;  1JLC B;  1OO0 B;  2PMW A;  1IWA A;  4EYI B;  4A8O A;  2FVS A;  4QR1 A;  3L4B C;  1XIQ A;  1JB0 C;  1T3O A;  3X1L B;  3RG6 A;  3AOD A;  2HFS A;  1S4E A;  2RAQ A;  1L3T A;  4DFJ A;  3NGS A;  3LP2 B;  4NAS A;  3M6U A;  1VQN S;  3NS7 B;  1PYT A;  4KO0 A;  1HYS A;  2W4P A;  2D9O A;  1JKH B;  2HFU A;  1U2F A;  1CJK B;  3GSI A;  1EKS A;  1Q5Y A;  2EFO A;  1PO6 A;  1TVR A;  4K7Q A;  1NK4 A;  5IZH A;  4BWJ A;  2G0C A;  1U1Q A;  2KDO A;  1RHU B;  2LXI A;  1CJU B;  3WDO A;  2VOD A;  3FFI B;  3TZY A;  4LBH A;  2MJN A;  1TKZ A;  3TRG A;  4K5R A;  2H1Y A;  3N6L A;  3ONQ A;  5J2N A;  2LCW A;  2KO1 A;  1Y00 A;  3DRX A;  4C3M A;  2F3J A;  1N5Y A;  2WZ1 A;  5HQ8 A;  4KKO A;  1CJV B;  1KLM B;  4CQ1 A;  2WK4 A;  1DBD A;  4DS4 A;  1MWQ A;  2WW8 A;  1RAG B;  1F0X A;  2Y8Y A;  1BQM B;  3H5Y A;  4ZIW A;  4KH0 B;  3FK4 A;  4Y00 A;  2LP4 A;  1R8B A;  1GX5 A;  2FD2 A;  4DX8 H;  1VCT A;  2UZA A;  2U1A A;  2MGZ B;  4O4G A;  2GAH C;  4ID5 A;  1DUR A;  4KTQ A;  3MD1 A;  1NME B;  2HHW A;  3A3O B;  5KG1 A;  2BJD A;  3NGT A;  1TR0 A;  4YY3 J;  2AD9 A;  1C1B A;  1H2U X;  2GZO A;  4X65 J;  1ZET A;  3R2D J;  3M30 B;  1P27 B;  4U96 A;  2HVD A;  3NOG A;  4EO6 A;  2NUH A;  2DTJ A;  2Q79 A;  4JOU A;  4M5H A;  5HSP A;  5KG0 A;  2HZA A;  2O66 A;  1X5O A;  1YX2 A;  4KRW A;  3MR5 A;  3BO3 A;  2Y0S D;  1WOR A;  2FYX A;  3FRY A;  4KHR A;  2QA2 A;  3OFH A;  3BM7 A;  2VC1 A;  3CJ3 A;  3OD2 A;  4HTJ A;  4ECZ A;  1FJC A;  1NSK L;  2ILY A;  3ZNU A;  1GMV A;  4YY3 F;  4RR5 A;  1NCL A;  1FHT A;  4IR9 A;  2J5A A;  4ZPC A;  4X65 F;  3GJS B;  3C16 A;  1RTD A;  2YH0 A;  2BW7 A;  3DRP B;  4ZHR B;  3Q8Q B;  3KHR A;  2KKH A;  4MIW A;  4NOH A;  1FWK A;  2KG1 A;  2AIR B;  4IFV B;  1OYD A;  4OZJ A;  2FJX A;  2CZ4 A;  1MU2 B;  5KT2 A;  4DFM A;  3J7Y U;  5AXL A;  4ZVT B;  3D1H A;  1IKW B;  3OR1 A;  1R7I A;  4KBI A;  4N8N A;  4Q2M A;  4HH0 A;  3PYF A;  3BPS P;  1LNQ A;  5L1L A;  1SBR A;  4ECT A;  2K7J A;  1S9G B;  2C3M A;  3GR0 A;  4ZVU B;  1RAC B;  1S1X B;  2D3O 1;  2RQK A;  4WE1 B;  1VBX A;  1T05 B;  1AB8 A;  1DTT A;  3VAG A;  3M6W A;  2I5J B;  2BMB A;  4EBC A;  1KTV A;  3CCV S;  3RRH A;  2CIM A;  1JJ4 A;  2NXU A;  1S1W B;  2X1F A;  4MTP A;  1VK3 A;  2IM1 A;  3BN7 A;  2V6A A;  4AE5 A;  3MEG A;  3UN3 A;  4DUY J;  3KYL A;  1RSC A;  2XMW A;  2COL A;  1UJ5 A;  3ET6 B;  4DFP A;  2VB6 A;  1ROF A;  1Q8B A;  2JVR A;  2PC6 A;  3ZO7 A;  2KXH A;  1YIT S;  3E01 A;  5K8O A;  1T0T V;  5KFG A;  2ADC A;  4OJ3 A;  3HHK A;  4FDF A;  1KQK A;  2M2B A;  3UDC A;  4RLE A;  3P6Y C;  1WEY A;  4DUY F;  5KFN A;  2HZV A;  3KJQ B;  1NM2 A;  1U6Z A;  3MAH A;  3QGH A;  2BX6 A;  1NKB A;  1JLQ A;  4WIQ A;  1FE4 A;  2CPJ A;  1YBT A;  1WWH A;  4P2F A;  3BQ2 A;  3BJY A;  4CM0 A;  3D5M A;  2CVE A;  2MZQ A;  4F3O A;  2GHP A;  4IQM A;  2ZOG A;  3BGO P;  5IQQ A;  5LJ5 Y;  4DR7 J;  2KT2 A;  3QQC D;  2LEP A;  4BBY A;  1U1O A;  3MAA A;  1JIH A;  2V4J A;  1U02 A;  1WC4 A;  4Y2C A;  3THV A;  2HQI A;  2ZJQ Q;  3A3P B;  1X5P A;  2R8K A;  4K4Y A;  1FEH A;  1RAB B;  3CVK A;  4OZL A;  4WYL A;  4ZJL A;  3PFO A;  2CPD A;  5K14 A;  2ZIT A;  1Y11 A;  1WSV A;  2DNP A;  3VVU A;  3NGU A;  2BJE A;  1JJH A;  1C0T A;  1S5Z A;  3LW5 C;  3DLE A;  5E2Q A;  3DYA A;  1NHV A;  4DR7 F;  3CC4 S;  3W62 A;  3WQP A;  1KC8 T;  1FJG J;  1S79 A;  1GAO A;  3PTW A;  2ABY A;  3UDL A;  3BEG B;  3GB0 A;  4WK1 A;  5LMN J;  1UPM B;  3QRR A;  3P5B P;  2MKH A;  4YS2 A;  3DM2 B;  1D1U A;  3CCW A;  2VOP A;  1HWL A;  4TLQ A;  4JV0 A;  1UVK A;  5CCL A;  1HI0 P;  2VFR A;  2ATL A;  1T9X A;  2V69 A;  4IUF A;  3SCJ E;  1Q0N A;  3SQG A;  3AH6 A;  2GW8 A;  1CC7 A;  1MG7 A;  1NLK L;  1AZS B;  4F0M A;  5HLF B;  3CMA S;  1CUL A;  3KHL A;  2QL7 B;  1QY7 A;  1SJ1 A;  4G1Q A;  4X2B A;  2JEF A;  3TA1 A;  1RT6 A;  5EDW A;  1FJG F;  2HAI A;  4IQX A;  2FHJ A;  5GAD U;  5LMN F;  5DGB A;  3FGV A;  1SCJ B;  2X7I A;  1D0E A;  1B7F A;  3KK2 B;  1Q8I A;  1UFL A;  2DNK A;  1WI6 A;  5E3Q A;  2V2K A;  3IWL A;  1KSP A;  5KFV A;  3M7V A;  5CD4 H;  2QTW A;  