The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
171
|
structure length |
125
|
Chain Sequence |
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb |
| molecule keywords |
Leucine-rich repeat serine/threonine-protein kinase 2
|
| molecule tags |
Transferase
|
| source organism |
Homo sapiens
|
| total genus |
22
|
| structure length |
125
|
| sequence length |
171
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2008-05-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF08477 | Roc | Ras of Complex, Roc, domain of DAPkinase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |
