3D6MB

Crystal structure of human caspase-1 with a naturally-occurring lys319->arg substitution in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIRKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutated, structurally altered caspase-1 with decreased enzymatic and increased RIP2-meditated inflammatory activity leads to a new type of periodic fever (ICE fever).
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3d6mB00
1RWNB 1SC4B 2C2ZB 1RWOB 1I51B 2H48B 3P45B 1RWWB 2H5JB 4ZVPB 1F9EB 2H4WB 1RHRB 2C2MB 4DCOB 2CJYB 2QL7B 4ZVTB 2CJXB 4ZVSB 2C2KB 2QLJB 1QTNB 2XZDB 1I3OB 3D6HB 4DCJB 1RHJB 2H51B 3GJRB 4ZVQB 1RHMB 2QLFB 3KJFB 1PAUB 4LSZB 1RHQB 1QDUB 3R7SB 1BMQB 3EDRB 1RE1B 1PYOB 2HBZB 3R7BB 2HBYB 3D6FB 3KJNB 4ZVRB 3KJQB 3GJSB 3P4UB 4JB8B 5IC4B 2XYPB 3EDQB 3R6LB 2XZTB 2HBRB 1IBCB 2XYGB 1RWMB 2C2OB 2Y1LB 4ZVUB 2XYHB 2H54B 2CNOB 2CNNB 3IBCB 1NMEB 3R7NB 1RHUB 3RJMB 4DCPB 1SC1B 2P2CB 1RWKB 2H4YB 1SC3B 1GFWB 2QL5B 3R5JB 2H65B 3QNWB 2FQQB 3GJTB 2CNLB 1RWPB 3GJQB 2HBQB 2QL9B 1RWVB 2Y0BB 5IC6B 3SIPB 1RWXB 1RHKB 2H5IB 3NS7B 2CNKB 2DKOB 3IBFB 5K20B 2CDRB 2QLBB 4ZVOB 3D6MB 2C1EB 3R6GB 1ICEB
chains in the Genus database with same CATH superfamily
1WKJA 5IQ6A 1TAQA 3MAAB 3NGUA 5HQMA 1JLQA 2ASDA 3U1NA 5BXIA 4J9QA 1M5VC 5HLFB 1FJGF 2W2NP 3TZXA 5HMZA 4CO5A 4RBVA 4B9SA 5F8HA 4RJVA 5K14B 1L3KA 4O3RA 1FK9A 4M63A 1YZ7A 2ZVIA 2IJNA 2WBRA 3PRVA 4TXSA 3US5A 4J7CA 2YX1A 3NGDA 1J5EF 4LVNP 2WVBA 4WP3A 2VPYB 2MHEA 1NKCA 4HLBA 2E9TA 1NJWA 3NNHA 1I5OB 1PC5A 4F4AA 3CEDA 3R8YA 1OJ4A 2JVRA 4ZPWR 3Q8QB 3OL9A 1HWJA 2LKZA 2HWHA 5FJ4A 2ZH6A 2VC0A 5F8IA 2JOQA 2XM3A 2QLJB 4LRAA 3KLHB 1L3TA 4ICLA 1JX4A 2G0CA 1BGXT 1TL3B 4ZK7M 4ECWA 2XSJB 2NUUG 3H5SA 4KHMA 2KDOA 2MJNA 2PMWA 3V81B 3W8GA 4ZMMA 1OO0B 2HNDB 4OFZA 2CQIA 1RHJB 2BANB 2B9YA 2H51B 1EJ7L 3SV3A 2MMYA 2M3DA 2YBVA 5KG2A 1UPPA 3TJ9A 4OYIA 1DFDA 2FB0A 3LOUA 2E66A 2KYXA 2R2UA 4K4XA 4DQQA 2D3UA 2E5IA 3KOAA 5IWAJ 2ZHAA 4C8LA 4YY3J 3HVWA 1R8CA 4PWUA 3D6FB 3J81U 4AQYJ 1HD0A 3CWJA 2OPPB 4X84A 4PQUB 2JEIA 1P9YA 3M8QB 4CLLA 1H3DA 1CJUB 3N6NA 4N47A 4C3KA 4B9TA 1UJ5A 1VISA 4L73A 3I9V9 4QWDA 4O4GA 1X5OA 1SJ3P 4Q8FA 9RUBA 1K44A 5IM0B 3CJ4A 2GS8A 1FKOB 2IJRA 1UKUA 2DY9A 2GA7A 2XYGB 3E01A 4OX8A 2UUAJ 2EFOA 3VAFA 2Y1JA 2W7OA 1PBAA 1YBAA 4ED6A 1QUVA 4OHXA 2J0SD 5E3AA 1RTJA 2XI3A 4M5LA 2NZ4A 1BE4A 1EIYB 2YKOA 3FC9A 3TNVA 1KQGB 1JQGA 2W4DA 2V8DA 4DBQA 4U8YA 4PCQA 5A8RB 4QQBA 5KFCA 5D15A 4IFVB 4OIXA 4KAIA 4AFFA 3VQTA 1T8EA 5DG8A 4CH0S 5KOWA 3T41A 3T6BA 3POTA 2OAUA 4OX9F 5CA5A 1RAOA 1JLEA 4MJKA 1DTQA 2HIYA 3MM6A 1D3WA 4MTPA 3QAEA 2W8LA 1IBMJ 1MW7A 3MM5A 1VHIA 2FLOA 2IYGA 4ZLJA 1X5SA 1MWYA 5BYSA 1TUVA 5HMXA 2D3ZA 2GX8A 4I2QA 4WFYA 5H9FK 2KXNB 1QUPA 1NAQA 2H5IB 2JX2A 3I96A 3DOKB 4KV8A 4O44B 3OFGA 4MK9A 3DU5A 3K5OA 1HL6A 4YN3B 4I6YA 1CS4B 2VOPA 2QO3A 2LQBA 2IDEA 5HJXA 1NEEA 4CYUA 1WSVA 2Z30B 4F4KA 2DYAA 4H4KC 1BC6A 4KIAA 4K0KF 3TUJC 2NSBA 4Q44A 1DTTA 3AOCA 4ANDA 2HQDA 1JLAB 4QWAA 1UETA 1SJ1A 4URSA 4WFBQ 1L3VA 4NLGA 4DUZF 2ATCB 3NAHA 2B5JA 3HP6A 2DCLA 1DQ8A 2LA6A 2AP6A 4YMEA 3NCQA 1HWIA 3EM1A 2IMWP 1NH7A 2W24A 4KFBB 2C2EA 3NNAA 3AXMA 1RACB 1REVA 2VFUA 3DNCA 3NCPA 4MIWA 4JI5F 4DV6F 3OQ2A 1NZAA 2V34A 4GMKA 2YY3A 5CQGA 3WIVA 2R8GA 4DX6A 1S1WA 3PX4A 1HIYA 2GVZA 2DO0A 1R8PA 2RF2A 3I31A 4ITSA 4QZVB 5KFRA 4YB1P 3TYTA 3TAPA 4DR6J 2QA4S 1NDKA 4HI1A 3AQPA 3UCGA 2XQCA 1K8AT 3AT1B 1SQGA 4IH7A 4LSNA 4NA3A 4WKYA 1XNRJ 3QFHA 2M9KA 3H59A 1RT6A 3OR2A 3QIPB 4E2FB 3PACA 4KHPF 1HD1A 3E8OA 5I3UA 1LXJA 1DJ0A 2HQGA 3BBBA 4USJC 3GV5B 3CC4S 5A76A 2VQEF 1JLEB 1RYSA 4LFCF 3GG0A 1U26A 1CJVB 2VBXA 5H9FJ 4F25A 1KBRA 3SDEA 1U4BA 3K5MA 2HHXA 1Y5IB 1FDNA 5KG3A 1NHKL 2FHOB 3O3LA 4WP9A 4D3HA 2MKIA 4A8KA 2UUCJ 2ZHOA 2JRSA 2LEAA 3DDKA 1PGZA 3DLBA 2OELA 2RDJA 5J2QA 1N33F 3FRZA 3PXGa 1REVB 1M0SA 4C3MA 1ZZFA 1TL4A 2CJKA 4B3MJ 1SUQB 4LT6A 4O23A 4DWIA 2RF2B 3EUNA 1N32F 1U8WA 2MY8A 3N79A 1NJZA 3QO9B 4NLWA 5KT6A 5B0CA 5KG1A 3KK2A 2DXEA 1C4AA 4F67A 2G2YA 4K8RA 4TQRA 1GXLA 4PUOA 4ES3A 3VAIA 2ASYA 4NCGA 3V4MA 3V6KA 4JV2A 4LR8A 4Y6IA 3IN5A 3MR7A 1KLMB 2CQCA 2RVJA 4GVBB 4KY3A 3SCIE 4EBEA 2F3JA 1NK8A 4IH6A 5KFGA 1OY8A 3LH2S 3CF5Q 4YDXA 4YFUA 4E8UA 4DQSA 3SCKE 3TAMA 1D9DA 3CD0A 3CMAS 4OLOA 3GIJA 2YX4A 3SSQA 4GO7X 1G2EA 1AXQA 3UE2A 2YNGB 3TEGA 1M5HA 1MN7A 3PYGA 5GAGU 3DOKA 5CABA 3G82A 1WDDA 1R8HA 3K7RA 3L7OA 4FF1A 2K3IA 3QJLA 4ED2A 1S6UA 1SCJB 2CJBA 2DIVA 3PTWA 3X1LB 3ENQA 1FRIA 3MUVP 3AA8A 3MEGA 3OBIA 2K1RB 2CG8A 3OL6A 3ENVA 5A0YA 1BD6A 5EWEA 2H65B 1RDRA 4DFJA 4OYAA 4Z2XA 3C14B 2ZBQA 1VC6A 3FJ2A 2CWKA 2AIRB 3OTOJ 2IVFB 3MDFA 1B0VA 1RABB 2AW0A 1BQXA 1URRA 5KFUA 1KSPA 2HYIB 1XNQJ 3AODA 3UD5A 1IKWA 4LFBJ 4OZ3A 2AGOA 4QR1A 5CYQA 2ZE2A 3OJUA 3FSXA 1L5UA 2A2DA 4NEYA 3SQGA 4OX6A 3NS7B 1UTAA 5HJYA 3CC7S 1WTFA 3I0SA 3KKFA 3QLHB 1AROP 1K73T 2E29A 2QYGA 1S6OA 4J5OA 1D8ZA 2NXCA 1SL0A 1J5OB 1V9OA 3A8KA 3MTJA 3CDEA 2IRYA 1KC8T 3KG4A 2Q3PA 3UW1A 1MWZA 3GILA 3EXYA 2F8EX 4HACA 1KQSR 4QPTA 2VASA 3EGNA 4HH1A 3PHTA 3H0PA 3AFGA 3PRDA 4KPYA 4EI2A 5K8PA 4A8YA 2GC8A 3BGOP 3HX9A 4UZCA 3OUYB 1GX5A 2XMVA 5D4OA 5J1PA 1QLNA 3AJ1A 2FD2A 1F9EB 4FYXB 5I3PA 3OVAA 4JYAJ 2R7VA 1FF2A 3VVTA 2RUGA 4LQ3A 2PFDA 5C5JA 4OJ3A 4DV4J 3RBXA 5C25A 4K2JA 4I4BA 5F8JA 2MZQA 3Q8PB 3AAWB 3KG0A 1HQEB 1VFJA 2QA1A 2VDIA 3IXQA 4JV0A 5J2MA 1KVJA 4HR2A 4P7VA 4IOBA 4P2SA 1H7WA 1KRPA 5DO2A 3HK2A 4DG1A 1S99A 3M6VA 4C6AA 4O0IA 2GVDB 4RZRA 1QY7A 2KYZA 3AD7C 3FBBA 2VPWB 1HBMA 2SXLA 1M90T 1CEZA 5JVHQ 4LF8F 1F0XA 2KZZA 1WOPA 2GFFA 2AJFE 2O66A 2VJVA 4DV3J 1B7FA 3IRXA 1T05B 4J9LA 3NAIA 4B02A 1F5AA 1Y5LB 2ASJA 1FWPA 2MZSA 4FKYA 3QJJA 2L3MA 4JYAF 1RHQB 3BQ0A 2BQRA 3LP1A 4IFYB 3PZPA 3DI6B 1HHQA 2VG7A 4N8NA 2C2DA 5F3TA 3QO9A 1HBUA 3OFEA 4X2BA 4DR4J 1ZA2B 3G2XA 1FFWB 5CYMB 4UOGA 1QVFR 2PA3A 1HNZF 4CTAB 1SV5A 1UFLA 3DRPB 1NSPA 2EFQA 4WIQA 4P71A 1CJVA 1V3ZA 4FPIA 4DPUA 4Z37A 1H0HB 3TQ1A 1WELA 3DLHA 3BSAA 1OMSA 2X1BA 3C6TB 2MHNA 4RW8B 4CO0A 5HLFA 1VQKS 4QR2A 4JI8J 2HBRB 3TOQA 3TVYA 4DR7J 2R7QA 2WBMA 7FD1A 4CWBA 2GMJA 5LJ5Y 2OLWA 4ZJOA 4F3QA 1R31A 4OV6A 1U6ZA 2BE7D 4QBUA 7FDRA 1YIJS 1T0TV 1HR0F 2K7KA 1H72C 3AD8C 3HSGA 2Z2YB 2RKIA 5ETOA 3LQVA 4QIEA 1UA1A 2C3OA 1YZ6A 4M8LA 2PMZD 3ENAA 4RR5A 1SBRA 3DOMA 2BW2A 2CQ3A 3BSCA 1TELA 2WZ1A 3HI9A 1KD1T 1VQOS 1FCAA 4WBFA 2BOAA 2XCPA 2ZDPA 1NMEB 3SCJE 3W61A 1FWKA 2BJDA 2AGQA 2OFHX 5ETNA 3N6LA 2H4YB 2OPRB 1FKPB 1HQUB 4B3SJ 2JJ4D 3GR1A 1VK8A 3WDOA 2YH1A 1BQMB 2QA2A 4RL1A 4LFAF 2MGZB 1RB0A 2DITA 4NLVA 5D4NA 2CNLB 2O01C 2OGUA 4RNHA 4NYOA 1N34J 3B54A 3QIDA 3W5XA 4N8OA 2FZKB 1U1RA 2GZOA 1RI7A 5CZXA 3SQOP 2FVPA 3A4TA 4O44A 4MT1A 3MR5A 1T7PA 4DXLA 2EWHA 1RHKB 4LIRA 2G0IA 4HVZA 2B3TB 1IUJA 1C1CA 4M5HA 5J1NA 2W9AA 2KRBA 3CJQA 4RU2A 3PFOA 2HMIA 3QT6A 5KFZA 4LF6F 4PQUA 3WBZA 5D77A 3FBEA 5CH7B 2IC3B 1F5BA 1LEOA 2GIQA 1JLCA 2W9CA 3CW2C 4QW9A 1O51A 1YK9A 2DJWA 3K5PA 2NREA 2QT7A 1SVDA 5L9NA 4HACB 1TKZA 4IDKA 1TL1B 4RBUA 4DZDA 1IBLJ 2F4VF 2F4VJ 2KFZA 3M2RB 2RE1A 3B6BA 2AJ1A 3PRBA 3R1LA 2DHHA 1U1KA 4F02A 3K57A 2KTQA 4EBDA 1I51B 5KFPA 2HAIA 4V19X 3DM2A 3Q2SC 5JJBA 2EFGA 2H48B 3GCXP 3KDOA 3VGVA 4A46A 1KN6A 2MDAA 3CCTA 3TJAA 1U0HA 2DGXA 4EK2A 3I9ZA 3NEKA 2ZBIA 3PYEA 4AL5A 2A3JA 1RWWB 2KB2A 2C3YA 2QG9B 3HKZD 3DGPB 5A8RA 5KOXA 3L3CA 4CM0A 5L1IA 1T02A 2QC3A 3QBCA 4AL6A 1H38A 4A8FA 3R2DJ 1RQ0A 1RT6B 2DNKA 3W5ZA 3EZUA 3FEXB 4W90B 4P9SA 4KKOB 1XN9A 1N5YB 4PPDA 2C42A 3RW6A 1KLMA 3CIZA 5CYJA 2AYMA 3HHLB 5FDLB 4UY8T 4U6PA 2M2BA 2DVIA 4LFCJ 1TKXB 4K4YA 1O0PA 1S6QA 3DDNA 5BYQA 1MMLA 2YKMB 4G1QB 1M5SA 3D6HB 3R97A 5KG5A 4OHWA 2CQBA 1VIOA 2RHSB 1RP5A 4HDHA 3PJWA 2B8PA 3U1MA 2QRRA 5I3QA 1U45A 4L3NA 3M8YA 2OPPA 4NXMJ 2VB6A 5E3QA 4DR4F 1SL2A 3RB3A 1JNZB 3KK3A 5KFXA 4CDIA 5B08A 2RRBA 2W4CA 4CLPA 3MM9B 4RUCA 1GMVA 3KJQB 3QIPA 3QMQA 4ER8A 4ECZA 1F1BB 1HW9A 1TKZB 4WTYA 4J37A 1E6VA 1WHYA 4LVOP 5IC4B 2FHKA 1T95A 4LRBA 4OZJA 4Y2IA 4L3KA 1K9MT 1VQ8S 4B9VA 2OTJS 5L1JA 3CDAA 2CQGA 2QLXA 3CDWA 1Q7LB 4IO1A 2HHQA 1U1MA 3MMCB 3ZFVA 3PJXA 1UW4A 1S6QB 1GNKA 2MLZA 3AA9A 3NBPA 1WF2A 3TARA 2LXFA 1X60A 4CNZA 2VFTA 1PJ6A 1JLBA 1RAIB 2AT1B 3KUEA 1OWXA 5KFHA 1JXLA 3QRPA 1H2TZ 2Y1LB 4ECTA 2VH7A 3DYAB 3MOZA 5T7LB 2KM8C 1FEHA 2M52A 2QJ3A 3HSJA 4PG7A 4FNIA 4ENOA 1Q8IA 4DL4A 4LF4J 4N5SA 3C8YA 1WKLA 2OI2A 4EO6A 4I6AA 3IBCB 1VDHA 2A2CA 4NLXA 2AYGA 4Q0BB 1RHUB 1DLOA 4CM2A 1LWFA 4EYIB 4OYOA 3L7UA 2CWXA 2W2MP 2NXNA 2W2PP 5IQQA 3WX8A 4U95A 4YHHF 2CPEA 4N56A 1D8YA 1IXKA 3TVKA 3J81Y 2AX0A 2B43A 2CXEA 3ISNC 3OL7A 2LMIA 3SYZA 4EYHB 1RZMA 4C97A 3KWMA 1YKWA 4KGVB 1NSQA 3A1YG 1HW8A 3VZIA 3DRRB 4M5DB 3CJ0A 5C25B 4FNHA 1JLGA 2XMKA 4DR1J 1XR7A 2KRRA 1YJTA 1NSAA 2FHJA 1MLAA 1XIQA 3I82A 3NGKA 3GPAA 3VAKA 2BDPA 2OTLS 3MEGB 3GIMA 4L74A 2VG5A 1B4SA 2BABA 3PW2A 4B3RJ 3MM9A 2AMCB 3UN3A 3G6VA 2BKOA 4B08A 3CC2S 1J5OA 2JL9A 3MMAA 3RR8A 1SJQA 5BYRA 4IG0B 3RAXA 3W3SA 5LOQA 3T5JA 3QRRA 3RRHA 4DPWA 3BS9A 5K8OA 2V0NA 3OD2A 4GVBA 2LDYA 3OSNA 2ZZMA 2XO7A 1YLXA 3DLGA 1R0AB 1U0SA 3VGSA 4DHVA 1AZSB 2K2PA 4PWDA 2X1AA 4PG8A 2QFJA 1EKSA 1RWOB 4P2FA 1N5SA 2CQHA 1N54B 2V94A 2YKMA 3HKWA 4GRSA 4WPAA 3UDVA 4YS2A 1JWWA 3P45B 3FCVA 3TRGA 3QRQA 2PFFB 2L48A 3KLHA 2X3DA 3U1LA 1YI2S 2MXYA 3W1YC 1KTQA 4H4OB 4QOTA 3C14A 2FDNA 4QYZJ 3ZTPA 4C0HA 4DSKA 3QSIA 3OSPA 2E9ZA 1C0TA 3AXKA 4RW4A 1SJFA 1HYSB 2V9KA 4USVA 3RYLA 4DSJA 4K4ZA 5DLFA 1U47A 4PXEA 1T03A 2YKQA 1C2PA 2VONA 2VA3A 2W9BA 5KFAA 4NLPA 3ZTQA 3RRGA 1Q8KA 1S6PB 2BJ3A 2D74B 5M2PA 1VQPS 2JVOA 3AD9C 1IM4A 4FF4A 4KQZA 2NXEA 2E1MC 2KJWA 3H42A 1MU2B 1CJKA 4P74A 2LXIA 3PY8A 1N34F 4KH1B 4IR9A 2HURA 4FBUA 4C8ZA 1FA0A 2OMLA 2N82B 5J2QB 5GAHI 1WD6A 2HHHJ 2PO4A 2XMTA 3OLBA 2GMLA 2WTFA 4UTGA 1KP6A 4LFAJ 5GMKa 3GR0A 2OFGX 2G1HA 1N4LA 1MNEA 4ZVQB 4JI1F 1PG5B 2W2OP 2DH9A 1UFKA 4EUVA 4UT4A 1RBLA 1QSSA 1J5EJ 2QMWA 1Q7YT 3TA0A 4RUAA 3K0JA 3PG9A 4KHPJ 1CQMA 4GKKJ 1RT5A 2D9PA 2VOOA 3ZZPA 4ZCIA 5AXNA 3ITHB 3DFEA 2CADA 4F04B 4R5PB 2ZKUA 4F4ZA 1XR6A 2CPFA 1X5TA 2M5YA 3F41A 3ZO7A 3H4DA 3PW0A 1N48A 3BGRB 4U9RA 1YGYA 2MSSA 2EKNA 3GQCA 1S72S 1Q81T 4ELUA 1HYSA 4OZNA 2OEKA 1HNWJ 2AV5A 3IG1B 3K8WA 1WUUA 4Q43A 1S6PA 4XDCA 5KFTA 2EBEA 5E33A 3HULA 4DR5J 3TW0A 2GQCA 1RWMB 1HBMB 4ILLA 3K8VA 2QZ8A 3MD1A 5RUBA 1A7GE 5KFKA 4J9KA 1YJWS 1I1GA 3ITHA 5C7PA 3W63A 3KLVA 1UPMB 4PXDA 1FESA 2FHJD 1Q95G 1XWLA 1YSJA 2ZH1A 1KONA 2FYXA 2ZWPA 3GTYX 1FNXH 2BM0A 1NJXA 3N5FA 1H73A 3M05A 2B7CB 2UXBF 1RUSA 4O3SA 1ZBTA 