5KFU A;  2YNI A;  4I4B A;  1FI4 A;  2KN4 A;  5F3T A;  3BH6 B;  3O44 A;  2W2M P;  3HHL D;  4IG0 A;  2E5J A;  2XO7 A;  1VBY A;  1W2I A;  3G82 B;  4UOC A;  3MZI A;  4C9D A;  1SI9 A;  4KGX B;  3KK1 A;  5J2M A;  1RTH B;  1K1S A;  2QLF B;  2UUA J;  1IKV A;  2B5J A;  1JLG B;  3FQK A;  2XZT B;  4B02 A;  2W24 A;  3D54 A;  4ELU A;  2BE2 A;  3K5P A;  2KFZ A;  1E6Y B;  2KZZ A;  3EXC X;  1WG5 A;  4D3H A;  2HIY A;  2W4D A;  4TYA A;  2QSW A;  4N77 A;  2XSF A;  5D4N A;  2C2O B;  1T9W A;  2EXU A;  2DIT A;  1JLE A;  3TA0 A;  2AW0 A;  2CKW A;  2HGM A;  4ETZ A;  3EZO A;  4I69 A;  4UZB A;  4BC7 A;  3RW7 A;  2UUA F;  1YBU A;  5E33 A;  4YN3 B;  3HVA A;  1SV5 B;  3OFG A;  4NXM J;  5L9N A;  1WSR A;  4Y65 A;  2YPZ A;  1A6L A;  4R8U B;  5KFK A;  2AT1 B;  1N34 F;  4F4K A;  4FS1 A;  5HL7 Q;  2ZWP A;  1SQG A;  3Q2S C;  2VOO A;  1BC6 A;  2ZE2 A;  3U27 A;  3QIP B;  1DJ0 A;  2J8S A;  4ZS6 A;  5KFB A;  1P6T A;  4NLP A;  4ZP9 A;  1VS3 A;  4A8Y A;  2LFV A;  1D9F A;  3DMJ B;  4FF2 A;  1EB0 A;  2QC3 A;  3NXZ A;  3C14 A;  4HVZ A;  4UOH A;  3DGV A;  3JB9 k;  1T02 A;  3TJ8 A;  3QAT A;  1XC9 A;  2IM2 A;  4PUO B;  1VQ6 S;  4NZ6 A;  4NXM F;  3CMQ A;  2JOQ A;  1RB0 A;  4GVB B;  9RUB A;  2E9Z A;  5I4M A;  1WG1 A;  1REV A;  3MR6 A;  3POT B;  5H9F K;  3RBD A;  1Y5L B;  3H2V E;  4X4S A;  4M94 A;  4C0B A;  1RCX B;  5EX0 A;  3HHL B;  5H9E J;  1TL4 A;  3W2V B;  1AUD A;  4L72 B;  2ASL A;  2CJQ A;  2B8P A;  2UU9 J;  3KMQ A;  4F0H A;  2W4C A;  2OTL S;  3TJ9 A;  2XYH B;  2CQD A;  4G6V B;  2I0X A;  5D0E A;  4NLW A;  5U47 A;  1VDH A;  4HTI A;  4CO1 A;  2LA4 A;  2A0F B;  3I5B A;  1S1V A;  4RW7 B;  4PWD A;  3ENV A;  1H2V Z;  2CFX A;  2JLF A;  1MN7 A;  2MQP A;  1XR6 A;  2HNY A;  3V6D A;  1MMD A;  4TLR A;  2PII A;  1IJE B;  3M2U B;  1F5B A;  4RL1 A;  2E1R A;  4AXJ A;  2HBQ B;  2Z4P A;  2C3U A;  1J27 A;  3FBE A;  4B3O A;  4C7Q A;  2X1A A;  1TFY A;  2KJV A;  1CS4 A;  2UU9 F;  1ZM2 A;  3UN2 A;  2CQI A;  3EIC A;  1W25 A;  3C66 A;  3FRZ A;  3DDN A;  3ZTR A;  4KHP J;  1SKU B;  2XY5 A;  2V50 A;  2MPU A;  3CUL A;  2E29 A;  2ASD A;  1S77 D;  1HQU B;  3IS9 A;  1NJY A;  3G8Q A;  3LGN A;  5HI7 A;  2BKN A;  1VRU A;  3SDE A;  4LVN P;  4OYZ A;  3I6P A;  5LOQ A;  4FF3 A;  1VQ5 S;  3VV2 B;  4I2P A;  4DX5 A;  2Z57 B;  1FTC A;  3LO3 A;  1Q8L A;  5DQG A;  1QSL A;  1G4C A;  3NCP A;  1LOU A;  4F7V A;  4L76 A;  3RYL A;  5DDO C;  3MTJ A;  2J8A A;  1S6P A;  1DTT B;  3VGS A;  5H1S V;  5C2G A;  2BV3 A;  3DXS X;  2VBX A;  3KLV A;  2H4W B;  1MWZ A;  3DOK A;  1OWX A;  1S6O A;  3I96 A;  5E3R A;  1HMV B;  2GQC A;  2FJV A;  2AJF E;  1S76 D;  3QT7 A;  5T41 A;  3Q89 A;  4O23 A;  1IN0 A;  1S59 A;  1RKI A;  2BJ8 A;  3D68 A;  4HKQ A;  3CD7 A;  4CO4 A;  5E7O B;  4ER8 A;  3D7S B;  1R8C A;  1V9O A;  1S57 A;  4Y34 A;  2HQD A;  1H73 A;  1X9M A;  4AD6 A;  4OI1 A;  4RUA A;  3F56 A;  4ZMM A;  4HEA 9;  2XY7 A;  4DSJ A;  2LEC A;  2MQM A;  1PBU A;  3B8H A;  4MKA A;  5DQI A;  5IT4 A;  3HJF A;  5DG7 A;  4YB1 P;  3QLH A;  2N7C A;  4X4R A;  2KXF A;  2LQJ A;  3N0V A;  2MZ1 A;  1Y3K A;  4IOA Q;  3N9U C;  1CJT B;  1RT7 B;  4QYZ K;  4OYP A;  1LV5 A;  2LQB A;  4AL6 A;  1T9U A;  3I87 A;  2B7C B;  3AQP A;  2DRB A;  2R4F A;  2YX1 A;  3LGM A;  2HQG A;  3J7Y I;  3CTR A;  1QE1 A;  3NS6 A;  4RX6 A;  3T6J A;  4MK8 A;  2BQR A;  3AJ2 A;  4ZP6 A;  2CVI A;  3HSG A;  1VQS A;  4NLR A;  5A76 A;  3HFV A;  3RU0 A;  4Q2L A;  3BQ0 A;  4CLK A;  3HSD A;  2NS1 B;  3H2L A;  4NL5 A;  1V5V A;  3FUY A;  2OML A;  4HT7 A;  4YOE A;  3ITH A;  4QWC A;  3QZ7 A;  1VQL S;  1YIJ S;  1RTI B;  1JNZ B;  4NYZ A;  3QT6 A;  1U1P A;  4ZLN A;  4NZ7 A;  2WBR A;  5ETT A;  1PAE X;  3GV5 B;  2VH7 A;  2E7V A;  2M5Y A;  2B3T B;  3TX0 A;  2RDI A;  2HEK A;  4LF2 A;  1H6K X;  2QLJ B;  3RBZ A;  3ZXW A;  1KFD A;  1UJ6 A;  4CLZ A;  2AGO A;  1IWG A;  2W9B B;  4IO9 Q;  3ZNJ 1;  3MFH A;  4K50 A;  4K5S A;  3DU6 A;  1LWE B;  2K8G A;  3IP0 A;  3UNG C;  5HMZ A;  4J9U E;  4QIE A;  3G87 A;  3C8Y A;  2F8H A;  3MCO A;  1SL2 A;  1IR2 A;  3HCX A;  1FXL A;  1SJ4 P;  