3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
5AWFC 1XD2B 1G8HA 2EFCB 4C0SA 2JAQA 1II8B 2D06A 5G41A 1TEXA 3TLXA 2RGNC 5B30A 4Q1CA 1QZXA 1VDZA 2WBLC 1KDOA 2X19A 2P67A 3LX8A 4UXHA 1W2GA 5FTJA 5GJWC 5E7JA 5JJLA 1XDBA 2PX0A 2ZE8A 3K0EA 4LJ6A 3EZ6A 1UKZA 1FL9A 1JNYA 2ZSDA 2XB2A 4PPGA 4G01B 3GJ7A 4HEJA 3WYFA 4DCUA 2JJ1D 1VPLA 3P20A 1Z6XA 1GAJA 2CHQA 2WWGA 1SKQA 1GSIA 3RYTC 3M4YA 2ZRAA 4DC9A 1M7HA 4DLXA 3Q7PA 2N42A 1CR4A 1SKYE 1WRBA 1KHTA 5JRJA 3Q9LA 2HLDD 3QKTA 1DELA 1R8SA 4TTPA 3U3MA 4D26A 2HXSA 1N3BA 3QPUA 2XAUA 2BMFA 2QP3A 4G5SA 1GL7A 2J7KA 2A5JA 3UMFA 5EJEA 4Q01A 2DFKB 4BFUA 3MRSA 4FIDA 1VG9B 3JZMA 4MYHA 4LV5B 3DVLA 1ZM4A 3GJ5A 4MDFA 2ZSEA 2EYQA 4WAUA 4BZQA 2CCJA 2J0UA 2GF9A 2Q6TA 3FHCB 2C8VA 3GEIA 1UKVY 3PEUA 3QF7A 1E2NA 2QENA 3QKSB 1DG1G 4IJMA 1G3UA 2WAXA 1QVAA 3LBIA 2R65A 5FUYA 4D81A 2FU5C 2XEXA 1W2HA 3OESA 5FI0B 3U44B 2BKUA 2WWWA 3BERA 3W5IA 1Z63A 4M53A 5FTKA 2XXAA 1W44A 1ZCBA 4TSFD 4JVLA 4G5GA 5J4LA 4NONA 4Q4JB 4M22A 2O8FB 2CMKA 3QNUA 1L8QA 3B9QA 3MAAC 4W5WA 2PL3A 2ZJ2A 1XTIA 3BBPA 2YJTD 1WBBA 4MQBA 5JHGB 4JSYA 3T12A 5GVRA 1VIAA 4AYXA 4V0MA 2VYFA 3GJ8A 3H1TA 2C99A 1Z07A 1US8A 4DIEA 1SXJB 3FB4A 2CXXA 4QJ3A 1UKEA 2GA8A 5KHOC 4W7SA 4DZZA 3TR0A 3K9NA 4OQLA 4DIDA 2QI9C 4F93B 1Z6TA 3AEZA 3DO6A 3GLFA 5JS8A 1XCPA 3QBTA 4LHXA 1T8UA 4A6XA 4P4SB 2WPDD 4ZDKA 2EQBA 4L4UA 2YVUA 5H68A 4D25A 2QPAA 3QQ5A 2ZJOA 3M0EA 1AQUA 4UXJA 4TTQA 4K8OA 1F60A 2SHKA 5KDDA 4G5QA 2YWEA 1SVLA 4Q47A 2L0XA 4TMTA 4LC1A 1CJTC 2J0VA 4UNNA 2XZLA 4EKDA 2GETA 4OI2A 3DKPA 1QG2A 2O8EB 2ZRJA 1FX0B 2D4HA 1UAAA 4C0AC 4ZDJA 4PO8A 3BK7A 2GJKA 1N6RA 2VP9A 3BIFA 4GZMA 3X1DA 4Z1MD 3I5YA 3EIQA 4AY2A 4DLUA 3C5CA 3OE7A 3EIHA 5KYKA 5E4FA 3THXA 4Y0VA 3BH0A 2J1LA 3IIKA 1NMXA 3ADBA 3AP2A 1ZD8A 4Q4HA 2ZRDA 2PMKA 1GG2A 1Z0FA 4JLAA 3FFBA 1NIPA 3WNDA 4FCVA 2AK2A 1FTNA 4DLWA 2IYQA 2GXSA 3SR0A 3AVXA 1II9A 2ZEJA 2VHCA 1IXZA 4OHXA 4LPKA 3W8RA 2QBYB 2OO7A 1EG7A 5JS7A 4Q1EA 5FR2A 3WP0A 5TB5A 4A8JB 2CBZA 3VU9B 4M9ZA 1E9RA 2IC5A 1G7SA 4NKRA 4IFEA 4P4TA 3B1XA 2QQEA 2JLUA 2IYLD 1DPFA 1CRQA 2NO6A 2AD5A 3AGQA 1E0SA 1RFLA 1W0KD 4DSOA 1J7KA 3RS3A 1W0JD 1P5ZB 4C7OA 1COWD 1N5IA 2YV5A 3GPLA 1MRSA 3K0CA 1MO4A 4B44A 4FW9A 4CEJA 4DVGA 3SDZA 1JJ7A 1G5TA 2ZUCA 4QJ4A 3U2QA 2R6GA 3NWJA 4NP6A 3CKLA 3DM5A 3VNVA 5B57C 3KKNA 4BZXA 3GJ3A 2WKPA 2XJ4A 1ESMA 2XNSA 3WRYC 2D2EA 1SHKA 2B7CA 2GXUA 4FMDB 4ESHA 4ZKEA 4PSKA 4LJ9A 4TL7A 4HAZA 2WSMA 1G6OA 4JLDA 5FPKA 1NLZA 3EW9A 3I5XA 4X8HA 3HDTA 4QHSA 3ZYCA 2CLCX 2XOKA 1CP2A 3W5JA 4Q4AB 3V00A 1YR7A 3WNBA 1W36D 2CJWA 2JDIA 4IVQA 4V0NA 4DCNA 1WCV1 3S1AA 1XZPA 2FV8A 2IA5A 5P21A 4EDHA 1R0ZA 1KI2A 1Z0JA 2Q9BA 3BFVA 3IDQA 1YRBA 3QXXA 4JLNA 4MGIR 4KBFA 5FBWB 3OEHA 4MUBA 3CWQA 2I1VB 1JQJC 1GL9B 1D8TA 4N1AA 2NZJA 3OAAD 4HB0A 3GLGA 1TMKA 2QAJA 4LZZA 1KY2A 2ZUBA 3NBFA 4EIWA 2W2TA 4DXAA 4MGZR 4KLNA 2F3RA 5C18A 2J46A 2FEMA 1S1MA 5BN4A 4KSBA 4WBSA 4P32A 5TY0A 1GUAA 4EFMA 3AVVA 1Q1QA 1XEFA 5DLQC 1U9IC 1Z0AA 2QAGB 1U8ZA 2QT0A 3HU2A 5G40A 2EFGA 5UKDA 4ZDWA 4RY2A 3A36A 4XVRA 4NYMR 2C04A 1SXJC 4ZCLA 1ZAKA 4YC7A 5G53C 3P26A 2HYDA 1OXUA 4QG7A 3SFVA 3EXAA 3ZIAA 3SJBA 3U4QB 2X2EA 1F2UA 1XMVA 3KJEA 4OJQA 2IS2A 1P9RA 1W36B 3GLHA 3K9GA 1U90A 1AS2A 4A92A 2HF8A 2JGNA 2GK7A 621PA 1VHLA 2J7PA 4NDZA 2R6DA 2GRJA 4QC2A 1VCOA 4LX0A 4OL0A 4WOPA 1PLJA 5JMTA 3K0FA 2ZIAA 1YZTA 2CLDX 4PC1A 2P65A 1I4TD 2V8OA 2VLIA 1QHXA 4U00A 1TQDA 3ADKA 2GBLA 4TYPA 4ZIRB 4OK6A 4FMDF 4YMVA 1GL6A 1KSJA 4FD2A 2JLWA 1QHYA 5BXQC 3U6BA 4C0JA 1KO4A 5IK2D 3B1ZA 1KNQA 5SZJA 4Q18A 5CIQA 4CYMA 2NQ2C 4ZCIA 3B82A 5TXGA 3SE0A 5CIWA 5KNDA 3OIYA 5FTLA 1YJ5A 2J3EA 2BMEA 3K9LA 1KDTA 2UKDA 1KKMA 2F1JA 2RGAA 1E4YA 2EFEB 1B23P 5KU1A 2ONJA 1B0UA 1X8KA 1NVVQ 4I4LA 5SZKB 1Y3AA 3Q72A 1TL7C 1Q44A 4NHOA 1EGAA 4HUTA 1ZU5A 2Q3HA 3PQCA 4A8JC 1E0KA 2FSFA 3TSZA 1P2SA 4O0MA 4PHTA 1W1WA 1IXSB 5EZ5A 2HJVA 3IGFA 2O52A 4Q7MB 4LJ5A 3GLIE 2ZSFA 5E7IA 2JLSA 5CB6A 4BLQA 2OFOA 3I8XA 4RD3A 5L3VA 2BEJA 4EPWA 3AVYA 3R9IA 3G82C 4BFXA 1G7RA 1NN3A 1LTQA 4Q9HA 1OXXK 2O0HA 1HE8B 4D0NA 3Q85A 3AVOA 5CJ2A 3K70D 3J81k 1G3RA 1UBEA 4JYBA 3PJRA 1Z2AA 2DWOA 3Q5EA 4A0RA 3F0TA 1GTVA 4Q1AA 1LS1A 4P4UA 5LBIA 3C16C 1RW4A 4MRPA 5FOUA 2OILA 3RLFA 3T35A 4IEIA 5DE3A 2QPOA 1CJKC 3C14C 2GESA 3GJ6A 2FFBA 5HPYB 4XTCS 2QMOA 5DGXA 5JJKA 4KODA 4ZDIA 2I3BA 1HYQA 2IYWA 1R4AA 4KFSA 4TTRA 3DZ8A 1YZNA 5JEDA 3TVDA 3FMPB 4DJTA 4KJZA 1Z06A 4NYIR 3GCGA 4UNPA 2ZSAA 4LGMA 4JKIA 2EFHB 3TAHA 2R44A 1NN5A 2JJ1A 4LOAA 1KNXA 4AG6A 2J0UB 3VR5A 1KMQA 1Z0DA 2YC2C 2ZI6A 2WIBA 3B5JA 3ASYA 3F3YA 4JZKA 4F91B 1SVIA 2GEVA 4DDVA 5EE5B 3CPEA 1EX7A 4IOMA 3MG9A 2QRZA 4OQXA 4U02A 4F38A 3UXMA 3FPAA 1E3MA 3MWJA 3IHWA 4RZ2A 4GBMA 3BWDD 4NMMA 1JI0A 4B3FX 1R8QA 1KSFX 4XSGA 3CNLA 3X1WA 4M1OA 3IPXA 4IOJA 1U0LA 4TLEA 1TF5A 4TZ6A 2QAGC 2ORIA 1VKJA 6Q21A 5HR5A 1N5KA 2MSDB 4GOXA 3G0HA 3REGA 2FH5B 2H5EA 3EC2A 5EE9A 3QOFA 5BQ5A 4YQFA 1RVDA 2FGJA 3TUJC 2X8AA 1G41A 4XOIA 3LFUA 2WZQA 3NDPA 3ONWA 4Z51A 1US8B 3CH5A 1UF9A 4C30A 2FZLA 4CT4B 4L5BA 1NJGA 2WWIA 5EP1A 1ZJ6A 1DBSA 2OG2A 4IOLA 4L9SA 2PCLA 1L4YA 1W36C 3GLFB 1TQ4A 1IN8A 2ZJ5A 3HPRA 1G5RA 3RWOA 1ZD9A 3X1ZA 3M6AA 3KXIA 4QFMA 3VMFA 1HT2E 3NDBB 1A7JA 2Z4SA 5BN3A 4NYJR 1KSGA 2GCNA 4ZI3A 1SVMA 1HY3A 1OKKD 2N46A 2BDTA 2VBCA 1CEEA 5FOSA 3FE2A 1NKSA 4D2IA 1YZUA 3RAPR 5G3ZA 1ZNZA 1T0HB 3GP8A 5FBQB 4ZV4A 1N2CE 2AKAB 4A2QA 3MSXA 4ILEA 1OH8A 4Q1DA 2O8DA 4B71A 4B73A 5C46F 5AUPB 2GKSA 1X8LA 3CRW1 2ZU0C 1KOFA 4WZAE 1M1YE 4XTRA 3ZH9B 2BHRA 3SFZA 2ERYA 3THXB 5HCNA 3I92A 3D6TB 1AQYA 2QORA 3OIWA 2WPDA 1CS4C 1XB2A 2KJQA 1Z6AA 5KNCA 4Q4HB 5AJZA 1FFHA 3NC0C 1S3SA 4PZLA 4KVAA 3PXGA 1I2MA 2HT6A 4FWTA 4PHHA 4KXFB 2B7BA 1HTWA 2XOKD 3WBJA 3RDPA 3RC8A 2ZQ5A 1E2MA 2XJ9A 1TQ2A 4LBVA 4LI0A 2G1KA 1XCMA 2VEDA 2IXGA 5EE0A 3ZD6A 2NPFA 4LC0A 3WBKA 1MV5A 1XMJA 3OEHD 1OSNA 2C9YA 1IOZA 1QHGA 2J41A 4Q9KA 4PHGA 4OI0A 4Z1MA 4BEBA 3LRPA 5DN6A 3W6OA 3CF6R 4I81A 3ETLA 1OE0A 1NVWQ 5JBQA 3L0IB 4C7OB 1OH6A 4JLOA 2UZIR 3QIAA 4CEJB 3DM9B 3FVQA 4LJ4A 1UADA 4FN5A 3B1WA 2B8TA 4IDNA 4DEYA 3U60B 1G19A 1IY2A 4B3DA 1N6KA 3RHFA 2XNDD 2FOLA 4ZO4A 3FMIA 1XRJA 3PIRA 2FSGA 1G20E 4UKDA 4U5XA 1ZIOA 3BJIC 1I4LD 1F48A 4LBWA 4M0LA 4GZLA 3MMPA 2R6CA 4LBZA 4MUAA 4L16A 4WA7A 5KPJA 1LS6A 4BFYA 3OIVA 4RZXA 1L2TA 2IL1A 3DMDA 1W0KA 2OCAA 4M1YA 3ZIAD 2IS1A 1IY1A 2ZVPX 3GQBA 3LWNA 1GKUB 2IEZA 4G5RA 4B6FA 3A1VA 1U0HC 2CJWB 1T8TA 4HAWA 4FWIB 3S1AB 4F4IA 1AA9A 3SBDA 4OKSA 2A5DA 4GT1A 3L82B 3W3ZB 1CXZA 1BS1A 3FKSD 2PZGA 2NG1A 4EPRA 2DBYA 2C03A 4BQSA 1P9NA 1XXHE 4OI1A 3EASA 3GLGB 1E2IA 3AH8A 3WMFA 5F3WB 1JEDA 3THOA 3IQWA 2J59A 2OAP1 3IIMA 3NVAA 1MO3A 4PZZA 2OFXA 2MSCB 5G3YA 1XP8A 3GLIA 4TT3D 4DKXA 4PC2A 4AKGA 3TMKA 1S2MA 1LF0A 2QM8A 2W6JD 2YHSA 1WQ1R 1XTSA 4HI0E 3WYGA 4HDQB 4V0LA 3FWYA 4P0TA 4P33A 3T1VA 4I1VA 4EFNA 1BH2A 4JBXA 2FNAA 1XMIA 4JYCA 4BLOA 1AK2A 4KHZA 4IDPA 5DYIA 3EX7C 1JECA 5TV2A 1RPZA 1XD8A 4V0KA 1E9FA 3BORA 3NHAA 1D2MA 2I4IA 4IVRA 1SKYB 4ABYA 1F2UB 3TW4A 1WB9A 4BRWA 4QHYA 3KUDA 2JLXA 4ARZB 2G6BA 1JALA 4W5JA 3I32A 3WNCA 1HE1C 2VP6A 4P3YA 1NN0A 2H7VA 2X77A 2FGKA 1L7VC 5K8TA 1E2QA 3ZZ0A 2GJSA 1N6LA 5KOYA 1T9HA 2QY9A 3K0FB 3O47A 4TMKA 4D6PA 3L8YA 4KI0A 3U7EB 1U8AA 2J5XA 3M1IA 4URZR 3LNCA 2RGXA 3P32A 2RHMA 2YWFA 1WMSA 3BGWA 1TPZA 3KKOA 2IBMA 2R62A 5FPYA 4Q9LA 1ZW6A 1DARA 2QE7D 2RH5A 5TMPA 1GRRA 2VRWA 2CDNA 1AZTA 4EQ6B 2XX3A 4CEIA 3KL4A 3TNFA 5J5CA 1X1RA 1HA3A 4TYWA 2YNMA 4NCJA 4OK5A 5JCPA 1R5NA 1YR6A 4PXAA 5IDVA 1VCMA 1FMLA 2IUSA 2ZANA 4XWKA 2V3CC 4BZPA 1A82A 4DSNA 3TH5A 2Q3MA 5L8VA 1KMHA 1E2GA 2O8CB 4I99A 1F3OA 1JBKA 3AVTA 1IY0A 2ORWA 1E9SA 2RKOA 2BC9A 2V4ZA 1RE0A 4K46A 1PZNA 3N5CA 2WOOA 2ZRCA 5IK2A 3VX3A 1NNEA 2WWYA 4PPFA 4Q48A 1XJCA 1K6MA 2DR3A 2R2AA 5IRCD 4R2IA 4KSCA 4GP7A 2JJ2D 3K0CC 4E07A 2PZFA 3GLHE 4HB2A 5KSOA 4W9MC 2F7SA 2OZEA 3W6NA 1G64A 4J0QA 4UNSA 2ZREA 2DFLA 2R8RA 2REBA 1KJZA 2Q3FA 4TYNA 1LY1A 1RYFA 1NI3A 1EX6A 2BMDA 3CZQA 4Q9IA 3CPHA 3MUFA 2QSZA 1CR1A 2AWNA 1ZM7A 3H0KA 3MWYW 3AF0A 5AJVB 4B3XA 4TYYA 5GJVC 1EK0A 4PC7A 4A6PA 1EFCA 2IF0A 1SVKA 1N25A 4RCZA 3PG5A 1YRAA 3A58B 3AKDA 4KCGA 3L43A 2GEUA 2H1LA 1C1YA 1XNJA 2ANCA 4G1UC 4M1SA 5FTNA 4G5OA 4AK9A 4XH9B 1YR9A 1VG1A 1IAQA 3QG1A 3TAUA 2J87A 4QM6A 4TLAA 4YDHB 2WSSD 2QZ4A 1H8ED 4I1SA 4UNRA 1RRGA 5CB8A 2HCJB 1AN0A 3C4JA 3KTAA 521PA 4JS0A 1DAFA 3D31A 1HH4A 4D0GA 3GFOA 1P2TA 2BMJA 2NIPA 2W0MA 4FCWA 3ZJYA 2IEYA 2H92A 3QKUA 1ZCAA 5HTKA 3DZDA 2ZI9A 1Z29A 1ZC4A 4LK2A 4RZUA 4H1UA 3QE0A 3BH7A 3BB4A 4IOKA 1IXRC 3U5ZB 4F7WA 4RKFA 4LUCA 3KJHA 4D80A 1OH5A 1OYYA 1XFAA 2IYUA 3IPYA 3Q5DA 5FOVA 5LPNA 2VP4A 5J4YA 1GNPA 4Q02A 1W7AA 1T91A 1NBMD 1UJ2A 2CE2X 4GSYA 3EWAA 2IYRA 4CEHA 2GAOA 2RB4A 4L15A 4WZ6A 4BFWA 3PR1A 2YC4C 3B2EA 1Q20A 1ZNWA 1FOEB 4XJXA 4QM7A 2XTMA 2HEIA 5FL7D 2EWWA 1OLOA 4AI6A 2KBEA 4HLUA 3GMTA 3O8RA 4LV8B 1E79D 2WJGA 3CR7A 4KFRA 2D7DA 1G3MA 1NVUQ 1RRFA 2W0SA 4TN1A 1X1SA 3WMGA 4M1TA 3IEVA 3KKPA 1T6NA 3AUXA 4ESVA 1P62B 1II0A 1TX4B 4Q5IA 1Z6YA 1GWNA 1S8FA 3V9PA 2XZOA 1XPOA 4DB2A 2ZRKA 4M2LA 3I61A 2ZR7A 1W4CA 5EUQB 2WWHA 5DN6D 3ADDA 4NCHA 2C9CA 1E1RD 2ATXA 4HAYA 2KBFA 1GIAA 3HU1A 1I4DD 3K53A 4WVFA 4F4CA 3OIUA 4Q21A 4B32A 2GBLC 4OYHA 4BLTA 2FPMA 2FF7A 5HE8A 2O8DB 3AV0B 4US1R 1GITA 1KK0A 3AVQA 2GDJA 1XTJA 3IQXA 5EXXA 1YQTA 3DKVA 5K8LA 1XXHA 4ON9A 3ZS8A 3JVVA 2NO9A 4PC3A 5DYGA 4HSEA 4TQAA 3KQNA 2QQ0A 1JAHA 2GAAA 1FUUA 2YOGA 1JR3D 4U7DA 1EFTA 1FMJA 4IDHA 1OH7A 4H1VA 2PJRA 4YLGA 3KQHA 4ASUD 1OKKA 4C2UA 4BECA 3EG5A 2V55B 3EZ2A 4GOJA 4NYIQ 4UJ3A 4ZCMA 4AWXA 3MGCA 3PEVA 4DDUA 3BFKA 4XSHA 1DO2A 2C78A 1FQKA 3UWOA 2OBLA 1LV7A 1GDDA 2ZRFA 3PEWA 2JATA 2DCUA 2AD1A 2Q21A 3HU3A 4QGHA 1G1MA 3EPLA 1G18A 3E1SA 1GOTA 1AGPA 1J8YF 2QMHA 3OFND 5TVKA 3T1OA 4NL4H 1NVXQ 4JKYA 5FBLB 1HQCA 3ICEA 3H86A 2F9LA 1E2HA 5DO9A 3TUZC 3CNOA 3K1JA 2ZYUX 3LV8A 5EZ6B 3DOFA 4DLZA 1W49A 4GMDA 1E0JA 3LXRA 1Z28A 2DHRA 4C3ZA 1OFTA 1J8MF 5DH9A 1AZSC 1NRJB 1GRNA 2R6AA 4Q19A 1TTTA 2DY1A 3LY5A 2BWJA 2B6HA 2F1IA 1OXVA 1JXOA 1XJ0A 2D3WA 1FQJA 2Z0MA 4TL6A 2PCJA 1R5OA 3TSOA 1F6BA 1T3SA 1BMFA 5KDOA 4QGAA 3FMOB 4FMBB 1R10A 4IRUB 3MJHA 1ZD1A 1QHNA 3LLMA 4DLRA 1DADA 1NBME 2G1JA 1QHSA 1UDWA 2DWQA 2OE2A 3A4LA 2CL0X 1HEIA 1G9XA 1N6PA 1KZ7B 3HPQA 4URUR 3TQFA 3X1XA 1KO5A 2NO0A 4NH0A 4PO9A 4Q1FA 4I1OA 5JECA 5JHHB 4NYJQ 4HB4A 1XEWX 1FNMA 1CLUA 1P9WA 2OM2A 1U98A 2XNDA 3UWKA 2MMGA 1XMSA 1E2PA 2WWXA 4QXAA 5FUWA 4YMTA 3QKRA 1KZGB 4JVSB 4HZUA 4ZPXA 2ZR9A 3CX7A 1T5LA 3E5HA 3GLIB 2WWFA 4AKEA 4WXRA 3AGPA 2XITA 4RJLA 4YMUA 1G6HA 1KAGA 1BIFA 1TNDA 3VFDA 1S9HA 4B3BA 3TGPA 2IYVA 3ZVRA 3AKEA 2GK6A 2EYUA 3SJCA 1VYVA 1KJWA 2B92A 2G3YA 2BOVA 1N6OA 2E9SA 2GHIA 4TLCA 4NCIA 3ZZUA 3FKSA 4DHEA 1KO7A 1LW7A 2RCNA 1IN6A 4JLVA 3B13B 1A2BA 5EUMA 4TMXA 2Q9AA 5H70A 3LX5A 2JLQA 4C9BA 1PUJA 5AUNB 1ZUHA 3L0PA 2IT1A 4R9UC 5GVSA 4B6EA 2CCGA 1JR3E 1R0YA 4TT3A 1ZM3A 1JR6A 2W6JA 1S0UA 3U7FB 4LYFA 3KB1A 4LBYA 1NN1A 1WE2A 1R7RA 1NG9A 3CIOA 4RKEA 3KXKA 1WA5A 1QHHB 3IO3A 3H2YA 4EFLA 3W90A 1W4RA 2HCBA 3UG6A 4IKEA 1OF1A 4CW7A 1KJYA 1SHZA 3K0SA 2MMCA 1HT1E 2IYYA 2DPXA 4MKIA 5AJXA 5LB4A 4JL8A 5BYJA 2CK3A 5IT5A 3QENA 4CEIB 3K09A 3MD0A 1AIPA 3KQUA 2VSOA 4DEXA 3A4NA 2A7QA 3HJNA 1FUKA 4G0NA 2P3SA 4QHTA 4D4JA 2NO1A 4O2RA 1DVRA 4XWOA 1G8FA 1BOFA 1K5DA 1KTVA 1P7CA 4KYIB 2ZXUA 5F98A 3QVUA 5EXSA 1Z6GA 2W2XA 3QF4A 5LDDC 5JRZA 4B48A 1NL3A 3UG7A 4RFSA 1KMHB 1QBKC 3C5HA 5J4HA 5DSZA 2MSEB 3N70A 3GFPA 2R9VA 1VG0B 1E0AA 4AC9A 2RAPA 1PUIA 2GJ8A 1XEXA 1M2OB 2YWHA 2QE7A 1T3HA 3FHOA 3RS4A 2J45A 1S9DA 3CX8A 3BRWD 2ZSBA 2AFHE 1PV4A 3NC1C 2EW1A 1GVNB 3A8TA 3LBHA 3B60A 4O25A 3CF0A 5M04A 1HURA 1TAGA 2E87A 3IEUA 2HUPA 2ASEA 2AXPA 3AVPA 4KITB 4M1KA 3ZQ6A 3C15C 2VP0A 3FYHA 4LJYA 4PAMA 3KQLA 3THYA 3QEOA 4BLPA 4S2EA 5KPDA 5JZVA 3B1YA 4C0KA 1IN7A 3EC1A 2XTNA 1G8GA 1H65A 2VHUA 3MJRA 2UZ3A 4KVGA 2RGEA 2WKRA 5L3QA 4WXPA 2F1HA 3NXSA 4JBYA 5FFMA 1NSTA 3CO5A 1E2LA 4GRAA 1VMAA 1AKYA 2XSZA 3VKGA 3HYTA 1G7CA 4D4KA 2JA1A 2JJ2A 4PQRA 2ODNA 2C9OA 3K70B 2XXAB 1N0UA 2IK8A 3ZVLA 3U44A 3RWMB 3JZAA 1G16A 3LH5A 3GD7A 2QM7A 3VR1A 5KSYA 4HYYA 4Q4JA 3KTAB 4PANA 1LB1B 3PV0A 4N0EA 5K8IA 2OCBA 2IXEA 4B3CA 1MOZA 2ZRMA 5D3MA 1TQ6A 3SBEA 3CBQA 3I8SA 4DB4A 1UEIA 2H17A 3ZLJA 1JXMA 4Q03A 1KSHA 2YYZA 3A6PC 2H18A 3CZPA 4LYAA 1D5CA 2BVNA 5CDFE 5JSZA 4DDTA 1D9ZA 1P72A 4TQUS 3RSOA 5FBVB 3B9PA 3B85A 2GTPA 4NBSA 1C4OA 3EZ7A 3EZFA 4XD7A 4D4LA 2DFTA 1QDEA 3V4FA 4CEHB 1OXSC 1VTKA 3TK1A 2OSBA 4EPTA 5AJYA 1XEWY 2WSSA 1H8EA 3U6KA 1BO6A 5JCZA 3KZ1E 2NMVA 2VPPA 2P0EA 2G83A 2YWGA 4M21A 1M8PA 2F43A 4HLCA 2QU8A 4TYQA 1E1QD 2ZS7A 2QP4A 1UBCA 2O0JA 2BM1A 1E4VA 2LCFA 1BKDR 1CJUC 4YONB 3VTKA 5ELXA 1W5SA 5CITA 4PX9A 2AHOA 3FDIA 3KFXA 4D82A 3SI7A 3L0OA 4DDWA 1V5WA 1YZQA 1IHUA 2O8EA 1JB1A 3DL0A 3I72A 3QSYA 1YZGA 1Q22A 3LW8A 4KFUA 1NBMA 4R7ZA 4CRWB 2C95A 5EP3A 4M8NE 1W46A 2ZVQX 3MWKA 4DLTA 2C77A 1CBUA 1PLKA 3SYNA 3GJ0A 4A4DA 2V6JA 4OHWA 2C98A 5FL7A 1N6IA 2YZ2A 2ZJ8A 1CF4A 221PA 5JLJA 1GM5A 1Q1EA 2VO1A 1ZM2A 1E79A 1XXHB 2PLRA 1R2QA 3ND8A 2WICA 4QGFA 3P1JA 2F6RA 2QBYA 3K0AA 1NY5A 2IHBA 3NBYC 4II7A 4UQOA 1MO5A 3THWA 2GEDA 1BMFD 1XU4A 5C1BA 3SQWA 4DT1A 3H4MA 4IDOA 4PR0A 2ZRHA 1XTQA 3P4YA 1ZINA 1J90A 1E1RA 1E2EA 1TU3A 2H16A 1OHHD 3R20A 5DNYB 3X2SA 4DCSA 1EWRA 3BD9A 3LAWA 2ZYWX 2AKYA 4TMVA 1KI7A 1UDXA 4EPVA 1N6HA 4Q1BA 3TSWA 4HUQA 2C96A 1Q1BA 2QA5A 1U94A 2ZU6A 3W6PA 5EP2A 3A1UA 2BJVA 2PZEA 2J0SA 1Z22A 2QT1A 1E2DA 2FEOA 1F5NA 3RSLA 3ZS9A 2PEYA 2JEOA 3RNLA 1EFUA 1XTKA 4FCTA 1A5TA 1JR3A 4LYJA 3W3AA 1CR2A 2JIZD 1F2TA 2O0KA 2JCSA 4ASUA 4B33A 4KFTA 3WXMA 4Y0AA 4RZ3A 1R6BX 3B6EA 5KDLA 2FDCA 2IX3A 1KK3A 5FBRB 4PAQA 3RS7A 4DBLC 3TW8B 4JLJA 1HV8A 4A1FA 3EAQA 3CRRA 3QEJA 1S4QA 1RYHA 4GI7A 1R5BA 3OFNA 3IBGA 3LDAA 4BPBA 4HAUA 2IS6A 2XZPA 1MH1A 2V1UA 4A0GA 1NLYA 2YINC 2ZRPA 5F2EA 4QRHA 3R9WA 2WJJA 3SHWA 3U61B 3K70C 3CUEF 4Z54A 5DISB 3U7GA 5TARA 3QPWA 4F92B 3SQXA 2O8BA 5DI3A 2OESA 4EPYA 1NIJA 2YOHA 3NH9A 4I1UA 4JL6A 4XVQA 4A82A 2JLVA 5FR1A 1V43A 2GCOA 3AM1A 3O8BA 3CW2A 4LRWA 2N1BA 1VCNA 3A1SA 3PEYA 1A2KC 4IVPA 3QKRB 4UJ5A 2Q0HA 1JQLB 2OBMA 4HZUB 4LJ7A 3UMSA 2BCJQ 1IN5A 1CU1A 1UEJA 3A37A 2AL7A 5EXTA 1VYUA 5LD2B 1FTSA 3TR5A 2EU8A 1DS6A 4PPNA 3MWLA 1XPRA 1FPMA 2AN9A 2ZS8A 1YZKA 2CK3D 1SVOA 2IYXA 2R6FA 3HYRA 1E32A 1XF9A 3GLHB 2NPIA 1ONBA 4JSTA 1U8YA 4OQFA 4B43A 4EAQA 1NF3A 5L3SA 3G5UA 4WIAA 4IDQA 1DAMA 2A2ZA 2FPKA 4C0BA 4AYWA 4PSAA 1ODFA 2QRNA 2F9MA 3UKDA 4HLUC 2IYZA 1N5LA 2QL6A 2ZYVX 3D3QA 4LHWA 3FHTA 2D74A 3BB3A 4LHZA 2PMDA 2OV2A 1NMZA 4JVNA 1TU4A 3OHMA 4BASA 3SYKA 4MRNA 1CKEA 2CLSA 1Q3TA 2EWVA 2VF8A 2IWHA 1LVGA 1VG8A 2WVJA 5JWRA 3FOZA 2BBWA 3VNUA 2WTUA 2BJWA 2BM0A 2ZJYA 1G291 4OQMA 4OHZA 4BE7B 3GJ4A 1SGWA 1GILA 2GVDC 2GJ9A 4POAA 3T1TA 2BV3A 3BS4A 1Z3IX 2GXQA 2KI5A 2QP9X 3RVBA 4MGYR 1ETUA 2ZE7A 3KQKA 2WM9B 2BKEA 4PFSA 4OQNA 2BBTA 4ACAA 4B47A 4CDGA 1XPUA 4LJ8A 3KKMA 1QRAA 2AXNA 4C0QC 1TF2A 2WJHA 4DCTA 3KUCA 4DSTA 1DTSA 2GZHA 1IQPA 1PVOA 5CDFA 3PUWA 5JEEA 2W00A 4JVMA 3QF4B 3QBVA 4HZIA 2F3TA 2VHJA 5KSPA 3NIBA 2AK3A 4BLRA 4BWYA 2XSZD 4XIGS 5FUVA 1ZYUA 3T5DA 421PA 4RFSB 1ZC3A 1DOAA 1KDPA 4KYUA 5FUXA 1U0JA 4IW3B 4TLBA 4US0R 4CF7A 1E94E 1S96A 2QMUA 3RRZA 5BYKA 5C4GB 2ZTSA 2CCKA 4GFDA 2DB3A 1XEXB 2BEKA 3OEED 4HB3A 3IILA 3LA6A 2FX3A 2QTHA 3WRXC 4YMSA 1P6XA 2WV9A 3DHWC 4YDSA 4B35A 1OIXA 2LKCA 4NYMQ 5L3RA 4V02A 1A1VA 1TUEA 1IJFA 1E2JA 1E98A 4K81B 5FI1B 4TWZA 1DAKA 3VAAA 2IYSA 4HDCA 1X6VA 3NHBA 1SXJD 3THYB 2ORVA 2QNRA 2PT5A 2HF9A 3SHFA 4TL9A 1G8PA 1Z5ZA 3LW7A 4XD7D 1OB2A 2CHVA 2A9KA 2QGNA 1XD9A 3H84A 4Q4LA 2NGRA 1IJEA 2EFDB 2WMOB 3QPVA 3FTQA 3QI2A 5L3QB 2GF0A 3RABA 3UMRA 1GZSA 4KO8A 4RD6A 3UATA 4E5UA 5J4KA 3E70C 4Z8YA 3EZ9A 3DMNA 1MABA 4G3XA 2X1VA 3CF2A 4F4JA 2ZS9A 1G21E 2ZITA 1RC8A 2IW3A 3Q3JB 3UK6A 4EJSA 1AGRA 4NE2A 3AF2A 4WW0A 2CL6X 2JASA 1ZUIA 2PH1A 1UPTA 2F55A 4ZKDA 2W6ID 1GFIA 4PAOA 2QROA 3AP3A 2B21A 2J9RA 1JPNA 2AWOA 1KY3A 2WOJA 2ERXA 1G4UR 4IEEA 1KI9A 3FGNA 2VF7A 1ESNA 5D3MB 3VQTA 3L8ZA 4Q66C 4QNMA 1GNRA 4AD8A 4C4PA 4CVNA 1U2RA 2QG6A 3VKWA 4LWZA 5IF9A 3ZD7A 2IS4A 4MRSA 3ZDQA 5LD2C 2WMNB 1HUQA 2ZE5A 5JSZB 1TF7A 4TMWA 5HKKD 3TRFA 3NKVA 1D6JA 4V03A 4X8LA 4AYTA 2PT7A 1E2KA 1VECA 5HZHA 3TUIC 2FFAA 1ZNYA 2GZAA 5C4MA 2KSQA 4LHYA 1NG1A 3TJZA 5SZIA 2FMXA 1RRPA 1Z0KA 1D2EA 1SZPA 1OW3B 4B34A 1ZUNB 3SNHA 1ZVQA 3FMFA 3X1YA 2F43B 2V9PA 3I4LA 4B2LA 3DEFA 3TIFA 3MLEA 5DI9A 3B7GA 2OXCA 2V7QA 2V1XA 1M7GA 4Q7JB 1Y63A 4L9WA 3AKCA 3N2IA 3HR7A 2LWIA 3T06B 2V6IA 5E3HA 1UFQA 4OK3A 3IKJA 1FZQA 4MA4A 1CJVC 4B3GA 2DYKA 2WJVA 5GJBA 3ASZA 5A4JA 1DAGA 1TADA 1PLLA 2C2HA 1QG4A 1QVRA 3AVWA 2A3RA 2JJ8A 2QUZA 1H8HD 4X8MA 2E1RA 3GEEA 4NZYA 4OBEA 4HAXA 2ZETA 1UBFA 2ZAMA 5KNBA 3ADCA 1JAIA 1VHTA 5E7MA 3GJXC 2PEZA 5ANRB 2IF2A 2NTYC 2OLJA 4O2LA 4X8OA 5B64A 5KUTA 2HT1A 2RGNA 4URYR 1Q0UA 3TVTA 1E1QA 3K09C 5BWMA 2ODEA 2I1QA 1IN4A 3K0AB 4NPHA 1KDRA 2FFHA 3B8HA 3OF5A 3SZRA 3UANA 2IYTA 3THWB 1VYTA 3AB3A 2ZYTX 3LXXA 3ZZTA 4DT1B 1GNQA 2FZ4A 1SXJE 2AR7A 3T1QA 1CJMA 2P2LA 3V4RA 1UKYA 4US2R 4N0DA 3R7WA 4MITA 1KI6A 2O5VA 5GADl 1MO6A 3B1VA 2A5GA 5CLLA 1LNZA 4Q9JA 1NMYA 1YR8A 1ZRHA 2QSYA 2CVFA 1DAEA 4HUQB 4CZ2A 1G4AE 1CRPA 2NZ8A 3CM0A 3AKYA 3KJGA 3TKLA 2GCPA 2X2FA 3ECCA 1M7BA 1Q1ZA 2QTVB 2H57A 2KWIA 4YXWD 4B76A 2FPLA 4JJKA 2W83A 3T34A 4DLVA 5KSZA 3SYLA 2VIIA 2OCYC 3VX4A 2BBOA 1XJQA 1OV4A 3VHXA 1CTQA 1F2TB 3U3KA 2GILA 5H1YA 5FOWA 4A2PA 2RGBA 2WAYA 4PPQA 5K8UA 3T61A 1X8JA 5FOXA 4ZI2A 5BW8A 1OHHA 4BUJA 1WXQA 1ZU4A 2JLYA 2FN4A 3KXLA 4H9GA 4FMCB 4XVUA 1OXTA 3CRQA 5JI3E 2RGGA 2DFNA 2FSHA 4MRRA 4A9AA 2VP5A 2ZJBA 4IFBA 4KU4A 2GWHA 3SS8A 2WIAA 3LD9A 2CNWD 5HCIA 1ZP6A 3BFXA 4O3MA 2Z5FA 4GDFA 4RD2A 4LPSA 4R98A 1G3IA 1RRCA 1JPJA 4B75A 5JJIA 1VCIA 2CL7X 3I1FA 2OBNA 5FPSA 4MGKR 2OAQ1 3W9YA 2IWRA 2JIZA 4MDEA 2ZJZA 1SVWA 1ZIPA 2O8BB 5DI3B 1W47A 2Q9CA 3O8CA 5DIFA 2GJAA 1N5JA 3SJAA 2GCOB 5JI2E 3C41J 4MYUA 1GKYA 4MKFA 2ZRIA 4JL5A 4B2IA 1FP6A 1XWIA 5B58C 4NU0A 2ODBA 4GP6A 2ZM5A 4TQ9A 3P27A 2H8KA 3VKHA 1N0VC 2AFIE 1MR3F 3UIEA 3WY9A 4S35A 3W8NA 2TMKA 3LQRA 3HP1A 2VH5R 4DLYA 2ZUDA 2ZAOA 3LVRE 1X3SA 1DEKA 3KKQA 3QXHA 4JLKA 4DRZA 1YHNA 2WJIA 2ODWA 3D7MA 3NG1A 5J40A 1QHIA 1E6CA 5L3SB 3K9HA 4W5HA 2WHXA 2VQSA 4A15A 5A5GA 1NKTA 4DUGA 4ARZA 4OI4A 2W58A 3QXCA 1NJFA 4QBHA 1EWQA 5A0FA 5KTYA 4M4SA 4AURA 3PUXA 3RRMA 1W4AA 5C2JB 4A2WA 1J70A 3CX6A 2VTKA 3ICQB 3AUYA 5FPTA 5HZKA 2VP2A 2YOFA 2NO7A 4NCNA 4ITRC 3RS5A 1EFHA 4BFVA 3TQCA 2A30A 3CRMA 5FH9A 1G5PA 3NBXX 1RJ9A 4A36A 5LB2A 1JJVA 2ZRGA 3VR3A 2PX3A 1UBGA 4EQ6A 1NY6A 3I3SR 3QVVA 5SZHB 1VIYA 3EARA 4P31A 4V0OA 1KAOA 4Q00A 4FMCF 1XD2A 1Z0IA 1RIFA 1II8A 1NP6A 2P5TB 2QEQA 3E2IA 1TEVA 2Z83A 3DDCA 5CYPA 4N3NA 4E03A 1YKSA 4ERNA 3FKQA 2O8CA 5F9FA 5JWOA 3R8FA 8OHMA 3I62A 2HYIC 3AF4A 5F9HA 4R2HA 2FJUA 1E99A 3IIJA 1KI4A 4QGGA 4GNKA 1E9CA 3QXJA 821PA 721PA 3RANA 2OEPA 5CK5A 4UXIA 4LYHA 1P75A 1E9DA 2Y8EA 1QF9A 3WHLA 4LY6A 2JLZA 1PJRA 4Q7LA 2OXRA 5EQTA 1EFRA 4BFSA 4R71A 2HDNB 2HV8A 3MFYA 1CULC 2ZPTX 3AF3A 2OUKA 2VHTA 5CJPA 4JT4A 4RVCA 4TZ0A 1RZ3A 2VSFA 3AF1A 3C7KA 4KLZA 4M1WA 5J47A 2QTFA 4BFZA 3CH4B 1CR0A 3CLVA 2FE4A 3D8BA 4CIDA 3Q8XB 3U7HB 1ELOA 3NEYA 4CGZA 3QKSA 4TLDA 4KAXA 3Q7QA 4FI3C 5TDHA 3UPUA 1HQYE 1P2VA 2D2FA 2P5SA 2G0TA 2A5YB 1SULA 2ZJAA 4QL3A 4KV9A 3EA5A 4URWR 1ZM9A 4JMPA 2G88A 4LSGA 4M9QA 3PVSA 3VHLB 3GEHA 3U3OA 3A4MA 2GVZC 1OFHA 4KBGA 4PO1A 1IONA 3OEEA 3PITA 1M34E 1OIVA 2O8FA 2BCGY 2XGJA 1KK2A 3VR6A 4C0HA 1Z2CA 4URVR 2G0NA 1MABB 1W4BA 3BXZA 1YZLA 2V7QD 3U3JA 4QKQA 4EJSB 1U9IA 3PFIA 1YE8A 2ATVA 3HR8A 1NLFA 1LF5A 2A5FA 2HLDA 3RRYA 1M6NA 4WZBE 2OLKA 2FFQA 3PUVA 2KE5A 2CE7A 3SOPA 2Z4RA 1SXJA 1C9KA 1OYWA 2CEAA 2NOAA 2XB4A 3KDSE 4FINA 4Z8XA 1OB5A 2G77B 2CHGA 1T3LA 3NH6A 3N2EA 1WBDA 2CVHA 1T0JB 3CNNA 5CYOA 1KI3A 1E9EA 1OT3A 3OE7D 1KK1A 4PC6A 4RSGA 5GJCA 3QXSA 3KJIA 4P4SA 1ZNXA 3QJYA 4BRUA 1OJLA 3EWSA 2FSIA 1W5TA 3F5FA 3LBNA 4LCBA 3RC3A 3RS2A 2P6NA 2OCPA 3KFVA 4RFVA 3KB2A 2WKQA 1OFUX 4TL8A 5FL3A 5HE9A 1Z08A 2BBSA 1E2FA 4DLSA 1Q12A 3AQ4A 1T5IA 2REOA 4IXNA 4M9XA 5DHFA 2W6IA 4TSFA 1KGDA 3I73A 3IO5A 4PQYA 2PJZA 2VA8A 4MH0R 1IBRA 2OHFA 1FX0A 1AM4D 5FTMA 2B8WA 1OPXA 1R0XA 2REXB 3BH6A 1XX6A 2P6UA 1KIMA 4BFTA 2ZI5A 3WP1B 4D4MA 1J99A 4IXMA 2C5LA 2ECKA 2ANBA 3KX2A 1KO1A 2Z43A 2ZROA 3PCRB 3SN6A 1S1CA 5HKKA 3K8YA 4RD1A 4MYCA 2QGZA 1ZMXA 4IHQA 1P73A 4JLBA 3RRNA 1DO0A 2EVWX 3EA0A 4LHVA 4QBGB 2GNOA 3CB4A 4XWAA 4PQFA 1FW6A 1EESA 1GP2A 1X86B 1P60A 1A4RA 3PUZA 4A8JA 3ZQJA 1LFDB 3VU9A 4HLQB 1FP7A 1KYIA 1ANKA 1SVSA 4RD0A 2IUUA 1AKEA 1Z83A 1XBTA 1RKBA 4NTZA 3DOEA 4MKGA 4OJKA 3OZXA 1Z8FA 2ZRBA 2UVQA 3B78A 3JVUA 1OIWA 4MRVA 4M1MA 4BGDA 5AJWA 1GKIA 4JLPA 1P61B 1AS3A 3PENA 3SJZA 2KB0A 3AP1A 3DPUA 3ND9A 5E95A 5B2ZA 3REFA 1TUIA 2JDID 2HXYA 2F1RA 3AVUA 3C8UA 3A1WA 1DG3A 3NBZC 1D9XA 4OHVA 5CM9C 4DCVA 5DHAA 1O3YA 1OFIA 4BEJA 5AK0A 4A0FA 4V0ME 5KO2A 3BB1A 4URXR 1DAHA 5EP4A 2ZE6A 4M9SA 1Q21A 3LQQA 4LJAA 3HWSA 3R7WB 1K8RA 1KI6B 1H8HA 1O87A 4HDOB 1AJEA 1G7TA 3GLFE 2DWPA 3NTUA 2RMKA 1EXMA 5JWHA 3CPJB 121PA 1Q57A 2FG5A 3U3RA 3WHKA 2XTZA 4L8GA 5EXPA 3QG5A 3FFAA 3WYAA 1T4GA 2HJGA 3VR4A 2P6RA 1N6NA 1NVVR 4HLDA 4Q4AA 3TBKA 2ZRLA 2IUTA 3CWZA 3NEJA 4QJ5A 4AIIA 1KI8A 4D0LB 3RS0A 4E22A 2GXAA 4UNQA 4JLMA 2ZRNA 2ZI3A 3EIEA 4C0LA 1WDTA 3EPKA 2QMEA 3F8TA 4YMWA 1ZBDA 3MCAA 1W48A 4LDJA 3SU8A 3BE4A 4B74A 3P4XA 4AKHA 1AS0A 2ZR0A 5AUOB 3IUYA 2QPTA 4AKIA 3TE6A 3T5GA 3BAFA 3BOSA 2VL7A 2BIFA 4B2PA 5JFGA 2GZDA 1W0JA 1Q3HA 1R0WA 1COWA 2WJYA 1P2UA 2ONKA 2VHQA 4LV6A 2D7CA 3PUYA 4JT2A 4DUGD 3O8DA 1E9BA 2Z6VA 5BN5A 3SEAA 3EPHA 5H8WA 4HAVA 1CIPA 4FXPA 2J7PD 4MKHA 3LLUA 5EE3A 4PTLA 4YXWA 3R8CA 5FPHA 5CK4A 4OHYA 2OT3B 4EJSC 1KO8A 2QAGA 2RGCA 1WP9A 5IHPA 1KKLA 1DE0A 2J0QA 4QBIA 1IM2A 2QN6A 1J2JA 3IHLA 4GOKA 4QBFA 1MT0A 4JBWA 1G17A 4PZYA 2A78A 1YU9A 4EUNA 2JLRA 1GRQA 1UM8A 3IBYA 4HATA 5FOTA 1BYIA 1P4SA 3U4QA 1L4UA 4AG5A 1E9AA 4GL2A 5EE1A 1U81A 2FWRA 4Q7KA 1KI1A 4GMXA 4EPXA 2D62A 2RGDA 3QUSA 1NSFA 1BYUA 3W34A 4MYTA 1E96A 3T15A 2CNWA 3A1TA 3LVQE 5AR1A 4BLSA 4DWJA 1FNNA 1G3QA 1JEEA 1I2DA 3QY0A 1MRNA 3OAAA 4PSVA 2AX4A 4QOSA 1E69A 1S3GA 5J4VA 3BC1A 5CM8B 5CLQA 4E09A 2W2VA 2FA9A 2IHYA 4RCYA 4RD4A 4C2TA 4PHFA 4ZIRA 1XTRA 4JJZA 4NCKA 5D3QA 2LKDA 3SC3A 1MKYA 1K5GA 1N0WA 4ACBA 4CT5A 1U99A 1WF3A 4DSUA 1D2NA 2G9NA 3ZVMA 1Z47A 3ZVNA 1DAIA 1G8YA 3ZGXA 1EFRD 4TMZA 1P3JA 1QHHA 1YVDA 3VR2A 2OFWA 1M74A 3CR8A 2ZI4A 4JIMA 3EPJA 2K5UA 3CONA 4QNRA 2YKGA 2PLFA 3R9XA 1XCGB 1SQ5A 2ZI7A 1RJ9B 3LO5A 5AUQA 2PBRA 2IXFA 1XZQA 2VSXA 4GPTA 3WMEA 4A0HA 3CRVA 2RHDA 3L2OB 3GLGE 2V54A 3L0SA 3GFTA
chains in the Genus database with same CATH superfamily
3LE8A 4CXMA 4C0SA 4PWWA 3QA9A 1V3SA 1JG4A 4PYDA 1NXWA 2EL9A 3SGLA 4C89A 2KYZA 1VPLA 1DAOA 3P0JA 1NPDA 3RYTC 1I1NA 4S1PA 1J5EF 3DBIA 5GV7A 1KHTA 3O8QA 1VLJA 4P93A 3Q9LA 2XKAA 4NG5A 4QCLA 4TTPA 5B7WA 2RH9B 3S4YA 4ZP1A 1XN1A 2QN1A 5ETQA 3UMFA 2GGPA 5HO4A 4Q01A 1YDHA 3DUFB 3W1YC 4G25A 1K0TA 1RB0A 4JFAA 4EVRA 3LBIA 5FUYA 3TYTA 7AT1A 1X0VA 2GQCA 2ZAYA 1OZ0A 1JL3A 5M2UA 4P52A 2CMKA 3KZVA 5DWVA 1ZA2B 5A02A 4BIMA 5A5FA 2CSUA 4GI5A 3RSCA 3EE3A 4Q2LA 4PYIA 4PGHA 4MQBA 1Y11A 2VYFA 2C99A 1AV7A 3HDQA 1IH8A 1MFZA 1WW8A 3S3TA 4B3JA 4ND6A 2MZJA 2DWCA 1TR0A 4CPDA 2YVUA 1DKUA 2GHRA 1YRQA 4C22A 5ALGA 1IPEA 4TS9A 1QLNA 1K97A 5CTAA 3N58A 4LY9A 4KR6A 3GRRA 3S2IA 2OYCA 1OAOA 1QH9A 2GH1A 3CIZA 5DJBA 3LC1O 2VP9A 5ERGB 1V5GA 3HCAA 3X1DA 2RU9A 3OE7A 5T3UA 2YKMA 3AP2A 1UETA 4ARIA 3ISVA 1MBZA 4CO3A 1RHKA 4FDFA 2G25A 5KOHB 3KLPX 4OYRA 5L9NA 2RQMA 5FPPA 2IC5A 4PKDB 1V8DA 3RU7A 3AGQA 5CA5A 3H6HA 3GT4A 3ZTWA 1E7RA 1B7GO 2I87A 2PDAA 2OXEA 3A3YA 1AZLA 4NP6A 1DIGA 1IUKA 2IYFA 2X6RA 3ONDA 2QJRA 2F3SA 4MAMA 3WRYC 2ZWPA 2D2EA 4MVWA 2LA6A 3FEYB 1YHYA 1RCTE 1MZPA 2QEXS 2B3TA 2LVBA 2FPGA 3DHNA 3ZYCA 2C2OB 1W9HA 5CYMA 1WOYA 3QXXA 5DO2A 4ZK2A 2IHKA 5GONF 4NSNA 1W85A 1GX6A 2FQ1A 4NAHA 3TFOA 2J46A 1Q16A 3A9TA 2CFIA 3RTGA 1LDBA 2H4HA 5UKDA 3SXUA 4C05A 5BP7A 5C5CA 3B1KA 3OOJA 3JV7A 1ZAKA 1PWZA 3SJBA 1NA5A 2R7OA 2PUVA 3QVOA 5AM2A 2XNHA 1QAMA 1XU9A 1HEYA 1KZ6A 3MA0A 2IXDA 3PPWA 4RNDB 1Q0QA 3ACBA 5T8KC 2HBYA 3DBRA 4PNEA 1ZHOA 3IAXA 1AMUA 5KYTA 4FFBB 2NQ2C 5E0KB 3HCFA 5CIWA 4G0PA 3ME5A 3VTIA 3K9LA 1KKMA 3TLJA 4RW6A 2UVDA 2ZTMA 3HSKA 2EFEB 2IIVA 1HYGA 4Y6OA 4P22A 1NNI1 2I3AA 2VPXA 4L27A 5IEJA 1RT5A 3GMIA 1XZHA 1U3TA 3SQOA 2HGLA 2PIDA 5I3PA 3Q0IA 1QU3A 1QO0A 1YDGA 1XWLA 3U16A 3ZG6A 1EVJA 2XRFA 1N2SA 4ECSA 2JZOA 2GIRA 1HYQA 4X45A 2ZAIA 4KJZA 2WG1A 4JKIA 3ZWWA 2FN7A 3KQVA 4BY9E 4R01A 3VR5A 4ZVMA 1F0NA 1SVIA 1PFWA 1N77A 1XHFA 5FFFA 2C97A 2OMOA 4EHHA 4RZ2A 5TQ0A 1KSFX 1AQLA 4KGVB 3TI9A 2UZAA 3ENQA 4G1CA 3N6MA 2BZSA 4ROSA 3K94A 3CTPA 4F2SA 2CPIA 4J94A 4L78A 1FFDA 4CHTA 5HF6A 3M2UA 1YRLA 1QYRA 1JQBA 3M6AA 4QFMA 3LF2A 3L07A 2VBCA 2A9OA 1IZYA 3K4PA 3QMPA 3ZUPA 5C8XA 1TUGB 3WAGA 1QIMA 2NYAA 3CRW1 1V4VA 3RUFA 4XTRA 4BO6A 3AFOA 3ZGOA 2YNFA 1AGYA 2O66A 2QORA 3HB7A 2GO1A 1ZZNA 2DK2A 2HW3A 2XOKD 3AXMA 2YUIA 3UTDA 4O6VA 4DY4A 1JLLA 3WBKA 2L82A 4IKOA 3FBWA 1A95A 1YV9A 3LRPA 1TL5A 4HQOA 1KMMA 3BKXA 4IGIA 3DNFA 1YKGA 3DTVD 4P7GA 1B6GA 2BFDB 1KQPA 3GAFA 2H5LA 3IAS6 5HMYA 4UFOA 1AUSL 4V1Ak 2MEWA 5BXYA 4DJ5X 2GHWA 1BGWA 5CFZA 4GZLA 1DKRA 3V9AA 1KFEB 4M1YA 1JE1A 4S1WA 2WYUA 5FWXA 2IJRA 2A5DA 4MPJA 4OHUA 4CT8A 4G26A 5T7LB 1E2IA 3L6BA 2ZVIA 1YCHA 3AL2A 3DTVB 4HVLA 1BN7A 2QM8A 2F17A 4NI2B 4V0LA 2WINI 4P33A 3ZLUA 2B2NA 4AS2A 4H1TA 3E51A 4CI9A 