2B6AA 1VK3A 2GV1A 2YWKA 3IWXA 4RW9A 4DG1B 2J7UA 2JC1A 4RWXA 1N6QA 1S1UA 2OJ3A 3RJMB 4J9NA 5ETTA 1F60B 4LQ9A 5C2CA 3OW2R 2BJ8A 4Y3CA 4JI0J 2IYIA 1KQFB 3H90A 2HKEA 3R5JB 4BC9A 5LMNF 1Q86T 1TL7A 3EZOA 2YPZA 4KO0A 2V8VA 2FVCA 2IVMA 4DX7A 5L38A 4DUZJ 1FDBA 3DRRA 4M5DA 3GJQB 1IWAA 3FFIA 1KFSA 2UXCJ 3PM9A 2OIHA 1HNVA 3EJMA 2XGPA 4QWBA 1U2RA 1EX8A 2YNIB 2Y8YA 3P8BB 2B8QA 3M2UA 3SIPB 1FRMA 2ILZA 1OQ3A 2XCAA 2CPXA 2OO4A 1REGX 4QWEA 2V67A 4KTQA 4NLRA 4Z7YA 2CG4A 3E51A 4OZ5A 4WFXA 1RTIB 2ZH8A 4C8NA 4NXNF 3KLGB 1N36F 4OHYA 4CRJA 5DM7Q 2RQCA 1EAYC 1ITPA 5HANA 3TR5A 3DU6A 1AZSA 2C1EB 2NLWA 1HHTP 1VQ5S 1WG1A 2EK1A 4F50A 4B9MA 3R2CJ 1M5PC 3EPIA 2HHVA 3HVTA 2P6SA 4ZLPA 2CZ4A 3FNNA 5B0DA 4YOEA 3AOAA 1SUQA 1JXEA 3G8TA 4WCEQ 2WSFC 3U7JA 2DNLA 1SH3A 2B7BB 2GHPA 3MOJB 2XY7A 4URQU 3MMBB 3DOMB 4PPZA 2AEJA 3KK2B 4CLYA 2VG5B 1S1VA 2AJ2A 2MLYA 3PFEA 3MM5B 2DRDA 2ZBPA 3VQSA 4ANCA 3M1VB 3PV8A 4PQAA 3M8PA 1RHRB 3M2UB 2ZZTA 4I64A 5KFIA 3UDEA 1QD1A 3CB4A 4URGA 2MJUA 3TO8A 4O3QA 4V19J 4K4VA 1MROA 4H4KA 4M5JA 4ECRA 4B9LA 3NNCA 3DLJA 1W7WA 3MM7B 4WE1A 5LSRA 5THWA 3T5HA 4P52A 1TL7B 1U1LA 3TWZA 2V2VA 3CJ2A 4WIIA 1F6TA 4UUWA 3OVSA 2XZDB 2VD3A 3HSDA 1UMJA 2MTLA 1FX4A 2WONB 4DCJB 4TY8A 2M0GB 5GVQA 2VFVA 4FYYB 3RGIA 3SI8A 4O3OA 2UVWA 3GV7B 3HLUA 3UDCA 1WG5A 1Q82T 3R7SB 3DRPA 3MHYA 4FF3A 4QR0A 1RTDB 5CAAA 3TQEA 2ASLA 1UZHA 4F8RA 1UVIA 2QLWA 2VG6A 2O1PA 2R7OA 2AJQA 3JAMY 3R7BB 2O67A 5HBMB 3KJNB 1S10A 2EBGA 2J5AA 3P4UB 3D54A 3GJSB 1S0MA 4NLQA 4NASA 1WEYA 1MWQA 1G6BA 5JXSA 1HWUA 1QE1A 4JOUA 2B4PA 3D68A 3JYTB 2OUGA 2JDJA 1F3VA 3OTCA 1YJNS 1UVLA 3MEEB 3H5YA 1VBZA 4DPTA 1FRJA 2WVCA 3M32B 3H25A 1LW2A 3BJYA 1PO6A 3L09A 4LF7F 5D0HA 3HCXA 5DRKA 1N5YA 4OZ1A 5A6WA 3M8QA 2OPSB 3N01A 1X9WA 2DK2A 4RW7A 2KZMA 3CNQP 4Y2CA 2UZAA 1VBYA 1CG2A 2QGFB 2XBPA 2OPQB 2MQMA 1RT5B 2YNIA 2ZHBA 2CUYA 3Q22A 2EC2A 4WU2A 3L4BC 5L1LA 2FJEB 2KVQE 3PIPQ 1N32J 4HKQA 5A8KA 4F4WA 2WHOA 1FVQA 1FVSA 2ZH3A 2FHMA 4K4WA 5HL7Q 2ZOGA 1N33J 4KGMA 4NLSA 1WI6A 3LTOA 2HVZA 3IO1A 4P73A 3OUYA 2VJUA 4RUHA 3KHRA 3D2WA 2K3KA 3W8PA 4DV0J 5DDOC 3UD3P 1Y5NB 1IM6A 3HVTB 4ZPTR 1JJ2R 2FY8A 5C42A 2HBQB 1TL5A 1W2BR 1E6YA 1MMNA 1X4AA 3CJSA 4CH7A 4U67Q 3RB4A 2HMIB 3KK1A 1IKYB 1HWKA 1WI8A 1VS3A 4RW4B 3KTQA 3HT3A 1Q8BA 1WG4A 4IQXA 1FD8A 2B6AB 2BMBA 2OSQA 5F8GA 3EPGA 2HFZA 2M8DB 4TKTA 3LAKA 1TAUA 2HQCA 1S9EB 1RU2A 4O3PA 2VA2A 3IBFB 3KMQA 2LQ9A 4QPXA 5KFNA 2AF6A 2CDRB 1S4EA 4DR5F 1N36J 1IBKF 1VHFA 1NUEA 4EZ9A 2V8HA 3CJ5A 2JNJA 2E7XA 2KL8A 3MMCA 1RWNB 4NXMF 5DQGA 3B82A 1HKAA 1G4CA 4O4RA 2HS4A 2YWWA 5KFQA 2ZJRQ 4HL9A 4UW2A 3GFXA 3IAM9 2BM1A 4BC7A 5F9LA 2LA4A 4L72B 4ED0A 1NJYA 4QIGA 1XJWB 2P6TA 2UVRA 4IQMA 5A0YB 4IYQA 1U2FA 2WB1D 3SCLE 3IA0A 3PO5A 2F40A 1T94A 4DSIA 1HMVA 4PXBA 4CO4A 2EVZA 4ZVFA 2HZAA 3BM7A 5IV3A 5LSOA 3I55S 4DV5F 2H3EB 4M1KA 4YR0A 4FN5A 4DEZA 4RNNA 3BSOA 2CQ0A 2YNHB 3UQSA 2FIUA 1S9GB 2V4JB 2IBOA 4DCOB 2J0QD 1UVMA 2ZOFA 3L95X 5J2PB 4FKXA 4LRFA 2QE5A 2OKQA 4OI4A 1AB8A 5LT5A 1XMOJ 4FDFA 2MEWA 3EMTA 4MK7A 1U8SA 2MZ1A 2W7PA 3BSNA 1JJ4A 2FJXA 2HIQA 2XHCA 5K8NA 1RT7A 3D4JA 4K4SA 2OSRA 3JTNA 3BPDA 1X4GA 2RILA 1PIEA 2VF3A 3VZHA 1JNRB 1NJIT 2D41A 5DJBA 1AW0A 5ETKA 4DUYJ 4RW6A 2XNRA 1HA1A 4AXIA 4YR3A 4CI0B 4NCAA 3HJVA 2I0XA 3AQOA 3OXGA 1ZYQA 4NYZA 4Q8EA 3HFKA 4Q2LA 1F2HA 2J9DE 3OR1B 5K14A 4A48A 4HH0A 4I2PA 4R5PA 2BX6A 3DOLB 5HROB 5D4PA 1QAXA 2ZOMA 3QJPA 3OL8A 4NRUA 3ET6B 4GC6A 2NZCA 2CQ1A 4XPEA 3KLEB 9ATCB 4ED4A 3MCMA 2A6MA 1NDPA 2VV5A 1NXIA 2G1DA 4FVMA 4JB8B 4LR9A 4YP3A 2J7KA 3CDUA 3PIOQ 3M6UA 3EDQB 4K5SA 2C3UA 4MIBA 2BE2B 3NP5A 1PILA 1JLQB 4CYUB 1VCTA 2N4CA 2C22A 1TK5A 2DR9A 1S97A 4L75A 1FX2A 1SB6A 1UAWA 4X66J 2EG2A 5A6PA 1D09B 1UWBB 2AYEA 3C19A 3HHEA 4PAAA 3PR5B 1T3NA 1PAEX 2LYVA 1Z4UA 5IV4A 1HNXJ 4CT8A 2CYYA 2HNDA 2J0XA 3DC2A 1EP4B 2PIIA 4O0NA 4ZVUB 4C7QA 5E5NA 2BA9A 4ILMA 3O5TB 3THPA 2ZM6F 2XY6A 3RR7A 1S77D 1RCOB 1TL1A 2G0JA 3KFWX 4USKA 3DDIA 1S9FA 4J9PA 2XY5A 2J9EA 3ETMA 2ZC3A 4I6WA 3PW4A 1K0TA 4ZLNA 1KS2A 2RQMA 2AJ0A 4ZPBA 5F8LA 1U1OA 4PG4A 3FMWA 3W5YA 4NZ7A 1TMMA 1WSRA 2J9DA 3FBCA 2Z4PA 3NOCA 3PX0A 4YHHJ 3HHNB 2DTJA 4WWSA 4DI6A 2Q66A 2Y3YA 4MK8A 4ED5A 1B64A 1HI8A 5KTQA 2HHUA 1FEEA 4ATNA 2IA6A 4LF9F 5IT4A 3KK1B 3MAAA 4DDFA 5KT3A 3ZNJ1 1RGVA 1HBNB 1RT2B 3CD6S 4DU7A 3OPKA 5E0OA 2U2FA 4GO5X 5IC6B 1X31C 2V4RA 2GAGC 3WZ0A 1CC7A 4DOZA 2RRNA 5A8WB 1ZTWA 3W9IA 3GZ7A 2YQ0A 3VAJA 2A6OA 1NKBA 1YJ9S 3O1LA 2HHPA 1VBXA 3PHEA 3CCVS 1O6XA 2DBBA 1IKXA 2QMXA 2BXJA 4RWWA 3PX6A 1JXVA 2WSCC 1R3NA 1S0OA 3R6GB 5D78A 3IC1A 4OI2A 3CCES 3EVMA 2B56A 2CJAA 1BQNB 1RAEB 1UVKA 2YKAA 5KG0A 3ZC4A 3K58A 2ZZNA 5KFJA 2ZFHA 3T1AA 1VC0A 1N6QB 2DXFA 1HNIA 3UO0A 3OFHA 4KO0B 5KFMA 2VIHA 1Y11A 3THVA 2R3VA 3TP2A 5KG4A 2MZTA 4M5NA 4I67A 1OS5A 1C4CA 3CIMA 5IT0A 3FQKA 1DQAA 1Q16B 4EFAC 4FS2A 1S9EA 2GNKA 4USWA 1DLOB 5LMNJ 2R8KA 4FVCA 7AT1B 4DLEA 3M6WA 4RW9B 4ZP6A 3LF0A 1H2UX 2RB7A 4DL6A 3IWNC 3GIIA 4IFYA 4JI2F 3G4SS 3T1HF 1S1TA 2DNQA 1CJKB 1FDAA 2XO6A 1VRUA 4HHUA 1Y7PA 4ECXA 3U27A 1QTMA 5SUHA 4YB6A 2UU9J 1CLFA 3E2EA 5F9NA 3GYGA 2C2KB 1RA6A 3EGWB 4P2MA 1IJEB 1Z2ZA 1NRKA 5IOLA 1VQLS 1WHXA 4TQSA 5LMUJ 2HVIA 4LF1A 2PT0A 3ELHA 1YWXA 2R9LA 2LFVA 3LGMA 4OX7A 4F0KA 3N9UC 4TN2A 2DNRA 5A8KB 3TEHB 4LSZB 2KU7A 2IIHA 2V69A 3KDNA 1X0FA 4ZS6A 1FKAF 1FD2A 3EVWA 3GIKA 1PSDA 3GWCA 1PYOB 3MCNA 3G96A 2HBZB 3P6YC 3TI0A 3GFYA 4HTJA 5M2RA 5HI7A 1TU0B 4WYWA 5GAEI 1Y3KA 1ZM9A 2DH7A 1ULRA 3BR8A 1XK8A 1FXRA 2XYPB 1NB2A 1LW2B 1OQ6A 3BGUA 4WE1B 5GMEA 1U49A 1HNWF 1VQ6S 5KFLA 2RMLA 1KVKA 1R6YA 2VPZB 2ZUAA 3NLCA 1XR5A 1BWVA 4Q7AA 4Y2MA 1AT1B 2CPJA 2V50A 3EYZA 3NGTA 4FYWB 2G9OA 3ISND 1TQLA 5HBMA 2HHWA 1OY6A 3MMJA 4IRCA 4C3LA 3CGIA 4DV1F 2FPHX 1OYEA 1D9AA 1NB7A 2ZD1B 1HBOB 1ZM4A 3AJDA 2PDAA 3M2VB 2JHEA 1LWXA 1ZAXA 2FVRA 3TUPA 2HHSA 2CNOB 5HQLA 3LO3A 1NHUA 5JUMA 5KFOA 4DSLA 1LKZA 6AT1B 1N56A 2CZ9A 4PG5A 1LV5A 4DCPB 1TP7A 2N3OA 1LK7A 2PA8D 4ZJLA 2WB4A 3JB9k 4OJGA 2L9NA 3IS9B 4W4MA 3I56S 1ZAVA 1T9VA 2DH8A 5KT4A 1MG7A 4ETZA 2W7AA 4DS5A 3KJVA 2E5JA 3P5BP 4NZ0A 1F9HA 1TUGB 1LWCB 3T6JA 4TYAA 4FF2A 1XC9A 3UNGC 1IKVA 1RWVB 1HQUA 1VRTB 1ZAWA 2HNYB 2N4DA 4LREA 5DZ7A 4HEA9 1Q8LA 4KV8B 4N7TA 4DV7J 2MPUA 2JZ5A 3DM2B 1CSJA 4W92B 2DT9A 4NEZA 1SKWA 3JS9A 1N5QA 3NBPB 4GC7A 1X5PA 3N6MA 3NGSA 1O8BA 3OXFA 4F0HA 3QFWA 1X4BA 3BGLA 4B3TF 4K5RA 3VCDA 1ZM3A 4WFNQ 4HYKA 1OYDA 1RAHB 4JI7J 1NU4A 4JI8F 1B0PA 4WP8A 2W4PA 4X4PA 2P9EA 4MFBB 1NNDA 1WC3A 1SV5B 2QA4G 1XEZA 2NYIA 4DMZA 2FLNA 2G4BA 3I32A 1WC6A 1C0UB 1RXOB 4B9NA 1DTTB 3UN2A 5KT7A 2RDDA 3KJVB 5LJ3Y 1MMDA 3BO3A 1HLWA 1YDLA 3G87A 2EPIA 4A47A 4ED1A 2XTJP 4L6V3 3UR3C 2MQOA 1E6YB 1W2IA 1MU2A 3S7RA 3KNGA 4O3NA 4CP5A 3ET6A 1X4CA 3W66A 5CCLA 2BVZA 3FCHA 1T05A 2EFPA 1TMJA 1TVRA 3IG1A 1GMWD 5DDPC 2VICA 1VRUB 2XI2A 1IJFB 1X0PA 1K0VA 3I4PA 1HWLA 4OZ0A 2PI5A 2HLUA 2PD1A 4DL7A 3N0VA 1ZZNA 1QAIA 2FVSA 2ERRA 4LRDA 3PKMA 1S1XA 2RS8A 5K9FA 2ABYA 1QTNB 3BQ2A 5LMUF 1R27B 4PKDB 2B4VA 3W64A 2BJ9A 1ZS6A 4L76A 2YNHA 3GIRA 5CCMA 4DV6J 4DV4F 1S0VA 4YB5A 5D3GB 3DLGB 4U7UK 3RZAA 1RHMB 2BJEA 2KO1A 2MQ8A 3O44A 5KT2A 4ID8A 4PZVA 4C0OC 2FVQA 4AT1B 4R0EA 1X9SA 2GO9A 2V2ZA 3PYFA 4RNMA 3EDRB 1L3UA 4GKJJ 1BWEA 2PE8A 4ID5A 1RE1B 3Q8YA 1FE0A 1RT1A 2ACYA 1FTRA 3D3BJ 4Z7CA 4JI2J 3LWMA 3PW5A 4PUOB 3MECB 3V5RA 2MKHA 2BRKA 1WHVA 2LQ8A 2RQ4A 3VGUA 4YUDA 3G6YA 5E7OB 2R8JA 1C1CB 2RS2A 4E98A 4LBHA 2CZVC 5IZHA 1YRXA 3KXDA 4NX9A 2DNGA 3IGNA 5HSPA 3TA2A 4FXVA 1S7HA 1RAJA 2J9CA 2Z58B 1DY3A 4U8VA 3T3FA 2KKHA 2DHXA 4NZ6A 1DAXA 1R8AA 2EFNA 3WC2A 4JI3F 3J7Z5 2DR8A 4G1PA 3TA1A 5EWFA 2M88A 2ADCA 3CCZA 3TZZA 1FXLA 1S5ZA 3F73A 3D1OA 3MM8B 1IKWB 2AU0A 4LF9J 2DY1A 2KI2A 2A1BA 3VR1A 3W2VB 8ATCB 1M5KC 3K2YA 3MEDA 1NPRA 4OZLA 1HI1A 2CDQA 4AUKA 5T14A 1K1SA 2WAQD 2KFYA 4DFPA 5IS2A 3CJRA 1ZPWX 3D3CJ 1XMBA 3RBEA 1S57A 2K1RA 3V6HA 4BLGA 2WONA 1OSDA 2XMMA 3NRBA 3M9NB 2XHWA 1TL3A 4MKVA 5E2QA 5C42B 4ZHRA 3PW7A 1UEUA 3FQLA 4RLEA 4BHQA 4USIA 4ERDA 1IR1A 2VKZG 4IG0A 4DSFA 1RT3A 2P9GA 4CLTA 2VU5A 1NPKA 2HQ3A 2F9DA 1Y00A 1H74A 2G2OA 3LPEA 2LQJA 1UZDA 3HHDA 4X4NA 1U25A 3A8JA 4OL8A 3M2RA 1YVFA 2VQFF 1HFEL 5F41A 1P1LA 4ALZA 1I6JA 2JSXA 2NXUA 2Z2MA 2M70A 2DPIA 1TK0A 2H1YA 4UOHA 1RWXB 1TR0A 3CTRA 3ZZ0A 4CLSA 4X62F 4JI6J 3C2PA 5B0EA 2ZH7A 3PYDA 3EXCX 5DQIA 2GJ2A 4F2RA 3MMBA 2BKNA 3CCMS 2PGCA 2RH3A 4DR2J 3IWLA 3RTVA 1M1GA 2HWTA 2VG7B 4F26A 4X4QA 1HNXF 4K2XA 2HNZB 1HBNA 1RT2A 3LW5C 2JEFA 3BDEA 1RK8A 3P96A 5CHCB 2MLXA 4X66F 2C2ZB 3ENWA 3MFHA 2B4OA 2Y9HA 5KFFA 2KG0A 3FK4A 2NYHA 2ZC4A 1KHWA 4LIWA 4W98A 5ADZA 3EVOA 4V1Ak 5EHHA 2CQ2A 2IAJB 3JSRA 3KYLA 1V6HA 2LLZA 3H98A 1WNEA 1Q5YA 2Y8WA 4NLUA 3S01A 2B4UA 4ED3A 3VVUA 3GE9A 2DNYA 1OSCA 2D7SA 3R5AA 2NQPA 1H7XA 4ZVTB 3MEKA 1VJWA 2YNGA 3DRSB 4QWCA 2XWXA 2GJIA 3CJKA 3IAS9 2HLTA 1QSYA 4J91A 1SKUB 2E9RX 3RUBL 1V3RA 1FRKA 4USUA 2ZEJA 5H1SV 1HARA 2AX1A 3IM9A 1RT3B 2COLA 3W2WB 3MPWA 4DPYA 2IDLA 5LM7E 3Q23A 1FXDA 4AXJA 3BPSP 1L3SA 3OVBA 3LGNA 5I42B 3T1YF 2IM2A 2NPIA 1HNIB 3VF0B 4CO3A 2ZH9A 4IG3B 3TAMB 1GX6A 1NLKL 2NCKL 2OHDA 3PEJA 5ETQA 4JUZA 3W7BA 4X4SA 2LXUA 4XIUA 3A8EA 1ZTTA 2C28A 1U1QA 4LF5F 1XMOF 1WORA 1GMUA 4CLWA 4HHHA 2HZVA 2E1RA 2DNOA 3KLEA 5L1KA 4DR3F 3Q8SB 3MR2A 2XG8A 4CH1A 4LRCA 5B0FA 2WVFA 1JLBB 2IC3A 2M4MA 3Q8VA 3W60A 2KFNA 1B0TA 2HBYB 4Y2KA 2CA9A 3DI6A 4K4TA 1TUWA 3H2UB 2GAHC 3P3DA 3E01B 4RX6A 2HVEA 4KB7A 4WZQA 3MPVA 3ZXWA 4NMLA 4IG3A 4ECUA 5DDRC 1ACMB 2HFVA 2WVDA 3HT0A 4LSLB 4OYZA 3T5LA 1S7IA 1CULB 2MKKA 4I56A 2Q1LA 4NI2A 3NCRA 1XERA 4IRDA 2EKYA 2H9ZA 1HNZJ 4UQTA 3L7PA 5ETVA 4Y00A 1N8RT 2J0WA 2GHWA 3HHLD 2EW9A 4H4MB 5CYQB 1YJ7A 2EEYA 4UQGA 3BDPA 3FKBA 4ZCLA 2HFNA 1HNVB 3N5BA 4UOFA 2UXBJ 3OR2B 3M8RA 4YB7A 1VC5A 4MKBA 1X4FA 3RG6A 2YX7A 4FYDA 3NXZA 1EQMA 2AZ1A 1VBKA 1NPPA 3AJ2A 3LUYA 4TNOA 1HHSA 3B78A 2AEFA 2I6WA 4LF8J 4K4UA 4QYZK 3D67A 1S4FA 3MCOA 2BKPA 4HT5A 4K7QA 1FJ7A 4S0MA 2KXHA 3I6PA 1SC3B 1GFWB 3LPYA 3J7YI 3NGRA 3HVRA 1OIAA 4DR6F 4HTIA 1LWCA 2HFSA 3G8SA 1GAOA 4H4MA 5HK4A 3TUZC 2QN6B 1BXNA 3LGHA 1QJHA 3M8SA 2V4QA 1RWPB 3QQCD 4CT9A 5DG9A 3R1HA 2WOMB 3BV8A 2Q43A 3CO9A 2QL9B 2W2QP 3QPIA 3PO4A 4CCHA 1TK8A 4I68A 4NMXA 3FRYA 4MAKA 2BE9B 5EGYA 3G6ES 1LXNA 4FXWA 1S79A 1RBOB 3SQGB 4XAKA 1M1KT 4RKUC 2V8GA 4M5GA 4LF7J 2D1CA 1IQZA 2VKRA 4N77A 3MZIA 2CNKB 5FD1A 3SSRA 4NLOA 2LEBA 3FCWA 2KG1A 1P9QC 2R8IA 2BOPA 3I0SB 4G3IA 2YKNB 1NO8A 3ZZRA 3EICA 3M32A 1WACA 2ADBA 5CYMA 3UWTA 1Z1ZA 3FDSA 1VGYA 2J6UA 2IA0A 