3FZB A;  3FNN A;  3NS5 A;  3LP1 B;  4E98 A;  3M2R B;  3K5M A;  3M8R A;  4A8S A;  4CZC A;  4U7C A;  2A1B A;  2JNJ A;  4LF1 A;  2R7Q A;  1WJ9 A;  4Q43 A;  4WK3 A;  3K8V A;  3ZZT A;  4N56 A;  4WKY A;  1G6B A;  2YKM B;  3FMB A;  1IKY B;  2B4O A;  2HLT A;  4FYW B;  1RYR A;  2WAQ D;  5AE2 A;  2ZBC A;  3DI6 A;  3UWT A;  5KFY A;  4PWU A;  2XMK A;  2RF2 A;  5KG2 A;  1QAY A;  2JEJ A;  2BVZ A;  1NO8 A;  1U24 A;  4URQ U;  5E3C A;  1BWE A;  1EET A;  1B0P A;  1HW8 A;  1X4F A;  4DHV A;  2Z2Z A;  4ED0 A;  1RT4 A;  1SIW B;  4H4M A;  1NBE B;  3M6X A;  3IC1 A;  3KLI A;  2E5L J;  3EVM A;  3KUG A;  1WKJ A;  2VJU A;  4DF4 A;  1MWY A;  3ICL A;  4KY3 A;  2ZOM A;  3UE2 A;  1S49 A;  4RW9 A;  1TL1 A;  5FLX U;  2YX7 A;  2QG9 B;  1TZ0 A;  2LDI A;  2FVR A;  3LWL A;  1RTJ A;  1LW0 B;  4OLO A;  4ZVS B;  3SMZ A;  4WU2 A;  3B4M A;  2D1C A;  4NRT A;  2ZH1 A;  1RT2 A;  1VI7 A;  2XWY A;  1QLN A;  4WZQ A;  1HBO B;  1ARO P;  1L3U A;  5BYQ A;  4DX7 A;  2XI3 A;  1U26 A;  1KWM A;  1WKK A;  2E5L F;  2ZKU A;  2IBK A;  5JJB A;  4FPI A;  5IFM A;  1KVJ A;  2OI2 A;  4IH6 A;  3VGV A;  1TL7 A;  3JSB A;  4A8K A;  4J91 A;  1F9F A;  3CJ5 A;  2BE9 B;  1FK9 B;  1GNK A;  3IN5 A;  3L7P A;  3N4W A;  2WSC C;  3TR5 A;  5BYS A;  4PG8 A;  4LSN B;  4DPU A;  4FVC A;  4A8W A;  3TAR A;  3HXM A;  1U1K A;  2H4Y B;  4LF4 J;  4Y3C A;  2AKW B;  4NCG B;  2DD8 S;  1HR0 J;  3W1Y C;  4QWE A;  4UY8 5;  3GU0 A;  4QWD A;  5GAD I;  2QGF B;  3N5F A;  4DEZ A;  1YJV A;  4BLG A;  2IVY A;  1HHS A;  1ZM3 A;  2G2Y A;  3G2X A;  3CC2 S;  4USM A;  4IFY A;  3UCZ P;  3MXH P;  2LQ9 A;  4IG3 A;  3M2V B;  2MMY A;  1T03 B;  1C4C A;  2AJ4 A;  3UDE A;  1XMQ J;  1RDR A;  3NL0 A;  2G2O A;  4C6A A;  2MLZ A;  1GMW D;  4Q8F A;  4I6W A;  3Q86 A;  2Y1R I;  5DGA A;  3A8J A;  1P9Q C;  2QMX A;  3V81 A;  1RHR B;  4LF4 F;  4K2J A;  3G6X A;  4PKD B;  4HT5 A;  5A0Y A;  1HR0 F;  4H4K C;  4FXV A;  2VUG A;  3AQO A;  3QGI A;  3CJT A;  1S1T A;  1WOO A;  2DNZ A;  1NK5 A;  3LAL A;  2HWH A;  1FD8 A;  4FYD A;  5ETN A;  1UPP A;  4I2Q A;  1EHW A;  2M70 A;  1XMQ F;  3IXQ A;  3NBP A;  3CDA A;  3DRY A;  3DOL A;  2EFG A;  2ZBI A;  5L38 A;  5DS7 A;  4P2X A;  5IT9 Y;  3I9Z A;  3T6B A;  2J7K A;  3MPU B;  4E2F B;  2NPF A;  1GMU A;  3JYT B;  3I82 A;  2EFV A;  5DM7 Q;  4X4P A;  2YKN B;  1YWX A;  1FRH A;  4EBD A;  2WHO A;  3J80 Y;  4W4M A;  3M8P B;  1C0U B;  4OHX A;  2UUT A;  3Q8P B;  2CNO B;  4XO0 A;  1HNI B;  3KOA A;  2FIU A;  5CYQ A;  3ADA C;  4NZ0 A;  1UJ4 A;  4OI2 A;  4CM2 A;  1R0A B;  2G0I A;  9ATC B;  1Y9O A;  2HVZ A;  2H51 B;  5F8G A;  1NU4 A;  2DIS A;  3BDP A;  1XK8 A;  2LXF A;  4QIF A;  3GCW P;  2PEB A;  2XCP A;  2UXC F;  1NSP A;  3RB4 A;  2ASY A;  2GIQ A;  2AX1 A;  2Z58 B;  1T11 A;  4G1I A;  4M5D A;  3LP0 B;  3UCG A;  2XHW A;  2K06 A;  2YQ0 A;  5ETS A;  3ELH A;  1FF2 A;  1NPR A;  2ZDO A;  1D9D A;  2XI2 A;  1M0S A;  1A9N B;  5M2P A;  4B9S A;  2QJ3 A;  2EBE A;  4L75 A;  2W9C B;  2V0N A;  2RU3 A;  1PJ7 A;  2PA8 D;  3SXL A;  2VQF F;  4U9R A;  3C6U B;  1H72 C;  4PXD A;  2LEA A;  2RS2 A;  2ZBQ A;  5DG8 A;  2EG1 A;  1N5S A;  3J7A N;  3W8G A;  4LUB A;  3ILL A;  1WD6 A;  4OYX A;  1NKC A;  4L73 A;  1TK8 A;  2WON B;  1SC6 A;  3B78 A;  8ATC B;  3H98 A;  5CYM B;  5KFF A;  2G1D A;  4HAC A;  4MK7 A;  1JWW A;  1X8D A;  3BR9 A;  1S1U A;  4EYH B;  1U09 A;  4RU9 A;  2XMU A;  2K3I A;  4DG1 B;  3AD7 C;  4ECX A;  2BAB A;  4ZLJ A;  2FJW A;  3GIR A;  2EKY A;  3QPI A;  2ERR A;  2DNH A;  5C42 B;  1R3N A;  3PKY A;  4DL2 A;  4YR0 A;  3CJ8 A;  5DET A;  5B0D A;  2AJ0 A;  4JI6 F;  2QT7 A;  1VFJ A;  1XJW B;  1K73 T;  2DNG A;  3D1O A;  2XEX A;  4ZKA A;  2ZBR A;  2ZZT A;  1LW2 A;  3VGT A;  1BQN A;  3TOQ A;  1UVM A;  2HHX A;  4P6Q A;  2A18 A;  2GQQ A;  3NCR A;  4ZP7 A;  1FDB A;  2B43 A;  2YQ3 A;  4ZP8 A;  4YFU A;  4ZPW R;  1IBK F;  1ZPW X;  3DGP A;  1Y10 A;  1DTQ B;  1FTR A;  3OL6 A;  4PG4 A;  3FJ2 A;  3MCN A;  3PJW A;  4EU0 A;  2SXL A;  4PWW A;  4PPZ A;  3AB2 B;  2XLK A;  1B4S A;  2ALZ A;  5JXS A;  3UVJ A;  5KFD A;  1WG4 A;  3D2W A;  5B7W A;  1SQE A;  5LXY A;  1NB2 A;  3ITH B;  1U0S A;  3LTO A;  2PO4 A;  1TL3 B;  1Y7P A;  2HGL A;  2QMW A;  3BV8 A;  4M8L A;  4RPF A;  3OUY A;  1DQ8 A;  2ZH9 A;  1RAA B;  3UDV A;  2V68 A;  1MRO B;  3LAM A;  2V9K A;  3BPD A;  3PZP A;  3M9O B;  2ALY B;  1FFW B;  2VA3 A;  1NK7 A;  1AFI A;  1FKP B;  2KVQ E;  4NPO A;  3GFX A;  4ILR A;  3HSZ A;  1WC0 A;  3FZ2 A;  2ZC3 A;  4DL6 A;  2XLJ A;  3MPD A;  4CLS A;  1AW0 A;  2XSJ B;  2C3P A;  1F3F A;  3BGU A;  2ZZM A;  4S0M A;  1FVQ A;  3HZG A;  3CCL S;  4UTG A;  3O6Q A;  3GTY X;  1J5O B;  2PFD A;  1KQF B;  2GAG C;  1I1G A;  5KG7 A;  2XNR A;  1FES A;  3CSK A;  2FZC B;  3CCS S;  1WF2 A;  4UUX A;  3TEG A;  3TAQ A;  2ZH4 A;  2A2D A;  4LR7 A;  3NG8 A;  2M88 A;  3CDE A;  2VKZ G;  1HIY A;  3MM7 A;  1CC8 A;  2D3U A;  3DNC A;  4F4Y A;  2G9O A;  3SCI E;  1S0V A;  4I0W A;  4B9N A;  2EK1 A;  3M1V A;  5D3G A;  1IQZ A;  1JMT A;  2Z2Y B;  4DL4 A;  3OTC A;  1KOH A;  2ZD1 A;  4OX9 J;  1QUP A;  3NNC A;  4QIW D;  5DG9 A;  3QGG A;  4KT0 C;  3QYY A;  3K58 A;  3G8T A;  1IR0 A;  3RAX A;  4ZJQ A;  2ROG A;  1FKO A;  5KFX A;  4KGZ B;  2W8K A;  1VK8 A;  1NJZ A;  2QA4 S;  1HD0 A;  3GJR B;  1PBA A;  2IYG A;  1F2G A;  1LQ9 A;  1SJQ A;  3G71 S;  2CDQ A;  3I55 S;  1HWK A;  5KFA A;  4N76 A;  3M9N B;  4JYA J;  4Q0B B;  1N32 F;  3FMW A;  3OTE A;  1YJU A;  4OX9 F;  1GX6 A;  4CDI A;  3HUL A;  2IAJ A;  4K4W A;  2PMH A;  4G3I A;  3O5T B;  1O51 A;  2EK6 A;  2DGW A;  3IR5 B;  1LWC A;  1Q7Y T;  3AHP A;  3N6N A;  3UO0 A;  2CQH A;  4OYA A;  5A8K B;  1U1M A;  3QMQ A;  3PJX A;  3DLG A;  5F3Z A;  3OV7 A;  4DV5 J;  5J1E B;  2JLE A;  4A8F A;  2GVD A;  4UOF A;  3TAM A;  2FQQ B;  2XQC A;  1FDA A;  1Q53 A;  4PG6 A;  4JYA F;  2M9K A;  1HBN A;  1RAI B;  5CXT A;  2VFV A;  2V8H A;  3ETO A;  4ECS A;  2ZDP A;  4ES3 A;  4IRK A;  2CPF A;  3CCT A;  1ZPV A;  3MEE B;  1AXQ A;  4WP9 A;  2DO4 A;  2OD6 A;  4KAI A;  5D0R A;  4YHH J;  2JFK A;  2UV8 G;  4DLG A;  2I1R A;  4X4N A;  4DSK A;  3CJS A;  5A2Q Y;  1RT5 A;  4A8M P;  2C28 A;  4DCJ B;  3QNW B;  2VKR A;  4H4O A;  1AT1 B;  3PEH A;  4QYR A;  1REG X;  2OPR B;  1C1C A;  3MMA B;  1QTM A;  4ED2 A;  2E66 A;  2KHD A;  3M9M B;  4DDF A;  5D78 A;  2YWG A;  1JLB B;  4OI6 A;  3PHE A;  3LF0 A;  3VZI A;  2W2P P;  3SI8 A;  4FNI A;  2I8E A;  1OSD A;  2ZVS A;  1HWJ A;  2JDJ A;  2DNM A;  2F40 A;  3DRS B;  2VDI A;  4AYB D;  2DGU A;  4ICL A;  1NAQ A;  2VPX B;  4GKJ F;  3BGR A;  4YHH F;  3MDF A;  1ZM4 A;  2XUL A;  4ZPV R;  4B9M A;  2PI4 A;  3GMG A;  3H90 A;  2B4P A;  3ZTS A;  1HWI A;  5HQM A;  1JK9 B;  2OJ3 A;  4DU7 A;  2VON A;  4PG7 A;  3GCX P;  1CEZ A;  4ELT A;  4I64 A;  2HHP A;  4Y2K A;  1VQO S;  3QAU A;  1XR5 A;  2WOM B;  2J0X A;  2ZH6 A;  4FF4 A;  2V8D A;  4DV1 J;  3TUZ C;  4P74 A;  2PFF B;  2FTR A;  2WVC A;  3V6H A;  1G1X A;  1HBU B;  2RDJ A;  5KT5 A;  2PN6 A;  2RJZ A;  3LQV A;  4FYX B;  4DR4 J;  5T7L A;  4NEY A;  2OPS B;  5FDL A;  1NDL A;  4JI5 F;  4ZLL A;  3MR2 A;  2DRD A;  2BRK A;  2CPZ A;  4ZCL A;  2JC0 A;  4QJV A;  3MPW A;  5JVG Q;  1OY8 A;  5F9L A;  1UKU A;  1YRT A;  3KNA A;  3GFH A;  5J2Q A;  4DWI A;  5THW A;  4FPR A;  2EBG A;  4RO0 A;  1PKU A;  3T3F A;  2OO4 A;  5DM6 Q;  2CNL B;  4OYB A;  2RT3 A;  2X1B A;  2YNF B;  5J1N A;  5F0U A;  4DR4 F;  4YP3 A;  3HVT B;  1VYA A;  2CXE A;  1IKX A;  1TKX A;  3AJD A;  3AAW B;  4ED1 A;  4M5I A;  2DCU B;  4PQU A;  5IV3 A;  1UMJ A;  2MEW A;  4CLW A;  3AOB A;  2IVM A;  1S6U A;  4DV4 F;  2XY6 A;  1FE0 A;  3KLG A;  2J9D A;  2JEG A;  4LFA J;  4EGL A;  5CZX A;  4M95 A;  2DPI A;  3WIU A;  4F04 B;  4IRC A;  5EWF A;  1VQ9 S;  3E2E A;  4J9V A;  2F1F A;  5EHH A;  4WTO B;  4LRC A;  2VPZ B;  3QJP A;  2BBE A;  3K8W A;  4P75 A;  3UNY A;  5GME A;  5I42 B;  3NLC A;  1WKL A;  2DNR A;  4ZVQ B;  4NLD A;  4PPD A;  1UEV A;  4OI0 A;  3DXB A;  2LYV A;  4KFB A;  2B9Y A;  2NXJ A;  3KLH A;  1S0M A;  1NK9 A;  4LFA F;  4F4W A;  3BDE A;  2OFH X;  1NJW A;  5J2P B;  1N36 J;  3M8Y A;  4A46 A;  1Q86 T;  2NR0 A;  2HYI B;  2HHQ A;  2GHV C;  4QIV A;  5L1K A;  2W8L A;  2CQB