2PSJA 3MTJA 1V16A 3OQ2A 3NHAA 4S0MA 4IVRA 4IIGA 1R89A 4LTDA 3OM8A 4D8TA 4FHZA 3UHPA 3KMQA 4P54A 1VLOA 4ALIA 2Y3IA 1QIEA 3WISA 2SCUA 3UE2A 1X5SA 4URZR 4ZCSA 1U0TA 3TTUA 1XQXA 2HMVA 5M29A 3EBPA 3MOGA 1GYPA 4YWJA 4WACA 1KFJB 2QL7B 2JNJA 3OE1A 3OO0A 2RF2A 4RK5A 2EC0A 2H1VA 1SQEA 2EG9A 5JO9A 1E2GA 2V63A 2GCEA 5GMEA 3FGZA 1YIJS 4B02A 1S1XA 2B78A 2LPMA 4K46A 4Y2YA 4WNAB 3WDKA 4G8BA 3A8KA 5IRCD 2EBFX 4KSCA 1N2ZA 3HV0A 2W4QA 1TLFA 4HB2A 2F7SA 1EIYB 1WPQA 1T0UA 1V37A 1Y1LA 1AZSB 1JYFA 5KU7A 3NHKA 3OOYA 1ISGA 5CCDA 1BA3A 2B7LA 1F0YA 4HMPA 1VIOA 3RU0A 1PQ4A 3ZCSA 1EFCA 1SVKA 3QSGA 2LDXA 4G1UC 4ML3A 4DV2B 4S2UA 4ZPTR 1N5YB 2F8EX 5CURA 4QM6A 3Q9SA 4TY8A 3PX6A 2QUKA 2WYVA 4YCDA 1NW8A 3QX3A 4B7AA 4Y7DA 3GFOA 1Y6RA 5HK8A 2BMJA 2NIPA 2CF6A 5MAOA 1TVMA 4QYSA 3MGAA 4XDYA 3FSEA 3FETA 4IOKA 4Z2XA 2W9CA 4RKFA 1J0CA 5BJRA 4M0KA 2CMGA 3VSDA 1W7AA 1RJFA 3WGUA 2R2TA 3PLRA 1W59A 3DOLA 2HA4A 2H11A 4DTCA 3B2EA 2GZMA 4KIJA 1KJ8A 2XDQA 3N8DA 3RSSA 3D9BA 4GLFA 1X1SA 3IXMA 2GT1A 3PUHA 3QVTA 3O8OB 1E1LA 1XPOA 4L0DA 2IXAA 4H60A 2CZVC 4EI7A 5E9QA 4BLTA 5HE8A 3CT6A 2GDJA 4C5AA 1XTJA 1RABA 4ON9A 5T67A 2A4MA 1NU4A 4P4LA 3GR0A 1RQRA 1X92A 5FO0A 4ENWA 1YE3A 4IDHA 1OH7A 1OKKA 3EZ2A 4ZCMA 1V6SA 3SSRA 2CLKB 2B7BB 4I66A 8LDHA 1YR1A 2C78A 1FYXA 4XPZA 3SZ2A 4M8IA 3ZNJ1 1G1MA 1HWJA 2GN6A 3T1OA 1X94A 3ISTA 1NVXQ 3DVSX 3H86A 2BR3A 3E9EA 3NPMA 3U7QA 3OT5A 4JYPA 4ZT3A 5LXTA 3G3EA 3O94A 2FQYA 5DLEA 3GUHA 3WFIA 1U2ZA 2PCJA 4ZOLA 3ZTPA 2NZ4A 4MIOA 4EY4A 2DH7A 4WKRA 3FF1A 2RRAA 4H7EA 1EUCA 2X3UA 5D6OA 4YRPA 2JK1A 3Q40A 2OB2A 4PNHA 3GILA 2Q49A 4U6NA 4MV5A 2XNRA 2ZQZA 3L05A 1F6DA 2BOVA 1L9XA 3GGSA 2HJRA 2IAJA 1KC1A 4RZIA 4QXOA 5AK6A 1QQBA 4C9BA 5CT8A 1WDMA 5JXWA 4R9UC 4WE3A 1JR3E 3N2GA 2ZH6A 2W6JA 1DFDA 1QJ4A 4MA0A 3RASA 3QVGB 3EG9A 2LCWA 4IKEA 4EG0A 1PBNA 1SHZA 4F4XA 3R24A 4CLFA 2QZZA 5DASA 1CUJA 1U65A 3A4NA 1VMBA 2A7QA 1LOUA 4O2RA 1SH7A 4GLJA 2VNHA 4LIRA 1XAIA 1KNZA 1TCAA 1G59A 1HNXJ 1BNCA 3N70A 1GKKA 1VG0B 2B0JA 4HGPA 1YS4A 3AIMA 2WPNA 4NLDA 1CY6A 3AVPA 4LJYA 3WLSA 4BLPA 2AN1A 4S2EA 3O91A 1NJZA 1G8GA 4U63A 2IM1A 3HKCA 4Y2UA 2QDKA 4CV1A 3NXSA 3R6DA 3C8ZA 4JXXA 3TIXB 4DV4B 1UXJA 2JA1A 2XQIA 5HCUA 1TQ8A 4JN6B 5KSYA 2C2GA 4HYYA 3MWGA 5C8DA 3I8SA 1WB5A 1SC6A 4U7UK 4BV3A 1PJCA 3BH7B 4FS3A 2ZNYA 2QJFA 1RXUA 1QQ7A 4TQUS 4NBSA 1U9CA 2OHGA 3VNAA 2ZKLA 5MN4A 1QGED 5HP4A 2Z95A 1U04A 1JFTA 2NSCA 5IAEA 3H4TA 5ALFA 4QYXA 4RZQA 1JT2A 1G8AA 5T6MA 1ZRSA 1WF2A 3KFXA 3IN5A 2FWAA 1V96A 2W9BB 3GGGA 2Q6OA 5DDPC 1YHZA 3HBNA 4FOPA 2XUAA 3M6XA 2G1DA 1KLMB 5EIXA 2V6JA 2NYVA 4Z37A 1ZM2A 2NUAB 2M52A 4DV4F 4QGFA 4FR5A 4BUCA 2IHBA 2H1HA 3ZDEA 1MO5A 3QTLA 4BNXA 1C2YA 2QYOA 3K5IA 3VSEA 1QSYA 5JADA 4F8RA 2PSHA 3LDHA 1FDTA 1V2HE 4B7UA 4HUQA 2JI8A 1X7YA 3T3FA 5EP2A 1K1QA 1KEZA 3FNBA 3IOMA 4WOJA 4DYHA 4ZHRA 4D5EA 4XIFA 4IHAA 3DPSA 3RSZA 3ZHSA 1C1BB 4TRMA 1FNXH 3Q8QB 1ADFA 3B6EA 2FDCA 2O3DA 5A76A 1KK3A 3EAQA 1G5IA 4URQU 4O3OA 3EMBA 2A92A 2J30A 1RAFA 1CIVA 1YA6A 1FK8A 3TD9A 4KXUA 3SHWA 4AMUA 1UMBB 1NUQA 2X0EA 2FMFA 1EFDN 5A6SA 5JPCA 1X0PA 4XLTA 1PNTA 2IEAA 2VTVA 2ZSJA 4DQ0A 3ZCVA 3PEYA 1JQLB 2OBMA 4BYGA 4WCDA 3BXXA 3MMNA 1GPAA 2PGCA 2IDZA 2ZKUA 4WUVA 4Q4DA 4NZ9A 3P49B 3BSYA 2DTDA 2BANA 4JQSA 3G5UA 1YASA 2BQRA 2LEBA 4CL8A 1P9LA 2FPKA 2WFZA 2QRNA 2F9MA 3UAVA 3PICA 2ZJ4A 3KOXA 4D9IA 3FNQA 3G6WA 3JQGA 2IWHA 3PW2A 1FVXA 2XY4A 5JWRA 5KFKA 1C9JA 1EK6A 1G291 1U2PA 4ALKA 5HHTA 3P94A 3LL4A 4ZVNA 1X9IA 4ED3A 4C11A 1BGVA 3D67A 1JWLA 3OFVA 1F9AA 5CFOA 4OH7A 4Z4CA 1WSWA 3MSCA 3L7KA 1WNEA 4IW3B 2ZCJA 4KRGA 3HJAA 3LDUA 1PJ3A 4GFDA 2AZDA 5TJHA 2QV6A 3QPCA 2EGGA 2ZH3A 3BM7A 5IH7A 4YDSA 3HHLA 3ML1A 4V02A 1VR6A 4PG4A 1NHVA 3OVSA 2KYXA 1XQVA 3ELBA 3G17A 2QL9B 2ORVA 4MKAA 2CB0A 2LEAA 2QGNA 1K88A 2QAIA 3R8XA 5AI5A 2EKPA 2DGUA 5JAPA 4FBGA 4G3XA 4BRSA 4F4JA 1OPIA 2ZITA 3UK6A 4M7OA 4EJSA 5GOTA 4F5EA 1UWVA 2R97A 3AF2A 3BJMA 3GB0A 1Q50A 2VDOB 4D3XA 3G8TA 3TLZA 2WOJA 1F6WA 1RTTA 2QQ5A 4CVNA 2KJWA 4C4PA 3VKWA 1QF6A 4LWZA 3PPXA 2AFVA 1VLMA 4UQTA 2PQMA 4MO2A 4LSNA 2XUPA 1M5OC 3G9QA 3J81A 4DU7A 1UCFA 2FFAA 1RT1B 4A16A 1SBZA 1X5TA 4B34A 1CQIA 1FNBA 3DOKB 3W66A 4BTEA 1F4PA 3IKJA 1CJVC 2IHR1 1KH3A 3Q2KA 4QULA 1XL0A 1MB0A 5JROA 3GA0A 1L7MA 4LSZA 3ADCA 1VHTA 3I56S 1WXEA 5CX4A 1UK7A 1PJLA 1V7QA 5IYZA 4O4GA 1IN4A 1XZJA 4EGLA 5LC1A 2NSDA 1RTZA 3RC7A 8AT1B 1CY8A 1DC6A 3K1ZA 3QFRA 4QAJA 2Y1LA 2QSYA 3SSSA 3AKYA 3LRXA 1WHYA 1O9BA 4LBIA 4WNYA 3R6GB 1MC4A 3SR4A 3GFZA 3OSPA 2GA9A 3WWEA 3AINA 4G5YA 4EO9A 2EJUA 4B4DA 1YJTA 2X6TA 1P8JA 2CWXA 1NQVA 3BD6A 3LD9A 1ZP6A 3UAWA 2WTFA 4E6EA 4LPSA 4R98A 4DABA 1A5SB 5B37A 4MQLA 3F1KA 4H3HB 1M5HA 3TUPA 3DZFA 3EY9A 1VZ3A 4CNZA 4B2IA 2JIPA 1M5TA 2F62A 2MINB 4M89A 1ZH0A 3AX6A 4C08A 3IAS9 1XKTA 3B1JA 2HA7A 2KZZA 4CO5A 2TSYB 3FUXA 2Z6QA 3TSAA 1SXIA 4LDZA 3UDEA 1RWMB 4OI4A 3OJOA 1AZWA 1BJTA 1TLLA 3SEZA 3S01A 1JSXA 3N8HA 5FUMA 4PXEA 1PIWA 2PKRA 2MMYA 2CBGA 1W88B 1EQ2A 3VYWA 1NQTA 3ZQ4A 2F63A 1ICEA 5JNLA 3EMVA 4C8NA 3NI2A 2XMSA 5E2QA 5JXHA 1MOPA 1M5SA 2BTQB 2DO4A 1IJBA 3QYJA 4AY3A 2BFFB 3KG2A 5HQ3B 1KFCB 3O84A 3R5XA 4E08A 2C2YA 3ZDDA 1MGOA 1DRJA 4DUZB 1DUVG 2FVSA 3AF4A 2FCAA 2FHPA 1E99A 4D02A 4H17A 1LW0B 4FZ5A 5HK9A 2IPOA 3H9CA 2H7YA 2P69A 1I7NA 2B34A 2CJ9A 3HHNB 1EP3B 3AF3A 5ETVA 5CJPA 3TAQA 4L7QA 1RZ3A 2VSFA 5J47A 3NGMA 4L9RA 5KOWA 3V2UA 4ISBA 3KDNA 4LC9A 3SKXA 4YAKA 4OGFA 1VC0A 3PC8C 4JBLA 2JBAB 4ES3A 1H85A 5FA8A 2A5YB 1NXVA 1H2FA 2O3JA 1SULA 3EA5A 4C1NA 4H7KA 3KEMA 3GRZA 1RHRB 1O77A 3NT4A 3K20A 2XBLA 5DTEA 4ECRA 1Y00A 4MQUA 3UF0A 2FZEA 1K2VN 1SXJA 3KHKA 3NBMA 4FINA 4Y6PA 2D3O1 2Z56A 4DCPA 1P91A 1MU0A 2XOXA 5KTTA 5BNZA 3SFUA 1OJLA 3EWSA 4CLEA 4KSYA 1YZYA 5BQOA 3O9ZA 3UMVA 2X14A 3AQ4A 3NGRA 2REOA 4E15A 2Y1XA 1I30A 2PJZA 4P71A 3JQKA 1RHJB 1FX0A 1ULUA 4DF8A 4K03A 2XTJA 4E1AA 4IS3A 5LQUA 4NE9C 2OQVA 3EXG1 4D4MA 3F5DA 4MIAA 4ZIVA 3SJ7A 4M0DA 2JLCA 4JLBA 2BKAA 2H65A 1G6Q1 4LHVA 4D9HA 1V1RA 3UGJA 3PUZA 3DC7A 4ZD6A 1Z2EA 4Q05A 9MHTA 3PKIA 2M1XA 1GDHA 2AEEA 4XEHA 1D9XA 5JH7A 1AFIA 4I8DA 2NP6A 4G84A 1DAHA 4H18A 2FW6A 5F3ZA 1RA6A 2GSDA 5KT4A 3DWIA 3CT4A 1SBYA 3HSGA 1CJKA 3SD7A 4ZLNA 4DLLA 4DSZA 3ULHA 4B40A 1ZD2P 1W4ZA 5BQXA 5F0WA 3AEKB 4Q4AA 2CD9A 3NEJA 4OF4A 3G86A 3KSDO 4E22A 4BS9A 2GXAA 4DSKA 2NVWA 4GKKB 3EPKA 3OVMA 1FQOA 3UTCA 1AQNA 2UUAB 4LDJA 4B74A 1R8YA 1BQMA 3N8KA 1PU2A 2QPTA 1J2RA 3D3CJ 2BVZA 3D6MB 5AW9A 2PMWA 3L1JA 3PUYA 3L3CA 4JT2A 1H6CA 1JKHA 4IDKA 5KMGA 5FPHA 1X9WA 3DAHA 3R5KA 3MBIA 3IHLA 2NLOA 4FPRA 3LUPA 2DXIA 4TU8A 3GIRA 2ZZKA 2JRCA 2HR1A 8ATCA 3A7EA 2X0DA 1KQFA 1KYZA 4DSLA 2W6ZA 4MYTA 4KIAA 4ELVA 1NI4A 3BYZA 1X77A 5IT9Y 1VQ9S 4OLJA 3ORQA 2A0UA 1RT9A 4QOSA 5BSKA 2D13A 3QVXA 4E09A 1JJ2R 4RCYA 4A8OA 3LT0A 4ZITA 2QMXA 3S29A 3I82A 3EA4A 3U4GA 1K5GA 2PV0A 4C3KA 1PSWA 2PWPA 1G8YA 3LDGA 2ONCA 2ZI4A 4MDHA 4GKKF 3OQVA 1RT3B 4QNRA 1NB7A 5D3KA 5KYWA 5KCZA 1HMYA 2UUAF 2O1PA 3FZ2A 1QHFA 2DKOA 4P2FA 3MHPA 3L2OB 2V54A 4MRAA 3AXSA 4C3VA 1RAIA 5D15A 3C46A 1EUDB 2RGNC 3LOQA 4Q1CA 1XTVA 2X19A 5FTJA 1KDOA 4Y1RA 2XY5A 1W2GA 1Y98A 1U1IA 4BEWA 2MZSA 1EVLA 3FRHA 1JNYA 3GJ7A 3TTSA 4GYYA 3P20A 1EP4B 5HEKA 4XUDA 1Q4RA 2FPPA 1DMSA 3ROPA 2UUCJ 2HLDD 2QP3A 3KC2A 2PVPA 3THPA 1NR7A 1SBHA 1DUIA 1KZ9A 2XH8A 3ZZOA 1DG1G 2VKTA 1GFWA 3ENKA 5FI0B 1UJMA 1EGHA 3W5IA 1SWVA 2GBIA 1Q14A 2ENUA 5EIEA 4G5GA 5J4LA 2GHPA 3VU3A 3L7AA 4GRIA 4BVJA 1T8EA 2OR3A 5FUQA 4USIA 2VJVA 2ISQA 2ZUUA 1T6ZA 3DGVA 2G8NA 4V0MA 3FTNA 4DIEA 4JJIA 1C80A 2GA8A 2FFJA 1MN6A 2P4HX 3AA9A 2QG9A 3QBTA 4LHXA 1AKRA 1U4OA 4L4UA 3WADA 3GPIA 1X7ZB 4LOJA 1TKAA 2RI6A 3WLQA 2G17A 1UA1A 5I5EA 1YZFA 5ESXA 4CR7A 4H4OB 1H1DA 3E9NA 3GG2A 2D4HA 1JLEB 3IGVA 2YHIB 1OWMA 5AXDA 4NMWA 3NP9A 1ND6A 1LEHA 4AY2A 4RABA 4Z7NB 3MT9A 2UUPA 3D02A 3FFBA 2R2SA 1WLSA 3E9CA 4HZGA 2VHCA 4QELA 2NSJA 2BRLA 3PX2A 1PGQA 3JZDA 4LZAA 3GPLA 3WJ2A 4QPZA 3VV2A 1PQUA 2R6GA 4OJ1A 2WNHA 1JHYA 3ELYA 3MUVP 4BZZA 4IYRA 1FSSA 5A3SA 3DZGA 1AD2A 4JLDA 3DMJA 1L5HA 2LQ5A 3ISND 2OZVA 4FWBA 2EOAA 2ZIGA 5JV5A 2I03A 2Q1WA 5T7BA 4CO2A 2XMGA 5HKAA 1L5WA 2IOQA 3UD3P 4FBMA 4AUMA 1X1QA 1NBHA 1RHUA 2NZJA 2CNOB 4TWRA 1FTWA 1TMKA 3M70A 5DGIA 1OLUB 3K5PA 4EIWA 5E6SB 3O31A 4N9QA 3AVVA 4UBNA 4XGQA 2QT0A 5JNVA 3V1YA 1W1IA 3OQ6A 2R7SA 4KWHA 3BG5A 2HYDA 3U4QB 1U6IA 2PMCA 4MV0A 1WC5A 1A8HA 4BWVA 2HF8A 3TJ8A 3UOGA 3QU7A 2HC9A 5JMTA 1TO2E 5A5DA 2ZJRQ 2P65A 3IAM6 3QJGA 2N75A 1ECLA 4C4SA 2Y0EA 1Z17A 4WCFC 3QKWA 2V34A 2EHJA 3QUTA 2F1JA 3PQ4A 3P9SA 4CNYA 2O3SA 3NEPX 4CV3A 4UVGA 1ZU5A 3UJ6A 1PTJC 2EFYA 1YK0A 4HYQA 2SBTA 4B7ZA 3M9NB 1WSDA 4GIBA 4J16A 1LTQA 1E3QA 1HE8B 5KFTA 3OFSA 3W64A 3DV0B 2ZUAA 4JYBA 5GV8A 4K1XA 2G4BA 1CZOA 4RSRA 5EZSA 1RW4A 5D0GA 2VDJA 3MCOA 1GLVA 1JWBB 1TOAA 2WVHA 4JNKA 2E4ZA 2Q3DA 3KJXA 4DJTA 2XCLA 1HLDA 2ZSAA 3T3PB 1E1MA 4JWKA 4LG1A 1VI2A 1GQ2A 1Z0DA 1CZRA 3B5JA 4ZXPA 3TG8A 4IIEA 3G0DA 5AKJA 2DLDA 1HBMB 2FLNA 4C4RA 2R2RA 5JAIA 4LBHA 3WA6A 4B3TJ 1G60A 5EVJA 2XMZA 1EM8A 3LP0A 2VATA 3EBLA 1URNA 3LFUA 2WKSA 4R68A 1ZMOA 1RKUA 1KEWA 2ZUVA 5FDFA 4R0VA 3R09A 4RV4A 2I6SA 1YJ8A 3RAPR 5DQGA 4ZV4A 5LYJB 4PRFA 4HRVA 2GCIA 1TV6A 3FPEA 5DJ5A 4G0QA 3K5NA 3LC0A 1ZHFA 1FFHA 3S7RA 5E8JA 1YRXA 5FJJA 3M30A 2V7BA 5JQGB 3KDAA 1JB0C 3ZD6A 1POWA 4WK6A 3BKTA 4BGEA 4OXIA 2H9AA 1C0UA 1L3UA 2AZMA 4ER8A 1FRKA 3ZNNA 3OHPA 4Y9SA 2KO1A 2O1XA 2W6PA 3KG1A 1FT8A 3SCIE 1DTWB 2IJGX 3ZY4A 3U60B 2OY0A 2DF8A 4J6EA 1XZEA 3RHFA 2YZGA 2B4UA 2QL5A 3PIRA 5K0TA 4UKDA 4MUAA 3SHQA 5KPJA 3CCRS 5FD1A 4BFYA 1TFWA 4PS1A 4D4HA 1JJ4A 3QVJA 4D9KA 3FHLA 2CV0A 3VO9A 2WD8A 3MPDA 1T2NA 5LYJF 4X3CA 4MT1A 3FYUA 4KRFA 1FS6A 5C24B 3R3ZA 3OQIA 4I2QB 4EPRA 4AXIA 2HMAA 1DBWA 4EW1A 3KXPA 1MO3A 2YHSA 1XTSA 1BDJA 4UMFA 2H1FA 1LPAB 1ZCZA 2BI7A 4BN4A 4P0TA 2VDWA 5JQGF 2IUFA 1OFVA 4JI8J 4BP1A 1O6CA 3WX0A 3EULA 1LQUA 1YH3A 3M8WA 3KUDA 2J32A 1X3LA 3HX9A 2XQGA 1HE1C 4MB0A 2AUNA 1VL5A 2GZ1A 1P44A 3LFHA 2CG8A 2CXQA 2EXUA 2IP2A 4AS1A 1XMQJ 1WMSA 2KU7A 3BGWA 2X7XA 1H2WA 4CNQA 4HDKA 3GT0A 1UUFA 3GNTA 1Z18A 1GRRA 5KFEA 1FRNA 2Z8YM 2AYEA 1Q19A 2YNMA 1QHEA 3IULA 1XLVA 1YR6A 4EM6A 2RHSB 2R4QA 2PNJA 1MEEA 1SCKA 4YJGB 1RYBA 5I8ZA 1K75A 2VBFA 2XB8A 1KOHA 3LBYA 3OCUA 3QQPA 1POXA 1OUMA 4PG6A 2B9YA 2OCXA 5GZ6A 1LK5A 4CL0A 1EEXB 1T9GS 3LCUA 1W5EA 3BMXA 3W6NA 1G64A 2ZREA 4CZCA 4QVGA 5EQDA 2VBZA 5DNAA 2BZGA 2XOEA 2B35A 1WMAA 1KYYA 3HBLA 2HLHA 1RISA 2ZP1A 1DXHA 4WZAA 3L43A 3GX1A 2YN2A 2RD2A 6NULA 1VG1A 1SUBA 2HO4A 2HCJB 3C4JA 5EJ7A 4D7AA 3TPCA 3ZJYA 4YRNA 1RAJA 5HTKA 2NTNA 1Z29A 3D5MA 1AOXA 4UAUA 3QE0A 2E29A 1ZD3A 3SMVA 2Z9DA 5J4YA 2ZIFA 1O95D 3HFVA 2RJZA 4NXNJ 4NJEA 2R96A 3OZCA 4EY8A 2O14A 5FL7D 2EWWA 4DJDC 4XYEA 4LUBA 1SIWB 4TN1A 2O8NA 1JLSA 1EP2B 4M2LA 1TVEA 3DE4X 4QBKA 3T7EA 3IQFA 1Y48E 2VASA 3GH1A 4QUHA 3FH0A 2FF7A 3AEYA 1FIUA 2CJKA 4C0WA 4FF2A 3LGNA 5EHGA 3LZDA 2AOVA 2D2VA 4GG1A 1L3TA 2UXBB 1YR2A 5GWXA 4OXYA 2LBPA 3OX1A 5BVGB 1LQ2A 1C14A 3JQ9C 1OFUA 1UPUA 5JUWA 4JASB 4MW7A 1HNWF 4XJTA 1XCOA 4RM2A 4CP5A 1GDDA 8ADHA 3OXLA 3E1SA 3WRXA 4YV7A 4RHEA 4IKPA 3H11B 1N7IA 1R0CA 3DOFA 1V5FA 1V8FA 3BQNB 3SC4A 1EJBA 4D9BA 3AFIA 1K47A 3LY5A 4BNMA 2RUGA 1N1MA 2RARA 4BO5A 2IX9A 3FMOB 4RA6B 1XO1A 4YV2A 1NBME 2G1JA 2CL0X 4Y2SA 3E5MA 1GT6A 4NBRA 1CUVA 2OM2A 2ZWAA 4RX6A 4ETIA 2P35A 3TEHB 1KZGB 2UXBF 1ISFA 3FYSA 3PNMA 1BIFA 2Q1SA 1XRNA 5JBNA 2HQCA 3JAWA 1DRVA 1LDGA 3I3OA 1IPFA 3IO1A 4IRDA 4RIHA 4RWXA 4JVOA 3LHIA 2DRDA 3MDFA 4TV9A 3DT8A 5AUNB 2PX2A 4OL8A 1C30A 4TT3A 2YICA 4ZJUA 5ECGC 4LYFA 4LBYA 4ILKA 5K6TA 4D79A 3VNBA 3IO3A 3UG6A 1MDBA 1EZ1A 3K0SA 4MKIA 1FFCA 4BHQA 2CPFA 3BUSA 2SKCA 3I0RA 2H2WA 3AOAA 1BXNA 2JC3A 1WMFA 4L3WA 3G0OA 4CQJA 4BQPA 1VBXA 1ZGHA 5CXTA 1XEXA 3OX3A 5CD1A 2YWHA 1RACB 1TD1A 3WFJA 4F2DA 2NZWA 2XHCA 4F36A 1Y0HA 4EHIA 5C80A 2XECA 1RTJA 4XM1A 1O0CA 2A8YA 1XMXA 2XCIA 2DQSA 4ZVTA 2WI8A 3FYHA 3THYA 4CLDA 1W8IA 2ODTX 4R81A 3EUAA 2XTNA 2J6HA 1S6QB 3BWXA 3U3ZA 3FJOA 4XYMA 1Q77A 2C4TA 4DE5A 4ZQHA 3PT9A 3GRYA 4D4KA 1B26A 2ODNA 1TZMA 3VAYA 4C6TA 5C3MA 1ATZA 2RB5A 1QYXA 3E27A 4Y65A 3PLNA 1L7BA 2G07A 4LNUB 3I5BA 3I58A 1YHQS 1MB2A 2CKMA 3FTFA 1DWQA 1U9ZA 4ZP8A 4BO4A 3AO0B 2J76E 1YJXA 3EZFA 4XD7A 4D4LA 1T05B 3AIIA 2AZ1A 4W6QA 1QM5A 3R0QA 2VPPA 2P0EA 2YWGA 4M21A 1B4SA 4YAOA 5EESA 1RYYA 3GT7A 3H5YA 1IZ9A 1K3TA 4NU8X 3HJFA 4PX9A 4C07A 2FEXA 3SHTA 4A6EA 3WB0A 4PV7A 1HKUA 1ZNQO 3LW8A 3FUCA 4LVNA 1U8WA 4D92A 2C98A 2R47A 5FBHA 1JHMA 2C4WA 2DEIA 1O4VA 5AHXA 3LKBA 2V5HG 1ZINA 3W2TA 3C8YA 1IQ0A 3MINA 4EHNA 2QA5A 3UA4A 2ONZA 3TWOA 1RWPB 2RHCA 5CD4A 3TO5A 1W7WA 4FCTA 5B08A 5HQ8A 1WEZA 2HGZA 4WK0B 2H4XA 1CX9B 1DRKA 1WTBA 2H9ZA 4R8SA 4TT8A 2IX3A 1ZK1A 3SCKE 3JQRA 7FD1A 3EISA 4NU6A 4Q3BA 2ZVDA 2X3FA 1LV5A 3LDAA 1VQLS 2QOEA 4TTIA 3S6JA 3F5SA 1LQ9A 4DUYJ 3U61B 3SQGB 4CDIA 4PPZA 3BIOA 1K6XA 4JL6A 4XWTA 3RSHA 3OUYB 1S1TA 2KS6A 3ZD8A 4LJ7A 4KUHA 3H2SA 2DULA 3ROGA 3SX4A 2IYXA 3HYRA 1USUA 2DOKA 2NPIA 4B43A 4A8TA 3GBPA 1X1CA 3AHEA 5AT1A 1IR1A 2F4VJ 1WB6A 3VAIA 3W9BA 1QDUB 3D3QA 4FGZA 1SB6A 4KTVE 2PMDA 3OHMA 1KWMA 1LWEA 4DV6J 3REQA 2I65A 3T5CA 3FOZA 1UBHS 4KGXB 3G6XA 1JYEA 2PBZA 5KFFA 3AJAA 1YRYE 3ZDRA 3UWSA 2AMFA 1JG2A 2GEBA 2KVIA 3M5PA 1R6XA 4CV2A 2BKEA 3E7FA 4OH1A 4ITSA 4LMAA 3BULA 3C6UB 4DSTA 4J0KA 1IQPA 3KE8A 4KE8A 4YCBA 1PQYA 4HEA6 4JJEA 3TEFA 3DI6A 5KSPA 2XSZD 5FUVA 3WLNA 3NHJA 5ILGA 4IH9A 1U0JA 5EMNA 3ORYA 2Q2NA 1JLFB 4D41A 3JAKB 4TV8A 3PGLA 2QNIA 4DNPA 1E62A 3OEED 1OS5A 4ECWA 2QTHA 3IAM9 3UXEA 4D9MA 5IDQA 3HE3A 3CYFA 1C1XA 2R1UA 2DMRA 2C4HA 2WLTA 1OGIA 2R7KA 4JC8A 5FV4A 4KL8S 3MJSA 4DR6B 3ROKA 3UCXA 1P1KA 1QPBA 4AF6A 4MWCA 2QPLA 4LYYA 3FTQA 3QI2A 1FQWA 2GF0A 4OJGA 3DFFA 3T5PA 3MAGA 2ERCA 1DP4A 4MVJM 4PAOA 3RT1A 4USHA 4KR0A 2HV9A 1E3LA 4AD8A 5MN5A 4JEUA 1XMOJ 3BE5A 3ONEA 2YVKA 4OXRA 1SD5A 1P27B 5IV4A 3NBAA 2YJ3A 1HBNB 4S04A 2ZVSA 3LT4A 2VJMB 5SZIA 3C6ZA 4CLRB 3SNHA 5U1PA 1E1NA 2Z6AA 3AKCA 1KWKA 3M89A 4XX0B 1NKVA 3W9JA 3QUBA 4DR6F 1RT4B 3LRTA 2NXNA 4IQ4A 3S8SA 4TKVB 3V8NA 2PKEA 4XDGA 4J9RA 3PLAE 2NS1B 5E7MA 4YB1P 1ID8A 4LHSA 5I9IA 3INYA 1Z0UA 2DC1A 5C7PA 3OF5A 4WFZA 2BCEA 1O6XA 2ZYTX 4DT1B 3JWPA 4TRNA 4E2FA 1GNQA 3BL6A 3BSFA 1KI6A 2NU7B 2R6R1 1YJNS 3ZWQA 3EIUA 4XPIA 4V0RA 1Z68A 3MJEA 5CAEB 1G2PA 1WCIA 2CMHA 2QGFB 4W6ZA 2OCYC 4CKZA 5IT4A 1F2TB 3U1LA 3UPTA 3T3EA 4EMBA 1DQAA 3HVTB 1WXIA 3KJVB 1QE0A 4F1WA 3POTA 4IQMA 2JJMA 4WINA 1U2QA 3KZOA 4A9AA 4RWZA 2Z5FA 4I67A 4FGWA 2HNYA 1N5QA 1TMJA 3E7DA 4C7QA 3DBVO 4CRJA 1ZIPA 2ZULA 4F4KA 1OSDA 2ZWOA 1B1AA 3LCMA 5FULA 3UHJA 1YULA 4TTTS 1ZHHA 2TMKA 4OQYA 2JEGA 5EXEA 1QCDA 3H0EA 5IWAJ 2VNIA 2PNFA 2HJWA 4HQ0A 2W58A 1A2QA 3NHYA 1F17A 1TJNA 1V3VA 5JD3A 3HSDA 3OZEA 2H0RA 5IN4A 3TXYA 2VDPB 1YWGO 1Y6FA 2Q6LA 1GARA 1NY6A 1GYRA 3H2ZA 3AFHA 2J7WA 1SUAA 3CEMA 4UM7A 3FC9A 1DAXA 2AI3A 2ODPA 4Q3KA 4GPZA 1WTFA 3GFXA 3OTDA 4QGGA 1N7JA 721PA 1UXGA 4BHTA 4YJ2B 1RDFA 4MZXA 1VRTA 1N5OX 4RVCA 3C7KA 5EJ5A 1OILA 5EWGA 4CIDA 3F67A 3FLBA 3R3UA 3DHVA 1I3LA 2O2DA 4JH0A 2YWKA 3SF0A 1HQYE 2ISSD 4L0CA 1CSEE 4URWR 4FYMA 3DTYA 1YDWA 3PFKA 2R7QA 1Z7WA 2QKYA 2AS0A 5JFOA 3AU9A 1IONA 1OIVA 5HBMA 5FQOA 2XGJA 1IMJA 3T6KA 4URVR 1MABB 1UEVA 3U3JA 4CMKA 4EB6B 2XYQA 2A5FA 1KVQA 4PF1A 2JD0A 4MYSA 1OB5A 4KLRA 2RBKA 3JQFA 3VAFA 2DBQA 3V48A 2X42A 1N9GB 1A8SA 1RFGE 3QXSA 3RW9A 3WOVA