3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
3EC2A 3T35A 1G17A 3QF7A 4P3YA 1L7VC 2ZI7A 1SULA 1YZTA 4TYYA 2IT1A 3B5JA 2R62A 1J90A 1GILA 3VHXA 2F55A 4TSFA 5GJCA 1VCNA 3EZ7A 4OHWA 5SZJA 4KVAA 3RS0A 3Q7PA 4D25A 1OH6A 1ZM3A 2GHIA 3LBNA 3NHAA 1Q12A 4KFUA 4B2IA 4IEEA 2DFNA 4C0BA 4ESHA 4ZV4A 1YQTA 1XCPA 2C99A 2VRWA 2PMDA 4NCJA 4EIWA 4ZKDA 3DEFA 4A4DA 1OIVA 5TB5A 2OCYC 3S1AA 1W2GA 2A5DA 5FOTA 2VIIA 2ATXA 2ZJ2A 2NPFA 3TGPA 4TMVA 1QHIA 2WWGA 3CB4A 1QDEA 3THWB 1XJQA 2AN9A 3BFVA 4PHFA 1BS1A 2O0HA 3X2SA 3F3YA 4B2PA 2X2FA 4RZXA 2BBTA 2DPXA 4RD1A 2HYDA 4TMKA 2E9SA 3UXMA 3U4QB 4Q5IA 4TQ9A 2QMOA 4QGHA 4BZQA 1E9SA 2GA8A 4PQFA 5KU1A 5TARA 4YMTA 4PO9A 4JLNA 5AJVB 1R7RA 3QVVA 1SHZA 4I1VA 4L9WA 1XMSA 2AXPA 3VR1A 4MGYR 4C3ZA 1VG9B 3A8TA 1EX7A 3AV0B 1TL7C 3ZZTA 2XGJA 2RKOA 3K0EA 2F1HA 2YYZA 1W4RA 5TMPA 3WYGA 3UMRA 1NKTA 4BFWA 2RAPA 1JEEA 1LY1A 3A6PC 3BB3A 4UJ3A 2ZSBA 2O8FA 3IPXA 2O8FB 4DB4A 1KMQA 2CL0X 2HLDD 2RGCA 2HDNB 2J0UB 2G6BA 1AK2A 2CJWA 4LBYA 1UDXA 2AWNA 2O8BB 2IF0A 1N2CE 1VKJA 2JLXA 4W5JA 1KNQA 2QT0A 3AVUA 2ZQ5A 1K5GA 1QVAA 4DLVA 1OIXA 1RZ3A 3EX7C 2DWOA 5ELXA 4IDQA 1NLZA 2QZ4A 1R6BX 4KVGA 1RYHA 3FGNA 3FKQA 4KSCA 2VO1A 3PITA 4JSTA 1WXQA 4OKSA 1IN8A 2QAJA 2QP9X 1XRJA 4HLUC 1X8KA 1J2JA 2ZJZA 4LYFA 2GCOA 1CBUA 1Q1BA 3SQXA 1QG2A 4AD8A 4JKIA 2J1LA 2RGBA 4Q9HA 4BEBA 2A9KA 2QGZA 4M2LA 5A4JA 5IRCD 2Z4SA 4TZ0A 3LX5A 4Z1MA 3FHOA 3GLIB 2AK3A 1QHGA 4PO8A 1IY0A 1ZP6A 2FU5C 1NMYA 1QHYA 1N6HA 2RGEA 2BHRA 3QKSA 2HF9A 4P0TA 4IXMA 3WRYC 4AI6A 2UZ3A 3O8RA 4HB3A 1TTTA 2F43A 3C14C 3AVPA 3UMFA 4EKDA 3BC1A 1OV4A 1S0UA 1ONBA 3GFOA 2OLKA 4KFRA 3SJCA 4P4TA 4I99A 3F8TA 5JRJA 3OIVA 4PANA 1HQCA 1Z47A 4TYWA 1XDBA 2PBRA 3IIJA 4A1FA 2WKRA 3MWYW 4PFSA 2QSYA 2HT6A 121PA 1VYUA 2LKDA 3NBYC 3RVBA 4DIEA 4IXNA 2EWWA 5LB2A 1TU3A 2QT1A 2XXAA 3TW8B 3NTUA 3DKPA 1ZM9A 1UKZA 4JZKA 4LJ9A 5C18A 2ZTSA 1G5PA 2C95A 3Q5EA 4WXPA 5L8VA 2D2FA 4DCTA 2JASA 4K46A 4WA7A 3K9LA 4AIIA 4TSFD 4Q1FA 2XZOA 3OIWA 1X3SA 1G19A 3U60B 4KODA 4IW3B 4HLQB 2YJTD 3HU2A 1XTRA 3L0IB 4GOKA 1V5WA 4E03A 1AZSC 2GEDA 2QRZA 1GKYA 3JZAA 4JLDA 4B76A 2XNDA 2AD5A 4QG7A 4RZUA 4QGGA 1P9NA 3W90A 3UG7A 5E7JA 5KUTA 5AK0A 2AHOA 4EJSC 1QHXA 1HE1C 1SXJA 3CUEF 3VTKA 3KJGA 3GEHA 1Z06A 2IUSA 1X86B 3ASZA 1SKYE 4Q4HB 4BRWA 4ZCMA 3VR5A 3U6KA 3TRFA 4F7WA 1DO0A 4PZLA 3O47A 4ZI3A 1P3JA 2VF8A 1Z6TA 3KJIA 2AKAB 2DYKA 3RRNA 3ZYCA 1XD2A 1XD2B 2ODWA 4KCGA 3GJ7A 4MYHA 3QPVA 1G4UR 2FN4A 3LW8A 5EJEA 4M1YA 5EXSA 1TX4B 1EFRD 1N6OA 2GF9A 2J0QA 3RS7A 1FNNA 3VAAA 1FL9A 4AYXA 2NG1A 4PQYA 4LHVA 2P5TB 4BLSA 1E2HA 5FUWA 4M9QA 5A5GA 1OFIA 3LXXA 3EPLA 5EUQB 4V0MA 2NOAA 3QJYA 2QL6A 3OFND 3BAFA 2Y8EA 4Q19A 4UXHA 2RGNA 4YLGA 1N6NA 2GESA 2I3BA 4IVQA 3OEHA 4H1VA 2BV3A 1G7RA 3TE6A 1SVIA 4O0MA 2I1VB 3RNLA 4DHEA 1OW3B 4FCTA 4LWZA 4QJ3A 4C0AC 2KI5A 4BLQA 3OE7A 4KYIB 2HCJB 1X6VA 3K09A 4OJQA 4RFSB 1W0KA 3OEHD 1SGWA 2C98A 4YMWA 1VCMA 4QNMA 1BOFA 1DAGA 2XX3A 4EQ6B 4ZDIA 3OF5A 2ZJAA 4YMUA 3HU1A 5JWHA 2GVDC 2GZHA 1JR3E 4YDSA 2ZI4A 4Q1DA 4UNNA 1RIFA 3IEUA 1E9FA 2WKQA 4HAWA 1RC8A 4URUR 5FUYA 4B32A 4XVQA 3VKWA 4HYYA 3VHLB 3QEOA 5A0FA 1GNRA 4JLOA 4MYCA 2GNOA 3WMGA 1UAAA 1Z0AA 4B2LA 3CRVA 1X1SA 3KXIA 1TMKA 5JWRA 2JLYA 2R6CA 3QI2A 2VPPA 2OG2A 4MGKR 3WYAA 1XZQA 1RRPA 2I1QA 3NXSA 5H8WA 1NSFA 5HTKA 1D9XA 3IILA 3OIUA 1EFHA 4PQRA 3QKTA 1RJ9A 4JLJA 5FPSA 2YKGA 1GITA 4TL9A 4EPYA 4ITRC 3AF4A 1E2PA 4WIAA 4A8JC 2W6JD 1SKYB 1DADA 2FSFA 5JLJA 1E4YA 2J46A 5BQ5A 3THYB 2QPAA 5DISB 2REXB 1W44A 2GJAA 4Q7JB 2WWYA 1G64A 1N0WA 2D7DA 3SFZA 3EIQA 1NN1A 3D7MA 3I61A 2H8KA 2QGNA 4WOPA 1Q0UA 3OEED 1G1MA 1D8TA 1T3LA 1TQDA 2O8EA 2XOKA 3QBTA 2CHVA 1DTSA 3KJHA 1ZD8A 2LWIA 4GZLA 4H1UA 4PHGA 2BJVA 2ZVQX 1FP7A 4ZCIA 2PL3A 1UBGA 3LVQE 4PC1A 4EQ6A 4UNRA 3I92A 5J4KA 2QBYA 1E2FA 4V0ME 3VR3A 2R44A 5CK5A 3BFXA 1QZXA 4US0R 1JALA 2EFGA 5JWOA 2FGJA 3B60A 3BGWA 1GNQA 2ZRJA 1CEEA 3BE4A 5CIWA 1R10A 3AP2A 5IHPA 4TQAA 4XD7A 3S1AB 3WBKA 2UKDA 2ATVA 4Z51A 2A78A 4DCVA 4N3NA 1U8YA 3AF2A 2ORWA 4G5RA 1FQJA 2XEXA 3H84A 2WV9A 3IIMA 4TMXA 3HR7A 1UFQA 4ZKEA 3CO5A 1W4BA 4XTRA 4KAXA 1M6NA 2AFHE 2FA9A 2R6GA 4MITA 3CX7A 1KJYA 3B13B 3KFXA 3LWNA 1HE8B 4JJZA 4QXAA 2O52A 1T9HA 4IOMA 1AZTA 3FB4A 1KDPA 1XX6A 2IS4A 3IHLA 1R0XA 1N5JA 4URWR 3V4RA 1JPJA 1KKMA 2ZRKA 2DFKB 2WICA 4JLPA 1EWRA 2J0VA 4LGMA 4U7DA 4IDHA 2IUTA 1X1RA 3DOFA 1OFUX 2ZAMA 1KNXA 1T91A 1LNZA 4QL3A 2ZSDA 2V7QA 3GJ0A 4UNPA 4BGDA 2WAYA 2R6FA 1KJZA 4DLZA 3HYTA 3KQNA 1OXVA 4DCNA 2ZI3A 4Q4AB 4HUQB 5HCNA 1SQ5A 3WYFA 4XVUA 1HQYE 2PT5A 1PLJA 1R0YA 4LRWA 3EPJA 2LKCA 3SYLA 1MKYA 3LFUA 3TAUA 3QY0A 2UVQA 2CJWB 3JZMA 4FMCF 1IJFA 3RWOA 1JXOA 4Z8XA 2ZS8A 1WA5A 1NJFA 1VIYA 3NC0C 2HXYA 3KKMA 3X1ZA 2IUUA 3OAAD 4BPBA 3UATA 1U90A 1GL7A 2Q9BA 2WJIA 1ZM2A 2VQSA 1FQKA 5EUMA 2CE2X 1WF3A 1R0WA 4XJXA 3T1OA 4TYNA 1M34E 2P6NA 1F48A 3ASYA 3DHWC 1CXZA 4KYUA 3SQWA 3CR8A 3THXB 1XB2A 3NWJA 3RS3A 2N1BA 4HAZA 1KGDA 2H92A 2EQBA 1JJVA 2OCBA 4JKYA 4A8JB 2MMGA 4ARZB 5DYGA 4DEXA 3O8BA 3GLIA 5KTYA 1N6PA 2IXEA 4M1TA 2ZJBA 4PHTA 3E5HA 2BMDA 4HI0E 4GPTA 4CEIA 3SNHA 4RD2A 