4DJBA 3ILOA 1FNMA 3CCWA 2L41A 1D0EA 2UUBF 4IRKA 3S1TA 1R89A 2ZNZA 2VUGA 4OHZA 5J2NB 4ZIWA 1FJCA 2Y0SD 2IPOB 2XSFA 1O5JA 1RKIA 3HVAA 3KLFA 3HXMA 4QJVA 4ZP8A 4TU8A 2B51A 3PVXA 3C66A 4XPCA 1SKRA 3IRXB 1ZOTA 4AQYF 2XB2D 1IVZA 3NMRA 1SQFA 3MFIA 4KJIA 4ED8A 1XBWA 3TX8A 2GQQA 3AOBA 3BEGB 4UUXA 4X65J 1ZA1B 2DHAA 4CIOA 1QVGR 1JLFB 2E44A 2HNYA 1RT7B 1NK0A 4OX9J 2RT3A 4RU9A 2XMAA 3JTOA 2RKIB 4OMFG 1FJEB 1V5VA 2F1FA 3KMSA 2PMHA 3JSBA 4RUBA 3A13A 4WYLA 3CCRS 2LECA 2DRBA 1SJRA 4BS2A 4X4RA 4F36A 2UXDF 1VOMA 5D8HB 1RKJA 5F8NA 2HGMA 1LNQA 2IM3A 2RAQA 5KFDA 3ADAC 3DCAA 1FERA 5AE3A 2F5GA 2I38A 5DS7A 4I2PB 4RPFA 2AQ4A 2BUNA 1M5OC 4G1QA 1VQNS 2ZM6J 3M30A 3H4BA 2CPYA 3VAHA 2VDHA 4TU7A 2OD6A 4GVLA 2V8PA 2E5LF 4DL0C 1TZ0A 1T9UA 1JJHA 1Y4ZB 3AB4B 3SEOA 1CULA 4X64J 3K89A 2E7WA 1URNA 2EK6A 2APOA 1NH8A 2CPIA 2EXUA 2N3LA 2OD4A 2YWGA 2Z56B 3FSYA 5HMWA 5MAOA 1R8BA 2JFKA 1S1WB 1NBEB 3CE8A 4Y28C 2D69A 3CCJS 2UUAF 5DZ6A 1VQYA 4DQIA 4ANEA 4DS4A 3FVYA 2VODA 1RU1A 1TV6B 3CSKA 4OJHA 5T7LA 3I5AA 2L9DA 3BB5A 4TY8B 2DNMA 4ZKAA 4H4OA 2GJFA 3MURP 1QM9A 2B5JB 2ZNYA 3Q2TC 1E6VB 1CS4A 2E1AA 3A3NB 4DN9A 3CJ3A 1R0BG 4TLQA 4MFBA 1NK4A 4F3OA 3D9BA 5DDQC 4C8KA 2OP5A 2V4JA 3I4HX 4WZMA 5IWAF 5D3GA 2XZTB 3LP2A 3KLGA 4PWDB 3BGFA 3C6TA 4RW8A 1G3OA 4YEAA 2R7TA 3KNAA 1UL3A 2PEBA 1AA1B 2CQDA 5I4MA 4DUTA 3CULA 3JSMA 3M7VA 2WK4A 1U7LA 2PEHA 3R9LA 3G6XA 4OYXA 4RBTA 4IOAQ 3B4MA 2UV8G 4AD6A 2BV3A 2DGWA 2VHGA 3T19A 5IXUA 5I3UB 3KG1A 2E5HA 1PJ5A 2YQ3A 4OYPA 4M5KA 5GAEU 2CNNB 3GP9A 4LF4F 1U48A 3VAGA 2JC0A 4WK3A 3UDLA 2UUCF 4I7FA 2YWEA 1SIZA 3GU0A 2NXJA 3M1VA 4ETXA 2NS1B 2JWNA 2V6AA 2YKNA 3B8HA 4IO9Q 1SXLA 4IR1A 2VBZA 4OQJA 1FFSB 3S6EA 3MR6A 1N5VA 5G0RA 2O5DA 3G8QA 1CVJA 4ILRA 4KFBA 1YJVA 2FQQB 1BQMA 1X8DA 2QTWA 2XMUA 3T9ZA 5IT9U 2HQFA 5HATA 3VGTA 5KT5A 3HPOA 4P75A 4DV2J 1Q4RA 2R7WA 2W25A 4Y0FA 2YNFA 3HM9A 4M95A 4ZPDA 4EEYA 2HGNA 2AEMA 5GAGI 4A8MP 2ZWOA 3GYXB 3QGIA 1U1NA 4NXNJ 1PBUA 1RBAA 3DLKA 3DGPA 2J76E 4OI3A 3H8YA 5D0EA 4DF8A 5KG6A 2HK3A 1RISA 2HHTA 2DO4A 4Q5VA 2XWYA 2UVVA 5T41A 4I1TA 4X4OA 5AXKA 1EP4A 2FGCA 2DGTA 2R4FA 3IBWA 2IRUA 3L9ZA 4HI2A 3X3UA 4EU0A 4J9OA 4LF5J 2KN4A 1DTQB 8AT1B 1FT8A 4DV5J 2PN6A 1JLCB 2W9CB 4OHVA 3TX0A 2KJVA 4KGKA 4OI6A 2DNZA 4ZIVA 2I2YA 1EETB 5FLXU 4ECQA 4CQ1A 5J1EB 2ZBRA 3BKTA 3DLKB 1SH0A 1YQHA 3CD5A 3G82B 5KFYA 1TKTA 4MIAA 1GT8A 4ZHRB 3UR0A 4WK1A 3LP0A 3MEDB 1KVIA 2IM1A 2GQ2A 2HK2A 4ZVPB 5BR8J 1T9YA 4LF2A 2W01A 3QT5A 4NLYA 5HVFA 1DARA 2BW7A 2CJYB 1WOOA 4GKKF 4ICLB 4J9MA 2KHDA 2CJXB 2DISA 2EFVA 3LA0A 3UVJA 3MWBA 4R8UB 2GW8A 1KOOA 4FPRA 1VQ4S 2Z57B 2XULA 2W8KA 5AT1B 4Q0BA 4ZJQA 5FDLA 1RCXB 4JI1J 3DMJB 3FGVA 4OYBA 3BO2A 2QYCA 3D5MA 1GK8A 3KUGA 1HBOA 5B0BA 1UVNA 2I5JA 1RWUA 4N41A 1EQ0A 2KH9A 1SC6A 2Z8QA 1CBKA 3P5TL 3N4WA 2QEXS 5A2QU 2RNEA 2RJZA 4P10A 1U0HB 2F9JA 4MMOA 3CDBA 4F3MA 4A8WA 4IH5A 1U1PA 3ILJA 1BMQB 4LBPA 1QSLA 4F2SA 3AHPA 1T9WA 2BE2A 1NCLA 2OPQA 4KSEB 4X62J 3A12A 1ZPVA 4PXCA 2R7UA 3RBZA 1SL1A 1VQ9S 2I9SA 5DM6Q 1FNOA 1SPBP 3DRSA 4DU8A 1UA0A 5HO4A 5C24A 1RAGB 3PCOB 1QAJA 3FEZA 2CJ9A 4QCLA 3DLEA 3R6LB 2LCWA 4LSLA 5ITHA 2VL1A 3H5UA 5HQ8A 1Y3JA 2R2TA 5J1EA 2E5LJ 2R2RA 2HHHF 4C98A 3O2IA 1ZM2A 1FFGB 1IBCB 3F56A 2MQQA 4A4JA 1T9XA 2NSCA 3CJKB 4WFAQ 2BR0A 4FXDA 3SSSA 2EC0A 1RLDA 1NDCA 2EI5A 3EGVA 1CC8A 2C2RA 4I69A 3CD7A 2NR0A 1N5TA 1DHMA 5K8MA 1JLGB 4ZPCA 4C8MA 4CZCA 1A9NB 3NWGA 3CPWR 1F2GA 3VHQA 1NM2A 1TTHB 3JXOA 4TLRA 5D4LA 4USMA 1RTHB 2XYHB 3HFZB 4JI4J 1GQEA 3D0IE 4DFKA 1A6LA 1X4EA 2FTRA 4QIFA 3QSYB 4B3RF 4RO0A 1KFDA 3OFFA 4X64F 5G0RB 1TFYA 2DB1A 2HRUA 2X1GA 3A3OB 3ZTSA 2XEXA 3QGHA 2VBYA 2CJQA 1LWFB 3JAMU 1YX2A 2GIRA 4RNFA 4C2MA 3T5KA 3UCUP 4C4WA 3VALA 1EZZB 3PEHA 2GVDA 5B7WA 4I2QB 3GJTB 2DHGA 4WU3A 5HVGA 3J7A1 2HPUA 4ED7A 2QIFA 2CPHA 1MROB 3ETOA 3HHLC 3T1HJ 1BQNA 2P8IA 3GFZA 3Q8UA 4NA2A 4PEOA 4DL2A 1C1BB 3SBMA 4QW8A 1GTEA 4QIVA 1UW9A 1WC0A 2RDIA 1RT4B 4DX5A 5L39A 2VC1A 3H40A 2DNNA 2AD9A 3HDSA 1KLNA 5F8MA 2MQPA 1GH8A 3MI7X 3UPFA 3FSIA 2HVDA 1H2VZ 3MCSA 3NS5A 1UEVA 1RSCA 4A8QA 1VQ7S 2BQ3A 3J7AN 2QV6A 2R7XA 4X65F 1HMVB 3K5NA 2K06A 2YWFA 3OXLA 1KWMA 3PJ9A 4WF9Q 1YRTA 3D6TB 4XTTA 4HDGA 3CO0P 5GADI 1NK5A 3T9NA 4A8OA 2ILYA 2F63A 3ISZA 1YRUA 5JMNA 1GMWA 3HF5A 2RU9A 3THTA 1T9TA 3CVKA 3I87A 2JLEA 1VI7A 3LANA 1FWLA 1Q53A 2Y1RI 3BYRA 4G1IA 3KLFB 1YHQS 1KNZA 2XLKA 2GGPB 3G71S 2MKYA 2ZE2B 3HSZA 4OYMA 4WXOA 1M1HA 1Q0NA 1QE1B 3JYTA 4Q45A 3LP1B 2CVEA 4J9VA 4QIWD 4ZP9A 4LUBA 5FIIA 1S1XB 4AYBD 1FKOA 4U7CA 3RB0A 3DHXA 3DKDA 3GSIA 2H5JB 2ZUGA 4RW6B 5DG7A 1B7YB 3HHLA 1RTJB 1F9FA 2DR6A 2HSEB 1ELOA 4BWJA 5CD4H 1RTDA 1T03B 1H98A 5AE2A 3U02A 3TZWA 3QAUA 2XMJA 3CT9A 3MAHA 1WF1A 3DMJA 2M7SA 3C16A 3DHWC 4PYDA 4ZOSA 4ZVSB 3SFUA 2CFXA 5HVHA 1WTBA 2DGVA 2UUWA 4B9UA 1XTZA 2VFSA 2WRMA 4ID5B 2OH2A 2QX0A 8RUCA 2O3DA 1FK9B 2IFXA 2HW3A 1PYSB 1TKTB 1Y10A 5L9XA 1I3OB 1BLUA 2AHOB 2BBEA 2ZVSA 4KC5A 3QZ8A 3MAQA 5F0UA 1DQ9A 4KHRA 6FD1A 4DF4A 1NKEA 4JI0F 3J7ZT 3NG8A 1VQSA 1JLFA 1OPIA 1QDUB 2F8HA 3SDEB 5DLGA 3Q83A 2WCXA 1U02A 1KTVA 4G6VB 3IMQJ 4M5IA 4TYBA 3D0HE 2Z2ZA 3VWSA 1BHNA 2HRTA 4Q2MA 5F3ZA 3V4IB 1IR2A 1PCAA 2MY7A 2UV8A 3MMAB 2A18A 4DR3J 1V5IB 1DURA 2LU1A 4F0MA 4ZVRB 5B0AA 1R0AA 5LXRA 4LFBF 1HPZB 2UUTA 4DPOA 4DV7F 3Q0AA 2LU2A 4NI2B 3GMGA 2FC8A 2IAJA 1TKXA 2MQLA 4ZN1A 5HP1B 2IBKA 1APSA 5KFSA 2CPZA 2GO8A 3C46A 1U6FA 1IKXB 3CJTA 3M8WA 4UF4A 4KYZA 1FTCA 4JV5F 3HFVA 2ZJQQ 1TV6A 4ZVEA 2HVHA 1S48A 2FZCB 5D0RA 1TKDA 2BQUA 1GTHA 2DGQA 3QZ7A 4B3TJ 1WHWA 4BBYA 1IBLF 4USHA 3EZ5A 4FS1A 2ALZA 3QATA 4E0DA 4XDDA 1UJ4A 2WVEA 3W9JA 5JVGQ 3ICLA 4DSEA 5J2MB 4KGXB 2WW4A 1FHTA 1FDDA 4DX8H 3EWGA 2HNZA 4A8XA 3MTKA 4A8SA 2MSTA 3W2WA 5C2GA 2KT3A 1FRXA 3I0RB 2EG1A 3JQJA 2DRAA 2R2SA 4LMZA 3QYYA 2AWZA 4DV1J 3QT7A 4NCBA 3S8SA 4EMDA 1SC1B 2MZRA 2HGLA 2P2CB 1RWKB 2CIMA 3M2VA 1MSWD 4XK8C 2JLGA 3CCUS 4DL5A 2RRAA 3D66A 3H7HB 3TZYA 4KPCA 3R5CA 4QU7A 4BCAA 4HT7A 2ZJPQ 3AH6A 3H5XA 5E41A 4OI0A 1W25A 2QFIA 1NHVA 4LR7A 1B70B 3AY0A 3FFIB 4NPOA 4NYPA 2DNHA 3HHKA 1LW0A 2FC9A 4ZITA 3D1HA 2BYCA 2YKPA 3EE3A 1JK9B 3M8PB 5EDWA 1WDTA 2IMOA 4MKYA 3ZZUA 3KUHA 3R5BA 3NWRA 3OT9A 4NOHA 2HFUA 3C15A 1VLOA 3N28A 1KR4A 1U24A 4CNYA 3KK3B 3F44A 2FJWA 2XLIA 4CLZA 1V3SA 5KFEA 3OHBA 4OZ2A 4DLGA 4FBTA 1SQEA 3BN7A 3I0RA 4LJMA 3TUIC 3W9HA 2VQFJ 2JEJA 4DQPA 4DFMA 2G2ZA 4LBIA 2YNFB 4PRFA 3D7SB 2DIUA 4IKAA 4WXWA 2UXCF 2IRXA 1WC4A 1UWAA 3RU0A 3RRKA 2HAFA 3C6UA 4DR1F 1H6KX 2X7IA 3MM8A 2U1AA 3PR4A 4UZBA 3MEEA 1DRZA 5HAOA 3PNIA 4DR7F 3ILIA 2UU9F 1S0NA 1XMQF 1WC1A 4ZCMA 4DV3F 2UVUA 3NMAA 2R42A 3C15B 4JI6F 2UUBJ 1BY9A 2A10A 3MD3A 5IM0A 2V68A 2L08A 1D9FA 2LQ5A 2X1FA 1N52B 1SI9A 3IR5B 1B99A 5I42A 1LW0B 2HG4A 1D1UA 1VJQA 3UVJB 2JEGA 1FE4A 3J80U 3CCLS 1NK9A 5DGBA 1VMBA 2VPXB 4GKJF 3M30B 4B3OA 1WEZA 3D0GE 3DXSX 4NE9C 5ETPA 3VV2B 5AJ3J 1JMTA 1PC4A 4JBCA 4NL5A 3J80Y 4F4XA 1SKSA 3M4XA 3IRWP 2YH0A 3M6XA 5D0GA 2Q6CA 1Q1KA 1X9MA 1R43A 4J90A 1BUXA 2V5HG 2KM8B 4ZDNA 2XS2A 3DXBA 1N0UA 3BF4A 2VZ9A 2YXLA 5ETLA 4NRTA 4FP9A 4ZN3A 3QWUA 3R27A 1UEKA 2OEJA 3FBFA 3K59A 4JV1A 4OLPA 2PI4A 1VR6A 2CVIA 3C3LA 5ETSA 1IWGA 3KJFB 4EO8A 2XSJA 3OJSA 3ZZYA 1I94F 3RBDA 1J2VA 1C0TB 4PYAA 4NWBA 5B0GA 4ECYA 2YVSA 3A3PB 4M94A 4MYUA 3EGZA 4K50A 4CLKA 2W9BB 4YDDB 3CCQS 2F4FA 5HP1A 1CPZA 1VYAA 2C3PA 2E1PA 1RAAB 5E3PA 4R8UA 1S12A 2FJBB 3SFGA 2FY1A 2XS5A 3UD4P 1GEHA 1WC5A 3O6QA 1VQMS 4U7UD 3IR7B 6FDRA 2POKA 4OYWA 5AXLA 2OEMA 5LL6d 2ZH5A 2I8EA 5K5MA 2YPYA 3LP0B 5GMDA 2KT5A 3DN9A 3RAQA 2HEKA 3R5DA 4AE5A 2KT2A 1JKHA 1A0OB 2XGQA 3HD2A 1GXUA 2C2OB 3FUYA 4EZ6A 2PC6A 1C0UA 2RHQB 2YWHA 2D3O1 4UY85 3H2VE 4K59A 1FKPA 2ZBCA 1NK6A 4OI1A 1AUSL 2WOMA 2H54B 2AZ3A 2X3GA 5MLCV 2XS7A 4OV1A 2FLLA 1Y9OA 1R6VA 1FI4A 3Q86A 3ZZOA 5M2UA 3MM7A 5AJ3F 2DR7A 1HI0P 3ILLA 3V2UC 2GVZB 1Z2LA 2IY5B 2BJ7A 4HHJA 4J9UE 1Q79A 3PKYA 3GCWP 4USTA 3JQMA 4NLTA 3OLAA 3M8ZA 2UP1A 2ZITA 2XNQA 3QNWB 4QU6A 3T1YJ 5E3CA 1YJUA 3QWPA 4CLUA 1CJTA 4NLDA 3C6UB 3HO1A 4IOCQ 1Q5VA 2Y0BB 2FGOA 3GYNA 3HZEA 3I5BA 3NS6A 4H54A 2N7CA 5J2NA 3ZTOA 2V63A 5A8WA 4G65A 2VBWA 3NOGA 2MGZA 4ECVA 4C8YA 3OTDA 5SZTA 2AJ4A 4YY3F 2B9EA 2J8SA 3UFCX 3OHAA 1VLYA 4P6QA 3A8IA 4ES1A 4J9RA 2ZD1A 3FMBA 4CLFA 5K20B 1S49A 1T3OA 2QLBB 3DOLA 1NZ8A 5EWGA 5HROA 4OJ1A 1HBUB 1XNQF 4ZVOB 2ROPA 1LWEB 3SMZA 3MUMP 2ZDOA 1X7VA 3BGRA 5BJRA 1VIXA 3MPDA 3MGJA 2YQ1A 2J8AA 2QSWA 3DRXA 4KBIA 2HS3A 1JJCB 4KE5A 4C0BA 4O4GB 5AXMA 5AE1A 1P27B 2ATLA 2FJVA 3LAMA 5KFVA 3TJ8A 1ZETA 1G1XA 2CPDA 1YG0A 4F4YA 1SJ4P 2G13A 4P72A 2FZGB 2RU3A 1C1BA 1PJ7A 3JSYA 3GV8B 1FRHA 1LQ9A 2DCUB 1FO1A 1UP1A 3KLIB 4DR2F 2NUHA 3NL0A 1AFJA 4R0JA 1YBUA 3V81A 2C2MB 3KHHA 4LF6J 1WWHA 2IM0A 4DUYF 3MF5A 3ONQA 4EWTA 4B3MF 1KOHA 3IM8A 3DGVA 3NKYA 2KVIA 3OTEA 3GLJA 2HRYA 1S1UB 1S59A 3BO4A 2DNPA 2P9CA 1U09A 2HWIA 5DQHA 2XC9A 2ZKTA 4IUFA 1FJGJ 1ZH5A 3G9CA 4ZCKA 3BR9A 3JTPA 1IQTA 3Q89A 1VRQC 3BH6B 1WOSA 2OPRA 1KDNA 3AB2B 5H9EJ 2PSZA 1R0CB 1HR0J 2LVWA 3GJRB 3W62A 3WQPA 1S1VB 2B0GA 4KGZB 1PAUB 3OR1A 4ZPAA 4F7VA 2DR5A 4B3SF 4ECSA 3TVZA 5CZVA 3CJ8A 2ZH2A 4FYVB 2DEIA 3ZTRA 2ROEA 4K0KJ 1YBTA 2DXDA 2L9WA 3DRYA 5DGAA 1RTIA 1WF0A 2DGOA 4DN0A 4PR6A 1P8GA 5J2PA 1J27A 2Z2LA 2IJFA 4C8OA 2R8HA 4P2XA 4FZVA 4MKAA 3RB6A 4JI5J 2MYFA 4ZA1A 3SZ2A 3Q24A 4ELVA 2RSQA 3B4DA 2D9OA 4JI3J 4EGLA 4PWWA 1W26A 2QSFA 1IBKJ 2DPJA 3IGVA 4IDKB 3J7YU 2J6SA 3G86A 1CJTB 2DEJA 3WHIA 3FZ2A 3D1QA 5G4DA 3V6DB 4DV2F 3P49B 4C9DA 2BRLA 5LXYA 2RUSA 1NDLA 2A0FB 3I5CA 3POTB 4WJBA 2AKWB 1IBMF 1I94J 2MKJA 1Y0HA 5KFWA 3LALA 1UJ6A 1N0VC 5B09A 2KXFA 3V6JA 4C48A 3VAMA 1X4DA 1YJRA 2GCFA 1R7IA 1XQIA 4C11A 4DZ6A 5IFMA 3R7NB 3GB0A 3QGPA 2B9XA 3HJFA 4QYRA 2D3OR 2IHR1 1KHVA 2AGPA 2DGUA 2M8HA 3H20A 3W65A 4MYTA 4WFZA 2AYBA 2HZCA 4KH0B 1KEKA 2Q6BA 3HMJG 3TAQA 4KT0C 1JKHB 4RW7B 1RADB 3CCSS 1OPZA 2BJ1A 3F0NA 3DYAA 1KQKA 5L46A 1JLAA 1FRLA 2J7WA 1G7CB 2CRLA 4ZLLA 2MB0B 4JI4F 5L8RC 2XZWA 3K5LA 4C11B 1TFWA 1EB0A 1EKRA 1IKYA 3KLIA 5F0WA 2RD5C 4DV0F 1XMQJ 3JQKA 4PABA 4MH8A 3IP0A 1WJ9A 2HFOA 2HS0A 1Q78A 3MECA 4TU9A 4BDPA 1SH2A 1IR0A 3WC0A 1YITS 2B9WA 4CO2A 4KR0B 4DPXA 5U47A 1RA7A 1DBDA 3O8WA 5D6GA 3OV7A 2MKCA 2Q79A 4Y2AA 5E3RA 3M9MB 3JSMB 1ICEB 2K8GA 1SC4B 2MKSA 4U96A 3M9OB 1AYEA 1F5CA 2E5GA 4BWMA 1AUDA 1KKHA 4Y34A 5A2QY 3CMQA 5EX3A 2DD8S 3QT8A 2HQIA 4ZP7A 3RW7A 1X4HA 3W2VA 2R7RA 4JI7F 2BANA 3HZGA 4B17A 5HMYA 2ROGA 1N88A 3CUNA 2H4WB 5GADU 2FJDB 2I5JB 3MR3A 3K17A 2OMOA 4D3GA 4WTOB 3MUTP 2XMWA 3PDNA 1DZ5A 2QL7B 