3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
1JNYA 4LJ9A 2CHVA 4IXMA 3IIMA 3KXIA 2A3RA 4P31A 5AWFC 3ZVNA 5FBVB 2IS4A 2X8AA 1A5TA 2GBLA 2VP9A 2ZYTX 1G7SA 4NE2A 4PQRA 421PA 4M1SA 5AJVB 1KSGA 1TQ2A 3QEOA 2ZRIA 1EWRA 2OCPA 3CNOA 4PAOA 3L0IB 2ZE5A 3K09C 3OAAD 4IEEA 4WIAA 1ZD8A 1V5WA 2JCSA 3I8XA 4MGYR 2XX3A 4U5XA 2QL6A 1G3QA 2IYTA 1C4OA 4A8JB 1SKYB 2QTFA 4ZDIA 1WQ1R 4DLRA 2VP6A 1RPZA 4LHVA 2WJYA 5FOUA 3V4RA 2BMFA 5AR1A 2NQ2C 1SGWA 4CEJB 4AG5A 1CLUA 1CTQA 1FQJA 2ZVPX 5TMPA 2C77A 2QZ4A 4DVGA 4F92B 2EQBA 1GP2A 3QF4B 4Q1AA 3LX5A 4G1UC 3THYB 3FGNA 3SFVA 1PUIA 2G0NA 4Z51A 1KDOA 2JLXA 2JDIA 2WOOA 3B13B 3SYNA 4FINA 3LO5A 3TSWA 1E4YA 1VPLA 3PQCA 5KNDA 1XEXB 2BDTA 4PR0A 2G0TA 3VFDA 4RD0A 4DCUA 1EFTA 4R71A 4QBHA 4B2IA 4KVAA 3WNBA 1W44A 3OEEA 2F1RA 4E5UA 2O8CB 4R7ZA 4Q03A 4MH0R 1P4SA 3T1OA 4CVNA 4NKRA 1UBGA 2BBWA 1AK2A 4XWAA 1G41A 3ZZTA 3UXMA 1OPXA 2ZRDA 3CRW1 2Q9CA 1E2GA 5CYPA 3C7KA 5D3QA 2AHOA 2C9OA 3SEAA 4JL5A 2QBYA 2VP5A 2GAOA 2C96A 5JRZA 1JJVA 1R0WA 4AG6A 3AKCA 2XXAA 1N0UA 4C0HA 2BJWA 4KITB 1UKZA 1X8LA 5JWHA 3SQWA 3E5HA 4DWJA 5FI1B 3VR5A 2VO1A 2ECKA 3BXZA 2QROA 4KAXA 3HU2A 4Q4LA 4P32A 1FQKA 4TMVA 2DY1A 2JLQA 4EPTA 1R0XA 2QI9C 4PC2A 1FTNA 3BFKA 2VYFA 3QPVA 4NP6A 2GXQA 4OI4A 4TQAA 5FUWA 4A2QA 4B48A 1KSJA 2C99A 2WWXA 3CF2A 2IYYA 2QMUA 2JA1A 2IL1A 2PT7A 1G8YA 1G3IA 3WXMA 4Z8YA 1T8TA 1LF5A 2J5XA 2W0MA 3W34A 2YOHA 3S1AB 1S9DA 2MSCB 2ZAOA 4HSEA 4TMKA 4POAA 1XCGB 2OXCA 4A4DA 3VQTA 1W4BA 3SQXA 4OYHA 3BOSA 1WBBA 2IYRA 2GXSA 2OZEA 2WTUA 1TUIA 4PC1A 1CF4A 4JLJA 1DAMA 1IN6A 1V43A 3O8DA 2H57A 2BCGY 3ADDA 2G6BA 3L0SA 2GWHA 4PO1A 1X3SA 4B6FA 2JLWA 3HU1A 2IXFA 2VRWA 5IF9A 2FA9A 2CE2X 1G8GA 2HEIA 3QY0A 5BYKA 1E2PA 3QKRB 1ZIOA 4PX9A 3SHFA 3LLUA 4A1FA 1G9XA 5FI0B 1JJ7A 3BB4A 2WKPA 3VHLB 3TK1A 4IDNA 1OH6A 2XJ4A 4LC1A 4PPGA 1KK2A 5TARA 4BLQA 1M6NA 5E4FA 4G5QA 5UKDA 3GLHA 1GNRA 1Q22A 2K5UA 4HDOB 4JYCA 3ZVMA 4MKGA 4RD1A 1C9KA 1Z6TA 2NO6A 4PANA 4FI3C 3CUEF 5GADl 1I2DA 2CNWD 1EGAA 3BFXA 3CRMA 4MUBA 5CJ2A 