A;  2FVQ A;  3M32 B;  3VR1 A;  2YVS A;  2NYH A;  4WZM A;  2NUU G;  2IYI A;  1SUQ B;  4V19 X;  2JSX A;  3J81 Y;  1T9V A;  4LRD A;  2IBO A;  2R8J A;  2ZNZ A;  5C2C A;  2R42 A;  4FXD A;  1VRQ C;  1BMQ B;  1RI7 A;  3DOM B;  4HL9 A;  1N36 F;  2DR7 A;  3S6E A;  3LWM A;  2O1P A;  4CYU A;  3U7J A;  2FB0 A;  4HLB A;  3T9Z A;  1I5O B;  3MM5 A;  4C8M A;  2FDN A;  4LF9 J;  3EXY A;  5HRO B;  4TY9 A;  2ZHA A;  3R27 A;  1ZBT A;  1NSA A;  2DNL A;  3ENW A;  3KLF A;  4XPE A;  1PAU B;  3KHG A;  5ADZ A;  3R5D A;  5K8M A;  2Z0G A;  3PKM A;  1B64 A;  5GAG U;  4OYW A;  4DQR A;  1NPK A;  2PA3 A;  2VFT A;  5BJR A;  7FDR A;  2QO3 A;  5I3U A;  4DV7 J;  2MY8 A;  3VQT A;  1S12 A;  1AYE A;  2QRR A;  3JAM Y;  3EGW B;  4LF9 F;  3R3T A;  4USK A;  1SC1 B;  2W01 A;  5KFT A;  2R7X A;  1CSJ A;  2F4F A;  1FRL A;  3BSN A;  3BR8 A;  5SZT A;  5A8W B;  3PCO B;  3IMQ J;  4N41 A;  3F41 A;  3KDN A;  2A2C A;  1N33 J;  5DDR C;  4WP3 A;  3WZ0 A;  2D3Z A;  2MHE A;  5L1I A;  2MQL A;  1SB6 A;  4LF8 F;  4GVL A;  2LXU A;  3QID A;  2Y3Y A;  5BR8 J;  4DV7 F;  1HNZ F;  2ZOF A;  5ETR A;  1EP4 A;  1YRX A;  2WRM A;  3H59 A;  3PYD A;  4QBU A;  3NEK A;  4MKB A;  4J9K A;  4OZ5 A;  2L08 A;  4NWB A;  5E3A A;  1N33 F;  4ED6 A;  1OMS A;  3GFY A;  1UVN A;  3KJV A;  4EO8 A;  4FS2 A;  4YB7 A;  2WB4 A;  3AXK A;  1NKE A;  4FVM A;  3ZZZ A;  1YJ9 S;  2V8V A;  2LKZ A;  1KOO A;  1RWX B;  5BR8 F;  4J5O A;  1JLA B;  3AT1 B;  4MYU A;  2BXJ A;  3OW2 R;  1TAU A;  1IBL J;  4P7V A;  4EFA C;  1U0H A;  1ZH5 A;  2DPJ A;  4URG A;  2BR0 A;  3HLU A;  2F4V J;  1IXK A;  2C2E A;  4RKU C;  2VZ9 A;  2B7B B;  2F9D A;  4M5N A;  3GII A;  4CLL A;  1FA0 A;  3JSM B;  4QYZ J;  2J7W A;  2MTL A;  3BN4 A;  5HVH A;  3TX8 A;  4RW8 B;  3TJA A;  1FRJ A;  1KVK A;  1Q16 B;  4NMX A;  2M7S A;  5DDP C;  5A8R B;  3TQE A;  2MDA A;  4X4Q A;  1UWA A;  4ZVO B;  4XDC A;  7FD1 A;  2YNG A;  1IBL F;  4C8L A;  2FJE B;  2F4V F;  4DX6 A;  1FX2 A;  2AMC B;  1FWL A;  3QWU A;  2FVP A;  2VG6 B;  5IC4 B;  1I3O B;  3R5G A;  3DDK A;  1HQ2 A;  1GEH A;  2PGC A;  5FJ4 A;  2UVW A;  4J9L A;  3E51 A;  3IRX A;  1QAI A;  4IRD A;  2MQQ A;  1FXD A;  2W9A A;  3O2I A;  3JSR A;  3D0G E;  4IDK A;  3V5R A;  2BYC A;  4KV8 A;  1VQP S;  2HRU A;  1SC4 B;  4JI1 J;  1WEX A;  5AJ3 J;  3OR2 A;  3CD0 A;  4P10 A;  4B9T A;  2EFQ A;  1XR7 A;  3KTQ A;  2MKJ A;  1H2T Z;  3AD8 C;  3BQ1 A;  5AT1 B;  3GIM A;  4LMZ A;  3R97 A;  1YJR A;  2QIF A;  1KD1 T;  3GG0 A;  1GTE A;  3KHH A;  3BKF A;  2J9C A;  5IV4 A;  3EJM A;  4RBV A;  4ILL A;  2OFG X;  1S6Q B;  3MED A;  2NXE A;  3BKU A;  3MEC B;  3I5A A;  1L5U A;  2MSS A;  3HFK A;  1RLD A;  2DO0 A;  1SJR A;  1E6V A;  3CME S;  1X4H A;  1RT3 B;  2RH3 A;  4NEZ A;  1VC6 A;  4JI1 F;  5AJ3 F;  1N5Q A;  2QA1 A;  1F1B B;  3P4U B;  2DHX A;  5C24 B;  2R7U A;  1HHT P;  1HBM A;  4DUT A;  2FZG B;  1RHJ B;  3Q8U A;  5K5M A;  4O44 A;  5FII A;  1WC3 A;  3SEO A;  3G6E S;  2MKS A;  2EI5 A;  5KFW A;  3AXM A;  3CCM S;  2OPP B;  3ILI A;  1VRT A;  2EEY A;  3UR3 C;  1T9T A;  4CLP A;  1I6J A;  2GVZ A;  2BM1 A;  4OI4 A;  1APS A;  4XAK A;  1GH8 A;  2PDA A;  4OL8 A;  3CO0 P;  4CI0 B;  2VIC A;  1R6Y A;  1N6Q A;  3UD5 A;  4DR6 J;  4RW6 B;  3MM8 A;  2EFP A;  3K7R A;  3MMJ A;  1HNW J;  2F9J A;  4NA3 A;  2QL9 B;  1HD1 A;  2K1R A;  2CPH A;  3NAI A;  4K59 A;  4DR3 F;  2DVI A;  4CTA A;  1EQ0 A;  3G6V A;  3DLJ A;  4DV3 J;  3QSY B;  3MMB B;  4KPY A;  3MPV A;  1VQ4 S;  1HKA A;  2IC3 B;  1ZM9 A;  2RS8 A;  3IWX A;  1TUG B;  2PI5 A;  3UFC X;  1IKX B;  2P6S A;  4KYZ A;  1TMJ A;  4ZVF A;  2KU7 A;  2ADB A;  2V8P A;  8RUC A;  4PCQ A;  4PZV A;  1XEZ A;  3I56 S;  4DR6 F;  3MGJ A;  4LR9 A;  3A1Y G;  1RAE B;  3WHI A;  5F0W A;  1HNW F;  1IBM F;  2HHH J;  1WOP A;  5KFZ A;  2DGX A;  5KFO A;  3BSC A;  4DV3 F;  3PX6 A;  1F5A A;  5CA5 A;  2E9R X;  3OXL A;  4ZVR B;  4OV6 A;  3OBI A;  3G6Y A;  2Y1I A;  3IR6 B;  3MFI A;  4EUV A;  5HP1 A;  1Y4Z B;  4C3L A;  4UZC A;  1M5P C;  3F44 A;  1QD1 A;  3U1M A;  2UUC J;  1K0V A;  4CLY A;  2Z30 B;  2H5E A;  1HPZ A;  4KGK A;  3QWP A;  1RP5 A;  2XYP B;  2CPI A;  3K0J A;  3EVW A;  1W7W A;  1U6B A;  3MM9 A;  5IM0 A;  3EDR B;  2IHR 1;  2HHH F;  4KQZ A;  1FKA F;  2XZD B;  2Q6C A;  1LKZ A;  3IRW P;  2KB2 A;  2DY1 A;  2HS0 A;  1HQE B;  2HBR B;  1JNR B;  3A12 A;  1JLF A;  1N0V C;  4MFB A;  3HKZ D;  2J0Q D;  1VLY A;  2UUC F;  5LMU J;  1IM6 A;  1BE4 A;  3DDI A;  3HMJ G;  2JWN A;  5F9N A;  1DAR A;  1U1R A;  3TUJ C;  2RU9 A;  2RB7 A;  3IG1 B;  5CZV A;  3PX4 A;  1R8H A;  2I6W A;  4CO5 A;  4M1K A;  1H3D A;  1ZTT A;  1XQI A;  2NXN A;  3C15 B;  3KG1 A;  2VHG A;  3T19 A;  4TN2 A;  1IQT A;  1X7V A;  4WU3 A;  1OY9 A;  5ETL A;  1KVI A;  2GV1 A;  2W7O A;  2B6A B;  5HBM B;  2NPI A;  4CWB A;  4U67 Q;  6FD1 A;  3D6T B;  5LMU F;  3H25 A;  2ZUG A;  4NLQ A;  4LRF A;  1QJH A;  5D77 A;  2HFV A;  1N88 A;  4K4U A;  3A4T A;  5L46 A;  2CJY B;  3QO9 A;  2HMI B;  2BJ3 A;  2NQP A;  3MWB A;  4TY8 A;  3GYG A;  2P9C A;  3GJQ B;  5KFM A;  3TNV A;  3C6T B;  3KK3 B;  3MAQ A;  1OS5 A;  4M63 A;  1QSY A;  1DLO A;  2P9E A;  2ROE A;  1KTQ A;  2QSF A;  4X4O A;  5I3P A;  3I0S A;  1TV6 B;  4E0D A;  4IO1 A;  1KN6 A;  2E5H A;  2OKQ A;  2YNH A;  3QRQ A;  1RU1 A;  4WFN Q;  4R5P B;  3W9J A;  4X84 A;  1PJ5 A;  4MAK A;  3GV8 B;  5K8N A;  4HH1 A;  3ULH A;  2RML A;  2W25 A;  2MZR A;  5CHC B;  2BW2 A;  4USH A;  4C8O A;  1FFS B;  1LWX A;  5D4P A;  4U7U D;  2Z8Q A;  1S9E A;  3M4X A;  2A6O A;  3MUM P;  2KG0 A;  3M8Q A;  1EJ7 L;  5G0R B;  2UXB J;  4W98 A;  2OH2 A;  2B4U A;  2YTC A;  4E8U A;  1KHV A;  2HNZ A;  4ES2 A;  4AQY J;  4OZ1 A;  4JI0 J;  2V2V A;  2KT5 A;  1OQ6 A;  2WVB A;  2NZ4 A;  3DLK B;  3EUN A;  2IJF A;  4R0J A;  1SQF A;  1U48 A;  2EWH A;  1B7Y B;  5GMK a;  2HK3 A;  4DCO B;  3D0I E;  4ECR A;  1VMB A;  2VA2 A;  4UQG A;  1S7H A;  2UXB F;  4XTT A;  4ED7 A;  5HN0 A;  1TL5 A;  3MM6 A;  4Q44 A;  1U6F A;  1X9W A;  3NKY A;  5HAN A;  4I67 A;  4OX7 A;  2CQP A;  4NLO A;  2MKY A;  2OPQ B;  4LBP A;  2BAN B;  2KL8 A;  4JI0 F;  3PXG a;  4JI7 J;  1RJJ A;  4A8Q A;  2DGQ A;  1NPP A;  4I7F A;  5GAG I;  4LSL A;  5D0G A;  3O8W A;  4WXW A;  4LFB J;  1HA1 A;  1U45 A;  1BY9 A;  2BQU A;  5BXI A;  5C25 A;  5KFJ A;  3BGL A;  3NWG A;  2HAF A;  1F2H A;  1I94 J;  2VG5 A;  4EBE A;  1SKW A;  2VG7 A;  3EVO A;  1S0O A;  4DQP A;  5AE1 A;  4QWA A;  3GV7 B;  1Z4U A;  1TMM A;  5KFP A;  3C2P A;  4WFY A;  2NLW A;  4IYQ A;  2AJ1 A;  2E5G A;  2GGP B;  1XBW A;  1YKW A;  5ITH A;  4DQI A;  2HS3 A;  5KG4 A;  4JI7 F;  1HNV B;  1NXI A;  4OHY A;  3OHA A;  3CT9 A;  5DZ7 A;  1TFW A;  4LFB F;  2M3D A;  5B0F A;  2ATC B;  2P8I A;  4NI2 B;  2V5H G;  1KEK A;  1KQS R;  1S97 A;  4IKA A;  1B3T A;  1RWK B;  5F8N A;  5AXM A;  3Q8R B;  1I94 F;  1H98 A;  3H0P A;  2IJR A;  3CJK B;  4DXL A;  2ASJ A;  1RT1 A;  1RLC L;  3BBC A;  4WFB Q;  2RKI A;  3FEZ A;  3OFF A;  3CO9 A;  1RAH B;  4TU9 A;  1JLC A;  3H20 A;  3IGV A;  4QWB A;  3QFH A;  4DZ6 A;  2CPE A;  1NSQ A;  4QW9 A;  2JX2 A;  3W2W B;  1HLW A;  3H40 A;  3KLE B;  1T95 A;  2YH1 A;  3LP2 A;  4F2R A;  2NYI A;  3A8E A;  5ETQ A;  2OEK A;  4K4X A;  3CJR A;  4RW4 B;  3H8Y A;  1KS2 A;  1V3R A;  1LWF B;  1WI8 A;  3L95 X;  1H0H B;  2WVD A;  3MUR P;  1JKH A;  1S72 S;  3MMC B;  5B0A A;  4MIA A;  4H54 A;  1PC4 A;  1KP6 A;  2GFF A;  4OZN A;  3AFG A;  1G3O A;  2HLU A;  2LMI A;  5DRK A;  1TKT B;  2GX8 A;  2AEF A;  2HRY A;  5GAH U;  4M5K A;  3N79 A;  3R9L A;  3TQ1 A;  1CJU A;  1K8A T;  2MJU A;  4J9R A;  3SCL E;  3FFI A;  1NRK A;  1FNX H;  3JQM A;  3GLJ A;  4LJM A;  3R7N B;  2PMZ D;  3GIL A;  4TQS A;  5RUB A;  2E1C A;  1CJV A;  1KLM A;  3D4J A;  2Q1L A;  3V4I B;  1JQG A;  4MK9 A;  5EN1 A;  3DCA A;  1BQM A;  1G7C B;  1YLX A;  4ZA1 A;  3NY0 A;  4C11 B;  1AFJ A;  5EWG A;  2X1G A;  2Z2L A;  2IRX A;  3OL9 A;  2CNN B;  2MGZ A;  4K8R A;  5IOL A;  2CWX A;  5KFH A;  2HIQ A;  1D8Z A;  3IM8 A;  3OT9 A;  4ZCM A;  3UQS A;  3DRR B;  2HHT A;  1BQX A;  2ZH2 A;  3M30 A;  1OY6 A;  1WTF A;  2AHO B;  5K20 B;  2KYX A;  2ZH8 A;  2GMH A;  4R0E A;  4RUH A;  2H48 B;  1WHV A;  2MLY A;  4LF7 J;  4KO0 B;  4CO2 A;  