5AJXA 4B34A 2JJ1D 1IN6A 2CCKA 1K5DA 5SZHB 3GEEA 1N6KA 2VBCA 1Q3HA 1SVWA 1YZKA 2ZSFA 3RWMB 1E2JA 1ZC3A 5J47A 1G18A 3KUCA 3SU8A 1KI6A 4ACBA 4Q03A 1Z6GA 3FHTA 1EWQA 1G6HA 2YOHA 3PUWA 2XITA 3QG1A 5AUQA 4ASUD 4AKGA 2ZJOA 1S3GA 4NCNA 1DAIA 2QE7A 2V54A 4AG5A 2V8OA 5AUNB 2CK3D 2ZU0C 1MRNA 1Z83A 1TF2A 2OE2A 2J7PD 2RHMA 4W7SA 3AVYA 4QHYA 1DAHA 4Q9LA 1Q21A 4BFVA 1AQYA 3KJEA 3QUSA 2J7KA 1KO5A 3SOPA 1MABB 4ON9A 3EARA 3X1XA 3JVVA 2CXXA 1MR3F 3V4FA 4ZIRB 1UPTA 4A2QA 4IVRA 1DAFA 1XTKA 3PUZA 3V00A 2QU8A 1E1QD 2YNMA 3IO5A 5LD2C 4X8OA 1SXJD 3THXA 5CDFA 1XD8A 2V6JA 2VHCA 3CNOA 3X1WA 2IC5A 4F92B 1TUEA 1QVRA 3FFAA 4NBSA 4O25A 4LV6A 1S3SA 3SEAA 3SHWA 4DSTA 2NGRA 5JEDA 2GK7A 1OB5A 1QHHA 3K0CA 3GCGA 1XBTA 4BFXA 1Z6XA 2ZE6A 2WSSA 3QPUA 3QXXA 3W6PA 3M1IA 1E94E 1MH1A 1AN0A 5BN5A 4B33A 2OXCA 2VYFA 2W2TA 3TSOA 4AWXA 2FWRA 3A37A 3K70C 2GK6A 3A4MA 5CM9C 4C2UA 1KJWA 1KSJA 4LJ7A 4R7ZA 4GDFA 5F3WB 1OXXK 1S9HA 4LC1A 4F38A 3OFNA 2FJUA 1CULC 1R8SA 3AVOA 3R9IA 3ZIAA 3ZD7A 2H57A 1TQ2A 4DWJA 5FPKA 1W0KD 1AGPA 1YZUA 4MGZR 2ZUCA 4WW0A 1LS1A 2CE7A 4C0QC 1EGAA 1ZUHA 1OHHA 4DUGD 3VMFA 2MMCA 1FUKA 1J70A 4BECA 2QY9A 1LFDB 3CX8A 2BBWA 4JBWA 1NG9A 4GMXA 2WJJA 2ZRNA 2WWFA 8OHMA 2F1JA 4TL6A 3OZXA 5B2ZA 1FX0A 3A36A 5FOVA 3LA6A 1GIAA 4BFZA 3K0CC 1Q20A 4HLUA 5FTKA 5TXGA 2Z83A 2YOFA 4JVSB 3U3RA 1A5TA 2VSXA 3EWAA 1GFIA 4BLTA 5L3SA 5FI1B 2PCJA 4MUBA 3HDTA 5L3SB 4D2IA 2HYIC 2QNRA 5JS7A 2FDCA 1IN4A 3U3KA 4RKFA 3K70B 1H8HA 3LAWA 4KHZA 4DSOA 3Q3JB 4C0LA 4A82A 1UEIA 3CLVA 2ODEA 4KI0A 2W2VA 1XEXB 4B3FX 3UPUA 2V4ZA 5J5CA 4L16A 1SVSA 5JJLA 1NMXA 3MRSA 2O8BA 3LQQA 5G3ZA 3TSWA 5TDHA 3U7EB 2G0NA 2YWGA 3EAQA 4F4CA 3ADCA 4MRSA 5BN4A 1U81A 1XXHA 1QHSA 1GM5A 1F3OA 3W34A 2H16A 3AH8A 4LPKA 2IHYA 4IHQA 5KNBA 4POAA 2I4IA 1G8FA 2XSZA 4WZAE 4XSGA 1P75A 1E1RA 2VP9A 1CJMA 2RH5A 1E2KA 4TT3D 2ONKA 1DE0A 2AKYA 2V6IA 1UM8A 3LH5A 5KSZA 2IHBA 3SN6A 4HAUA 1LV7A 3WY9A 4TLBA 2W58A 4HB0A 5JJKA 1QG4A 2YOGA 2D2EA 5C4GB 1N0UA 4CEJB 2IXGA 1IY1A 2PCLA 2ZE5A 4DEYA 1XJ0A 3QEJA 4RFVA 2ZETA 1D6JA 1GRQA 3HYRA 4ILEA 2IEYA 2ZI6A 2JLWA 2FFAA 3RSLA 3ZJYA 1R5BA 5KDOA 5LD2B 1ZD9A 3WP1B 3PV0A 2ZAOA 2W6JA 4NHOA 4B6EA 2B8WA 1CTQA 3P20A 3BRWD 4A0HA 4N1AA 3SBEA 2CVFA 4AYTA 4DDTA 1U94A 4M1OA 5FBRB 2HF8A 3RRYA 4D80A 1XPOA 4XWAA 3RS5A 1E9BA 2FSHA 3CRQA 2YWHA 4DLWA 3UG6A 2VP2A 4S2EA 1KY2A 1AJEA 1U98A 3FTQA 2YC2C 1NVXQ 1XEXA 4OI1A 4G1UC 1GRNA 2J45A 3EG5A 2OFXA 3NEJA 3QF4B 2D3WA 4CRWB 2EU8A 4M9XA 5EE5B 4JT2A 5D3MA 2WJYA 3GLFB 3TQCA 4BUJA 4AY2A 2E87A 5CB6A 4FWIB 4WZBE 3H86A 3ZS9A 4KLZA 1JQJC 1VMAA 3FMPB 3CNLA 3X1YA 3ZQJA 3WNBA 3E1SA 3T5DA 4LYJA 5JS8A 3AP1A 2PMKA 3U61B 3CW2A 2IEZA 3THYA 2IS1A 1G9XA 2FH5B 1DVRA 4DLYA 1OF1A 1G3IA 1XCMA 3VKHA 1E79A 4GRAA 1Q3TA 3NEYA 4HDQB 3KZ1E 1NY5A 1I4DD 2ZJYA 4XIGS 1GNPA 4OK5A 2B7CA 3C4JA 4ZO4A 2OV2A 3CRRA 3ZZUA 1WBBA 4IEIA 2IYXA 4B44A 1KO4A 3ND9A 4MQBA 3UKDA 4D4LA 4HLDA 5AUPB 2X2EA 3U44A 3CZPA 2DFTA 2OEPA 2PLRA 2ZR0A 4Y0VA 3TR5A 4US2R 1Z0FA 1G8HA 1HH4A 3GLGA 5HE8A 1BMFD 3VR2A 5DHFA 3P4XA 5EP4A 4LJ8A 4MRVA 4A8JA 4ARZA 4BFYA 2HEIA 4C30A 2EYQA 1NL3A 5FOXA 1KI2A 5H68A 4AC9A 3GLIE 1G291 2RGAA 4II7A 4BFUA 1E2MA 1T8UA 2ZXUA 5BW8A 3FDIA 4WAUA 5FBVB 2KBFA 2BKUA 4GMDA 4KO8A 1VHTA 3FHCB 3P27A 4ABYA 4DDVA 1P2UA 4G0NA 1T5LA 3FKSA 4C2TA 3PUVA 2ZR7A 1F2UA 3BH0A 3UK6A 1V43A 2PJZA 5B30A 3B1VA 1DARA 5DGXA 3QKRA 1E98A 4CGZA 3QQ5A 1TEXA 4HDOB 4NYMQ 4AG6A 2QSZA 1SZPA 2FGKA 5KYKA 1GRRA 2VHUA 5DN6A 3QXHA 1KI7A 4GBMA 4DKXA 3FYHA 5EZ5A 2XZPA 1G3UA 4LK2A 4UQOA 4NYMR 3U3OA 1P62B 3SHFA 1FX0B 2EFHB 3EZFA 2XZLA 3QG5A 1T5IA 1RRCA 4OHVA 4DB2A 3PEWA 4H9GA 1KDTA 1FZQA 4MKFA 3OESA 5B58C 2V9PA 4Q4LA 4BEJA 5KSYA 4DC9A 2H7VA 2XSZD 1Z0DA 5JRZA 1KAGA 2J41A 4D6PA 3O8DA 4M53A 3CRW1 4URZR 3IDQA 2WSMA 4A2PA 1KZ7B 3QF4A 5LPNA 3N70A 2P5SA 1UBFA 2X19A 3GPLA 4XWKA 4V0NA 3TW4A 5CDFE 2RMKA 2GXUA 4PR0A 2WOJA 3SJBA 1IHUA 4B75A 4CT4B 1AKYA 1A4RA 1T0HB 3ICEA 4TLEA 5TV2A 4YXWA 2QM8A 5D3QA 2XJ9A 2GJ8A 1NI3A 1IQPA 2BOVA 4MYUA 2BMJA 2YWFA 5K8UA 2D7CA 2JJ2D 1E9EA 2QMEA 4MRPA 3RLFA 5FL7D 2B92A 3C16C 2J59A 3QIAA 1LW7A 4U00A 1GVNB 1KI6B 1QHNA 3W9YA 2GDJA 1KI9A 4GP6A 1P60A 4OYHA 5EE9A 5UKDA 4HZIA 5CJPA 2BWJA 2IYLD 4RCYA 3BD9A 2X77A 5LBIA 5KPDA 3R9WA 1E1RD 5GJWC 4JLMA 2R9VA 2BIFA 3KTAA 5KDLA 2C96A 3TMKA 1F2TB 1Z08A 1M7GA 4NL4H 4V0OA 4HEJA 3RHFA 3R8FA 4Z54A 2Q3MA 3LLUA 2XNDD 2WJHA 3N2EA 1U0JA 2IYSA 4LJ5A 5GVSA 3FFBA 1JB1A 3AVXA 1FOEB 2HCBA 5BYJA 3GJ3A 4EFMA 4DDUA 1TF5A 1OH8A 3CH4B 3T1QA 1XTIA 3DO6A 3ZD6A 4NKRA 5J4HA 2QAGC 1I4LD 1VG8A 1YZNA 5DNYB 1NVVQ 3GFPA 5GVRA 1JNYA 4DLXA 3HWSA 2G9NA 1WBDA 2WIBA 2P0EA 4U5XA 5GJVC 1JR3D 4PPFA 2NO0A 3GLHA 4JBYA 4NCKA 2A5GA 3PIRA 4E22A 3MGCA 3T1TA 4P4UA 4LOAA 5FTMA 1G8GA 1ZAKA 4QC2A 2X1VA 3R7WA 3A1UA 3IO3A 3IBGA 2C78A 2EW1A 1AKEA 2GAAA 4OQLA 1UADA 1T3SA 3CONA 5IDVA 4RZ3A 3HJNA 2CBZA 4Q00A 3SYKA 3W3ZB 1ZD1A 1IM2A 2XNSA 1W2HA 3K9HA 4WXRA 4UNQA 521PA 1QHHB 3SE0A 4W9MC 4AK9A 1R4AA 4LJYA 3OHMA 3LX8A 3PENA 2P6RA 4G01B 2Z0MA 2QM7A 4FMDB 5IT5A 1PLLA 3WXMA 2WTUA 4L9SA 2Q3FA 3C7KA 2GAOA 1SHKA 2GJSA 2G83A 3LRPA 3L82B 4OHXA 5K8IA 1KI3A 4A6PA 4EPWA 2QTHA 1BKDR 2QPTA 1KK0A 2BC9A 1CR1A 2XTZA 3K0FB 4EAQA 3C5CA 4QNRA 3U7FB 2G88A 2GRJA 2UZIR 4JT4A 4R98A 4M1SA 2V1XA 1JECA 4QKQA 2V55B 2VP6A 5JI2E 1ZU4A 4DZZA 4DJTA 3DOEA 4TMZA 1U9IC 2C8VA 1UEJA 3LNCA 3NG1A 4A0RA 4RD0A 4Q1BA 4C0SA 3L2OB 5JEEA 3QXSA 3VR6A 1XZPA 3IBYA 5H1YA 3F5FA 4Q7MB 3PEVA 1FTNA 4HB4A 2HXSA 1S96A 1ZNWA 2WWXA 3BWDD 3NH6A 1NN5A 1VECA 1CS4C 1N0VC 1Z29A 4JLBA 3SDZA 5L3VA 2J7PA 3AVWA 4BE7B 4LY6A 2WAXA 1W46A 1ZM7A 1BYIA 2ZU6A 4DRZA 4OI2A 1TF7A 1Z0KA 4QOSA 5L3QA 4GOXA 4YMVA 3AGPA 2V1UA 4KFSA 1ODFA 2ZVPX 1NSTA 1ETUA 4NYIR 1TAGA 1I2MA 2C04A 1IXZA 2IX3A 4TTPA 3PXGA 3AKCA 1XMIA 2ZRHA 4P4SB 1YVDA 2WOOA 4Q48A 1S1MA 1OKKA 1SVOA 1XFAA 5FR2A 1Z6AA 2HJVA 2O8DA 3KXLA 5EXXA 3CWZA 1M8PA 3D8BA 5HKKA 4ESVA 1KHTA 4N0DA 3U3JA 4CEHB 2ZANA 4BRUA 1Q22A 1ZJ6A 4Y0AA 2JJ2A 2RGDA 1DG1G 2QMHA 2IYVA 1KO8A 3BERA 4D0NA 2QAGB 2R6AA 1EFCA 1OPXA 1HURA 2Z6VA 2C9YA 2GBLA 3ECCA 1OH7A 4URXR 2F1RA 3G5UA 5G3YA 2G1JA 3U7GA 1R5OA 5DE3A 2P6UA 2KE5A 3ADDA 3B6EA 4JYCA 2QQEA 4TLDA 1AQUA 3KQLA 1AS3A 3QOFA 4LHWA 2MSDB 3U7HB 3LBHA 1G7TA 4Q1CA 4EPXA 3LO5A 4NONA 2WJGA 2IS6A 2ZE8A 1ZM4A 1J7KA 1RVDA 2CLDX 1PZNA 1CU1A 1XTSA 1KKLA 1ZCBA 5FOSA 1ZIOA 4PC7A 2FMXA 4G5QA 2JCSA 2C77A 2A2ZA 2AWOA 3DZ8A 2D74A 4M21A 5EE3A 2DBYA 3B8HA 1NP6A 2OZEA 2VP4A 3A1TA 1W4CA 5TVKA 2PT7A 3LW7A 1CRPA 1NVWQ 1Q1QA 2QENA 4QBIA 3L8ZA 4Q9JA 5KSOA 3K1JA 2ODBA 4ZCLA 1UDWA 4HAYA 2OILA 1UJ2A 1B0UA 1NBMA 2OM2A 4LPSA 1H8HD 2BEJA 1FNMA 1FPMA 1M2OB 3KQKA 1XTQA 1H8ED 2FPKA 3PUXA 2X8AA 2OBMA 2GXQA 4IVPA 3ZGXA 1XP8A 4CVNA 2RHDA 1FUUA 3G82C 4K8OA 1X8JA 4PPQA 2YHSA 5JHHB 1T4GA 1MO4A 2NO1A 2GEUA 3NDBB 2O8CA 1U8ZA 5HZHA 2C5LA 3K0AA 2DWQA 2ZRGA 3PJRA 4BLOA 4EJSA 2H1LA 3D3QA 2GJ9A 1P4SA 1M1YE 5DHAA 4LV5B 2W00A 4Q4HA 3CRMA 1M74A 2OCAA 3WMFA 2B6HA 4X8LA 2O5VA 2IYRA 2PX0A 4EPRA 1IOZA 4TYPA 1P7CA 4J0QA 1S1CA 1Z2AA 1U99A 4TYQA 2ZS9A 3TKLA 4O3MA 2J87A 3ETLA 2B21A 2QQ0A 3CPJB 5G40A 5BXQC 5JSZB 2YZ2A 2QP3A 4MKHA 5CB8A 3CM0A 3CF0A 4PO1A 2CL7X 4RKEA 2IYYA 2JDID 4JL6A 4PZZA 3FMIA 3W5IA 1OT3A 2YV5A 2BBOA 1VG0B 3THWA 5F9HA 2QMUA 2WBLC 2N46A 3FE2A 4PAQA 1GKUB 4I81A 4JL5A 1L4UA 1AM4D 1W4AA 3CPEA 3QBVA 4FW9A 2BKEA 1W48A 2KJQA 4OHYA 1E99A 4LUCA 4M0LA 5H70A 3WBJA 5HR5A 1UBCA 2FOLA 3KX2A 5DN6D 5AWFC 3FOZA 4C7OA 4M9ZA 1QBKC 1IAQA 4LZZA 2XOKD 5KOYA 3FMOB 5EE1A 1JI0A 4EPVA 1FTSA 1MO3A 3AKEA 1OJLA 5BYKA 3QKRB 1Y3AA 2EWVA 3ZZ0A 5DH9A 1NBME 2C9CA 4UKDA 1DG3A 4IFEA 4QBGB 3TSZA 3ZS8A 1DBSA 4KV9A 5IK2D 5KDDA 5CLLA 821PA 2IYQA 2PLFA 4R9UC 2VF7A 3DKVA 1HT2E 4Q4JA 4B3DA 3FPAA 4OL0A 3ZVRA 5FI0B 5C2JB 1N5IA 1OXSC 3MLEA 2FF7A 3CNNA 2ZYTX 1YZGA 1SXJE 2ZSEA 3TR0A 3Q5DA 1YJ5A 5KO2A 2O8DB 5CLQA 3M4YA 5TY0A 1NLYA 4HAVA 3E2IA 2FPMA 1RRFA 3K8YA 5KNCA 3U6BA 2REBA 1G6OA 4NCHA 4X8HA 1N5LA 3AF1A 3THOA 3NC1C 4Q21A 1FW6A 1E79D 1E9DA 4NCIA 4LJ4A 1YR6A 621PA 3P1JA 4QGAA 1E3MA 1JPNA 2OCPA 4UNSA 5CIQA 3LD9A 4F4JA 5AR1A 1J8YF 2ZRDA 5F2EA 1FMLA 1TUIA 1G7CA 3I5YA 1NNEA 1UBEA 2JEOA 2WPDA 4P31A 2FG5A 3R20A 4TTQA 1W47A 4IDPA 2CHGA 5DI3A 2ZRFA 4L8GA 4TQUS 5FPTA 4A2WA 2HLDA 1NY6A 3KB1A 4GFDA 5DLQC 2AFIE 3GP8A 3A1VA 4LDJA 1VCIA 2ANBA 3RANA 3U44B 3R9XA 4TZ6A 2V3CC 3L43A 4CT5A 1IN7A 4YDHB 2GF0A 3NDPA 4B73A 3FKSD 4XOIA 4IDOA 4MRNA 1D2MA 5JECA 4EPTA 3EPHA 3BIFA 1E32A 1RJ9B 3U4QA 2G3YA 2XAUA 4YONB 1MO5A 3U3MA 4Q1EA 1E2IA 2CMKA 1E2LA 4FXPA 2GZDA 3EZ6A 3N2IA 3RS4A 1BYUA 2Z5FA 1YZLA 5C4MA 3EZ2A 3W3AA 1P2SA 3B1YA 1MRSA 1G3MA 1JAIA 2KWIA 4Z1MD 2F3RA 4D4JA 2F7SA 1Z2CA 2IS2A 3K0SA 3B78A 1N25A 1NVUQ 1RKBA 4PAOA 2FFBA 3I72A 3IQXA 4EFLA 3ND8A 1IBRA 1VHLA 2ANCA 2NO7A 3K9GA 4A9AA 3DPUA 3KUDA 2PZGA 1OFHA 4G5GA 1VIAA 2JIZD 1HUQA 3ZQ6A 3AF3A 2WZQA 5FTLA 5FTJA 3BFKA 5DSZA 1U0LA 3EWSA 4EJSB 1OFTA 1GAJA 3PUYA 3CKLA 1ZIPA 5FUXA 2QRNA 1D2EA 4OK3A 4Q02A 4TLCA 2JLRA 3T15A 3L0PA 4OI0A 3EPKA 3CX6A 5F98A 1L4YA 4GNKA 5C46F 2BMEA 2RB4A 3GLFE 4LJ6A 1CP2A 1XXHB 3AGQA 4JLAA 3BS4A 3W8NA 4CW7A 1W36C 4JBXA 2BVNA 2CNWD 4JMPA 1KO7A 2WMNB 3EW9A 1RE0A 3KB2A 4EFNA 3LQRA 2J9RA 4QJ4A 4QJ5A 2WPDD 4BLPA 2O0JA 4P32A 4CYMA 1N6IA 2HT1A 2BCGY 3P4YA 2BCJQ 2TMKA 2Q0HA 3N5CA 4RD4A 1MV5A 4MKIA 4BWYA 1G20E 2CL6X 3P26A 4P33A 3BH7A 2ZRCA 3I4LA 1GL6A 1XWIA 1HT1E 4L15A 5DI9A 2VA8A 4GP7A 2YINC 1KMHB 4M9SA 4RJLA 3D31A 3MSXA 3MWKA 5K8LA 4URVR 2WVJA 3UIEA 1II9A 4N0EA 4PPNA 3TAHA 2F43B 2DCUA 5CJ2A 2REOA 3ZVNA 3BXZA 3T34A 1WB9A 3VKGA 2D4HA 3W6NA 1NLFA 1NN3A 4E5UA 1COWA 1Q57A 4NTZA 4BLRA 4PC6A 5E95A 1DEKA 4JVLA 5JHGB 4C0JA 3RC3A 4XSHA 3SBDA 4CDGA 1IXRC 4MDEA 3CIOA 3LY5A 4W5HA 1W36B 4ASUA 1IN5A 2IW3A 3ZDQA 3CF2A 4AYWA 3KTAB 1ZC4A 1OKKD 3GJXC 5D3MB 1FFHA 4TL8A 3A1WA 1DOAA 2ODNA 2F3TA 2FNAA 2HJGA 1KK3A 4KFTA 2Q21A 4PAMA 1JR3A 2W0SA 4BFTA 4B71A 4QHTA 4QGFA 2RGNC 4OQMA 2OUKA 5EP3A 3ZH9B 3FVQA 3I8SA 4LYHA 1G21E 1VDZA 4OQNA 5FPHA 2IWHA 3FMFA 4B3XA 4DT1B 1G5RA 1W49A 2OBNA 4ZPXA 3TK1A 5DO9A 1G16A 4HATA 4D26A 1DAEA 2RGXA 4FCVA 2KSQA 3HPQA 2JLVA 1P2TA 4E09A 2FSIA 1JQLB 2DY1A 4JVMA 1XPRA 4LYAA 1NIPA 4YC7A 2OFWA 4A6XA 1M7HA 3B85A 3GEIA 4MKGA 2ZE7A 3OE7D 4IRUB 3LLMA 4WZ6A 1KAOA 1US8A 4FMCB 2C03A 4M1MA 3GLFA 1U9IA 3REGA 1G8PA 4PZYA 1OYWA 3CF6R 2HV8A 1Z22A 4M4SA 4PPGA 4Q4AA 4JYBA 2CLCX 2GCNA 2CNWA 1JXMA 1WRBA 1YRAA 2ZPTX 3QENA 5E4FA 2ZUBA 1W5TA 2A7QA 1SXJB 1N3BA 3R7WB 2J3EA 3MJRA 4RZ2A 1LB1B 2AK2A 3TBKA 4ACAA 4Q66C 1OH5A 2WJVA 3M6AA 3DL0A 4IJMA 1UKYA 3ZIAD 3VNVA 3UWOA 1GDDA 1PJRA 1E0SA 1OE0A 1OHHD 3DMDA 1TQ6A 2GTPA 4Q9IA 5EXTA 3Q9LA 1VYTA 3NVAA 3AEZA 4YXWD 4B43A 4OBEA 5BWMA 2IBMA 3WHLA 4B35A 1JR6A 3DMNA 4YMSA 1W0JA 4GSYA 1J8MF 3VNUA 3MWLA 3EIEA 3NBFA 4CEJA 1GSIA 2CEAA 1LTQA 4FD2A 3QSYA 2FX3A 3G0HA 4C0KA 1JAHA 3Q7QA 5J4LA 2JLUA 2XTNA 4GT1A 1E0KA 2QN6A 5G53C 3EXAA 2YVUA 3AUYA 2WWWA 4UXJA 2J0SA 1RW4A 2VTKA 1AGRA 1P61B 3AVQA 4LJAA 1KI8A 1Z07A 4Q47A 2IYWA 2EFDB 3F0TA 2VLIA 2CLSA 1KO1A 2WSSD 4B3CA 3KKNA 4BZPA 4I1UA 4JJKA 4QFMA 1ANKA 2NZ8A 4GOJA 4XVRA 2DB3A 1ESMA 3B1WA 4M1WA 1WMSA 2C2HA 5HPYB 3NHBA 1YR7A 5B57C 1WCV1 3REFA 5GJBA 3OAAA 3AP3A 4RCZA 5FR1A 4MH0R 2QROA 2AD1A 2VL7A 4TT3A 4KBGA 5FL3A 3C8UA 2P67A 2CK3A 1PUIA 1S9DA 4PHHA 2QORA 1KI4A 2BBSA 2JDIA 3MMPA 3QNUA 4G3XA 4PSAA 5B64A 2D62A 2PZEA 1I4TD 3B1XA 2ZS7A 4TMWA 3A4LA 3KQHA 4ZI2A 1M7BA 4LV8B 2YWEA 1P73A 4MUAA 1II0A 1SVKA 3SS8A 4C9BA 5JMTA 2ZRMA 2IWRA 5CK4A 3ICQB 4JLVA 3HR8A 4LHYA 2ASEA 1CR4A 5P21A 1ZYUA 1ZMXA 3I32A 5JCZA 2PX3A 2JJ1A 1NIJA 4KITB 3IKJA 1PLKA 3T06B 1O3YA 4IKEA 4D4MA 1VPLA 2QA5A 4OI4A 5FTNA 1GL9B 1EG7A 1E0AA 3GJ8A 2NO6A 3PQCA 4C4PA 3HPRA 2GBLC 2QEQA 1COWD 3TUZC 3KXKA 2ZM5A 4HZUA 2GXAA 1G41A 1GZSA 3LVRE 1W5SA 2VP0A 3JVUA 1IXSB 1ZVQA 1F2TA 1WP9A 1U8AA 2GETA 5EQTA 1XMJA 4KXFB 4B3GA 4OK6A 4DDWA 3MWJA 3NIBA 1S4QA 5JBQA 2FZLA 3BH6A 4RVCA 5IK2A 5K8TA 1CJTC 3UWKA 1IJEA 4I1OA 3UMSA 3TUIC 3SZRA 5FBQB 3I73A 421PA 1OYYA 1AS2A 1ZINA 2E1RA 4FN5A 3NBXX 3H2YA 4YQFA 2JGNA 3RSOA 4PC3A 4A92A 4NPHA 4NYJR 3BB4A 1RYFA 2W83A 2G77B 4B74A 4GI7A 1E9RA 2KBEA 5GADl 4JLKA 3L0OA 3QXJA 1E9CA 3B82A 2QP4A 1CIPA 2ZI5A 3KKOA 4DLTA 1E1QA 1O87A 3RABA 2FFQA 1ZRHA 2OAP1 3RRMA 3SJZA 4XD7D 1RRGA 4DT1A 1YHNA 1L2TA 3RYTC 4BASA 3MD0A 2A5JA 1D9ZA 1MOZA 1T0JB 5L3RA 2R8RA 4MGIR 4PXAA 3TNFA 3OEEA 1IONA 5KPJA 3NKVA 3LXRA 1T3HA 1XCGB 1AA9A 5EP2A 3CZQA 5E7MA 3W6OA 4Q01A 1F6BA 1HYQA 4IFBA 4TTRA 4BQSA 1XXHE 4URYR 4D0LB 2GKSA 3TLXA 2VP5A 1BMFA 3AB3A 1Z5ZA 4EUNA 6Q21A 2NMVA 2L0XA 2ZRLA 4G5SA 1UKEA 3BJIC 3K09C 4TLAA 5SZIA 1KK1A 2SHKA 3WMEA 4ERNA 2OO7A 2QBYB 4HUQA 2DHRA 2ERXA 3VFDA 1W0JD 1D2NA 2MSEB 4IOLA 2QTFA 2QI9C 3WHKA 2R65A 4LI0A 1TEVA 4FMBB 2ZJ5A 1C1YA 3BB1A 4UXIA 4HLCA 5FBLB 4ZIRA 2FZ4A 1ESNA 2ZYWX 1SKQA 1IY2A 5M04A 3TH5A 1CR2A 2ERYA 3I5XA 4DCSA 3PEYA 1NJGA 1ZCAA 3GLGE 4I4LA 1G7SA 2WWIA 1A2KC 4O2RA 3VU9B 4V0LA 3PCRB 3KL4A 1VYVA 2ZSAA 2ECKA 2IK8A 2IYZA 4HDCA 4D81A 2DR3A 3B9PA 2VEDA 3VR4A 1C9KA 3T61A 1YRBA 221PA 1G4AE 1ZUIA 2Q3HA 2QTVB 4S35A 4AKIA 3GD7A 1CJKC 1NMZA 1JEDA 2J0UA 1GG2A 4BFSA 1Z63A 4B6FA 5G41A 1XPUA 4FIDA 1T6NA 5J4VA 1R2QA 1EFTA 2FEMA 1S2MA 1XEFA 2FE4A 4HSEA 4Q18A 4OQXA 1CRQA 1E2GA 2YC4C 2H17A 1X8LA 2G0TA 2A5YB 1QF9A 1NG1A 4CIDA 2VH5R 4KBFA 5JSZA 1EX6A 4M8NE 3ZVMA 3IEVA 3R8CA 1N6RA 1SVMA 5FBWB 4B48A 1U2RA 2IA5A 1AS0A 1SVLA 1YU9A 3SC3A 4E07A 5E7IA 4MYTA 3QE0A 3PEUA 4LX0A 4LHXA 2Q6TA 2ONJA 3A4NA 4CEHA 3AVVA 1B23P 4M22A 5FH9A 3KFVA 4KJZA 1BO6A 3AM1A 1US8B 3Q85A 3EC1A 1OXUA 4R2IA 2PJRA 4NE2A 1E4VA 1KYIA 1K8RA 2G1KA 2GXSA 4MA4A 4QBHA 4DLRA 5C1BA 2O8CB 4DXAA 1GWNA 4P4SA 3QKSB 3NBZC 4BZXA 3U5ZB 1TADA 1BH2A 4G5OA 4D82A 1HEIA 1XTJA 2OBLA 2P2LA 1XEWY 2QG6A 3IQWA 5AUOB 1II8B 2ORIA 1II8A 4HB2A 3KKPA 2D06A 4R71A 5EXPA 3SR0A 1PVOA 2PH1A 3P32A 1Z6YA 2ZRBA 2EFEB 4XH9B 3ADBA 2RGGA 1DELA 1OXTA 4KU4A 4B47A 4QRHA 2ZRIA 5JI3E 1KI1A 2HUPA 1C4OA 2PZFA 1MT0A 2PEYA 2QPOA 4Q1AA 5KSPA 1OLOA 1E9AA 2BJWA 4LC0A 3WP0A 4C7OB 1DAKA 4FMDF 4WVFA 4NU0A 2ZJ8A 1A82A 4KSBA 1OSNA 5KHOC 4A15A 2CDNA 4RSGA 4W5WA 1LF0A 1RPZA 3PR1A 5EE0A 4Z8YA 1GKIA 1I2DA 1KOFA 1E69A 2QUZA 2CVHA 3L8YA 3CR7A 4MDFA 2JJ8A 2A3RA 2JLSA 2ZI9A 4DLUA 1MABA 3MJHA 5HE9A 3H1TA 1KIMA 3B9QA 3TVTA 5J4YA 3J81k 4FINA 2H18A 5SZKB 4A36A 1HA3A 1PV4A 4TWZA 1EFRA 3KQUA 2XB4A 3SYNA 3X1DA 1WQ1R 721PA 3O8CA 1G5TA 2WM9B 4V02A 2IYTA 2NQ2C 3T1VA 1BIFA 2OXRA 3L0SA 2FSGA 2ZITA 4QBFA 4TN1A 2B7BA 1KZGB 4A0FA 1ZNZA 2XTMA 1VCOA 2JIZA 3B7GA 4AURA 1L8QA 4RD3A 1Z0JA 1YKSA 4AKEA 2F9LA 1GUAA 4Q4JB 3RC8A 2WWHA 3A1SA 1E2DA 3TIFA 1CJVC 1NKSA 1CKEA 1WE2A 2OFOA 5CYOA 3DDCA 3WNDA 4JVNA 2IF2A 3I62A 1GTVA 2W0MA 2F1IA 2AL7A 1VTKA 3MFYA 1ELOA 5FPYA 1JJ7A 3Q8XB 5HZKA 3WRXC 3IIKA 1R5NA 1P72A 1VG1A 1F60A 2Z43A 2GZAA 2ZIAA 3RRZA 1E2NA 1Z3IX 5BN3A 1ZNXA 1W7AA 2FEOA 2Q9AA 3ZLJA 1KY3A 1YR9A 2ZUDA 3WNCA 4L4UA 2AR7A 3HP1A 3AQ4A 4NDZA 4ZDJA 4JSYA 3LBIA 5AJZA 1XEWX 4HZUB 1KSFX 3VQTA 3SI7A 1A7JA 1NRJB 4FI3C 4V0KA 4TL7A 2NO9A 4X8MA 4US1R 2OESA 5FUVA 3I8XA 1G8YA 3UANA 5HCIA 1ZU5A 4RY2A 1F2UB 2EFCB 3ADKA 1J99A 4NYIQ 4DBLC 1WDTA 1P5ZB 2IL1A 2BMFA 3EIHA 1T8TA 5J40A 4FCWA 4OHZA 1ZBDA 5LB4A 2IXFA 5DIFA 4C0HA 2GCPA 3U2QA 2Z4RA 3K0FA 2WIAA 2JAQA 3C41J 3D6TB 1XMVA 3GJ4A 3B1ZA 3PG5A 2ZR9A 2FPLA 2EVWX 1XD9A 2JLQA 1EFUA 2ZRAA 4PTLA 2WHXA 1U0HC 4CEIB 1SXJC 3SJAA 2OHFA 1KSGA 1HY3A 4OJKA 1Z28A 4PSKA 1Z0IA 1P6XA 2F6RA 3NH9A 1S8FA 3DM5A 1KTVA 2AX4A 5AJWA 1H65A 3BBPA 2VSOA 3DZDA 4Q7KA 5HKKD 2ZYUX 2GCOB 3MAAC 3EASA 1E2QA 3RS2A 4F91B 3I1FA 1KK2A 2H5EA 3BK7A 2JLZA 3KKQA 2OAQ1 4OQFA 3DM9B 2R2AA 4AKHA 4XWOA 2GWHA 1H8EA 2BM1A 1CLUA 2NZJA 1XU4A 3GJ5A 3GMTA 4DLSA 1XF9A 4NH0A 3GLHB 1A1VA 3AKDA 1TPZA 2N42A 3AF0A 3PVSA 3E70C 1F5NA 3TUJC 2F9MA 3QKUA 2QAGA 3B2EA 5FFMA 5JJIA 3CH5A 2OT3B 2J5XA 1RFLA 3MCAA 1FMJA 1MO6A 1Q44A 2RCNA 2VSFA 1A2BA 2MSCB 4IDNA 1E6CA 3I3SR 3TQFA 2GJKA 4PX9A 3TJZA 2FV8A 1LF5A 4V03A 3MUFA 2O8EB 1UF9A 2VHTA 4D0GA 2GEVA 3CPHA 3GQBA 1NN0A 3LDAA 1PUJA 3GLGB 2GILA 1AIPA 1XNJA 2NIPA 3EA5A 4RD6A 4L5BA 3IPYA 1ZW6A 2V7QD 4M1KA 3RAPR 2NTYC 3A58B 4NZYA 3IHWA 5ANRB 2JA1A 1R8QA 1TNDA 1EESA 4DSUA 4QM6A 2K5UA 1GOTA 1NF3A 3K9NA 3MG9A 4CZ2A 2DFLA 3T5GA 5JZVA 3IUYA 1G3RA 3QVUA 5F9FA 2ZROA 1Q1EA 2R6DA 4ZDWA 4DVGA 1GP2A 3HU3A 1JBKA 2VHJA 4R2HA 3K70D 1CR0A 1LVGA 3W5JA 4B3BA 1YR8A 1HTWA 1CJUC 2WKPA 4DUGA 5CITA 3EZ9A 3T12A 4WBSA 3GFTA 1W36D 4TMTA 3QPWA 3ONWA 2P65A 1KDOA 2B8TA 1D5CA 3QXCA 4F4IA 1P2VA 1W1WA 4CF7A 3GLHE 2BEKA 3K53A 3OIYA 5DYIA 2WMOB 5EP1A 4NYJQ 3EA0A 4LSGA 1R0ZA 1YZQA 2W6IA 2OSBA 2C9OA 4LBWA 1P9RA 1EK0A 1XJCA 3RDPA 4O2LA 3IGFA 4XTCS 4DSNA 3ZVLA 3DVLA 3VX4A 1OIWA 1TU4A 2XJ4A 2Q9CA 1OB2A 5JFGA 4DCUA 4IOKA 1EXMA 2CCGA 4JS0A 2NPIA 3TVDA 3GJ6A 1N5KA 3BORA 2AXNA 2BDTA 4HAXA 4LBZA 3VX3A 1LS6A 4PC2A 4LBVA 5AJYA 3V9PA 2EYUA 1KMHA 4RFSA 2JATA 2ZYVX 1DO2A 4JIMA 1KDRA 5EZ6B 5FOUA 3H4MA 5FOWA 4UJ5A 3FWYA 5KNDA 2W6ID 4LHZA 5CYPA 5LDDC 2VHQA 5FL7A 3VU9A 1KSHA 1HV8A 1G3QA 1NVVR 5JCPA 4QHSA 3AUXA 3CWQA 2ORVA 1DS6A 2PEZA 1N6LA 4HUTA 2LCFA 4K81B 5DI3B 1DPFA 1E96A 3Q72A 4DIDA 4F93B 1DAMA 2BM0A 4D4KA 2XB2A 4NMMA 2FFHA 2W2XA 4JL8A 4PSVA 3K0AB 4KLNA 1FP6A 3KDSE 1P9WA 2A5FA 3SFVA 1ZNYA 2ZEJA 3AKYA 2XXAB 2CCJA 2ZRPA 4A0GA 2GVZC 3BOSA 4GL2A 1CF4A 4GZMA 5L3QB 3LV8A 2DWPA 2ZREA 2IYUA 4I1SA 1TQ4A 1K6MA 1Y63A 2QE7D 5IF9A 2A30A 3C5HA 4EDHA 1E0JA 4Q7LA 1YE8A 2KB0A 1Z8FA 3M0EA 4LCBA 5E3HA 2CHQA 4MRRA 2P3SA 2O0KA 2OLJA 4FWTA 1E2EA 3H0KA 1ZUNB 1NBMD 3C15C 4U02A 3W8RA 1UKVY 3AVTA 4QM7A 3CBQA 1QRAA 4ZDKA 3PFIA 5CM8B 4Q9KA 1Q1ZA 4IOJA 4NP6A
chains in the Genus database with same CATH superfamily
1NVEA 2ZI7A 2R1TA 3ZZYA 1J8VA 1NYQA 2AF6A 2PGJA 3OJLA 5LUBA 4CUZA 5TGZA 2JAOA 3RS0A 2IUYA 3H5RA 2YVAA 4B2IA 3ACDA 2JPDA 3ROKA 4L3OA 4EIWA 3S99A 2JGJA 5TF4A 3PSHA 3COZA 5LM3A 1GZ3A 1F8FA 5TVGA 3CB4A 3H9BA 2AN9A 5HIMA 1CETA 4B2PA 3GFZA 4N77A 4QW9A 3KVOA 2BBTA 2DPXA 1R0SA 4OXXA 4GKKF 3R3UA 1SCIA 5CNIA 4PQFA 5KU1A 3IBTA 4I1VA 1R6VA 3C15A 2FPGA 1PT9A 5E7OB 2HAFA 4B09A 2FMFA 3AERB 4UMEA 2FPOA 2RAPA 4URHA 2EATA 3ZTRA 3BB3A 3NS7B 4FKYA 5K0EA 3SZ2A 2IF0A 1QVAA 2AJ2A 3RAMA 4DPYA 3ROQA 2DHCA 3D8SA 4X62J 3PITA 4JSTA 1MROA 3V4SA 4PWWA 4OLJA 1CBUA 4MXDA 4JJ6A 1QG2A 3GSDA 4AD8A 1QGUB 1VPTA 4Q9HA 4ETIA 2VQEF 1DV1A 4RABA 4N48A 2IVYA 4ANDA 1KERA 1E6VB 4AI6A 2ECPA 3ZWOA 1GK8A 2F63A 3M9NB 1FU8A 5J3JA 4REMA 4KKOA 2DUNA 2HS3A 4P10A 4MW1A 3TL2A 4BGVA 5GM1A 1T0IA 3DL4A 3UVEA 5G1NA 1YWGO 1DUVG 2UUOA 1C0TB 2QZPA 3EVDA 4A8SA 1SD5A 3Q5EA 4Y9UA 4NA2A 1MNEA 5U1PA 3L4BC 3DJFA 4TRMA 4MP3A 4KE9A 2BKNA 2QA4G 4H35A 4UE6A 3GV5B 2E9RX 1UDAA 4KAAA 2Z1NA 5KUTA 1Z5OA 4X1KA 1XNRF 3I55S 3ASZA 1SKYE 4KXWA 4F7WA 4ZI3A 3HVTB 3RRNA 2W6OA 5C1IA 1Q0RA 5D3KA 1B8NA 1QIHA 4XGQA 3LW8A 1WXXA 3RS7A 3NT5A 5AM5A 3URMA 3THRA 1EXWA 4LFBF 2CYAA 5BORA 4YLEA 4IMRA 4YLGA 4XVCA 4QDOA 4EL0A 4QJ3A 1L5QA 3IURA 1NI4A 3QWHA 1NJ8A 2H1SA 4DCOB 4ZZ3A 5A3RA 3MMCB 2FMHA 1FK9B 2E4UA 4ENPA 1SIUA 1WDLA 4LYEA 2AV6A 4OUKX 5IJWA 3T0FA 1FCAA 3IJ5A 5C24A 4DV4F 1QGAA 2R6CA 3OR1A 5IC5A 5BN4B 2ZYAA 4C7QA 3RIHA 2RIJA 2B37A 1DADA 4DV0F 4PHCA 3MMNA 3V6KA 1MW8X 4KRYA 3THYB 4CUKA 2REXB 2QN8A 3ZC3A 4MV7A 1U65A 4I2QA 1HSOA 1S12A 1DUIA 4PO3X 2LWIA 4H1UA 4G86A 4WJZA 5KFOA 2R8BA 3IUSA 3JPYA 3EFOB 4ND2A 1Z7WA 3AW9A 2BJHA 3O0DA 4NLWA 2CFOA 1EYZA 1JALA 2X6RA 1GNQA 3G5LA 2ZWPA 1X4EA 4YT8A 2HHLA 3AKZA 1FRIA 3E8XA 2RIPA 4D9BA 5EAIA 3FOFC 3AF2A 2XBUA 2A0YA 4G1QA 3B13B 4D8XA 1K3FA 2EW9A 3L6RA 2PUWA 3LUHA 3ZCSA 4URWR 1KKMA 3DN9A 5I8PA 2VBWA 4RVOA 4CMEA 3H5OA 2HH9A 1WKJA 3L05A 2Q27A 1Y1KE 3L92A 2JFGA 3DGVA 3WYFA 3BDVA 2BUAA 2CJWB 3FPEA 5J9FA 5CCLA 3NC0C 1C8VB 1CZHA 4BDPA 3HKBB 1QM5A 2MQ8A 2BEWA 1FX4A 5KQLA 1J0BA 3GLIA 4WOKA 3PJGA 3F73A 1Z73A 4B6GA 2RF2A 4BMPB 3IE1A 1MMLA 4W1PA 2RBKA 2JFBA 2MY7A 5AVZA 5J2UF 4U39A 1JJAA 1RHUB 3OM1A 1Z25A 4NS1A 2ZSFA 3NBPA 2ZH3A 3HFGA 4F12A 3OL7A 5M7EA 3C3KA 1DAIA 4AG5A 2HA5A 5E1OA 5C24B 1XCJA 4WFKA 5KOJB 1MABB 2J6UA 2WHRA 4O3SA 3ZDEA 4M5JA 5TEWA 3G2MA 1ZCZA 3V00A 2H54B 3V6DB 4J1QA 1HT3A 4WXWA 4ERDA 4XX1A 3O8OA 3ILOA 3L8DA 2O50A 2XMJA 3V46A 5JEDA 1AKRA 1RI5A 2ZE6A 5A6SB 2JGIA 1Y8RB 5KVQA 1ZAXA 3K70C 1V5GA 3V8EA 2PC6A 2W2MA 3ZIAA 2DHGA 2O14A 1W0KD 4RHTA 1EGAA 1PZXA 1ZUHA 3E0QA 3IP6A 3U17A 2MMCA 1LFDB 8OHMA 4TL6A 3OZXA 5B2ZA 4G9BA 5DDPC 4TKUB 5M3BA 4KDRA 4JI0F 2KU7A 2OQIA 2R6JA 3IUJA 4UU0A 2PCJA 2R7AA 1FE4A 3T5JA 1WSBA 5B7PA 5C7IO 2C42A 