5KO2A 3C8UA 1E0AA 3QBVA 3ND8A 4JLNA 4W9MC 1CP2A 3NH6A 3B5JA 2CLSA 3I92A 1VG8A 4A8JC 3K0SA 2QMHA 1XTJA 1RC8A 2ZEJA 1E79A 2JLRA 5BN3A 4BFTA 1E4VA 2R6GA 3IEVA 4TYQA 3A6PC 2QORA 1U8YA 3Q5EA 3ZLJA 1S96A 5FR1A 5E7IA 4Q4HA 2G1KA 4F4IA 1A7JA 1S2MA 2YV5A 3OIYA 4ZKEA 3V00A 4OL0A 2N1BA 5G41A 1L7VC 4URUR 4K81B 1XZQA 4M1WA 4R2HA 1W2HA 4MKIA 5KPJA 1E2LA 3CZQA 4NPHA 3A1WA 3IIKA 4GFDA 4PHGA 4B73A 1OFIA 1OHHA 2AXPA 2J41A 3K70C 1ZNZA 1G64A 2WWIA 1KYIA 2W6IA 1ZC4A 2DBYA 2WV9A 4C2UA 1E79D 2ASEA 1Z0KA 4PSVA 2H8KA 2N46A 2FOLA 4XTRA 1MRNA 4L16A 4MRNA 1VECA 4BFVA 4JS0A 5JCZA 721PA 2UZ3A 2A30A 3SFZA 3T5DA 2HT1A 3AVXA 2IS1A 2D7DA 1ZD9A 1E2EA 4Y0AA 4PC3A 2YKGA 2PMDA 2VA8A 2DWQA 4TYNA 1UFQA 4TTPA 3OFND 4B6EA 3NXSA 2ZQ5A 2WWFA 4L9SA 3SJZA 5H1YA 1CXZA 4PPNA 4WAUA 2DFLA 2X2EA 5D3MA 5FBLB 4P4TA 4XSHA 2XZPA 2OSBA 4NYIR 1II8B 4Q4AA 4DLYA 1UJ2A 1F2UB 1XZPA 4JIMA 5EXTA 2OAP1 3ZYCA 4OI1A 1YU9A 4HI0E 2HUPA 3T15A 3W90A 2VHTA 3SBEA 3WBJA 4EUNA 3WY9A 5EUMA 2G1JA 3NH9A 5JBQA 1P62B 5JJLA 1CJTC 3BWDD 2PT5A 4Q9HA 2PBRA 2VSOA 4Q4AB 3QSYA 4S2EA 2ZE8A 2FMXA 3LBIA 4AYTA 2R9VA 1GKYA 4O0MA 4OQLA 5TXGA 1AZSC 4RFSA 2FSHA 1CJKC 3W6NA 3ZS9A 5C4MA 3I4LA 2C9YA 3GLGA 2PZGA 1TUEA 5AUNB 2J0VA 3NEJA 4IW3B 2PZEA 5CK4A 4JYBA 1M2OB 3U2QA 5H70A 1R5OA 2R65A 3OIUA 1H8EA 3TVTA 3LW8A 2ZSDA 1D8TA 2FV8A 2QA5A 3SZRA 2C98A 4MRPA 4BFYA 4DHEA 3AP2A 3SU8A 1M7GA 5KDDA 3AKYA 3GLGB 2FFBA 2WJHA 5KSZA 4KFSA 4LJ7A 1Z8FA 1DAEA 2QE7D 2VTKA 4CGZA 1CU1A 2FF7A 1DAKA 4DCSA 5HKKD 3LV8A 4C2TA 2Z43A 1GL7A 2B21A 3CX7A 4H1VA 4RCYA 2C03A 1G6HA 2EFGA 2OILA 3U60B 2XGJA 4G5SA 1F2UA 3CNNA 1KKMA 4AD8A 3VTKA 3I3SR 4D0LB 4BFXA 3SR0A 1U9IA 2ZRAA 3AVQA 3AH8A 2H5EA 1AZTA 3TVDA 3AGQA 3B8HA 4MGZR 3RWOA 1G8HA 1T3LA 4HAVA 4KYUA 2QRZA 4L5BA 1W7AA 4E09A 1MOZA 1NVWQ 1YZNA 2ZE7A 4TL8A 1GL6A 1ESMA 4HAUA 1MT0A 3RRNA 3K0FA 3U4QA 1UDWA 4LYJA 3THYA 3DDCA 1S1CA 3B1YA 1FUUA 4NU0A 2YC4C 4ACAA 4PSAA 3U3JA 2IK8A 3NC1C 1KO7A 2E9SA 2P67A 1OFUX 2OAQ1 3ASZA 4UNRA 1L4UA 3KUDA 2H18A 5LD2B 1N6IA 1IY2A 4NCKA 