4LSNB 2UXDJ 2ALYB 2VFRA 3QGGA 1TVRB 4AL7A 3BBFA 2WW8A 2ZH4A 3D28A 5H9EK 3MXHP 2C2NA 1NK7A 1CJUA 4TY9A 3OTOF 2LEPA 2JLFA 2BZ2A 1RTHA 3BZQA 3CXCR 1K47A 2QMUB 3H2LA 2J6TA 3BKUA 2C3MA 3FZBA 3DLLQ 3MPUB 3GFHA 1HQ2A 1YTYA 1EARA 2GIFA 3DLEB 3V4IA 4UOCA 2CAJA 4R25A 4X4UA 3V6DA 2QLFB 4ELTA 4KKOA 4WKRA 1PYTA 4X4TA 2ACMA 4RNOA 3TANA 1QAYA 5DETA 2MZJA 4Y65A 1HPZA 3MPYA 5ETMA 3E3XA 1S9GA 1T11A 3BBCA 4N76A 3LP2B 1WEXA 3ZZZA 2E7VA 2F65A 2GGPA 3R3TA 1AFIA 5CXTA 1LOUA 4EBCA 4JV5J 5EUHA 4B3OB 3J81j 3IR6B 1B3TA 4PG6A 3BREA 4DL3A 3BQ1A 1SIWB 4I0WA 2RIJA 3R5GA 4CTAA 4X4VA 2P5VA 2XLJA 3UCZP 3LWLA 1RT4A 2GHVC 4P7TA 4ZPVR 2CQ4A 2JFDA 4NCGB 2N7YA 3GSDA 2DHSA 3IFEA 3WIUA 1K1QA 2W1BA 3BKFA 1IKVB 2F8MA 1ROFA 1VRTA 3ZZTA 2CQPA 3BYPA 2V9WA 3ULHA 3OTBA 1P1TA 4YQWA 3MM6B 3KHLA 2LDIA 2R7SA 4KRWA 1LK5A 2IVYA 2VG6B 5LSLA 1OY9A 2V2KA 1UVJA 5IT9Y 3FEYB 3C16B 4ES2A 2X51A 2Z0GA 1S1TB 3QLHA 2VQEJ 1LFPA 5KFBA 2I1RA 1LWEA 3HD1A 4JP8A 5KG7A 3SV4A 2E1CA 1UCNA 1LFWA 2RQKA 1F3FA 4NA1A 1JIHA 2V2QA 1MN9A 2YTCA 4XO0A 2DGSA 1XNRF 3IS9A 1U2CA 3GONA 1RAFB 1HQEA 2QL5B 5BR8F 3RAMA 4I7FB 3KHGA 4ZVGA 1RJJA 2FUG9 2F7VA 2WSEC 3BH7B 2K7JA 2LP4A 1U6BA 3UI3A 5EN1A 3SXLA 3BN4A 5CD4A 1IN0A 3VTIA 2NPFA 2MQNA 1UFWA 4DQRA 1P6TA 3NY0A 2Y1IA 1NSKL 1RLCL 3ZNUA 1WKKA 4M5MA 3WX4A 1S76D 1CQNA 5C24B 1EHWA 2DKOB 2BEFA 2FJAB 4YR2A 3CMES 3UN5A 1EETA 1GXTA 2KHCA 3EX7B 4ZVHA 1RYRA 2FLPA 2JH3A 5HN0A 4IFVA 3GG1A 1RTZA 4CO1A 1PKUA 1RT1B 5ETRA 5KAKA 2BACA 5FLXY 4J9SA 5EX0A 2GMHA 3Q8RB 1UWBA 3UNYA 3D6MB 2OPSA 2H5EA 1JB0C 4TVAB 2CKWA 5GAHU
chains in the Genus database with same CATH topology
1RWNB 1SC4B 2C2ZB 1RWOB 1I51B 2H48B 3P45B 1RWWB 2H5JB 4ZVPB 1F9EB 2H4WB 1RHRB 2C2MB 4DCOB 2CJYB 2QL7B 4ZVTB 2CJXB 4ZVSB 2C2KB 2QLJB 1QTNB 2XZDB 1I3OB 3D6HB 4DCJB 1RHJB 2H51B 3GJRB 4ZVQB 1RHMB 2QLFB 3KJFB 1PAUB 4LSZB 1RHQB 1QDUB 3R7SB 1BMQB 3EDRB 1RE1B 1PYOB 2HBZB 3R7BB 2HBYB 3D6FB 3KJNB 4ZVRB 3KJQB 3GJSB 3P4UB 4JB8B 5IC4B 2XYPB 3EDQB 3R6LB 2XZTB 2HBRB 1IBCB 2XYGB 1RWMB 2C2OB 2Y1LB 4ZVUB 2XYHB 2H54B 2CNOB 2CNNB 3IBCB 1NMEB 3R7NB 1RHUB 3RJMB 4DCPB 1SC1B 2P2CB 1RWKB 2H4YB 1SC3B 1GFWB 2QL5B 3R5JB 2H65B 3QNWB 2FQQB 3GJTB 2CNLB 1RWPB 3GJQB 2HBQB 2QL9B 1RWVB 2Y0BB 5IC6B 3SIPB 1RWXB 1RHKB 2H5IB 3NS7B 2CNKB 2DKOB 3IBFB 5K20B 2CDRB 2QLBB 4ZVOB 3D6MB 2C1EB 3R6GB 1ICEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWN B;  1SC4 B;  2C2Z B;  1RWO B;  1I51 B;  2H48 B;  3P45 B;  1RWW B;  2H5J B;  4ZVP B;  1F9E B;  2H4W B;  1RHR B;  2C2M B;  4DCO B;  2CJY B;  2QL7 B;  4ZVT B;  2CJX B;  4ZVS B;  2C2K B;  2QLJ B;  1QTN B;  2XZD B;  1I3O B;  3D6H B;  4DCJ B;  1RHJ B;  2H51 B;  3GJR B;  4ZVQ B;  1RHM B;  2QLF B;  3KJF B;  1PAU B;  4LSZ B;  1RHQ B;  1QDU B;  3R7S B;  1BMQ B;  3EDR B;  1RE1 B;  1PYO B;  2HBZ B;  3R7B B;  2HBY B;  3D6F B;  3KJN B;  4ZVR B;  3KJQ B;  3GJS B;  3P4U B;  4JB8 B;  5IC4 B;  2XYP B;  3EDQ B;  3R6L B;  2XZT B;  2HBR B;  1IBC B;  2XYG B;  1RWM B;  2C2O B;  2Y1L B;  4ZVU B;  2XYH B;  2H54 B;  2CNO B;  2CNN B;  3IBC B;  1NME B;  3R7N B;  1RHU B;  3RJM B;  4DCP B;  1SC1 B;  2P2C B;  1RWK B;  2H4Y B;  1SC3 B;  1GFW B;  2QL5 B;  3R5J B;  2H65 B;  3QNW B;  2FQQ B;  3GJT B;  2CNL B;  1RWP B;  3GJQ B;  2HBQ B;  2QL9 B;  1RWV B;  2Y0B B;  5IC6 B;  3SIP B;  1RWX B;  1RHK B;  2H5I B;  3NS7 B;  2CNK B;  2DKO B;  3IBF B;  5K20 B;  2CDR B;  2QLB B;  4ZVO B;  3D6M B;  2C1E B;  3R6G B;  1ICE B; 
#chains in the Genus database with same CATH topology
 1WKJ A;  5IQ6 A;  1TAQ A;  3MAA B;  3NGU A;  5HQM A;  1JLQ A;  2ASD A;  3U1N A;  5BXI A;  4J9Q A;  1M5V C;  5HLF B;  1FJG F;  2W2N P;  3TZX A;  5HMZ A;  4CO5 A;  4RBV A;  4B9S A;  5F8H A;  4RJV A;  5K14 B;  1L3K A;  4O3R A;  1FK9 A;  4M63 A;  1YZ7 A;  2ZVI A;  2IJN A;  2WBR A;  3PRV A;  4TXS A;  3US5 A;  4J7C A;  2YX1 A;  3NGD A;  1J5E F;  4LVN P;  2WVB A;  4WP3 A;  2VPY B;  2MHE A;  1NKC A;  4HLB A;  2E9T A;  1NJW A;  3NNH A;  1I5O B;  1PC5 A;  4F4A A;  3CED A;  3R8Y A;  1OJ4 A;  2JVR A;  4ZPW R;  3Q8Q B;  3OL9 A;  1HWJ A;  2LKZ A;  2HWH A;  5FJ4 A;  2ZH6 A;  2VC0 A;  5F8I A;  2JOQ A;  2XM3 A;  2QLJ B;  4LRA A;  3KLH B;  1L3T A;  4ICL A;  1JX4 A;  2G0C A;  1BGX T;  1TL3 B;  4ZK7 M;  4ECW A;  2XSJ B;  2NUU G;  3H5S A;  4KHM A;  2KDO A;  2MJN A;  2PMW A;  3V81 B;  3W8G A;  4ZMM A;  1OO0 B;  2HND B;  4OFZ A;  2CQI A;  1RHJ B;  2BAN B;  2B9Y A;  2H51 B;  1EJ7 L;  3SV3 A;  2MMY A;  2M3D A;  2YBV A;  5KG2 A;  1UPP A;  3TJ9 A;  4OYI A;  1DFD A;  2FB0 A;  3LOU A;  2E66 A;  2KYX A;  2R2U A;  4K4X A;  4DQQ A;  2D3U A;  2E5I A;  3KOA A;  5IWA J;  2ZHA A;  4C8L A;  4YY3 J;  3HVW A;  1R8C A;  4PWU A;  3D6F B;  3J81 U;  4AQY J;  1HD0 A;  3CWJ A;  2OPP B;  4X84 A;  4PQU B;  2JEI A;  1P9Y A;  3M8Q B;  4CLL A;  1H3D A;  1CJU B;  3N6N A;  4N47 A;  4C3K A;  4B9T A;  1UJ5 A;  1VIS A;  4L73 A;  3I9V 9;  4QWD A;  4O4G A;  1X5O A;  1SJ3 P;  4Q8F A;  9RUB A;  1K44 A;  5IM0 B;  3CJ4 A;  2GS8 A;  1FKO B;  2IJR A;  1UKU A;  2DY9 A;  2GA7 A;  2XYG B;  3E01 A;  4OX8 A;  2UUA J;  2EFO A;  3VAF A;  2Y1J A;  2W7O A;  1PBA A;  1YBA A;  4ED6 A;  1QUV A;  4OHX A;  2J0S D;  5E3A A;  1RTJ A;  2XI3 A;  4M5L A;  2NZ4 A;  1BE4 A;  1EIY B;  2YKO A;  3FC9 A;  3TNV A;  1KQG B;  1JQG A;  2W4D A;  2V8D A;  4DBQ A;  4U8Y A;  4PCQ A;  5A8R B;  4QQB A;  5KFC A;  5D15 A;  4IFV B;  4OIX A;  4KAI A;  4AFF A;  3VQT A;  1T8E A;  5DG8 A;  4CH0 S;  5KOW A;  3T41 A;  3T6B A;  3POT A;  2OAU A;  4OX9 F;  5CA5 A;  1RAO A;  1JLE A;  4MJK A;  1DTQ A;  2HIY A;  3MM6 A;  1D3W A;  4MTP A;  3QAE A;  2W8L A;  1IBM J;  1MW7 A;  3MM5 A;  1VHI A;  2FLO A;  2IYG A;  4ZLJ A;  1X5S A;  1MWY A;  5BYS A;  1TUV A;  5HMX A;  2D3Z A;  2GX8 A;  4I2Q A;  4WFY A;  5H9F K;  2KXN B;  1QUP A;  1NAQ A;  2H5I B;  2JX2 A;  3I96 A;  3DOK B;  4KV8 A;  4O44 B;  3OFG A;  4MK9 A;  3DU5 A;  3K5O A;  1HL6 A;  4YN3 B;  4I6Y A;  1CS4 B;  2VOP A;  2QO3 A;  2LQB A;  2IDE A;  5HJX A;  1NEE A;  4CYU A;  1WSV A;  2Z30 B;  4F4K A;  2DYA A;  4H4K C;  1BC6 A;  4KIA A;  4K0K F;  3TUJ C;  2NSB A;  4Q44 A;  1DTT A;  3AOC A;  4AND A;  2HQD A;  1JLA B;  4QWA A;  1UET A;  1SJ1 A;  4URS A;  4WFB Q;  1L3V A;  4NLG A;  4DUZ F;  2ATC B;  3NAH A;  2B5J A;  3HP6 A;  2DCL A;  1DQ8 A;  2LA6 A;  2AP6 A;  4YME A;  3NCQ A;  1HWI A;  3EM1 A;  2IMW P;  1NH7 A;  2W24 A;  4KFB B;  2C2E A;  3NNA A;  3AXM A;  1RAC B;  1REV A;  2VFU A;  3DNC A;  3NCP A;  4MIW A;  4JI5 F;  4DV6 F;  3OQ2 A;  1NZA A;  2V34 A;  4GMK A;  2YY3 A;  5CQG A;  3WIV A;  2R8G A;  4DX6 A;  1S1W A;  3PX4 A;  1HIY A;  2GVZ A;  2DO0 A;  1R8P A;  2RF2 A;  3I31 A;  4ITS A;  4QZV B;  5KFR A;  4YB1 P;  3TYT A;  3TAP A;  4DR6 J;  2QA4 S;  1NDK A;  4HI1 A;  3AQP A;  3UCG A;  2XQC A;  1K8A T;  3AT1 B;  1SQG A;  4IH7 A;  4LSN A;  4NA3 A;  4WKY A;  1XNR J;  3QFH A;  2M9K A;  3H59 A;  1RT6 A;  3OR2 A;  3QIP B;  4E2F B;  3PAC A;  4KHP F;  1HD1 A;  3E8O A;  5I3U A;  1LXJ A;  1DJ0 A;  2HQG A;  3BBB A;  4USJ C;  3GV5 B;  3CC4 S;  5A76 A;  2VQE F;  1JLE B;  1RYS A;  4LFC F;  3GG0 A;  1U26 A;  1CJV B;  2VBX A;  5H9F J;  4F25 A;  1KBR A;  3SDE A;  1U4B A;  3K5M A;  2HHX A;  1Y5I B;  1FDN A;  5KG3 A;  1NHK L;  2FHO B;  3O3L A;  4WP9 A;  4D3H A;  2MKI A;  4A8K A;  2UUC J;  2ZHO A;  2JRS A;  2LEA A;  3DDK A;  1PGZ A;  3DLB A;  2OEL A;  2RDJ A;  5J2Q A;  1N33 F;  3FRZ A;  3PXG a;  1REV B;  1M0S A;  4C3M A;  1ZZF A;  1TL4 A;  2CJK A;  4B3M J;  1SUQ B;  4LT6 A;  4O23 A;  4DWI A;  2RF2 B;  3EUN A;  1N32 F;  1U8W A;  2MY8 A;  3N79 A;  1NJZ A;  3QO9 B;  4NLW A;  5KT6 A;  5B0C A;  5KG1 A;  3KK2 A;  2DXE A;  1C4A A;  4F67 A;  2G2Y A;  4K8R A;  4TQR A;  1GXL A;  4PUO A;  4ES3 A;  3VAI A;  2ASY A;  4NCG A;  3V4M A;  3V6K A;  4JV2 A;  4LR8 A;  4Y6I A;  3IN5 A;  3MR7 A;  1KLM B;  2CQC A;  2RVJ A;  4GVB B;  4KY3 A;  3SCI E;  4EBE A;  2F3J A;  1NK8 A;  4IH6 A;  5KFG A;  1OY8 A;  3LH2 S;  3CF5 Q;  4YDX A;  4YFU A;  4E8U A;  4DQS A;  3SCK E;  3TAM A;  1D9D A;  3CD0 A;  3CMA S;  4OLO A;  3GIJ A;  2YX4 A;  3SSQ A;  4GO7 X;  1G2E A;  1AXQ A;  3UE2 A;  2YNG B;  3TEG A;  1M5H A;  1MN7 A;  3PYG A;  5GAG U;  3DOK A;  5CAB A;  3G82 A;  1WDD A;  1R8H A;  3K7R A;  3L7O A;  4FF1 A;  2K3I A;  3QJL A;  4ED2 A;  1S6U A;  1SCJ B;  2CJB A;  2DIV A;  3PTW A;  3X1L B;  3ENQ A;  1FRI A;  3MUV P;  3AA8 A;  3MEG A;  3OBI A;  2K1R B;  2CG8 A;  3OL6 A;  3ENV A;  5A0Y A;  1BD6 A;  5EWE A;  2H65 B;  1RDR A;  4DFJ A;  4OYA A;  4Z2X A;  3C14 B;  2ZBQ A;  1VC6 A;  3FJ2 A;  2CWK A;  2AIR B;  3OTO J;  2IVF B;  3MDF A;  1B0V A;  1RAB B;  2AW0 A;  1BQX A;  1URR A;  5KFU A;  1KSP A;  2HYI B;  1XNQ J;  3AOD A;  3UD5 A;  1IKW A;  4LFB J;  4OZ3 A;  2AGO A;  4QR1 A;  5CYQ A;  2ZE2 A;  3OJU A;  3FSX A;  1L5U A;  2A2D A;  4NEY A;  3SQG A;  4OX6 A;  3NS7 B;  1UTA A;  5HJY A;  3CC7 S;  1WTF A;  3I0S A;  3KKF A;  3QLH B;  1ARO P;  1K73 T;  2E29 A;  2QYG A;  1S6O A;  4J5O A;  1D8Z A;  2NXC A;  1SL0 A;  1J5O B;  1V9O A;  3A8K A;  3MTJ A;  3CDE A;  2IRY A;  1KC8 T;  3KG4 A;  2Q3P A;  3UW1 A;  1MWZ A;  3GIL A;  3EXY A;  2F8E X;  4HAC A;  1KQS R;  4QPT A;  2VAS A;  3EGN A;  4HH1 A;  3PHT A;  3H0P A;  3AFG A;  3PRD A;  4KPY A;  4EI2 A;  5K8P A;  4A8Y A;  2GC8 A;  3BGO P;  3HX9 A;  4UZC A;  3OUY B;  1GX5 A;  2XMV A;  5D4O A;  5J1P A;  1QLN A;  3AJ1 A;  2FD2 A;  1F9E B;  4FYX B;  5I3P A;  3OVA A;  4JYA J;  2R7V A;  1FF2 A;  3VVT A;  2RUG A;  4LQ3 A;  2PFD A;  5C5J A;  4OJ3 A;  4DV4 J;  3RBX A;  5C25 A;  4K2J A;  4I4B A;  5F8J A;  2MZQ A;  3Q8P B;  3AAW B;  3KG0 A;  1HQE B;  1VFJ A;  2QA1 A;  2VDI A;  3IXQ A;  4JV0 A;  5J2M A;  1KVJ A;  4HR2 A;  4P7V A;  4IOB A;  4P2S A;  1H7W A;  1KRP A;  5DO2 A;  3HK2 A;  4DG1 A;  1S99 A;  3M6V A;  4C6A A;  4O0I A;  2GVD B;  4RZR A;  1QY7 A;  2KYZ A;  3AD7 C;  3FBB A;  2VPW B;  1HBM A;  2SXL A;  1M90 T;  1CEZ A;  5JVH Q;  4LF8 F;  1F0X A;  2KZZ A;  1WOP A;  2GFF A;  2AJF E;  2O66 A;  2VJV A;  4DV3 J;  1B7F A;  3IRX A;  1T05 B;  4J9L A;  3NAI A;  4B02 A;  1F5A A;  1Y5L B;  2ASJ A;  1FWP A;  2MZS A;  4FKY A;  3QJJ A;  2L3M A;  4JYA F;  1RHQ B;  3BQ0 A;  2BQR A;  3LP1 A;  4IFY B;  3PZP A;  3DI6 B;  1HHQ A;  2VG7 A;  4N8N A;  2C2D A;  5F3T A;  3QO9 A;  1HBU A;  3OFE A;  4X2B A;  4DR4 J;  1ZA2 B;  3G2X A;  1FFW B;  5CYM B;  4UOG A;  1QVF R;  2PA3 A;  1HNZ F;  4CTA B;  1SV5 A;  