2QR5A 3JALB 1KC1A 2Q3BA 3OJEA 3I04M 2W2PP 4L16A 1E58A 2ZP1A 3GFGA 1YVFA 4OFBA 5CAEA 3O3MB 2FC9A 4EW2A 1XERA 4X3CA 3UF0A 3VKUA 1C30B 3VAJA 1EARA 5F21A 4H4MA 3BUSA 2JZCA 4QFDA 1H66A 2X7XA 1TECE 5AW1A 2YOGA 2D2EA 2VPYB 2H1VA 1GRQA 1ZD9A 5B2FA 1Y0HA 1F3LA 5AKIA 3LCCA 2G70A 1Q8BA 2HBQA 3CMQA 4JBNA 1ZETA 3L3BA 1OY1A 1W9HA 4MV4A 3U3DA 1F0PA 1L7PA 3GFFA 3V1NA 1FMFA 2HY7A 3QF4B 4N7JA 1KEKA 5ITZB 2O0MA 2PX5A 3A4VA 2QRKA 4BHTA 2MQNA 3R7SA 3KZ1E 2HAEA 3KUGA 4B80A 3NV9A 2FHJA 4RLEA 5AUPB 4D44A 4ZCKA 1N6QA 4CLDA 3PF8A 3TQEA 2AJCA 2Q1YA 2OQ2A 5TR9A 1C9NA 4TKVA 2C4WA 2VUHB 1H2AS 1QSGA 3GNSA 1G291 5ETTA 2VK2A 2BFCB 5M2QA 2PL5A 1NXPA 3FHCB 3R0VA 3SPXA 4G0NA 1A97A 4WPGA 4ZCPA 4EKYA 1E98A 1RLDA 3S28A 1UJ6A 4NYMQ 3GXOA 2H65A 3KJXA 1YF3A 4F8JA 3RJZA 4PNHA 3B38A 4J1TC 2X8BA 4AZ3A 4CL0A 4UZFA 2P2SA 1YJNS 2JRLA 2Y1LA 2C5GA 3TW4A 5CDFE 4CT4B 5EY5B 3KDPA 1A4RA 2FW0A 5AT1B 1YJXA 2HJ9A 1VSTA 5ERXA 1I0ZA 2I5JB 5K8UA 2YNFA 1MMFB 2ZB4A 4JB2A 4G1PA 4PCQA 4R6WA 2J9CA 3VUFA 2I99A 4OYHA 3E4CA 1ACJA 4MS1A 5CJPA 3SBXA 3K5NA 4KQFA 4LBIA 1TC1A 1QANA 2J9ZB 2JDJA 1QORA 5F12A 3R8FA 1D2CA 2AC4A 5HQ3A 4BQOA 3CCFA 4QUGA 4EGJA 2YWCA 1XTIA 1GZ7A 2GHPA 3PY8A 1RPNA 2QAGC 4EVRA 3NUGA 1YI0A 2P0EA 4PPFA 3IYLW 3C6QA 3S7RA 1ZAKA 4NR0A 2RNEA 4EFDA 4Y7CA 1G1AA 3IO3A 1NJ1A 5K7SA 5HVFA 4PV7A 4LF4J 3AIOA 5FUQA 4W9MC 2J4FA 1M2FA 5INTA 2ZH2A 5ADVA 4RW6A 5DHRA 4F1JA 3S2IA 2GJSA 3LRPA 4ND4A 2WF7A 1H72C 2A9JA 3R4VA 1T5TA 4C7JA 3FTFA 5B7QA 5ETKA 4QNRA 4JI5B 2V55B 1DZIA 2H1YA 2WUEA 3HB0A 1NULA 4QSMA 2C8VA 3NG1A 5JQGA 4C0SA 4OYAA 4W8HA 1N8SA 1NHUA 7YASA 5JVDB 1EB8A 4ICLB 1EXVA 2QJRA 1FYEA 4A8WA 4WESB 2Z57B 1VGYA 3KLVA 1R74A 3VJLA 4AMYA 5DYTA 2UXBJ 2I3DA 3V2HA 3QJJA 3ZEAA 3G8TA 1WLYA 1N32F 2QM0A 3KXLA 3CBGA 1AD2A 1HNXF 2HRRA 1PSDA 5JLAA 3G8DA 3KHSA 3QYAA 2AZ1A 3DV0B 2QPLA 2A35A 3BILA 1V37A 1IWBB 3M7VA 2A8YA 4BO9A 1G20B 5C8YF 1LSOA 3IOBA 1KEEB 2CV2A 2ZE8A 1CU1A 1XTSA 4LGYA 2XGOA 1S97A 1JL3A 4N76A 2O9JA 3K6SB 2C4TA 4A8HA 1YAHA 3QOYA 1MDBA 2HK7A 1NUPA 3AXTA 4EENA 2B8EA 4CWBA 3F7TA 2OZLA 3PQ8A 5E1DA 2BX6A 4XK8C 1IPFA 2GJ9A 2BEUB 4PGGA 5F52A 5DHPA 2IYRA 4G67A 3MPWA 1P7CA 3SHVA 1K8XB 1MFZA 2WIFA 1Y1RA 4IIJB 4HWKA 2COEA 1EQ2A 3BKUA 1PU2A 1NXTA 1OT3A 3G59A 1V5IA 3KLBA 3FE2A 4YAGA 4PAQA 5I42A 3CEHA 2HM7A 1WU8A 3R41A 4KLAA 4TT8A 2G9UA 3KX2A 1BGXT 1X5TA 1NFQA 2P6PA 2VZLA 2C9ZA 8LDHA 4X6LA 5IVHA 1HO3A 4HDRA 5CX1A 1UDBA 1RAHA 1NC1A 1XMOJ 1RAOA 5GMDA 3UXEA 2VF7A 1HT2E 4Q4JA 3FROA 1OXSC 1AXQA 2ZDQA 4B0PA 4EAAA 1YZGA 2MXYA 1EZZB 3KP1A 3MM6A 2IFTA 1TEZA 1QUVA 3AF1A 2Y1EA 4PPZA 1RWWB 1TCAA 2BJ7A 5JPCA 2EX1A 4OAPA 1VIDA 1R4MA 2BANB 1OXKB 3FRYA 5TPZD 4BPRA 2CHEA 1RA6A 4OL9A 1WEXA 1T6YA 1RIIA 4MNTA 4YV2A 2ANBA 1PI3A 3GFBA 4DYDA 1EIZA 2LCQA 2WCXA 3GJRB 1PJ7A 3NHMA 4CLHA 2GN0A 3L7UA 3WLSA 4YP7A 1MO5A 1CZUA 4DQSA 1CBKA 1F2DA 1VJTA 3OU7A 1VQLS 4KPFC 1WOPA 2DGTA 4UU8A 2JAUA 3I72A 3AR9A 2QO3A 4P4LA 4CG2A 1VIAA 5I4IA 2FN7A 5I5EA 4BMCA 4Q5VA 1Z5GA 1NF8A 2ZOMA 3T15A 4OI0A 1RCOB 1KOJA 3D8UA 4GNKA 3ET4A 2HQBA 1TIBA 5C34B 5AW0A 3AGQA 4KP7A 3W8NA 1X13A 1R1DA 2W1BA 1M2WA 3LQRA 2J9RA 2X41A 5CG2A 4AZVA 3G2QA 4WP9A 4BWYA 2OI2A 3ROGA 3P96A 1GL6A 1IY8A 2XYPB 1MC5A 4M9SA 4EYHB 4U6SA 1BX3A 3GYXB 2WVJA 3EGIA 4N0EA 1JLEB 2PLWA 4DPMA 3LQFA 3CTRA 2NS1B 1Q84A 3K5HA 3SBDA 4MDEA 2VJPA 2JGDA 1VRUB 3UO0A 1SKBA 4H59A 4F6RA 1HM5A 2DPMA 1VDZA 4UNIA 4FS3A 3AAWB 4ALNA 3GP9A 4FCVA 1V9LA 1YU6A 5AXMA 3E9MA 1M7HA 4IRUB 1KP9A 4JAVC 4Q4AA 2CQ2A 5K6TA 2F8MA 3KALA 1W5TA 2KO1A 4ZYYA 4G8JA 2G1PA 1RHRA 4DUYJ 2F62A 4O3NA 3AUJB 2H4JA 3GGGA 1QP4A 4RX1A 3NVAA 4HT7A 1RMQA 5DNDA 1W0JA 1E7MA 1WHYA 3FCVA 4Y7DA 1S1WB 3OLVA 2JLUA 2FMIA 5G53C 1C8LA 1DQAA 3K8QA 1AGRA 2OA0A 1RWVB 2NACA 4A10A 3CT4A 4EF6A 4RH0A 3UA3A 1F6WA 1ZY2A 4GOJA 1YR7A 3OL8A 3ZGYA 1AUOA 2O59A 2VL7A 4Y6OA 1JKJA 5CH8A 2ZTMA 3FNHA 2X7IA 3RS8A 2YWEA 5IZCC 3TZZA 1Z26A 5DP2A 1Q0TA 2WZCA 5MN4A 1IEXA 3SCZA 3I64A 2E1AA 3K72B 2XEDA 1I6WA 4P5DA 5DP1A 3HFSA 3IB3A 2QJWA 4Q3BA 2L9DA 3RHSA 3M49A 2DY0A 1ZXLA 1VKNA 4K28A 2PSSA 2H1WA 4MUMA 3KS9A 4CKBB 4NPHA 1XLWA 3W63A 4ZFNA 2FHMA 2W6ZA 5E6UB 4Z7CA 2YWXA 3U40A 4ETZA 3RSCA 2ZJFA 1M8FA 3MM6B 4RXUA 2GBIA 3OVAA 1KVUA 3NKVA 1K73T 3RVQA 4AF7A 3P2KA 4UULA 4RKUC 2VP5A 4ZAWA 1GPAA 3MHYA 1E6VA 3A8EA 2W4QA 1I7DA 1GZVA 2NU7A 1W4LA 2VA2A 2R65A 3HA5A 4TV9B 2ILVA 3H1BA 2REQA 3W4KA 4FI3F 4MVJH 4DCSA 1CSEE 3GLGE 3T19A 3OVMA 1L7NA 1XPUA 3SCIE 5ISMA 2J9YB 2ORED 3TO5A 1VJCA 1E5DA 4IF6A 3EFHA 3B52X 4ZI7A 1DSSG 4R3NA 2VH5R 4KBFA 4R25A 4ZI5A 4Z4FA 1E89A 2VPWB 1WORA 2NLOA 3OCYA 2B4OA 2PJRA 2O8CB 1K8RA 4MA4A 4Y9TA 2N7CA 2Z2YA 4P4SA 3JAMA 4G5HA 3ASVA 2A9RA 4M83A 3GOHA 5EXPA 1M2EA 2CNKA 1GRCA 4XH9B 3EICA 2RGGA 3FNQA 4G0PA 3OZTA 5KSPA 1NI4B 7MHTA 3CWJA 4LFCF 2V6BA 4P71A 4W5WA 2AIRB 1DOZA 1B0TA 1SBQA 1BQMA 1T1IA 2DLNA 3ZHBA 3KK1A 3H1TA 5J4YA 1U6KA 1GAWA 3TA2A 3SR3A 2IYTA 4QBFA 1ZNZA 4NICA 4BNDB 1TP7A 1EEXB 3TCXB 1UXKA 2JI6A 1XZCA 3KOUA 5CYOA 4EARA 3W5BA 4LZWA 5FPYA 2IM0A 1MWYA 3FTDA 1UFRA 4YB7A 1K8ZB 1L7EA 3WNCA 4C6TB 4L4UA 5HYVA 3AQ4A 5KFWA 1KOLA 