5GVRA 1NY5A 1AM4D 2ONJA 1IM2A 1R8SA 1NMZA 2OE2A 1KI2A 1IXRC 2HT6A 4LC0A 3K70B 2HYIC 4URXR 3KXKA 3FVQA 4PAQA 4AKIA 2WAXA 4IJMA 2ZREA 2WHXA 1E1RD 1E9CA 1X6VA 1X86B 3UG7A 2VEDA 2BC9A 1ZM4A 2ZUDA 3WNDA 4ZPXA 4CYMA 2XZOA 3I62A 4JSTA 1R0ZA 4OK6A 3CONA 5IK2D 3F0TA 3VMFA 1TEXA 3FMOB 5HZHA 5JEEA 2WKRA 2Q9AA 1DS6A 2ZVQX 3RYTC 1E94E 1TAGA 4JLMA 1G17A 4QJ5A 2RGGA 5L8VA 1IN4A 1ZIPA 2CEAA 2JIZD 2ZRMA 5F3WB 4C7OA 2O8EA 4F7WA 1Q1ZA 2PJZA 3HP1A 2YC2C 4DLVA 4BUJA 4US2R 3LBHA 2WWGA 3GJ0A 4PAMA 1SXJA 3K0CC 3FWYA 3N2IA 3HWSA 1E0SA 1G5PA 5EZ5A 4V0OA 3QE0A 1OH5A 1ZM7A 2QT0A 1Z0JA 1H8HD 4OJKA 5JSZA 3PG5A 1MKYA 2PX0A 1MRSA 1W4RA 4B75A 4EQ6B 2EW1A 2CHQA 2QMEA 1KAGA 3Q72A 3T35A 3I32A 1JPJA 2ZUBA 4QJ3A 1VYVA 3PEVA 2R2AA 5AUPB 2J59A 1IN5A 3B78A 1YQTA 1OIXA 1VIAA 5K8IA 1PLJA 1X1RA 5C18A 3R8FA 2BMEA 1QF9A 4XIGS 2ZETA 4QBFA 3T1QA 2HF8A 1GNPA 4KVGA 2QENA 1WCV1 4QC2A 1HT1E 4MKHA 2GCOB 3K0EA 1SVIA 3LD9A 2KBFA 4D80A 3OFNA 1XD2B 2QG6A 1JECA 2O5VA 3REFA 2A5GA 3T1VA 3ZIAD 3RC8A 3Q3JB 2LWIA 2GCOA 2CK3A 4YONB 1RRGA 4DEXA 1WMSA 2Q6TA 1KJYA 4TLCA 4UJ3A 3ZQ6A 2ZR9A 4EIWA 3W3AA 4M1KA 4Q7MB 3EZ6A 2V55B 2WBLC 3RWMB 2ZJOA 4ZO4A 3U5ZB 1XXHB 2NTYC 2XAUA 1H8ED 4NYMR 2D06A 3OAAA 3KJGA 3PV0A 2ZR0A 1S3SA 2F3RA 1DE0A 1F3OA 4DIDA 2P3SA 2QTHA 2BEKA 2OCYC 3LRPA 4JL6A 1SZPA 3NDPA 4ZCMA 2BCJQ 5EE1A 1FP7A 4BE7B 4IFEA 1Q0UA 1YR7A 1R8QA 4NL4H 5AJZA 1VCNA 3M4YA 4A92A 4EJSB 2OFWA 4PHFA 1MABA 4V0ME 2CLDX 5JI3E 5BQ5A 5FUXA 2DR3A 1A4RA 1J8MF 4I81A 3TW8B 1WBDA 3I5YA 4FWTA 3LXRA 5FOWA 5IHPA 1G5RA 1G6OA 4N1AA 1KI9A 3TJZA 3TNFA 5DHAA 5B58C 4M4SA 3EA5A 2QTVB 4DLWA 4EPXA 4QNRA 4JLKA 3FB4A 1CR1A 1XX6A 1UEJA 1Z63A 4OQNA 2QGZA 2MMGA 3AVPA 4I1SA 2F9LA 2XEXA 1XMVA 2P6RA 5AJWA 1UDXA 2JLZA 3CR8A 3KXLA 1SKYE 3QXJA 2WPDA 2ZYVX 4M8NE 2FJUA 2NO1A 5CITA 1NSFA 5DYIA 4CDGA 3WHKA 2BMDA 2ZJ2A 1KO8A 1R5BA 2ATXA 2OXRA 2XB4A 5SZKB 1EX7A 4ZDKA 2ZU0C 5FFMA 2C2HA 1EFCA 4JVMA 5A5GA 4TWZA 1IY1A 1UKEA 2A78A 4ZV4A 2ZI4A 1FPMA 2FFQA 3NWJA 3BFVA 4PHHA 5B30A 4JLDA 1LV7A 1G3MA 2GJKA 