1UFL A;  3DRP B;  1NSP A;  2EFQ A;  4WIQ A;  4P71 A;  1CJV A;  1V3Z A;  4FPI A;  4DPU A;  4Z37 A;  1H0H B;  3TQ1 A;  1WEL A;  3DLH A;  3BSA A;  1OMS A;  2X1B A;  3C6T B;  2MHN A;  4RW8 B;  4CO0 A;  5HLF A;  1VQK S;  4QR2 A;  4JI8 J;  2HBR B;  3TOQ A;  3TVY A;  4DR7 J;  2R7Q A;  2WBM A;  7FD1 A;  4CWB A;  2GMJ A;  5LJ5 Y;  2OLW A;  4ZJO A;  4F3Q A;  1R31 A;  4OV6 A;  1U6Z A;  2BE7 D;  4QBU A;  7FDR A;  1YIJ S;  1T0T V;  1HR0 F;  2K7K A;  1H72 C;  3AD8 C;  3HSG A;  2Z2Y B;  2RKI A;  5ETO A;  3LQV A;  4QIE A;  1UA1 A;  2C3O A;  1YZ6 A;  4M8L A;  2PMZ D;  3ENA A;  4RR5 A;  1SBR A;  3DOM A;  2BW2 A;  2CQ3 A;  3BSC A;  1TEL A;  2WZ1 A;  3HI9 A;  1KD1 T;  1VQO S;  1FCA A;  4WBF A;  2BOA A;  2XCP A;  2ZDP A;  1NME B;  3SCJ E;  3W61 A;  1FWK A;  2BJD A;  2AGQ A;  2OFH X;  5ETN A;  3N6L A;  2H4Y B;  2OPR B;  1FKP B;  1HQU B;  4B3S J;  2JJ4 D;  3GR1 A;  1VK8 A;  3WDO A;  2YH1 A;  1BQM B;  2QA2 A;  4RL1 A;  4LFA F;  2MGZ B;  1RB0 A;  2DIT A;  4NLV A;  5D4N A;  2CNL B;  2O01 C;  2OGU A;  4RNH A;  4NYO A;  1N34 J;  3B54 A;  3QID A;  3W5X A;  4N8O A;  2FZK B;  1U1R A;  2GZO A;  1RI7 A;  5CZX A;  3SQO P;  2FVP A;  3A4T A;  4O44 A;  4MT1 A;  3MR5 A;  1T7P A;  4DXL A;  2EWH A;  1RHK B;  4LIR A;  2G0I A;  4HVZ A;  2B3T B;  1IUJ A;  1C1C A;  4M5H A;  5J1N A;  2W9A A;  2KRB A;  3CJQ A;  4RU2 A;  3PFO A;  2HMI A;  3QT6 A;  5KFZ A;  4LF6 F;  4PQU A;  3WBZ A;  5D77 A;  3FBE A;  5CH7 B;  2IC3 B;  1F5B A;  1LEO A;  2GIQ A;  1JLC A;  2W9C A;  3CW2 C;  4QW9 A;  1O51 A;  1YK9 A;  2DJW A;  3K5P A;  2NRE A;  2QT7 A;  1SVD A;  5L9N A;  4HAC B;  1TKZ A;  4IDK A;  1TL1 B;  4RBU A;  4DZD A;  1IBL J;  2F4V F;  2F4V J;  2KFZ A;  3M2R B;  2RE1 A;  3B6B A;  2AJ1 A;  3PRB A;  3R1L A;  2DHH A;  1U1K A;  4F02 A;  3K57 A;  2KTQ A;  4EBD A;  1I51 B;  5KFP A;  2HAI A;  4V19 X;  3DM2 A;  3Q2S C;  5JJB A;  2EFG A;  2H48 B;  3GCX P;  3KDO A;  3VGV A;  4A46 A;  1KN6 A;  2MDA A;  3CCT A;  3TJA A;  1U0H A;  2DGX A;  4EK2 A;  3I9Z A;  3NEK A;  2ZBI A;  3PYE A;  4AL5 A;  2A3J A;  1RWW B;  2KB2 A;  2C3Y A;  2QG9 B;  3HKZ D;  3DGP B;  5A8R A;  5KOX A;  3L3C A;  4CM0 A;  5L1I A;  1T02 A;  2QC3 A;  3QBC A;  4AL6 A;  1H38 A;  4A8F A;  3R2D J;  1RQ0 A;  1RT6 B;  2DNK A;  3W5Z A;  3EZU A;  3FEX B;  4W90 B;  4P9S A;  4KKO B;  1XN9 A;  1N5Y B;  4PPD A;  2C42 A;  3RW6 A;  1KLM A;  3CIZ A;  5CYJ A;  2AYM A;  3HHL B;  5FDL B;  4UY8 T;  4U6P A;  2M2B A;  2DVI A;  4LFC J;  1TKX B;  4K4Y A;  1O0P A;  1S6Q A;  3DDN A;  5BYQ A;  1MML A;  2YKM B;  4G1Q B;  1M5S A;  3D6H B;  3R97 A;  5KG5 A;  4OHW A;  2CQB A;  1VIO A;  2RHS B;  1RP5 A;  4HDH A;  3PJW A;  2B8P A;  3U1M A;  2QRR A;  5I3Q A;  1U45 A;  4L3N A;  3M8Y A;  2OPP A;  4NXM J;  2VB6 A;  5E3Q A;  4DR4 F;  1SL2 A;  3RB3 A;  1JNZ B;  3KK3 A;  5KFX A;  4CDI A;  5B08 A;  2RRB A;  2W4C A;  4CLP A;  3MM9 B;  4RUC A;  1GMV A;  3KJQ B;  3QIP A;  3QMQ A;  4ER8 A;  4ECZ A;  1F1B B;  1HW9 A;  1TKZ B;  4WTY A;  4J37 A;  1E6V A;  1WHY A;  4LVO P;  5IC4 B;  2FHK A;  1T95 A;  4LRB A;  4OZJ A;  4Y2I A;  4L3K A;  1K9M T;  1VQ8 S;  4B9V A;  2OTJ S;  5L1J A;  3CDA A;  2CQG A;  2QLX A;  3CDW A;  1Q7L B;  4IO1 A;  2HHQ A;  1U1M A;  3MMC B;  3ZFV A;  3PJX A;  1UW4 A;  1S6Q B;  1GNK A;  2MLZ A;  3AA9 A;  3NBP A;  1WF2 A;  3TAR A;  2LXF A;  1X60 A;  4CNZ A;  2VFT A;  1PJ6 A;  1JLB A;  1RAI B;  2AT1 B;  3KUE A;  1OWX A;  5KFH A;  1JXL A;  3QRP A;  1H2T Z;  2Y1L B;  4ECT A;  2VH7 A;  3DYA B;  3MOZ A;  5T7L B;  2KM8 C;  1FEH A;  2M52 A;  2QJ3 A;  3HSJ A;  4PG7 A;  4FNI A;  4ENO A;  1Q8I A;  4DL4 A;  4LF4 J;  4N5S A;  3C8Y A;  1WKL A;  2OI2 A;  4EO6 A;  4I6A A;  3IBC B;  1VDH A;  2A2C A;  4NLX A;  2AYG A;  4Q0B B;  1RHU B;  1DLO A;  4CM2 A;  1LWF A;  4EYI B;  4OYO A;  3L7U A;  2CWX A;  2W2M P;  2NXN A;  2W2P P;  5IQQ A;  3WX8 A;  4U95 A;  4YHH F;  2CPE A;  4N56 A;  1D8Y A;  1IXK A;  3TVK A;  3J81 Y;  2AX0 A;  2B43 A;  2CXE A;  3ISN C;  3OL7 A;  2LMI A;  3SYZ A;  4EYH B;  1RZM A;  4C97 A;  3KWM A;  1YKW A;  4KGV B;  1NSQ A;  3A1Y G;  1HW8 A;  3VZI A;  3DRR B;  4M5D B;  3CJ0 A;  5C25 B;  4FNH A;  1JLG A;  2XMK A;  4DR1 J;  1XR7 A;  2KRR A;  1YJT A;  1NSA A;  2FHJ A;  1MLA A;  1XIQ A;  3I82 A;  3NGK A;  3GPA A;  3VAK A;  2BDP A;  2OTL S;  3MEG B;  3GIM A;  4L74 A;  2VG5 A;  1B4S A;  2BAB A;  3PW2 A;  4B3R J;  3MM9 A;  2AMC B;  3UN3 A;  3G6V A;  2BKO A;  4B08 A;  3CC2 S;  1J5O A;  2JL9 A;  3MMA A;  3RR8 A;  1SJQ A;  5BYR A;  4IG0 B;  3RAX A;  3W3S A;  5LOQ A;  3T5J A;  3QRR A;  3RRH A;  4DPW A;  3BS9 A;  5K8O A;  2V0N A;  3OD2 A;  4GVB A;  2LDY A;  3OSN A;  2ZZM A;  2XO7 A;  1YLX A;  3DLG A;  1R0A B;  1U0S A;  3VGS A;  4DHV A;  1AZS B;  2K2P A;  4PWD A;  2X1A A;  4PG8 A;  2QFJ A;  1EKS A;  1RWO B;  4P2F A;  1N5S A;  2CQH A;  1N54 B;  2V94 A;  2YKM A;  3HKW A;  4GRS A;  4WPA A;  3UDV A;  4YS2 A;  1JWW A;  3P45 B;  3FCV A;  3TRG A;  3QRQ A;  2PFF B;  2L48 A;  3KLH A;  2X3D A;  3U1L A;  1YI2 S;  2MXY A;  3W1Y C;  1KTQ A;  4H4O B;  4QOT A;  3C14 A;  2FDN A;  4QYZ J;  3ZTP A;  4C0H A;  4DSK A;  3QSI A;  3OSP A;  2E9Z A;  1C0T A;  3AXK A;  4RW4 A;  1SJF A;  1HYS B;  2V9K A;  4USV A;  3RYL A;  4DSJ A;  4K4Z A;  5DLF A;  1U47 A;  4PXE A;  1T03 A;  2YKQ A;  1C2P A;  2VON A;  2VA3 A;  2W9B A;  5KFA A;  4NLP A;  3ZTQ A;  3RRG A;  1Q8K A;  1S6P B;  2BJ3 A;  2D74 B;  5M2P A;  1VQP S;  2JVO A;  3AD9 C;  1IM4 A;  4FF4 A;  4KQZ A;  2NXE A;  2E1M C;  2KJW A;  3H42 A;  1MU2 B;  1CJK A;  4P74 A;  2LXI A;  3PY8 A;  1N34 F;  4KH1 B;  4IR9 A;  2HUR A;  4FBU A;  4C8Z A;  1FA0 A;  2OML A;  2N82 B;  5J2Q B;  5GAH I;  1WD6 A;  2HHH J;  2PO4 A;  2XMT A;  3OLB A;  2GML A;  2WTF A;  4UTG A;  1KP6 A;  4LFA J;  5GMK a;  3GR0 A;  2OFG X;  2G1H A;  1N4L A;  1MNE A;  4ZVQ B;  4JI1 F;  1PG5 B;  2W2O P;  2DH9 A;  1UFK A;  4EUV A;  4UT4 A;  1RBL A;  1QSS A;  1J5E J;  2QMW A;  1Q7Y T;  3TA0 A;  4RUA A;  3K0J A;  3PG9 A;  4KHP J;  1CQM A;  4GKK J;  1RT5 A;  2D9P A;  2VOO A;  3ZZP A;  4ZCI A;  5AXN A;  3ITH B;  3DFE A;  2CAD A;  4F04 B;  4R5P B;  2ZKU A;  4F4Z A;  1XR6 A;  2CPF A;  1X5T A;  2M5Y A;  3F41 A;  3ZO7 A;  3H4D A;  3PW0 A;  1N48 A;  3BGR B;  4U9R A;  1YGY A;  2MSS A;  2EKN A;  3GQC A;  1S72 S;  1Q81 T;  4ELU A;  1HYS A;  4OZN A;  2OEK A;  1HNW J;  2AV5 A;  3IG1 B;  3K8W A;  1WUU A;  4Q43 A;  1S6P A;  4XDC A;  5KFT A;  2EBE A;  5E33 A;  3HUL A;  4DR5 J;  3TW0 A;  2GQC A;  1RWM B;  1HBM B;  4ILL A;  3K8V A;  2QZ8 A;  3MD1 A;  5RUB A;  1A7G E;  5KFK A;  4J9K A;  1YJW S;  1I1G A;  3ITH A;  5C7P A;  3W63 A;  3KLV A;  1UPM B;  4PXD A;  1FES A;  2FHJ D;  1Q95 G;  1XWL A;  1YSJ A;  2ZH1 A;  1KON A;  2FYX A;  2ZWP A;  3GTY X;  1FNX H;  2BM0 A;  1NJX A;  3N5F A;  1H73 A;  3M05 A;  2B7C B;  2UXB F;  1RUS A;  4O3S A;  1ZBT A;  2B6A A;  1VK3 A;  2GV1 A;  2YWK A;  3IWX A;  4RW9 A;  4DG1 B;  2J7U A;  2JC1 A;  4RWX A;  1N6Q A;  1S1U A;  2OJ3 A;  3RJM B;  4J9N A;  5ETT A;  1F60 B;  4LQ9 A;  5C2C A;  3OW2 R;  2BJ8 A;  4Y3C A;  4JI0 J;  2IYI A;  1KQF B;  3H90 A;  2HKE A;  3R5J B;  4BC9 A;  5LMN F;  1Q86 T;  1TL7 A;  3EZO A;  2YPZ A;  4KO0 A;  2V8V A;  2FVC A;  2IVM A;  4DX7 A;  5L38 A;  4DUZ J;  1FDB A;  3DRR A;  4M5D A;  3GJQ B;  1IWA A;  3FFI A;  1KFS A;  2UXC J;  3PM9 A;  2OIH A;  1HNV A;  3EJM A;  2XGP A;  4QWB A;  1U2R A;  1EX8 A;  2YNI B;  2Y8Y A;  3P8B B;  2B8Q A;  3M2U A;  3SIP B;  1FRM A;  2ILZ A;  1OQ3 A;  2XCA A;  2CPX A;  2OO4 A;  1REG X;  4QWE A;  2V67 A;  4KTQ A;  4NLR A;  4Z7Y A;  2CG4 A;  3E51 A;  4OZ5 A;  4WFX A;  1RTI B;  2ZH8 A;  4C8N A;  4NXN F;  3KLG B;  1N36 F;  4OHY A;  4CRJ A;  5DM7 Q;  2RQC A;  1EAY C;  1ITP A;  5HAN A;  3TR5 A;  3DU6 A;  1AZS A;  2C1E B;  2NLW A;  1HHT P;  1VQ5 S;  1WG1 A;  2EK1 A;  4F50 A;  4B9M A;  3R2C J;  1M5P C;  3EPI A;  2HHV A;  3HVT A;  2P6S A;  4ZLP A;  2CZ4 A;  3FNN A;  5B0D A;  4YOE A;  3AOA A;  1SUQ A;  1JXE A;  3G8T A;  4WCE Q;  2WSF C;  3U7J A;  2DNL A;  1SH3 A;  2B7B B;  2GHP A;  3MOJ B;  2XY7 A;  4URQ U;  3MMB B;  3DOM B;  4PPZ A;  2AEJ A;  3KK2 B;  4CLY A;  2VG5 B;  1S1V A;  2AJ2 A;  2MLY A;  3PFE A;  3MM5 B;  2DRD A;  2ZBP A;  3VQS A;  4ANC A;  3M1V B;  3PV8 A;  4PQA A;  3M8P A;  1RHR B;  3M2U B;  2ZZT A;  4I64 A;  5KFI A;  3UDE A;  1QD1 A;  3CB4 A;  4URG A;  2MJU A;  3TO8 A;  4O3Q A;  4V19 J;  4K4V A;  1MRO A;  4H4K A;  4M5J A;  4ECR A;  4B9L A;  3NNC A;  3DLJ A;  1W7W A;  3MM7 B;  4WE1 A;  5LSR A;  5THW A;  3T5H A;  4P52 A;  1TL7 B;  1U1L A;  3TWZ A;  2V2V A;  3CJ2 A;  4WII A;  1F6T A;  4UUW A;  3OVS A;  2XZD B;  2VD3 A;  3HSD A;  1UMJ A;  2MTL A;  1FX4 A;  2WON B;  4DCJ B;  4TY8 A;  2M0G B;  5GVQ A;  2VFV A;  4FYY B;  3RGI A;  3SI8 A;  4O3O A;  2UVW A;  3GV7 B;  3HLU A;  3UDC A;  1WG5 A;  1Q82 T;  3R7S B;  3DRP A;  3MHY A;  4FF3 A;  4QR0 A;  1RTD B;  5CAA A;  3TQE A;  2ASL A;  1UZH A;  4F8R A;  1UVI A;  2QLW A;  2VG6 A;  2O1P A;  2R7O A;  2AJQ A;  3JAM Y;  3R7B B;  2O67 A;  5HBM B;  3KJN B;  1S10 A;  2EBG A;  2J5A A;  3P4U B;  3D54 A;  3GJS B;  1S0M A;  4NLQ A;  4NAS A;  1WEY A;  1MWQ A;  1G6B A;  5JXS A;  1HWU A;  1QE1 A;  4JOU A;  2B4P A;  3D68 A;  3JYT B;  2OUG A;  2JDJ A;  1F3V A;  3OTC A;  1YJN S;  1UVL A;  3MEE B;  3H5Y A;  1VBZ A;  4DPT A;  1FRJ A;  2WVC A;  3M32 B;  3H25 A;  1LW2 A;  3BJY A;  1PO6 A;  3L09 A;  4LF7 F;  5D0H A;  3HCX A;  5DRK A;  1N5Y A;  4OZ1 A;  5A6W A;  3M8Q A;  2OPS B;  3N01 A;  1X9W A;  2DK2 A;  4RW7 A;  2KZM A;  3CNQ P;  4Y2C A;  2UZA A;  1VBY A;  1CG2 A;  2QGF B;  2XBP A;  2OPQ B;  2MQM A;  1RT5 B;  2YNI A;  2ZHB A;  2CUY A;  3Q22 A;  2EC2 A;  4WU2 A;  3L4B C;  5L1L A;  2FJE B;  2KVQ E;  3PIP Q;  1N32 J;  4HKQ A;  5A8K A;  4F4W A;  2WHO A;  1FVQ A;  1FVS A;  2ZH3 A;  2FHM A;  4K4W A;  5HL7 Q;  2ZOG A;  1N33 J;  4KGM A;  4NLS A;  1WI6 A;  3LTO A;  2HVZ A;  3IO1 A;  4P73 A;  3OUY A;  2VJU A;  4RUH A;  3KHR A;  3D2W A;  2K3K A;  3W8P A;  4DV0 J;  5DDO C;  3UD3 P;  1Y5N B;  1IM6 A;  3HVT B;  4ZPT R;  1JJ2 R;  2FY8 A;  5C42 A;  2HBQ B;  1TL5 A;  1W2B R;  1E6Y A;  1MMN A;  1X4A A;  3CJS A;  4CH7 A;  4U67 Q;  3RB4 A;  2HMI B;  3KK1 A;  1IKY B;  1HWK A;  1WI8 A;  1VS3 A;  4RW4 B;  3KTQ A;  3HT3 A;  1Q8B A;  1WG4 A;  4IQX A;  1FD8 A;  2B6A B;  2BMB A;  2OSQ A;  5F8G A;  3EPG A;  2HFZ A;  2M8D B;  4TKT A;  3LAK A;  1TAU A;  2HQC A;  1S9E B;  1RU2 A;  4O3P A;  2VA2 A;  3IBF B;  3KMQ A;  2LQ9 A;  4QPX A;  5KFN A;  2AF6 A;  2CDR B;  1S4E A;  4DR5 F;  1N36 J;  1IBK F;  1VHF A;  1NUE A;  4EZ9 A;  2V8H A;  3CJ5 A;  2JNJ A;  2E7X A;  2KL8 A;  3MMC A;  1RWN B;  4NXM F;  5DQG A;  3B82 A;  1HKA A;  1G4C A;  4O4R A;  2HS4 A;  2YWW A;  5KFQ A;  2ZJR Q;  4HL9 A;  4UW2 A;  3GFX A;  3IAM 9;  2BM1 A;  4BC7 A;  5F9L A;  2LA4 A;  4L72 B;  4ED0 A;  1NJY A;  4QIG A;  1XJW B;  2P6T A;  2UVR A;  4IQM A;  5A0Y B;  4IYQ A;  1U2F A;  2WB1 D;  3SCL E;  3IA0 A;  3PO5 A;  2F40 A;  1T94 A;  4DSI A;  1HMV A;  4PXB A;  4CO4 A;  2EVZ A;  4ZVF A;  2HZA A;  3BM7 A;  5IV3 A;  5LSO A;  3I55 S;  4DV5 F;  2H3E B;  4M1K A;  4YR0 A;  4FN5 A;  4DEZ A;  4RNN A;  3BSO A;  2CQ0 A;  2YNH B;  3UQS A;  2FIU A;  1S9G B;  2V4J B;  2IBO A;  4DCO B;  2J0Q D;  1UVM A;  2ZOF A;  3L95 X;  5J2P B;  4FKX A;  4LRF A;  2QE5 A;  2OKQ A;  4OI4 A;  1AB8 A;  5LT5 A;  1XMO J;  4FDF A;  2MEW A;  3EMT A;  4MK7 A;  1U8S A;  2MZ1 A;  2W7P A;  3BSN A;  1JJ4 A;  2FJX A;  2HIQ A;  2XHC A;  5K8N A;  1RT7 A;  3D4J A;  4K4S A;  2OSR A;  3JTN A;  3BPD A;  1X4G A;  2RIL A;  1PIE A;  2VF3 A;  3VZH A;  1JNR B;  1NJI T;  2D41 A;  5DJB A;  1AW0 A;  5ETK A;  4DUY J;  4RW6 A;  2XNR A;  1HA1 A;  4AXI A;  4YR3 A;  4CI0 B;  4NCA A;  3HJV A;  2I0X A;  3AQO A;  3OXG A;  1ZYQ A;  4NYZ A;  4Q8E A;  3HFK A;  4Q2L A;  1F2H A;  2J9D E;  3OR1 B;  5K14 A;  4A48 A;  4HH0 A;  4I2P A;  4R5P A;  2BX6 A;  3DOL B;  5HRO B;  5D4P A;  1QAX A;  2ZOM A;  3QJP A;  3OL8 A;  4NRU A;  3ET6 B;  4GC6 A;  2NZC A;  2CQ1 A;  4XPE A;  3KLE B;  9ATC B;  4ED4 A;  3MCM A;  2A6M A;  1NDP A;  2VV5 A;  1NXI A;  2G1D A;  4FVM A;  4JB8 B;  4LR9 A;  4YP3 A;  2J7K A;  3CDU A;  3PIO Q;  3M6U A;  3EDQ B;  4K5S A;  2C3U A;  4MIB A;  2BE2 B;  3NP5 A;  1PIL A;  1JLQ B;  4CYU B;  1VCT A;  2N4C A;  2C22 A;  1TK5 A;  2DR9 A;  1S97 A;  4L75 A;  1FX2 A;  1SB6 A;  1UAW A;  4X66 J;  2EG2 A;  5A6P A;  1D09 B;  1UWB B;  2AYE A;  3C19 A;  3HHE A;  4PAA A;  3PR5 B;  1T3N A;  1PAE X;  2LYV A;  1Z4U A;  5IV4 A;  1HNX J;  4CT8 A;  2CYY A;  2HND A;  2J0X A;  3DC2 A;  1EP4 B;  2PII A;  4O0N A;  4ZVU B;  4C7Q A;  5E5N A;  2BA9 A;  4ILM A;  3O5T B;  3THP A;  2ZM6 F;  2XY6 A;  3RR7 A;  1S77 D;  1RCO B;  1TL1 A;  2G0J A;  3KFW X;  4USK A;  3DDI A;  1S9F A;  4J9P A;  2XY5 A;  2J9E A;  3ETM A;  2ZC3 A;  4I6W A;  3PW4 A;  1K0T A;  4ZLN A;  1KS2 A;  2RQM A;  2AJ0 A;  4ZPB A;  5F8L A;  1U1O A;  4PG4 A;  3FMW A;  3W5Y A;  4NZ7 A;  1TMM A;  1WSR A;  2J9D A;  3FBC A;  2Z4P A;  3NOC A;  3PX0 A;  4YHH J;  3HHN B;  2DTJ A;  4WWS A;  4DI6 A;  2Q66 A;  2Y3Y A;  4MK8 A;  4ED5 A;  1B64 A;  1HI8 A;  5KTQ A;  2HHU A;  1FEE A;  4ATN A;  2IA6 A;  4LF9 F;  5IT4 A;  3KK1 B;  3MAA A;  4DDF A;  5KT3 A;  3ZNJ 1;  1RGV A;  1HBN B;  1RT2 B;  3CD6 S;  4DU7 A;  3OPK A;  5E0O A;  2U2F A;  4GO5 X;  5IC6 B;  1X31 C;  2V4R A;  2GAG C;  3WZ0 A;  1CC7 A;  4DOZ A;  2RRN A;  5A8W B;  1ZTW A;  3W9I A;  3GZ7 A;  2YQ0 A;  3VAJ A;  2A6O A;  1NKB A;  1YJ9 S;  3O1L A;  2HHP A;  1VBX A;  3PHE A;  3CCV S;  1O6X A;  2DBB A;  1IKX A;  2QMX A;  2BXJ A;  4RWW A;  3PX6 A;  1JXV A;  2WSC C;  1R3N A;  1S0O A;  3R6G B;  5D78 A;  3IC1 A;  4OI2 A;  3CCE S;  3EVM A;  2B56 A;  2CJA A;  1BQN B;  1RAE B;  1UVK A;  2YKA A;  5KG0 A;  3ZC4 A;  3K58 A;  2ZZN A;  5KFJ A;  2ZFH A;  3T1A A;  1VC0 A;  1N6Q B;  2DXF A;  1HNI A;  3UO0 A;  3OFH A;  4KO0 B;  5KFM A;  2VIH A;  1Y11 A;  3THV A;  2R3V A;  3TP2 A;  5KG4 A;  2MZT A;  4M5N A;  4I67 A;  1OS5 A;  1C4C A;  3CIM A;  5IT0 A;  3FQK A;  1DQA A;  1Q16 B;  4EFA C;  4FS2 A;  1S9E A;  2GNK A;  4USW A;  1DLO B;  5LMN J;  2R8K A;  4FVC A;  7AT1 B;  4DLE A;  3M6W A;  4RW9 B;  4ZP6 A;  3LF0 A;  1H2U X;  2RB7 A;  4DL6 A;  3IWN C;  3GII A;  4IFY A;  4JI2 F;  3G4S S;  3T1H F;  1S1T A;  2DNQ A;  1CJK B;  1FDA A;  2XO6 A;  1VRU A;  4HHU A;  1Y7P A;  4ECX A;  3U27 A;  1QTM A;  5SUH A;  4YB6 A;  2UU9 J;  1CLF A;  3E2E A;  5F9N A;  3GYG A;  2C2K B;  1RA6 A;  3EGW B;  4P2M A;  1IJE B;  1Z2Z A;  1NRK A;  5IOL A;  1VQL S;  1WHX A;  4TQS A;  5LMU J;  2HVI A;  4LF1 A;  2PT0 A;  3ELH A;  1YWX A;  2R9L A;  2LFV A;  3LGM A;  4OX7 A;  4F0K A;  3N9U C;  4TN2 A;  2DNR A;  5A8K B;  3TEH B;  4LSZ B;  2KU7 A;  2IIH A;  2V69 A;  3KDN A;  1X0F A;  4ZS6 A;  1FKA F;  1FD2 A;  3EVW A;  3GIK A;  1PSD A;  3GWC A;  1PYO B;  3MCN A;  3G96 A;  2HBZ B;  3P6Y C;  3TI0 A;  3GFY A;  4HTJ A;  5M2R A;  5HI7 A;  1TU0 B;  4WYW A;  5GAE I;  1Y3K A;  1ZM9 A;  2DH7 A;  1ULR A;  3BR8 A;  1XK8 A;  1FXR A;  2XYP B;  1NB2 A;  1LW2 B;  1OQ6 A;  3BGU A;  4WE1 B;  5GME A;  1U49 A;  1HNW F;  1VQ6 S;  5KFL A;  2RML A;  1KVK A;  1R6Y A;  2VPZ B;  2ZUA A;  3NLC A;  1XR5 A;  1BWV A;  4Q7A A;  4Y2M A;  1AT1 B;  2CPJ A;  2V50 A;  3EYZ A;  3NGT A;  4FYW B;  2G9O A;  3ISN D;  1TQL A;  5HBM A;  2HHW A;  1OY6 A;  3MMJ A;  4IRC A;  4C3L A;  3CGI A;  4DV1 F;  2FPH X;  1OYE A;  1D9A A;  1NB7 A;  2ZD1 B;  1HBO B;  1ZM4 A;  3AJD A;  2PDA A;  3M2V B;  2JHE A;  1LWX A;  1ZAX A;  2FVR A;  3TUP A;  2HHS A;  2CNO B;  5HQL A;  3LO3 A;  1NHU A;  5JUM A;  5KFO A;  4DSL A;  1LKZ A;  6AT1 B;  1N56 A;  2CZ9 A;  4PG5 A;  1LV5 A;  4DCP B;  1TP7 A;  2N3O A;  1LK7 A;  2PA8 D;  4ZJL A;  2WB4 A;  3JB9 k;  4OJG A;  2L9N A;  3IS9 B;  4W4M A;  3I56 S;  1ZAV A;  1T9V A;  2DH8 A;  5KT4 A;  1MG7 A;  4ETZ A;  2W7A A;  4DS5 A;  3KJV A;  2E5J A;  3P5B P;  4NZ0 A;  1F9H A;  1TUG B;  1LWC B;  3T6J A;  4TYA A;  4FF2 A;  1XC9 A;  3UNG C;  1IKV A;  1RWV B;  1HQU A;  1VRT B;  1ZAW A;  2HNY B;  2N4D A;  4LRE A;  5DZ7 A;  4HEA 9;  1Q8L A;  4KV8 B;  4N7T A;  4DV7 J;  2MPU A;  2JZ5 A;  3DM2 B;  1CSJ A;  4W92 B;  2DT9 A;  4NEZ A;  1SKW A;  3JS9 A;  1N5Q A;  3NBP B;  4GC7 A;  1X5P A;  3N6M A;  3NGS A;  1O8B A;  3OXF A;  4F0H A;  3QFW A;  1X4B A;  3BGL A;  4B3T F;  4K5R A;  3VCD A;  1ZM3 A;  4WFN Q;  4HYK A;  1OYD A;  1RAH B;  4JI7 J;  1NU4 A;  4JI8 F;  1B0P A;  4WP8 A;  2W4P A;  4X4P A;  2P9E A;  4MFB B;  1NND A;  1WC3 A;  1SV5 B;  2QA4 G;  1XEZ A;  2NYI A;  4DMZ A;  2FLN A;  2G4B A;  3I32 A;  1WC6 A;  1C0U B;  1RXO B;  4B9N A;  1DTT B;  3UN2 A;  5KT7 A;  2RDD A;  3KJV B;  5LJ3 Y;  1MMD A;  3BO3 A;  1HLW A;  1YDL A;  3G87 A;  2EPI A;  4A47 A;  4ED1 A;  2XTJ P;  4L6V 3;  3UR3 C;  2MQO A;  1E6Y B;  1W2I A;  1MU2 A;  3S7R A;  3KNG A;  4O3N A;  4CP5 A;  3ET6 A;  1X4C A;  3W66 A;  5CCL A;  2BVZ A;  3FCH A;  1T05 A;  2EFP A;  1TMJ A;  1TVR A;  3IG1 A;  1GMW D;  5DDP C;  2VIC A;  1VRU B;  2XI2 A;  1IJF B;  1X0P A;  1K0V A;  3I4P A;  1HWL A;  4OZ0 A;  2PI5 A;  2HLU A;  2PD1 A;  4DL7 A;  3N0V A;  1ZZN A;  1QAI A;  2FVS A;  2ERR A;  4LRD A;  3PKM A;  1S1X A;  2RS8 A;  5K9F A;  2ABY A;  1QTN B;  3BQ2 A;  5LMU F;  1R27 B;  4PKD B;  2B4V A;  3W64 A;  2BJ9 A;  1ZS6 A;  4L76 A;  2YNH A;  3GIR A;  5CCM A;  4DV6 J;  4DV4 F;  1S0V A;  4YB5 A;  5D3G B;  3DLG B;  4U7U K;  3RZA A;  1RHM B;  2BJE A;  2KO1 A;  2MQ8 A;  3O44 A;  5KT2 A;  4ID8 A;  4PZV A;  4C0O C;  2FVQ A;  4AT1 B;  4R0E A;  1X9S A;  2GO9 A;  2V2Z A;  3PYF A;  4RNM A;  3EDR B;  1L3U A;  4GKJ J;  1BWE A;  2PE8 A;  4ID5 A;  1RE1 B;  3Q8Y A;  1FE0 A;  1RT1 A;  2ACY A;  1FTR A;  3D3B J;  4Z7C A;  4JI2 J;  3LWM A;  3PW5 A;  4PUO B;  3MEC B;  3V5R A;  2MKH A;  2BRK A;  1WHV A;  2LQ8 A;  2RQ4 A;  3VGU A;  4YUD A;  3G6Y A;  5E7O B;  2R8J A;  1C1C B;  2RS2 A;  4E98 A;  4LBH A;  2CZV C;  5IZH A;  1YRX A;  3KXD A;  4NX9 A;  2DNG A;  3IGN A;  5HSP A;  3TA2 A;  4FXV A;  1S7H A;  1RAJ A;  2J9C A;  2Z58 B;  1DY3 A;  4U8V A;  3T3F A;  2KKH A;  2DHX A;  4NZ6 A;  1DAX A;  1R8A A;  2EFN A;  3WC2 A;  4JI3 F;  3J7Z 5;  2DR8 A;  4G1P A;  3TA1 A;  5EWF A;  2M88 A;  2ADC A;  3CCZ A;  3TZZ A;  1FXL A;  1S5Z A;  3F73 A;  3D1O A;  3MM8 B;  1IKW B;  2AU0 A;  4LF9 J;  2DY1 A;  2KI2 A;  2A1B A;  3VR1 A;  3W2V B;  8ATC B;  1M5K C;  3K2Y A;  3MED A;  1NPR A;  4OZL A;  1HI1 A;  2CDQ A;  4AUK A;  5T14 A;  1K1S A;  2WAQ D;  2KFY A;  4DFP A;  5IS2 A;  3CJR A;  1ZPW X;  3D3C J;  1XMB A;  3RBE A;  1S57 A;  2K1R A;  3V6H A;  4BLG A;  2WON A;  1OSD A;  2XMM A;  3NRB A;  3M9N B;  2XHW A;  1TL3 A;  4MKV A;  5E2Q A;  5C42 B;  4ZHR A;  3PW7 A;  1UEU A;  3FQL A;  4RLE A;  4BHQ A;  4USI A;  4ERD A;  1IR1 A;  2VKZ G;  4IG0 A;  4DSF A;  1RT3 A;  2P9G A;  4CLT A;  2VU5 A;  1NPK A;  2HQ3 A;  2F9D A;  1Y00 A;  1H74 A;  2G2O A;  3LPE A;  2LQJ A;  1UZD A;  3HHD A;  4X4N A;  1U25 A;  3A8J A;  4OL8 A;  3M2R A;  1YVF A;  2VQF F;  1HFE L;  5F41 A;  1P1L A;  4ALZ A;  1I6J A;  2JSX A;  2NXU A;  2Z2M A;  2M70 A;  2DPI A;  1TK0 A;  2H1Y A;  4UOH A;  1RWX B;  1TR0 A;  3CTR A;  3ZZ0 A;  4CLS A;  4X62 F;  4JI6 J;  3C2P A;  5B0E A;  2ZH7 A;  3PYD A;  3EXC X;  5DQI A;  2GJ2 A;  4F2R A;  3MMB A;  2BKN A;  3CCM S;  2PGC A;  2RH3 A;  4DR2 J;  3IWL A;  3RTV A;  1M1G A;  2HWT A;  2VG7 B;  4F26 A;  4X4Q A;  1HNX F;  4K2X A;  2HNZ B;  1HBN A;  1RT2 A;  3LW5 C;  2JEF A;  3BDE A;  1RK8 A;  3P96 A;  5CHC B;  2MLX A;  4X66 F;  2C2Z B;  3ENW A;  3MFH A;  2B4O A;  2Y9H A;  5KFF A;  2KG0 A;  3FK4 A;  2NYH A;  2ZC4 A;  1KHW A;  4LIW A;  4W98 A;  5ADZ A;  3EVO A;  4V1A k;  5EHH A;  2CQ2 A;  2IAJ B;  3JSR A;  3KYL A;  1V6H A;  2LLZ A;  3H98 A;  1WNE A;  1Q5Y A;  2Y8W A;  4NLU A;  3S01 A;  2B4U A;  4ED3 A;  3VVU A;  3GE9 A;  2DNY A;  1OSC A;  2D7S A;  3R5A A;  2NQP A;  1H7X A;  4ZVT B;  3MEK A;  1VJW A;  2YNG A;  3DRS B;  4QWC A;  2XWX A;  2GJI A;  3CJK A;  3IAS 9;  2HLT A;  1QSY A;  4J91 A;  1SKU B;  2E9R X;  3RUB L;  1V3R A;  1FRK A;  4USU A;  2ZEJ A;  5H1S V;  1HAR A;  2AX1 A;  3IM9 A;  1RT3 B;  2COL A;  3W2W B;  3MPW A;  4DPY A;  2IDL A;  5LM7 E;  3Q23 A;  1FXD A;  4AXJ A;  3BPS P;  1L3S A;  3OVB A;  3LGN A;  5I42 B;  3T1Y F;  2IM2 A;  2NPI A;  1HNI B;  3VF0 B;  4CO3 A;  2ZH9 A;  4IG3 B;  3TAM B;  1GX6 A;  1NLK L;  2NCK L;  2OHD A;  3PEJ A;  5ETQ A;  4JUZ A;  3W7B A;  4X4S A;  2LXU A;  4XIU A;  3A8E A;  1ZTT A;  2C28 A;  1U1Q A;  4LF5 F;  1XMO F;  1WOR A;  1GMU A;  4CLW A;  4HHH A;  2HZV A;  2E1R A;  2DNO A;  3KLE A;  5L1K A;  4DR3 F;  3Q8S B;  3MR2 A;  2XG8 A;  4CH1 A;  4LRC A;  5B0F A;  2WVF A;  1JLB B;  2IC3 A;  2M4M A;  3Q8V A;  3W60 A;  2KFN A;  1B0T A;  2HBY B;  4Y2K A;  2CA9 A;  3DI6 A;  4K4T A;  1TUW A;  3H2U B;  