1HYS B;  4BS2 A;  3SV4 A;  1BD6 A;  3ZZY A;  4OV1 A;  5LM7 E;  1RE1 B;  3CF5 Q;  1RA6 A;  4GC7 A;  1O6X A;  1Q8K A;  3MEK A;  1DY3 A;  3MHY A;  1TVR B;  2AGQ A;  1DZ5 A;  4CLF A;  3DRP A;  4ZHR A;  3VCD A;  2DGT A;  1YBA A;  2DR5 A;  1X4C A;  5KFQ A;  2N7Y A;  2CQC A;  2HND A;  3EPG A;  4JB8 B;  2IDE A;  1TKZ B;  3NP5 A;  4ZVE A;  5A6P A;  5J2N B;  3US5 A;  4IFV A;  2C3O A;  1MSW D;  5J1P A;  4RWW A;  4LF7 F;  4ZIV A;  3EX7 B;  2Y8W A;  1MU2 A;  4ZPT R;  5GAE U;  4NCB A;  4IOC Q;  3VAK A;  1RKJ A;  1N5Y B;  1TQL A;  4KKO B;  3AY0 A;  3CCJ S;  4A47 A;  3CED A;  1IKW A;  4DPY A;  2FJB B;  1VQM S;  3EMT A;  4OX8 A;  4Q8E A;  3IWN C;  4C2M A;  4LRB A;  5JVH Q;  4FP9 A;  2EFN A;  1KLN A;  2C2K B;  4X66 J;  1S1X A;  4O4G B;  2YQ1 A;  4ID5 B;  4WE1 A;  4ZPB A;  3THT A;  2DIU A;  1T05 A;  1YRU A;  3LH2 S;  5MLC V;  3VAH A;  2I5J A;  4ZPD A;  3PFE A;  1OSC A;  1RWV B;  1U47 A;  4FNH A;  1C1B B;  5HAO A;  4UST A;  4FYV B;  3C46 A;  3EZ5 A;  4DOZ A;  5LXR A;  1S1W A;  5M2U A;  4CNZ A;  1TKD A;  1VQ7 S;  2J6U A;  2DH7 A;  4DBQ A;  5C7P A;  1ZZN A;  1PIL A;  2GIR A;  1UW4 A;  2Y1J A;  1XN9 A;  1WC5 A;  3R1L A;  1GXL A;  2CJX B;  4X66 F;  3EM1 A;  3FDS A;  3OQ2 A;  3HSJ A;  3D6M B;  2ZFH A;  4TYB A;  1TU0 B;  3X3U A;  2BM0 A;  3MF5 A;  2H54 B;  3GP9 A;  2OLW A;  5IT0 A;  1W2B R;  3C16 B;  1RTD B;  2HWI A;  2DXF A;  3TUI C;  2R7S A;  3AA9 A;  4DPO A;  2E9T A;  4W90 B;  2FLL A;  2HFZ A;  3J81 j;  3TZZ A;  1BUX A;  3ZZR A;  3RZA A;  4LQ9 A;  3W3S A;  4QPX A;  4N7T A;  1DQ9 A;  5AE3 A;  2ZH7 A;  2CZV C;  1GQE A;  4OYO A;  4F36 A;  3HPO A;  4J9P A;  3OR1 B;  3EGZ A;  2XCA A;  2QE5 A;  2R7R A;  2AP6 A;  3QAE A;  4KE5 A;  2DHG A;  2XO6 A;  2C2R A;  3LPE A;  3SQO P;  3W8P A;  3IBF B;  5KT4 A;  4KHP F;  2HBY B;  4U7U K;  4F02 A;  5KFE A;  1ZOT A;  4ED3 A;  2VPW B;  3FKB A;  4HHH A;  1ITP A;  3NGR A;  4ZVH A;  3HHL C;  1RK8 A;  1G2E A;  2CWK A;  2B4V A;  5EGY A;  2R2T A;  3KMS A;  3T9N A;  5FLX Y;  5JUM A;  2Z56 B;  2XYG B;  3BSO A;  2HQF A;  3K2Y A;  3MEG B;  2XLI A;  2QFJ A;  2JL9 A;  4U8V A;  4ES1 A;  5LSO A;  1U2R A;  3RGI A;  1DHM A;  4QR2 A;  3LOU A;  4J9N A;  2L9N A;  3KFW X;  2L41 A;  2NXC A;  2G0J A;  2DNQ A;  4ECW A;  1PYO B;  3DM2 A;  1NUE A;  2KT3 A;  3E01 B;  2HHS A;  4KHM A;  5KFL A;  2OUG A;  5D15 A;  3KKF A;  2V67 A;  2CPY A;  1WEL A;  2BDP A;  1AZS A;  3MTK A;  3WC0 A;  5B0B A;  5HLF A;  4EEY A;  1WHY A;  2BE7 D;  1Q1K A;  2QZ8 A;  4DPW A;  3W5X A;  4WF9 Q;  1UW9 A;  1JLQ B;  4NLY A;  2OIH A;  1PGZ A;  3M8S A;  2AJ2 A;  1F6T A;  2BAC A;  2XTJ P;  4ZPA A;  3KK2 A;  4XDD A;  5CYJ A;  3IAS 9;  2R8G A;  2XM3 A;  3T5K A;  1WHW A;  3QSI A;  3KXD A;  4JV5 J;  2D9P A;  2A10 A;  3MAA B;  1LXN A;  2VQE J;  2V4J B;  3G4S S;  1KDN A;  1R8A A;  1UWB A;  2O5D A;  3G82 A;  1MW7 A;  4FZV A;  4TQR A;  1X4A A;  3RB0 A;  1Q82 T;  5M2R A;  2GCF A;  5K14 B;  2D7S A;  3KUE A;  3L9Z A;  1C0T B;  4O0N A;  1RTH A;  3N6M A;  1T8E A;  3DLE B;  2KFN A;  3DYA B;  1JLG A;  4PYA A;  1RBA A;  1QM9 A;  2FY8 A;  4JV5 F;  4P71 A;  4OFZ A;  2R2R A;  2FJD B;  2VQE F;  1E6Y A;  2EVZ A;  2YWE A;  4FBU A;  1NZ8 A;  2BUN A;  1Y0H A;  3CJ0 A;  5HAT A;  3TWZ A;  3PYG A;  3EZU A;  1W26 A;  4UY8 T;  1RAJ A;  1X31 C;  3OSP A;  2XHC A;  1MNE A;  3SQG B;  4QIG A;  3WX4 A;  5DO2 A;  2H9Z A;  1JJC B;  4ZCI A;  5HVG A;  3QZ8 A;  1CUL B;  1SV5 A;  2DH9 A;  4OX6 A;  3OTD A;  4TXS A;  3J7Z T;  2VFS A;  3CB4 A;  4G1Q B;  4OQJ A;  1RT6 B;  4R8U A;  3FC9 A;  3L09 A;  1URR A;  4ALZ A;  3W64 A;  3Q0A A;  2O01 C;  3QIP A;  4DL7 A;  1F60 B;  4EZ6 A;  3B4D A;  3DMJ A;  4FKY A;  2YNI B;  1RIS A;  3H42 A;  1VLO A;  4KR0 B;  4NXN J;  1N52 B;  2C2Z B;  4BCA A;  1EQM A;  3S7R A;  4F26 A;  4B9U A;  3CCZ A;  4PUO A;  4LT6 A;  2DK2 A;  1Q81 T;  2V34 A;  4IG0 B;  2XS7 A;  1YZ7 A;  4GVB A;  2L3M A;  2M0G B;  2UVV A;  1RQ0 A;  4YR2 A;  2CQG A;  3PRD A;  3M8W A;  3PX0 A;  1K9M T;  3POT A;  5KTQ A;  3RRG A;  3KK1 B;  3HHL A;  3HHE A;  4MT1 A;  3CDU A;  3BB5 A;  1EAR