3VQTA 3SI7A 4JI7F 1D6SA 5AOBA 4YR3A 4ZHRB 1VIMA 1CG6A 2GX8A 1WG8A 2EFCB 3WA7A 1YUBA 1RVV1 5J40A 3GROA 4HNGA 5JBNA 1Z75A 1A96A 3K0FA 2Y1IA 3UYLA 2JLQA 3L7OA 2ZRAA 4R8KA 5BW5A 2WK1A 4FGUA 3JTNA 1P6XA 4JI3J 2MYPA 4JFAA 4D6YA 3ROXA 4YRZA 4RSRA 5D7NA 3H5YA 2OAQ1 5T3UA 1J9ZA 3ZZ1A 2M0GB 5A4MS 1FUEA 2ZCVA 1C1DA 1JP7A 2AMYA 4EJ0A 1F5NA 3AO0B 3H7IA 3JSAA 2PVCA 4X7RA 4RQTA 4J0FA 2JLBA 3VPBA 1JA9A 3TAMB 4PYIA 2HQSA 1RAAA 4D0GA 3ELUA 1R89A 3LDAA 4D43A 2GILA 1XNJA 4EL5A 2HIMA 3P19A 5EIHA 2VQFB 5K51A 4R7GA 2HU2A 4KIAA 4EO9A 5K3BA 1EFDN 4O3RA 2NVWA 4LW8A 2H2DA 1R7IA 1HYHA 1SC1A 1ISRA 2ZROA 1Q1EA 1N2JA 1P33A 1GP2A 3VDQA 1NZFA 3LKZA 2FW7A 1WXDA 4LRCA 3C6UA 1YR8A 3K2IA 3HULA 5CITA 1ULBA 3T12A 4WBSA 2Z08A 4C8ZA 1ND6A 3ONWA 3I2GA 5BSGA 1D5CA 4F9FA 2WMOB 2YBEA 4JUFA 4R1QA 4LBWA 1HF3A 1H22A 1SJ4P 1OIWA 4JNKA 3LT2A 4KI7A 2C7QA 3GRCA 3KLEB 4X84A 3RTVA 3WKDA 3D67A 4RFSA 3ILVA 3SEFA 4K6HA 4TS9A 1G3QA 4N8DA 3HFRA 2FPPA 1YQUA 4F93B 4DIDA 1NTRA 2BM0A 1F1JA 3KDSE 4QVKA 2ES4A 1KS2A 4JUAA 4FFBA 2Z4PA 1BHNA 4R0MA 1FTCA 3M6IA 1P8AA 3NX4A 4WXMA 2WVDA 4EDHA 3V81A 1YSJA 1L5WA 1KJ9A 3G85A 4HOYA 5HUQA 2KFZA 4UOEA 2BHTA 5EN1A 5JZOA 1MJHA 3PFIA 2BE2B 2VJUA 2GN4A 1FDVA 3J81j 3QF7A 4P3YA 5F4BA 5ES3A 5M5BA 1XZEA 3B5JA 2XVYA 3L7JA 2G2OA 1FFYA 3TD9A 2IEGA 4D3GA 2J3MA 4M60A 2A2CA 4MIAA 3CCLS 2C5EA 4D0RA 2B83A 1RWXB 3MHTA 1NUHA 3ITEA 3N8IA 2V7VA 4OJGA 4F71A 3ZK9A 5ETMA 3FDXA 2W8ZA 4LXIA 4L8VA 4RD1A 1QRDA 1B73A 1SHZA 1R12A 3AR5A 2F4VJ 1ENYA 3SR4A 3GLKA 4DM3A 3UMRA 3AI3A 4NEZA 3GB0A 2JGEA 1THMA 2GBGA 3E9QA 5KQSA 2BKXA 4B9SA 4MWSA 2HLTA 2QT0A 4MH8A 2YUIA 5EVJA 3IKTA 4C04A 1SHJA 1HBOB 4AYBD 1OR8A 2ZJZA 4P0PB 5HQJA 3SQXA 2QGZA 2BBEA 5BSTA 3JWGA 1NWHA 3VSCA 2PQ2A 2FU5C 1Y37A 3CVOA 3JYPA 4MW6A 1TTTA 5E6SB 4UOZA 3ETJA 1XCBA 1RCTE 3GJZA 4DMLA 3N0WA 3UT5B 1JTFA 1M6EX 3RVBA 121PA 2DVMA 2O5DA 1V95A 4M5DB 4LVOA 1TK0A 3PSAA 3MJEA 2C2OA 3S2EA 4O1HA 4NLDA 4WXPA 3HJTA 4WA7A 2Q2OA 3EJWA 2QZZA 3OIWA 2XTJA 3BKFA 3FYTA 3R5GA 1RRMA 1AZSC 3BDAA 4ZN6A 2XNKA 1HE1C 5FUMA 5IJ0B 1SVDA 1E18A 4Z6KA 1U2PA 3AOEC 2H85A 4HKTA 3KJIA 4ZO9A 5IJAA 1S4EA 4PBTA 3HU5A 4HJRA 1TB4A 1WUKS 2GF9A 2X15A 2NG1A 1E2HA 4KO0A 3Q8KA 1I6KA 2IC3A 3HHLB 3I6YA 3VVCA 1I5RA 4HRYA 2B8QA 1A1SA 1XHLA 2PZKA 4NNJA 1BHQ1 3GDOA 2GVDC 4J90A 4DQDA 3IEUA 4ZHQB 1PSZA 2N75A 4E5YA 4MTLA 4DABA 5AVJA 1GYPA 2I87A 3VHLB 3KIPA 4UBOA 2R5NA 2GNOA 4QD3A 3KXIA 3LUFA 3H4VA 1HMPA 4MGKR 4Q9DA 4CP5A 3EQ9A 5HFJA 2QLXA 4Q05A 5IT9Y 4C76A 3EF0A 1E2PA 4A8JC 5LYYA 2FSFA 1SV5A 5BQ5A 3AR4A 1Z0UA 5J2NA 2VUGA 5JNSA 4Q39A 3SFZA 3D1QA 1HKUA 3Q12A 2FVYA 5HBGA 1D8TA 2XOKA 2ZH9A 1OI3A 4PHGA 5CH7B 3P6YC 4ZVUA 2YL2A 3ZOZA 3JYQA 4UNRA 4WI1A 1P9OA 2QBYA 1B0VA 3UN2A 3OVSA 1JNXX 2QMZA 4FZRA 4TXLA 2JEIA 3L1HA 4RZSA 2PUCA 2A78A 3R6TA 3EXIB 2ATCA 4L74A 3W2WB 3MRVA 3OLAA 1HI0P 3HR7A 5DRTA 4ZKEA 4R01A 1Y5IA 4BUZA 1VRQC 4C0WA 1JEYB 3D6HA 5A76A 2O52A 2J0QD 2RCYA 2VCEA 3HT0A 4LCJA 4XRGA 1TIPA 3EXYA 2RQMA 4PSCA 2V50A 1GA1A 3ZC4A 1LNZA 4ZT3A 4JP8A 4DS5A 1KYVA 4M5HA 1OXVA 3DCYA 1QF7A 4X00A 5ICGA 3E7PA 3VGSA 1MKYA 2HWKA 1IJFA 5LWHA 3I6IA 2VQFJ 2RHJA 1QKKA 2R1ZA 5BSUA 3OLCX 4NBRA 3Q8QB 1TUBB 1Y81A 2ZHAA 1F48A 3EY9A 3THXB 1NU6A 2QN2A 1ST2A 1TL7A 1GU0A 1O95C 3AJ2A 2Q0QA 1T9XA 4UDYX 2CDRA 4G4SO 1IBKB 3T7IA 1NYRA 1K5DA 1IXYA 1Q3HA 1IE3A 3RWMB 1RI1A 4YGYA 4A5SA 1IJEB 1EWQA 1N7GA 2ZJOA 1VPVA 5TEVA 1QQAA 4WE3A 4JI7J 1KE1A 1H9AA 3LPEA 2X5XA 4MHSA 1Q16A 4J94A 3SOPA 1TW3A 4U2CA 1CZKA 2XB8A 4AXXA 4X1OA 1CNFA 2WD9A 1EK2A 1OX4A 2PANA 2JHEA 3VPDA 5ILGA 2XMAA 3RNOA 1N5YB 1SXJD 1WSVA 4KB7A 2IC5A 1FESA 1CG2A 3NJ4A 4FHZA 3BE5A 2WIDA 4U9RA 4MR7A 1ZN7A 4MA5A 1IC6A 1MH1A 4G36A 2GD2A 3HHKA 4D7AA 4DA0A 4M0FA 2C97A 1XN1A 2DH5A 4CQLB 2VYFA 4AWXA 1PYOA 4GLOA 1KSJA 4PE5B 4XPZA 5KFIA 1M2OA 3VZBA 5FPKA 5IPFA 3PNBA 1LS1A 2CE7A 1Z62A 3JY6A 4J3FA 2QIFA 2QDXA 3BK2A 1FUKA 2F1JA 1SU8A 4MAFA 4JYAJ 5BT9A 3VYVA 1XA0A 1QH1A 4PYRA 3WQSB 5CNMA 5K1ZA 5L3SA 4O44B 2HYIC 1FRFS 1TK5A 1IKXA 4RKFA 5TPZA 4F4WA 3L84A 4HXGA 5DLYA 2VPWA 4KOAA 4O4HB 3NBUA 4O3FA 3S2SA 4JI1J 3U7EB 3VOSA 5EWJB 2B2CA 1T2FA 3WQBA 3AH8A 1VIOA 2AJFE 1XMOF 3A4YA 3EG9A 1DE0A 4MV3A 1MU2A 2OC9A 1T29A 1QIEA 3RU7A 3H90A 4KO0B 1IY1A 1REQB 1JB0C 2FFAA 4H27A 4WK6A 1WG1A 2MMYA 3UI3A 4M55A 1TOAA 3UCGA 1A50B 4RAQA 2FSHA 4NBLA 4L0MA 3ZY2A 1K0TA 1Y5RA 4L0CA 4OI1A 3ZY3A 3EDMA 4CRWB 1CC7A 5D01A 5CB6A 1RWMB 3R44A 2Z1DA 1FDUA 2VL1A 3G2OA 2IEZA 2OELA 1G9XA 3NTXA 3UT6A 2E5FA 1E79A 3NEYA 2K2WA 4HDQB 3OLBA 3A28A 4WLOA 4JC5A 3RQIA 5KWVA 1FDTA 1L3BA 1XV5A 1VLZA 2PYIA 5HRAA 1ECFA 1Z6ZA 3GLGA 4LJ8A 1VE5A 4HX9A 2FOXA 2IXTA 4ZOLA 1SD2A 2IZ1A 2RGAA 2EFQA 1PZHA 1T8UA 4R1OA 3N2KB 4C9DA 2RRNA 2VOJA 4BVHA 1IQRA 4IHJB 3DBHB 4J9UE 4RYDA 1NJIT 2GC8A 3IR6B 1TKXA 1Q2XA 2WP8J 3G88A 3LWMA 1JLAA 2FFRA 2IU3A 3SVLA 5SYNA 4TWJA 1G63A 2H7VA 1WZIA 3JQRA 2FUG1 1QGZA 3CRW1 1J49A 3VNQA 4RC9A 1L8OA 1SUIA 3QF4A 4UCFA 3KLGA 4N65A 1P1FA 3WL3A 3CLRD 3OOWA 2YKMB 3P9RA 3AUUA 4RZIA 2CSUA 1U24A 3OWHA 3S5UA 2GPBA 3DU5A 1I2CA 3VZPA 3GWZA 3SYRA 2EZUA 4BGIA 3F8SA 4Y6SA 3BD9A 