2GAH C;  3P3D A;  3E01 B;  4RX6 A;  2HVE A;  4KB7 A;  4WZQ A;  3MPV A;  3ZXW A;  4NML A;  4IG3 A;  4ECU A;  5DDR C;  1ACM B;  2HFV A;  2WVD A;  3HT0 A;  4LSL B;  4OYZ A;  3T5L A;  1S7I A;  1CUL B;  2MKK A;  4I56 A;  2Q1L A;  4NI2 A;  3NCR A;  1XER A;  4IRD A;  2EKY A;  2H9Z A;  1HNZ J;  4UQT A;  3L7P A;  5ETV A;  4Y00 A;  1N8R T;  2J0W A;  2GHW A;  3HHL D;  2EW9 A;  4H4M B;  5CYQ B;  1YJ7 A;  2EEY A;  4UQG A;  3BDP A;  3FKB A;  4ZCL A;  2HFN A;  1HNV B;  3N5B A;  4UOF A;  2UXB J;  3OR2 B;  3M8R A;  4YB7 A;  1VC5 A;  4MKB A;  1X4F A;  3RG6 A;  2YX7 A;  4FYD A;  3NXZ A;  1EQM A;  2AZ1 A;  1VBK A;  1NPP A;  3AJ2 A;  3LUY A;  4TNO A;  1HHS A;  3B78 A;  2AEF A;  2I6W A;  4LF8 J;  4K4U A;  4QYZ K;  3D67 A;  1S4F A;  3MCO A;  2BKP A;  4HT5 A;  4K7Q A;  1FJ7 A;  4S0M A;  2KXH A;  3I6P A;  1SC3 B;  1GFW B;  3LPY A;  3J7Y I;  3NGR A;  3HVR A;  1OIA A;  4DR6 F;  4HTI A;  1LWC A;  2HFS A;  3G8S A;  1GAO A;  4H4M A;  5HK4 A;  3TUZ C;  2QN6 B;  1BXN A;  3LGH A;  1QJH A;  3M8S A;  2V4Q A;  1RWP B;  3QQC D;  4CT9 A;  5DG9 A;  3R1H A;  2WOM B;  3BV8 A;  2Q43 A;  3CO9 A;  2QL9 B;  2W2Q P;  3QPI A;  3PO4 A;  4CCH A;  1TK8 A;  4I68 A;  4NMX A;  3FRY A;  4MAK A;  2BE9 B;  5EGY A;  3G6E S;  1LXN A;  4FXW A;  1S79 A;  1RBO B;  3SQG B;  4XAK A;  1M1K T;  4RKU C;  2V8G A;  4M5G A;  4LF7 J;  2D1C A;  1IQZ A;  2VKR A;  4N77 A;  3MZI A;  2CNK B;  5FD1 A;  3SSR A;  4NLO A;  2LEB A;  3FCW A;  2KG1 A;  1P9Q C;  2R8I A;  2BOP A;  3I0S B;  4G3I A;  2YKN B;  1NO8 A;  3ZZR A;  3EIC A;  3M32 A;  1WAC A;  2ADB A;  5CYM A;  3UWT A;  1Z1Z A;  3FDS A;  1VGY A;  2J6U A;  2IA0 A;  4DJB A;  3ILO A;  1FNM A;  3CCW A;  2L41 A;  1D0E A;  2UUB F;  4IRK A;  3S1T A;  1R89 A;  2ZNZ A;  2VUG A;  4OHZ A;  5J2N B;  4ZIW A;  1FJC A;  2Y0S D;  2IPO B;  2XSF A;  1O5J A;  1RKI A;  3HVA A;  3KLF A;  3HXM A;  4QJV A;  4ZP8 A;  4TU8 A;  2B51 A;  3PVX A;  3C66 A;  4XPC A;  1SKR A;  3IRX B;  1ZOT A;  4AQY F;  2XB2 D;  1IVZ A;  3NMR A;  1SQF A;  3MFI A;  4KJI A;  4ED8 A;  1XBW A;  3TX8 A;  2GQQ A;  3AOB A;  3BEG B;  4UUX A;  4X65 J;  1ZA1 B;  2DHA A;  4CIO A;  1QVG R;  1JLF B;  2E44 A;  2HNY A;  1RT7 B;  1NK0 A;  4OX9 J;  2RT3 A;  4RU9 A;  2XMA A;  3JTO A;  2RKI B;  4OMF G;  1FJE B;  1V5V A;  2F1F A;  3KMS A;  2PMH A;  3JSB A;  4RUB A;  3A13 A;  4WYL A;  3CCR S;  2LEC A;  2DRB A;  1SJR A;  4BS2 A;  4X4R A;  4F36 A;  2UXD F;  1VOM A;  5D8H B;  1RKJ A;  5F8N A;  2HGM A;  1LNQ A;  2IM3 A;  2RAQ A;  5KFD A;  3ADA C;  3DCA A;  1FER A;  5AE3 A;  2F5G A;  2I38 A;  5DS7 A;  4I2P B;  4RPF A;  2AQ4 A;  2BUN A;  1M5O C;  4G1Q A;  1VQN S;  2ZM6 J;  3M30 A;  3H4B A;  2CPY A;  3VAH A;  2VDH A;  4TU7 A;  2OD6 A;  4GVL A;  2V8P A;  2E5L F;  4DL0 C;  1TZ0 A;  1T9U A;  1JJH A;  1Y4Z B;  3AB4 B;  3SEO A;  1CUL A;  4X64 J;  3K89 A;  2E7W A;  1URN A;  2EK6 A;  2APO A;  1NH8 A;  2CPI A;  2EXU A;  2N3L A;  2OD4 A;  2YWG A;  2Z56 B;  3FSY A;  5HMW A;  5MAO A;  1R8B A;  2JFK A;  1S1W B;  1NBE B;  3CE8 A;  4Y28 C;  2D69 A;  3CCJ S;  2UUA F;  5DZ6 A;  1VQY A;  4DQI A;  4ANE A;  4DS4 A;  3FVY A;  2VOD A;  1RU1 A;  1TV6 B;  3CSK A;  4OJH A;  5T7L A;  3I5A A;  2L9D A;  3BB5 A;  4TY8 B;  2DNM A;  4ZKA A;  4H4O A;  2GJF A;  3MUR P;  1QM9 A;  2B5J B;  2ZNY A;  3Q2T C;  1E6V B;  1CS4 A;  2E1A A;  3A3N B;  4DN9 A;  3CJ3 A;  1R0B G;  4TLQ A;  4MFB A;  1NK4 A;  4F3O A;  3D9B A;  5DDQ C;  4C8K A;  2OP5 A;  2V4J A;  3I4H X;  4WZM A;  5IWA F;  5D3G A;  2XZT B;  3LP2 A;  3KLG A;  4PWD B;  3BGF A;  3C6T A;  4RW8 A;  1G3O A;  4YEA A;  2R7T A;  3KNA A;  1UL3 A;  2PEB A;  1AA1 B;  2CQD A;  5I4M A;  4DUT A;  3CUL A;  3JSM A;  3M7V A;  2WK4 A;  1U7L A;  2PEH A;  3R9L A;  3G6X A;  4OYX A;  4RBT A;  4IOA Q;  3B4M A;  2UV8 G;  4AD6 A;  2BV3 A;  2DGW A;  2VHG A;  3T19 A;  5IXU A;  5I3U B;  3KG1 A;  2E5H A;  1PJ5 A;  2YQ3 A;  4OYP A;  4M5K A;  5GAE U;  2CNN B;  3GP9 A;  4LF4 F;  1U48 A;  3VAG A;  2JC0 A;  4WK3 A;  3UDL A;  2UUC F;  4I7F A;  2YWE A;  1SIZ A;  3GU0 A;  2NXJ A;  3M1V A;  4ETX A;  2NS1 B;  2JWN A;  2V6A A;  2YKN A;  3B8H A;  4IO9 Q;  1SXL A;  4IR1 A;  2VBZ A;  4OQJ A;  1FFS B;  3S6E A;  3MR6 A;  1N5V A;  5G0R A;  2O5D A;  3G8Q A;  1CVJ A;  4ILR A;  4KFB A;  1YJV A;  2FQQ B;  1BQM A;  1X8D A;  2QTW A;  2XMU A;  3T9Z A;  5IT9 U;  2HQF A;  5HAT A;  3VGT A;  5KT5 A;  3HPO A;  4P75 A;  4DV2 J;  1Q4R A;  2R7W A;  2W25 A;  4Y0F A;  2YNF A;  3HM9 A;  4M95 A;  4ZPD A;  4EEY A;  2HGN A;  2AEM A;  5GAG I;  4A8M P;  2ZWO A;  3GYX B;  3QGI A;  1U1N A;  4NXN J;  1PBU A;  1RBA A;  3DLK A;  3DGP A;  2J76 E;  4OI3 A;  3H8Y A;  5D0E A;  4DF8 A;  5KG6 A;  2HK3 A;  1RIS A;  2HHT A;  2DO4 A;  4Q5V A;  2XWY A;  2UVV A;  5T41 A;  4I1T A;  4X4O A;  5AXK A;  1EP4 A;  2FGC A;  2DGT A;  2R4F A;  3IBW A;  2IRU A;  3L9Z A;  4HI2 A;  3X3U A;  4EU0 A;  4J9O A;  4LF5 J;  2KN4 A;  1DTQ B;  8AT1 B;  1FT8 A;  4DV5 J;  2PN6 A;  1JLC B;  2W9C B;  4OHV A;  3TX0 A;  2KJV A;  4KGK A;  4OI6 A;  2DNZ A;  4ZIV A;  2I2Y A;  1EET B;  5FLX U;  4ECQ A;  4CQ1 A;  5J1E B;  2ZBR A;  3BKT A;  3DLK B;  1SH0 A;  1YQH A;  3CD5 A;  3G82 B;  5KFY A;  1TKT A;  4MIA A;  1GT8 A;  4ZHR B;  3UR0 A;  4WK1 A;  3LP0 A;  3MED B;  1KVI A;  2IM1 A;  2GQ2 A;  2HK2 A;  4ZVP B;  5BR8 J;  1T9Y A;  4LF2 A;  2W01 A;  3QT5 A;  4NLY A;  5HVF A;  1DAR A;  2BW7 A;  2CJY B;  1WOO A;  4GKK F;  4ICL B;  4J9M A;  2KHD A;  2CJX B;  2DIS A;  2EFV A;  3LA0 A;  3UVJ A;  3MWB A;  4R8U B;  2GW8 A;  1KOO A;  4FPR A;  1VQ4 S;  2Z57 B;  2XUL A;  2W8K A;  5AT1 B;  4Q0B A;  4ZJQ A;  5FDL A;  1RCX B;  4JI1 J;  3DMJ B;  3FGV A;  4OYB A;  3BO2 A;  2QYC A;  3D5M A;  1GK8 A;  3KUG A;  1HBO A;  5B0B A;  1UVN A;  2I5J A;  1RWU A;  4N41 A;  1EQ0 A;  2KH9 A;  1SC6 A;  2Z8Q A;  1CBK A;  3P5T L;  3N4W A;  2QEX S;  5A2Q U;  2RNE A;  2RJZ A;  4P10 A;  1U0H B;  2F9J A;  4MMO A;  3CDB A;  4F3M A;  4A8W A;  4IH5 A;  1U1P A;  3ILJ A;  1BMQ B;  4LBP A;  1QSL A;  4F2S A;  3AHP A;  1T9W A;  2BE2 A;  1NCL A;  2OPQ A;  4KSE B;  4X62 J;  3A12 A;  1ZPV A;  4PXC A;  2R7U A;  3RBZ A;  1SL1 A;  1VQ9 S;  2I9S A;  5DM6 Q;  1FNO A;  1SPB P;  3DRS A;  4DU8 A;  1UA0 A;  5HO4 A;  5C24 A;  1RAG B;  3PCO B;  1QAJ A;  3FEZ A;  2CJ9 A;  4QCL A;  3DLE A;  3R6L B;  2LCW A;  4LSL A;  5ITH A;  2VL1 A;  3H5U A;  5HQ8 A;  1Y3J A;  2R2T A;  5J1E A;  2E5L J;  2R2R A;  2HHH F;  4C98 A;  3O2I A;  1ZM2 A;  1FFG B;  1IBC B;  3F56 A;  2MQQ A;  4A4J A;  1T9X A;  2NSC A;  3CJK B;  4WFA Q;  2BR0 A;  4FXD A;  3SSS A;  2EC0 A;  1RLD A;  1NDC A;  2EI5 A;  3EGV A;  1CC8 A;  2C2R A;  4I69 A;  3CD7 A;  2NR0 A;  1N5T A;  1DHM A;  5K8M A;  1JLG B;  4ZPC A;  4C8M A;  4CZC A;  1A9N B;  3NWG A;  3CPW R;  1F2G A;  3VHQ A;  1NM2 A;  1TTH B;  3JXO A;  4TLR A;  5D4L A;  4USM A;  1RTH B;  2XYH B;  3HFZ B;  4JI4 J;  1GQE A;  3D0I E;  4DFK A;  1A6L A;  1X4E A;  2FTR A;  4QIF A;  3QSY B;  4B3R F;  4RO0 A;  1KFD A;  3OFF A;  4X64 F;  5G0R B;  1TFY A;  2DB1 A;  2HRU A;  2X1G A;  3A3O B;  3ZTS A;  2XEX A;  3QGH A;  2VBY A;  2CJQ A;  1LWF B;  3JAM U;  1YX2 A;  2GIR A;  4RNF A;  4C2M A;  3T5K A;  3UCU P;  4C4W A;  3VAL A;  1EZZ B;  3PEH A;  2GVD A;  5B7W A;  4I2Q B;  3GJT B;  2DHG A;  4WU3 A;  5HVG A;  3J7A 1;  2HPU A;  4ED7 A;  2QIF A;  2CPH A;  1MRO B;  3ETO A;  3HHL C;  3T1H J;  1BQN A;  2P8I A;  3GFZ A;  3Q8U A;  4NA2 A;  4PEO A;  4DL2 A;  1C1B B;  3SBM A;  4QW8 A;  1GTE A;  4QIV A;  1UW9 A;  1WC0 A;  2RDI A;  1RT4 B;  4DX5 A;  5L39 A;  2VC1 A;  3H40 A;  2DNN A;  2AD9 A;  3HDS A;  1KLN A;  5F8M A;  2MQP A;  1GH8 A;  3MI7 X;  3UPF A;  3FSI A;  2HVD A;  1H2V Z;  3MCS A;  3NS5 A;  1UEV A;  1RSC A;  4A8Q A;  1VQ7 S;  2BQ3 A;  3J7A N;  2QV6 A;  2R7X A;  4X65 F;  1HMV B;  3K5N A;  2K06 A;  2YWF A;  3OXL A;  1KWM A;  3PJ9 A;  4WF9 Q;  1YRT A;  3D6T B;  4XTT A;  4HDG A;  3CO0 P;  5GAD I;  1NK5 A;  3T9N A;  4A8O A;  2ILY A;  2F63 A;  3ISZ A;  1YRU A;  5JMN A;  1GMW A;  3HF5 A;  2RU9 A;  3THT A;  1T9T A;  3CVK A;  3I87 A;  2JLE A;  1VI7 A;  3LAN A;  1FWL A;  1Q53 A;  2Y1R I;  3BYR A;  4G1I A;  3KLF B;  1YHQ S;  1KNZ A;  2XLK A;  2GGP B;  3G71 S;  2MKY A;  2ZE2 B;  3HSZ A;  4OYM A;  4WXO A;  1M1H A;  1Q0N A;  1QE1 B;  3JYT A;  4Q45 A;  3LP1 B;  2CVE A;  4J9V A;  4QIW D;  4ZP9 A;  4LUB A;  5FII A;  1S1X B;  4AYB D;  1FKO A;  4U7C A;  3RB0 A;  3DHX A;  3DKD A;  3GSI A;  2H5J B;  2ZUG A;  4RW6 B;  5DG7 A;  1B7Y B;  3HHL A;  1RTJ B;  1F9F A;  2DR6 A;  2HSE B;  1ELO A;  4BWJ A;  5CD4 H;  1RTD A;  1T03 B;  1H98 A;  5AE2 A;  3U02 A;  3TZW A;  3QAU A;  2XMJ A;  3CT9 A;  3MAH A;  1WF1 A;  3DMJ A;  2M7S A;  3C16 A;  3DHW C;  4PYD A;  4ZOS A;  4ZVS B;  3SFU A;  2CFX A;  5HVH A;  1WTB A;  2DGV A;  2UUW A;  4B9U A;  1XTZ A;  2VFS A;  2WRM A;  4ID5 B;  2OH2 A;  2QX0 A;  8RUC A;  2O3D A;  1FK9 B;  2IFX A;  2HW3 A;  1PYS B;  1TKT B;  1Y10 A;  5L9X A;  1I3O B;  1BLU A;  2AHO B;  2BBE A;  2ZVS A;  4KC5 A;  3QZ8 A;  3MAQ A;  5F0U A;  1DQ9 A;  4KHR A;  6FD1 A;  4DF4 A;  1NKE A;  4JI0 F;  3J7Z T;  3NG8 A;  1VQS A;  1JLF A;  1OPI A;  1QDU B;  2F8H A;  3SDE B;  5DLG A;  3Q83 A;  2WCX A;  1U02 A;  1KTV A;  4G6V B;  3IMQ J;  4M5I A;  4TYB A;  3D0H E;  2Z2Z A;  3VWS A;  1BHN A;  2HRT A;  4Q2M A;  5F3Z A;  3V4I B;  1IR2 A;  1PCA A;  2MY7 A;  2UV8 A;  3MMA B;  2A18 A;  4DR3 J;  1V5I B;  1DUR A;  2LU1 A;  4F0M A;  4ZVR B;  5B0A A;  1R0A A;  5LXR A;  4LFB F;  1HPZ B;  2UUT A;  4DPO A;  4DV7 F;  3Q0A A;  2LU2 A;  4NI2 B;  3GMG A;  2FC8 A;  2IAJ A;  1TKX A;  2MQL A;  4ZN1 A;  5HP1 B;  2IBK A;  1APS A;  5KFS A;  2CPZ A;  2GO8 A;  3C46 A;  1U6F A;  1IKX B;  3CJT A;  3M8W A;  4UF4 A;  4KYZ A;  1FTC A;  4JV5 F;  3HFV A;  2ZJQ Q;  1TV6 A;  4ZVE A;  2HVH A;  1S48 A;  2FZC B;  5D0R A;  1TKD A;  2BQU A;  1GTH A;  2DGQ A;  3QZ7 A;  4B3T J;  1WHW A;  4BBY A;  1IBL F;  4USH A;  3EZ5 A;  4FS1 A;  2ALZ A;  3QAT A;  4E0D A;  4XDD A;  1UJ4 A;  2WVE A;  3W9J A;  5JVG Q;  3ICL A;  4DSE A;  5J2M B;  4KGX B;  2WW4 A;  1FHT A;  1FDD A;  4DX8 H;  3EWG A;  2HNZ A;  4A8X A;  3MTK A;  4A8S A;  2MST A;  3W2W A;  5C2G A;  2KT3 A;  1FRX A;  3I0R B;  2EG1 A;  3JQJ A;  2DRA A;  2R2S A;  4LMZ A;  3QYY A;  2AWZ A;  4DV1 J;  3QT7 A;  4NCB A;  3S8S A;  4EMD A;  1SC1 B;  2MZR A;  2HGL A;  2P2C B;  1RWK B;  2CIM A;  3M2V A;  1MSW D;  4XK8 C;  