A;  1D8Y A;  5J2M B;  4X4T A;  3W2V A;  3HKW A;  1IKV B;  2KM8 B;  2RHQ B;  3ISZ A;  4CH0 S;  2B5J B;  5HQL A;  4RNM A;  4NXN F;  1BGX T;  2FLN A;  4AXI A;  2BE2 B;  1YZ6 A;  2UXD J;  2J7U A;  2DGS A;  2ZKT A;  4AT1 B;  2XMT A;  2YPY A;  3NCQ A;  1T9Y A;  4EZ9 A;  2QL5 B;  4RW7 A;  2C42 A;  1B0V A;  3F0N A;  2H5I B;  1UA1 A;  1UVL A;  2AJQ A;  1JLE B;  5LJ3 Y;  4C98 A;  1NND A;  3M2U A;  3PG9 A;  3SZ2 A;  1D09 B;  2J0W A;  2H5J B;  4ZN3 A;  3KUH A;  4MMO A;  2X51 A;  2HND B;  2J9E A;  3Q83 A;  3M05 A;  4P52 A;  5GAH I;  4CT9 A;  2V94 A;  1SKS A;  2VFU A;  2UXD F;  1YVF A;  4USV A;  1HQU A;  2ZE2 B;  3TVK A;  1ZS6 A;  2HVE A;  3GG1 A;  4DL5 A;  2DHH A;  3T1A A;  1CBK A;  3C14 B;  3PVX A;  2APO A;  5CAA A;  2M8D B;  3I9V 9;  2WBM A;  3JS9 A;  6FDR A;  3R5J B;  1M5H A;  3P8B B;  2AYM A;  2C22 A;  3P3D A;  2R7V A;  3IFE A;  1CVJ A;  1REV B;  2HSE B;  2PT0 A;  2LU2 A;  3UPF A;  4M5M A;  2MZS A;  2OEL A;  1YJW S;  1HMV A;  2R3V A;  4RNO A;  1GFW B;  2Y1L B;  2VF3 A;  3ZZP A;  2KM8 C;  2IY5 B;  2FC9 A;  4P9S A;  2JLG A;  1U49 A;  2WTF A;  4Q5V A;  1HWU A;  2LQ5 A;  4LIW A;  2DGO A;  4OMF G;  4XK8 C;  4HHJ A;  2OTJ S;  4D3G A;  2MQ8 A;  3S01 A;  1S1V B;  2VD3 A;  4PWD B;  2C2N A;  3U02 A;  3SSS A;  3U1N A;  2HNY B;  3V6D B;  2HWT A;  1NB7 A;  3MOJ B;  4ANC A;  5KT3 A;  2DEI A;  4FYY B;  4B3O B;  2CJB A;  1EKR A;  4F2S A;  4KB7 A;  2CJA A;  1CS4 B;  4X4U A;  2KHC A;  4PG5 A;  5ETV A;  2CNK B;  4O3P A;  2GJI A;  2DR6 A;  5SUH A;  3K59 A;  1CJT A;  4WYW A;  1RT7 A;  1V3Z A;  2VBY A;  3GYN A;  2YWK A;  2AZ1 A;  1NH7 A;  4KC5 A;  2R9L A;  4CH7 A;  1NJX A;  2OP5 A;  3IS9 B;  3UCU P;  3FBC A;  1CQM A;  1VRU B;  2DCL A;  1K0T A;  3SDE B;  2V2Q A;  5GAE I;  1UVJ A;  4ITS A;  1H7W A;  2QEX S;  3ETM A;  4NML A;  1BLU A;  2AEJ A;  4P7T A;  4I2P B;  4B17 A;  2DIV A;  1Q78 A;  3M6V A;  4J9S A;  2OEJ A;  4DSF A;  5HVF A;  1S6P B;  2E1A A;  1FWP A;  1RTI A;  2VU5 A;  3RB3 A;  1OPI A;  3N5B A;  3DOK B;  3P96 A;  4HI2 A;  3DHX A;  2B8Q A;  1MN9 A;  1FRI A;  2RVJ A;  3EGN A;  3D6F B;  3QT5 A;  3UN5 A;  5D4O A;  2Y0B B;  2YWW A;  2C2M B;  3VAL A;  2E7W A;  4CO3 A;  1UAW A;  3TZX A;  3OL8 A;  1X4E A;  4QR0 A;  2W9B A;  3PAC A;  2XMA A;  2RIL A;  3W63 A;  3FSY A;  1LWE A;  3BSA A;  3D1Q A;  1R31 A;  1YQH A;  2GO9 A;  4DUZ J;  1Q95 G;  2CJK A;  2IPO B;  3Q8V A;  3ILO A;  3LP1 A;  4LVO P;  5DLG A;  1OIA A;  3M2R A;  3MCS A;  3T5L A;  1RBO B;  1FXR A;  1ZAX A;  2KFY A;  3NNH A;  1P1T A;  4L3N A;  2RQM A;  1OQ3 A;  1TUV A;  2F7V A;  3Q8S B;  3QLH B;  4KGM A;  1TAQ A;  3JQJ A;  4CO0 A;  4EI2 A;  3ISN D;  2YKM A;  1IKY A;  4RBT A;  4F67 A;  4DF8 A;  4OZ3 A;  1OYE A;  3T5H A;  2GIF A;  4JBC A;  4OHZ A;  1UEU A;  3FEX B;  1UZD A;  4DUZ F;  1WF0 A;  3RR7 A;  3Q24 A;  5ETP A;  2K2P A;  1GK8 A;  1QE1 B;  4NA2 A;  4NLT A;  4NX9 A;  1IVZ A; 
#chains in the Genus database with same CATH homology
 2H4W B;  5K20 B;  2XYG B;  2H65 B;  1SC1 B;  4DCO B;  3GJT B;  2CNK B;  3IBC B;  1RHJ B;  1QDU B;  3R5J B;  2C2K B;  3GJR B;  1RWK B;  4ZVS B;  2H48 B;  3KJF B;  2HBQ B;  3GJS B;  4ZVR B;  1BMQ B;  4DCJ B;  3QNW B;  3R7N B;  2C1E B;  2QL5 B;  2DKO B;  2QLF B;  1RWV B;  2CNO B;  1RE1 B;  1PYO B;  1SC4 B;  2H5I B;  3R6G B;  2XZT B;  3P45 B;  2CDR B;  2QL7 B;  2HBZ B;  3KJN B;  3RJM B;  1SC3 B;  1GFW B;  1RHR B;  2Y1L B;  3NS7 B;  3EDQ B;  1RHK B;  1IBC B;  2H51 B;  2QL9 B;  2XYP B;  1NME B;  2H5J B;  2C2O B;  4ZVQ B;  3SIP B;  2C2Z B;  3EDR B;  1RWP B;  4ZVT B;  4ZVO B;  2CJX B;  4JB8 B;  2XZD B;  1RHQ B;  1RWM B;  2CNL B;  4LSZ B;  2CJY B;  1QTN B;  1PAU B;  3IBF B;  1I51 B;  2QLB B;  2CNN B;  2QLJ B;  1RWO B;  4ZVP B;  3D6M B;  2HBY B;  5IC6 B;  2FQQ B;  1F9E B;  3R7B B;  3R7S B;  3GJQ B;  4DCP B;  2P2C B;  1RHU B;  1RWN B;  2HBR B;  3D6H B;  2H54 B;  1RWW B;  4ZVU B;  5IC4 B;  3D6F B;  1I3O B;  2XYH B;  2Y0B B;  2H4Y B;  2C2M B;  1RHM B;  3KJQ B;  3R6L B;  1ICE B;  3P4U B;  1RWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...