2BY4A 5KPDA 3RIGA 3KTAA 2RKBA 5BR1A 4K87A 1F2TB 2QVXX 1K7FB 1V5VA 2LCWA 2H59A 4HEJA 3Q86A 4QEDA 4CTJA 3ODGA 2XNDD 2EHDA 4Q45A 1QFMA 4DDUA 4JI1B 4BNLA 3U0VA 1V8ZA 5TJHA 1I4LD 2XCTB 3ZDZB 1TA4A 2A3NA 5ALOA 2WIBA 5GJVC 1L5YA 3SQDA 2WW8A 3BWEA 4QC2A 2NVBA 3IBGA 1RYSA 3ORHA 4CMGA 4JX9A 3UD4P 1B0ZA 3MRXA 3PENA 2HBRB 3EQ6A 1L3IA 4GX5A 5IT5A 2R2UA 3ITHA 3ZVKA 4XLTA 4OHXA 4EPWA 1KK0A 3HLTA 4UF4A 3KLEA 4U7GA 4X66J 4ZYVA 3OPQA 1RACA 3L02A 3TPCA 2OCKA 5CVEA 1LDNA 2R5WA 3VAGA 5JEEA 2W4IA 3OOHA 1ZISA 4GE0A 4RZQA 2OV3A 2W7TA 4B3TF 4MS1B 4CGYA 2ZTHA 4LY6A 4C08A 1ZM7A 2EQAA 1DQ9A 1AMNA 1OWOA 3IBCA 1A6LA 4TTPA 3DAGA 2H5JA 1GTSA 1L3VA 2J31A 3BBFA 3WO0A 3CWZA 3WGNA 5HP1A 5FBHA 2MQQA 2PX4A 2PH5A 5KG7A 1Y9JA 2EEPA 3TQOA 2AYBA 3WGLA 2X9VA 1OH7A 1RKJA 3IA0A 3JARA 2FAXA 3BRSA 1IVYA 2ZJ4A 3PDIB 1VA4A 2QW8A 1WF0A 5CT8A 5F78A 6LDHA 3LO5A 4Q82A 4X45A 1C29B 1PZNA 4MX8A 5FOSA 4DL3A 3UWPA 5H9FJ 1RI2A 3CFYA 5CYQB 4MI1A 1Q1QA 2QENA 1RWUA 4Z7JA 1ULZA 2KMLA 4ZCLA 1B0UA 3DS8A 3OPKA 3SLKA 5A5FA 1H8ED 2GXQA 3KZMA 2NSLA 3O75A 5AO9A 1ECGA 1I0IA 3B70A 2O8CA 1TM3E 5DGHA 4KHPB 5G4KA 1UWKA 4XB6B 1CE8B 1P77A 4EITA 1CQIA 2VPXA 3UR0A 4CUJA 1U99A 4F5WA 1CQNA 2W6CX 1J0XO 3FTNA 5AE3A 3ZNJ1 4HQRA 4DV6J 2ON6A 5DLFA 3D4NA 4MCJA 5A7HA 3THWA 1L4UA 2JL9A 4TROA 5EMMA 2AIRA 3HXTA 3C8HA 3W2VA 2NZCA 3HJUA 3KT3A 1S7GA 1QBKC 1VBYA 3UQSA 2MKYA 2RQKA 1SO8A 3BF4A 4JJFA 4H6XA 1PTKA 4QDZA 2GKGA 2H3EB 3IV6A 2WNSA 4BN4A 3GFYA 1FTYA 3MEGB 3TI9A 3G8CA 4C0XA 2QG9B 3HEBA 2REBA 1G6OA 1AQNA 2M9MA 2I7CA 3NC1C 3RVOA 1CVRA 5D8DA 3N76A 2RH9B 3EEBA 2XD4A 3H18A 2ZB8A 1POXA 1TUIA 4PYJA 2GEBA 3CO9A 5F51A 1VJGA 3A3NA 1K0VA 5LA6A 5FPTA 4JV0A 1N34F 2ZUGA 3A1VA 3F3SA 1QGDA 2XDQB 3D4LA 2OAGA 3TNJA 3O4IA 2NU6A 4U9IS 4EY6A 3U3MA 3PDCA 5EIWA 3OX3A 3IUQA 5ER6A 2MHEA 5B3JA 3F46A 3B1YA 4JR1A 4IEFB 1RWNB 3ZGNA 4P52A 1BQNA 1T2EA 2QD2A 4EGSA 4TQRA 4BATA 2JIZD 5DMHA 3LGAA 1IHOA 1ZK2A 3EWSA 5TC4A 3PE3A 2A6OA 3ABIA 1KP6A 2LRHA 3AT1A 4LOLA 1Y5NB 4YPFA 1L4YA 3DBRA 1URPA 1XXHB 2JGRA 3B3JA 1D3AA 3WZLA 4F8EA 3IBFB 1BVHA 3QFWA 4AJ1A 5KIAA 2CL6X 3CN9A 2FW6A 2ECQA 3O2SB 2JG3A 1ESEA 1XNQF 1GU1A 1HDOA 1YDFA 3PGA1 4URVR 5LIPA 3WIVA 1P31A 4O4JF 2P2DA 4U8VA 2REOA 3BRWA 4O4IB 1XMQB 3RU0A 4YX9A 2ZIGA 1J09A 1IQ0A 4EG8A 3AR7A 1O2DA 1M6VB 3TL6A 4OQYA 4GLFA 4A8QA 2XYRA 4AYWA 4JKOA 1ZC4A 3MTEA 4TL8A 4AUKA 4QT4A 2GGSA 2HJGA 3U02A 3O4RA 1QRRA 4X64J 2UUBB 3DZGA 3FMFA 4NCGB 4CCAA 2ZM6B 2I6TA 5DX0A 4Z0TA 2X8LA 3BGRB 2FJPA 4HFNA 1W94A 1KOHA 3W2HA 1G98A 2H2IA 1H2XA 4PYAA 1DU4A 1YE5A 2XMZA 2RONA 2M1XA 4KQ9A 5BP7A 3V80A 2OSQA 2O7QA 2AOXA 1MA3A 3JQ8B 3ZNUA 1OHHD 2VJCA 1ES9A 3L1IA 5DM0A 4CKWA 2YDYA 2W4MA 1LTHR 1H4SA 1KOGA 4CEJA 3M8QB 1ZGBA 2QN6A 4JV2A 2ADBA 5I42B 2PT0A 3MM5A 2J8AA 3AU9A 2DPJA 4F3KA 1U8XX 4DR1B 2QLJB 3MA0A 4OFWA 3QWPA 4RKWA 4B3CA 3DGEC 2ASJA 1R8HA 3M6FA 2ACKA 4PY2A 1I7QB 2IELA 4FNHA 2AJLI 2O3RA 3UENA 3TFOA 1SH3A 2FN8A 2CK3A 4PSAA 4QIGA 2D62A 1PD0A 1RBMA 3A4LA 1SVKA 1TKTA 3SCLE 1JTEA 4JLVA 3KQVA 1WZ2A 1WCIB 2PX2A 4BMSA 4RJVA 7MDHA 1RT1B 3L6EA 2ZOGA 3DA8A 2WLTA 1U6FA 2WW4A 2QLBA 1IFXA 1R18A 4F0MA 3ME5A 1E6WA 3K1YA 2RK6A 5ALNA 4BBYA 1PGPA 1VC5A 1MEJA 1J21A 3BR8A 3LC0A 3WB9A 3WYCA 3VGUA 4OBWA 4I1OA 4PZUA 3EMBA 2E1RA 4OZNA 1TKDA 1J2UA 4M94A 4B74A 1IRXA 1ZYQA 3B82A 4DR5F 1CIPA 3KKOA 3RABA 2FLKA 2DUUA 1IB0A 4CM9A 1RRGA 4YR0A 2R8RA 2XUDA 2DFDA 3ROFA 3TNFA 4HNAB 3LS2A 1E7SA 4F0JA 1XXHE 5B37A 1FY2A 1UPXA 4TPKA 3G8BA 2AYXA 5BN3B 2ERXA 1FX2A 5CBKA 2SECE 4HXFB 3R5JB 2ZJ5A 1JHMA 4ISBA 3ZZPA 1IY2A 4BCBA 2ORYA 3SCJE 2VRCD 1AFJA 1HDXA 3VU9B 3KK0A 3FRJA 1P2DA 1VYVA 1AG9A 3TIVA 1M67A 1N8RT 5AOAA 5IBRA 4LWOA 4S35A 1AURA 1NMZA 1JEDA 2ZUUA 5IUNC 4QLBA 3ZWMA 5J4VA 1QTNB 1YJ7A 4TLRA 1S2MA 3T4UA 4KPYA 1O6CA 4NFYA 4PZAA 3FD8A 4Q7QA 2A5YB 1L6RA 2P4UA 2G5CA 1UEKA 1SVMA 3KE8A 2VUUA 5E7IA 1RSZA 1KJ8A 3ON5A 5FH9A 2BEUA 3OLYA 1OXUA 3ZZNA 4DLRA 3Q88A 3L4BA 4MMYB 4IWYA 1PV1A 3NOXA 4XFDA 2VCHA 2CXNA 2NTEA 1IQZA 2MU1A 4E31A 1Z15A 4AMUA 4O0IA 2EFEB 2G72A 3OCZA 4KU4A 2C2BA 3VALA 2PZFA 1MT0A 2QPOA 4D8VA 1E9AA 4TNOA 1UP4A 2OV8A 5A9RA 2NU7B 2ZJ6A 3KVNA 1A82A 4KSBA 5IMBA 5KHOC 5BSVA 3BH6B 4HFJA 1S77D 4Y2XA 4B45A 4P3OA 3B51X 1QTIA 3VI3B 3PJXA 2JX2A 2P7IA 2JEZA 3HT3A 1WQ1R 3O8CA 5JD6A 3HY3A 4H4CA 2JIRA 1VL8A 3QM1A 5CYGA 4UZBA 1WB6A 2H4ZA 2OMEA 4YRDA 1KPHA 1QS0A 1IKXB 3LUYA 1C7QA 1N92A 2HDOA 4O44A 2W0MA 1ELOA 3Q8XB 2XHCA 1TU0A 3KOXA 2XYVA 4B8ZA 3UDEA 2ZIAA 1X15A 1OYDA 4OSEA 1PG0A 4NDZA 1U7UA 2H7XA 3LI2A 4V0KA 4HDKB 4RGBA 5ABPA 5JNVA 4PX3A 4N4AA 4UMFA 4CIYA 3DI6B 1J99A 2BUNA 1T8TA 2RSQA 1PT6A 3RUFA 4B6PA 2Z4RA 4K5QA 2JC3A 1P27B 1CVJA 5J2MA 1HY3A 4FJ1A 1AX9A 1H65A 4E12A 4DCPA 2ZYUX 4DN0A 2ATLA 4DLAA 4QELA 1HYGA 3H8JA 2PX6A 4J49A 4NMWA 1RABB 4XR9A 4WK0B 2YH2A 2W8BB 2LDBA 3Q2TC 3WL7A 2P9FA 3JS5A 3L7AA 3TUJC 1FYDA 1Y3DE 5IN4A 3GV0A 3LYHA 2D9OA 4DCCA 1XHFA 2OP1A 4I1PA 1X4CA 2SBTA 2VPTA 1UF9A 1NP7A 2WP0A 2RHCA 1NN0A 1CY1A 3F5MA 5DLEA 5TGDA 4N7RA 4RTNA 4L7QA 1RT7A 4IGEA 1IKVA 1V5EA 1UQRA 2PYZA 2Q3LA 4KRFA 2GO9A 3FRIA 1DQZA 2W7OA 2A0UA 2I2CA