2JLG A;  3CCU S;  4DL5 A;  2RRA A;  3D66 A;  3H7H B;  3TZY A;  4KPC A;  3R5C A;  4QU7 A;  4BCA A;  4HT7 A;  2ZJP Q;  3AH6 A;  3H5X A;  5E41 A;  4OI0 A;  1W25 A;  2QFI A;  1NHV A;  4LR7 A;  1B70 B;  3AY0 A;  3FFI B;  4NPO A;  4NYP A;  2DNH A;  3HHK A;  1LW0 A;  2FC9 A;  4ZIT A;  3D1H A;  2BYC A;  2YKP A;  3EE3 A;  1JK9 B;  3M8P B;  5EDW A;  1WDT A;  2IMO A;  4MKY A;  3ZZU A;  3KUH A;  3R5B A;  3NWR A;  3OT9 A;  4NOH A;  2HFU A;  3C15 A;  1VLO A;  3N28 A;  1KR4 A;  1U24 A;  4CNY A;  3KK3 B;  3F44 A;  2FJW A;  2XLI A;  4CLZ A;  1V3S A;  5KFE A;  3OHB A;  4OZ2 A;  4DLG A;  4FBT A;  1SQE A;  3BN7 A;  3I0R A;  4LJM A;  3TUI C;  3W9H A;  2VQF J;  2JEJ A;  4DQP A;  4DFM A;  2G2Z A;  4LBI A;  2YNF B;  4PRF A;  3D7S B;  2DIU A;  4IKA A;  4WXW A;  2UXC F;  2IRX A;  1WC4 A;  1UWA A;  3RU0 A;  3RRK A;  2HAF A;  3C6U A;  4DR1 F;  1H6K X;  2X7I A;  3MM8 A;  2U1A A;  3PR4 A;  4UZB A;  3MEE A;  1DRZ A;  5HAO A;  3PNI A;  4DR7 F;  3ILI A;  2UU9 F;  1S0N A;  1XMQ F;  1WC1 A;  4ZCM A;  4DV3 F;  2UVU A;  3NMA A;  2R42 A;  3C15 B;  4JI6 F;  2UUB J;  1BY9 A;  2A10 A;  3MD3 A;  5IM0 A;  2V68 A;  2L08 A;  1D9F A;  2LQ5 A;  2X1F A;  1N52 B;  1SI9 A;  3IR5 B;  1B99 A;  5I42 A;  1LW0 B;  2HG4 A;  1D1U A;  1VJQ A;  3UVJ B;  2JEG A;  1FE4 A;  3J80 U;  3CCL S;  1NK9 A;  5DGB A;  1VMB A;  2VPX B;  4GKJ F;  3M30 B;  4B3O A;  1WEZ A;  3D0G E;  3DXS X;  4NE9 C;  5ETP A;  3VV2 B;  5AJ3 J;  1JMT A;  1PC4 A;  4JBC A;  4NL5 A;  3J80 Y;  4F4X A;  1SKS A;  3M4X A;  3IRW P;  2YH0 A;  3M6X A;  5D0G A;  2Q6C A;  1Q1K A;  1X9M A;  1R43 A;  4J90 A;  1BUX A;  2V5H G;  2KM8 B;  4ZDN A;  2XS2 A;  3DXB A;  1N0U A;  3BF4 A;  2VZ9 A;  2YXL A;  5ETL A;  4NRT A;  4FP9 A;  4ZN3 A;  3QWU A;  3R27 A;  1UEK A;  2OEJ A;  3FBF A;  3K59 A;  4JV1 A;  4OLP A;  2PI4 A;  1VR6 A;  2CVI A;  3C3L A;  5ETS A;  1IWG A;  3KJF B;  4EO8 A;  2XSJ A;  3OJS A;  3ZZY A;  1I94 F;  3RBD A;  1J2V A;  1C0T B;  4PYA A;  4NWB A;  5B0G A;  4ECY A;  2YVS A;  3A3P B;  4M94 A;  4MYU A;  3EGZ A;  4K50 A;  4CLK A;  2W9B B;  4YDD B;  3CCQ S;  2F4F A;  5HP1 A;  1CPZ A;  1VYA A;  2C3P A;  2E1P A;  1RAA B;  5E3P A;  4R8U A;  1S12 A;  2FJB B;  3SFG A;  2FY1 A;  2XS5 A;  3UD4 P;  1GEH A;  1WC5 A;  3O6Q A;  1VQM S;  4U7U D;  3IR7 B;  6FDR A;  2POK A;  4OYW A;  5AXL A;  2OEM A;  5LL6 d;  2ZH5 A;  2I8E A;  5K5M A;  2YPY A;  3LP0 B;  5GMD A;  2KT5 A;  3DN9 A;  3RAQ A;  2HEK A;  3R5D A;  4AE5 A;  2KT2 A;  1JKH A;  1A0O B;  2XGQ A;  3HD2 A;  1GXU A;  2C2O B;  3FUY A;  4EZ6 A;  2PC6 A;  1C0U A;  2RHQ B;  2YWH A;  2D3O 1;  4UY8 5;  3H2V E;  4K59 A;  1FKP A;  2ZBC A;  1NK6 A;  4OI1 A;  1AUS L;  2WOM A;  2H54 B;  2AZ3 A;  2X3G A;  5MLC V;  2XS7 A;  4OV1 A;  2FLL A;  1Y9O A;  1R6V A;  1FI4 A;  3Q86 A;  3ZZO A;  5M2U A;  3MM7 A;  5AJ3 F;  2DR7 A;  1HI0 P;  3ILL A;  3V2U C;  2GVZ B;  1Z2L A;  2IY5 B;  2BJ7 A;  4HHJ A;  4J9U E;  1Q79 A;  3PKY A;  3GCW P;  4UST A;  3JQM A;  4NLT A;  3OLA A;  3M8Z A;  2UP1 A;  2ZIT A;  2XNQ A;  3QNW B;  4QU6 A;  3T1Y J;  5E3C A;  1YJU A;  3QWP A;  4CLU A;  1CJT A;  4NLD A;  3C6U B;  3HO1 A;  4IOC Q;  1Q5V A;  2Y0B B;  2FGO A;  3GYN A;  3HZE A;  3I5B A;  3NS6 A;  4H54 A;  2N7C A;  5J2N A;  3ZTO A;  2V63 A;  5A8W A;  4G65 A;  2VBW A;  3NOG A;  2MGZ A;  4ECV A;  4C8Y A;  3OTD A;  5SZT A;  2AJ4 A;  4YY3 F;  2B9E A;  2J8S A;  3UFC X;  3OHA A;  1VLY A;  4P6Q A;  3A8I A;  4ES1 A;  4J9R A;  2ZD1 A;  3FMB A;  4CLF A;  5K20 B;  1S49 A;  1T3O A;  2QLB B;  3DOL A;  1NZ8 A;  5EWG A;  5HRO A;  4OJ1 A;  1HBU B;  1XNQ F;  4ZVO B;  2ROP A;  1LWE B;  3SMZ A;  3MUM P;  2ZDO A;  1X7V A;  3BGR A;  5BJR A;  1VIX A;  3MPD A;  3MGJ A;  2YQ1 A;  2J8A A;  2QSW A;  3DRX A;  4KBI A;  2HS3 A;  1JJC B;  4KE5 A;  4C0B A;  4O4G B;  5AXM A;  5AE1 A;  1P27 B;  2ATL A;  2FJV A;  3LAM A;  5KFV A;  3TJ8 A;  1ZET A;  1G1X A;  2CPD A;  1YG0 A;  4F4Y A;  1SJ4 P;  2G13 A;  4P72 A;  2FZG B;  2RU3 A;  1C1B A;  1PJ7 A;  3JSY A;  3GV8 B;  1FRH A;  1LQ9 A;  2DCU B;  1FO1 A;  1UP1 A;  3KLI B;  4DR2 F;  2NUH A;  3NL0 A;  1AFJ A;  4R0J A;  1YBU A;  3V81 A;  2C2M B;  3KHH A;  4LF6 J;  1WWH A;  2IM0 A;  4DUY F;  3MF5 A;  3ONQ A;  4EWT A;  4B3M F;  1KOH A;  3IM8 A;  3DGV A;  3NKY A;  2KVI A;  3OTE A;  3GLJ A;  2HRY A;  1S1U B;  1S59 A;  3BO4 A;  2DNP A;  2P9C A;  1U09 A;  2HWI A;  5DQH A;  2XC9 A;  2ZKT A;  4IUF A;  1FJG J;  1ZH5 A;  3G9C A;  4ZCK A;  3BR9 A;  3JTP A;  1IQT A;  3Q89 A;  1VRQ C;  3BH6 B;  1WOS A;  2OPR A;  1KDN A;  3AB2 B;  5H9E J;  2PSZ A;  1R0C B;  1HR0 J;  2LVW A;  3GJR B;  3W62 A;  3WQP A;  1S1V B;  2B0G A;  4KGZ B;  1PAU B;  3OR1 A;  4ZPA A;  4F7V A;  2DR5 A;  4B3S F;  4ECS A;  3TVZ A;  5CZV A;  3CJ8 A;  2ZH2 A;  4FYV B;  2DEI A;  3ZTR A;  2ROE A;  4K0K J;  1YBT A;  2DXD A;  2L9W A;  3DRY A;  5DGA A;  1RTI A;  1WF0 A;  2DGO A;  4DN0 A;  4PR6 A;  1P8G A;  5J2P A;  1J27 A;  2Z2L A;  2IJF A;  4C8O A;  2R8H A;  4P2X A;  4FZV A;  4MKA A;  3RB6 A;  4JI5 J;  2MYF A;  4ZA1 A;  3SZ2 A;  3Q24 A;  4ELV A;  2RSQ A;  3B4D A;  2D9O A;  4JI3 J;  4EGL A;  4PWW A;  1W26 A;  2QSF A;  1IBK J;  2DPJ A;  3IGV A;  4IDK B;  3J7Y U;  2J6S A;  3G86 A;  1CJT B;  2DEJ A;  3WHI A;  3FZ2 A;  3D1Q A;  5G4D A;  3V6D B;  4DV2 F;  3P49 B;  4C9D A;  2BRL A;  5LXY A;  2RUS A;  1NDL A;  2A0F B;  3I5C A;  3POT B;  4WJB A;  2AKW B;  1IBM F;  1I94 J;  2MKJ A;  1Y0H A;  5KFW A;  3LAL A;  1UJ6 A;  1N0V C;  5B09 A;  2KXF A;  3V6J A;  4C48 A;  3VAM A;  1X4D A;  1YJR A;  2GCF A;  1R7I A;  1XQI A;  4C11 A;  4DZ6 A;  5IFM A;  3R7N B;  3GB0 A;  3QGP A;  2B9X A;  3HJF A;  4QYR A;  2D3O R;  2IHR 1;  1KHV A;  2AGP A;  2DGU A;  2M8H A;  3H20 A;  3W65 A;  4MYT A;  4WFZ A;  2AYB A;  2HZC A;  4KH0 B;  1KEK A;  2Q6B A;  3HMJ G;  3TAQ A;  4KT0 C;  1JKH B;  4RW7 B;  1RAD B;  3CCS S;  1OPZ A;  2BJ1 A;  3F0N A;  3DYA A;  1KQK A;  5L46 A;  1JLA A;  1FRL A;  2J7W A;  1G7C B;  2CRL A;  4ZLL A;  2MB0 B;  4JI4 F;  5L8R C;  2XZW A;  3K5L A;  4C11 B;  1TFW A;  1EB0 A;  1EKR A;  1IKY A;  3KLI A;  5F0W A;  2RD5 C;  4DV0 F;  1XMQ J;  3JQK A;  4PAB A;  4MH8 A;  3IP0 A;  1WJ9 A;  2HFO A;  2HS0 A;  1Q78 A;  3MEC A;  4TU9 A;  4BDP A;  1SH2 A;  1IR0 A;  3WC0 A;  1YIT S;  2B9W A;  4CO2 A;  4KR0 B;  4DPX A;  5U47 A;  1RA7 A;  1DBD A;  3O8W A;  5D6G A;  3OV7 A;  2MKC A;  2Q79 A;  4Y2A A;  5E3R A;  3M9M B;  3JSM B;  1ICE B;  2K8G A;  1SC4 B;  2MKS A;  4U96 A;  3M9O B;  1AYE A;  1F5C A;  2E5G A;  4BWM A;  1AUD A;  1KKH A;  4Y34 A;  5A2Q Y;  3CMQ A;  5EX3 A;  2DD8 S;  3QT8 A;  2HQI A;  4ZP7 A;  3RW7 A;  1X4H A;  3W2V A;  2R7R A;  4JI7 F;  2BAN A;  3HZG A;  4B17 A;  5HMY A;  2ROG A;  1N88 A;  3CUN A;  2H4W B;  5GAD U;  2FJD B;  2I5J B;  3MR3 A;  3K17 A;  2OMO A;  4D3G A;  4WTO B;  3MUT P;  2XMW A;  3PDN A;  1DZ5 A;  2QL7 B;  4LSN B;  2UXD J;  2ALY B;  2VFR A;  3QGG A;  1TVR B;  4AL7 A;  3BBF A;  2WW8 A;  2ZH4 A;  3D28 A;  5H9E K;  3MXH P;  2C2N A;  1NK7 A;  1CJU A;  4TY9 A;  3OTO F;  2LEP A;  2JLF A;  2BZ2 A;  1RTH A;  3BZQ A;  3CXC R;  1K47 A;  2QMU B;  3H2L A;  2J6T A;  3BKU A;  2C3M A;  3FZB A;  3DLL Q;  3MPU B;  3GFH A;  1HQ2 A;  1YTY A;  1EAR A;  2GIF A;  3DLE B;  3V4I A;  4UOC A;  2CAJ A;  4R25 A;  4X4U A;  3V6D A;  2QLF B;  4ELT A;  4KKO A;  4WKR A;  1PYT A;  4X4T A;  2ACM A;  4RNO A;  3TAN A;  1QAY A;  5DET A;  2MZJ A;  4Y65 A;  1HPZ A;  3MPY A;  5ETM A;  3E3X A;  1S9G A;  1T11 A;  3BBC A;  4N76 A;  3LP2 B;  1WEX A;  3ZZZ A;  2E7V A;  2F65 A;  2GGP A;  3R3T A;  1AFI A;  5CXT A;  1LOU A;  4EBC A;  4JV5 J;  5EUH A;  4B3O B;  3J81 j;  3IR6 B;  1B3T A;  4PG6 A;  3BRE A;  4DL3 A;  3BQ1 A;  1SIW B;  4I0W A;  2RIJ A;  3R5G A;  4CTA A;  4X4V A;  2P5V A;  2XLJ A;  3UCZ P;  3LWL A;  1RT4 A;  2GHV C;  4P7T A;  4ZPV R;  2CQ4 A;  2JFD A;  4NCG B;  2N7Y A;  3GSD A;  2DHS A;  3IFE A;  3WIU A;  1K1Q A;  2W1B A;  3BKF A;  1IKV B;  2F8M A;  1ROF A;  1VRT A;  3ZZT A;  2CQP A;  3BYP A;  2V9W A;  3ULH A;  3OTB A;  1P1T A;  4YQW A;  3MM6 B;  3KHL A;  2LDI A;  2R7S A;  4KRW A;  1LK5 A;  2IVY A;  2VG6 B;  5LSL A;  1OY9 A;  2V2K A;  1UVJ A;  5IT9 Y;  3FEY B;  3C16 B;  4ES2 A;  2X51 A;  2Z0G A;  1S1T B;  3QLH A;  2VQE J;  1LFP A;  5KFB A;  2I1R A;  1LWE A;  3HD1 A;  4JP8 A;  5KG7 A;  3SV4 A;  2E1C A;  1UCN A;  1LFW A;  2RQK A;  1F3F A;  4NA1 A;  1JIH A;  2V2Q A;  1MN9 A;  2YTC A;  4XO0 A;  2DGS A;  1XNR F;  3IS9 A;  1U2C A;  3GON A;  1RAF B;  1HQE A;  2QL5 B;  5BR8 F;  3RAM A;  4I7F B;  3KHG A;  4ZVG A;  1RJJ A;  2FUG 9;  2F7V A;  2WSE C;  3BH7 B;  2K7J A;  2LP4 A;  1U6B A;  3UI3 A;  5EN1 A;  3SXL A;  3BN4 A;  5CD4 A;  1IN0 A;  3VTI A;  2NPF A;  2MQN A;  1UFW A;  4DQR A;  1P6T A;  3NY0 A;  2Y1I A;  1NSK L;  1RLC L;  3ZNU A;  1WKK A;  4M5M A;  3WX4 A;  1S76 D;  1CQN A;  5C24 B;  1EHW A;  2DKO B;  2BEF A;  2FJA B;  4YR2 A;  3CME S;  3UN5 A;  1EET A;  1GXT A;  2KHC A;  3EX7 B;  4ZVH A;  1RYR A;  2FLP A;  2JH3 A;  5HN0 A;  4IFV A;  3GG1 A;  1RTZ A;  4CO1 A;  1PKU A;  1RT1 B;  5ETR A;  5KAK A;  2BAC A;  5FLX Y;  4J9S A;  5EX0 A;  2GMH A;  3Q8R B;  1UWB A;  3UNY A;  3D6M B;  2OPS A;  2H5E A;  1JB0 C;  4TVA B;  2CKW A;  5GAH U; 
#chains in the Genus database with same CATH homology
 1RWN B;  1SC4 B;  2C2Z B;  1RWO B;  1I51 B;  2H48 B;  3P45 B;  1RWW B;  2H5J B;  4ZVP B;  1F9E B;  2H4W B;  1RHR B;  2C2M B;  4DCO B;  2CJY B;  2QL7 B;  4ZVT B;  2CJX B;  4ZVS B;  2C2K B;  2QLJ B;  1QTN B;  2XZD B;  1I3O B;  3D6H B;  4DCJ B;  1RHJ B;  2H51 B;  3GJR B;  4ZVQ B;  1RHM B;  2QLF B;  3KJF B;  1PAU B;  4LSZ B;  1RHQ B;  1QDU B;  3R7S B;  1BMQ B;  3EDR B;  1RE1 B;  1PYO B;  2HBZ B;  3R7B B;  2HBY B;  3D6F B;  3KJN B;  4ZVR B;  3KJQ B;  3GJS B;  3P4U B;  4JB8 B;  5IC4 B;  2XYP B;  3EDQ B;  3R6L B;  2XZT B;  2HBR B;  1IBC B;  2XYG B;  1RWM B;  2C2O B;  2Y1L B;  4ZVU B;  2XYH B;  2H54 B;  2CNO B;  2CNN B;  3IBC B;  1NME B;  3R7N B;  1RHU B;  3RJM B;  4DCP B;  1SC1 B;  2P2C B;  1RWK B;  2H4Y B;  1SC3 B;  1GFW B;  2QL5 B;  3R5J B;  2H65 B;  3QNW B;  2FQQ B;  3GJT B;  2CNL B;  1RWP B;  3GJQ B;  2HBQ B;  2QL9 B;  1RWV B;  2Y0B B;  5IC6 B;  3SIP B;  1RWX B;  1RHK B;  2H5I B;  3NS7 B;  2CNK B;  2DKO B;  3IBF B;  5K20 B;  2CDR B;  2QLB B;  4ZVO B;  3D6M B;  2C1E B;  3R6G B;  1ICE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...