1MH1A 4Q47A 2ZIAA 2FH5B 4Q4JB 4U7DA 3LX8A 2MSDB 3H86A 4W5HA 4E03A 3U6KA 4B3XA 3LH5A 2E87A 4EAQA 2WICA 2O8FB 3LFUA 4XOIA 1ZM9A 4HB2A 3BD9A 1E2JA 1SXJC 3K0CA 2NO0A 1G1MA 4IVQA 4B44A 3VHXA 1JQJC 2JIZA 2GEDA 3A1UA 1EG7A 1GG2A 4RFSB 3PJRA 2N42A 3LY5A 4AKHA 2EFCB 4EKDA 3AGPA 1AKEA 1VTKA 1KHTA 2C78A 2EU8A 1EFRD 2UZIR 5EQTA 2ANBA 2EFHB 2B8TA 2ZRFA 3GLIE 3BB1A 1TTTA 3NDBB 3EARA 2C8VA 4TQUS 1VG9B 2ZI7A 2XSZD 2PL3A 1G4AE 1E1QD 1TU3A 4QGHA 2XB2A 1A2BA 5L3SB 4S35A 1ZMXA 3U3OA 2OCAA 4MUAA 2HDNB 4C30A 2FEOA 4ACBA 1A1VA 1YRAA 4GNKA 1OF1A 2WJVA 4HDCA 3KKOA 2J1LA 1NBME 1NIJA 2CMKA 1KI6B 3WYGA 3NKVA 1CEEA 3K9LA 1OXVA 2CCGA 4V03A 3KZ1E 1CRPA 2NPIA 1AKYA 2D74A 4WW0A 4XTCS 3KFVA 1AGPA 1P2SA 4UNNA 2JJ2D 1ZNWA 1R6BX 1UKYA 4QG7A 4YMUA 3TIFA 2GZHA 4FXPA 2BWJA 3MWKA 4IVRA 1TQ6A 2ZROA 4LBWA 4W5WA 4NYIQ 2DB3A 4DUGA 4PC7A 2ONKA 3J81k 2VHQA 3T5GA 1W5TA 3U7EB 1OH8A 4DBLC 3NC0C 1VHTA 4XD7A 2O8BA 1M1YE 3UWKA 3QKSA 1E2MA 1M74A 3IBYA 4Q9KA 3AKEA 5DIFA 3VAAA 3PEYA 1KJWA 1L2TA 4P4UA 4A36A 3KKPA 1J2JA 2F3TA 4QGGA 1OYWA 5H68A 3M1IA 1Z08A 3ZD7A 2IYQA 5TVKA 3LBNA 2O52A 4OK3A 4CEHA 4NBSA 2AK2A 4BFUA 4BWYA 2W83A 4BFZA 1UBFA 5HR5A 1HE8B 4TZ0A 2J7PA 4ZIRB 2A5YB 5JSZB 4GZMA 4HAZA 4JVSB 2R6FA 4EFMA 4XH9B 1YHNA 4C3ZA 3AF4A 3WYAA 1TF2A 3KQHA 1P9RA 4PPQA 1S3GA 1P9WA 4GP6A 4KFUA 3QKRA 3LDAA 5TDHA 1VYTA 3THWA 1X8JA 3WBKA 2AWOA 5G40A 3DZ8A 5FL7A 4AURA 3RC3A 2O0HA 1OYYA 5BN4A 4K8OA 4C4PA 3VU9A 3B7GA 3P20A 2IUTA 1G8PA 5HTKA 3EWAA 1E0JA 2CL6X 4R9UC 3CBQA 5DI3B 3O47A 2REOA 3V4FA 3B82A 3DHWC 2ZS7A 4PQYA 1WB9A 1RJ9A 3DKPA 2JLYA 2ZJAA 3DMDA 5FUYA 4RKFA 3H4MA 3VKWA 3VR2A 1JXOA 1R0YA 1EESA 2F43A 1OIVA 2A2ZA 1OXXK 4RY2A 3MJHA 2CBZA 1N6OA 1XJCA 2WKQA 1I4LD 1Q3HA 2REBA 2AD1A 2VH5R 3FTQA 3RS3A 4D81A 4IVPA 2G3YA 5C4GB 1NBMA 1BMFD 1NNEA 1JR6A 2GDJA 2BKEA 2FE4A 3U44A 5J4KA 3MLEA 3TLXA 1QHIA 4DSTA 3VKGA 1Q44A 5L3QA 1T8UA 3PCRB 4IKEA 2ZRBA 3QKTA 4AWXA 4CRWB 1W48A 4FMCB 5GJVC 4TQ9A 2GKSA 2IBMA 1TQ4A 4PHTA 4LYHA 1ZW6A 2R44A 2B8WA 4XVQA 3QF7A 3ZGXA 2QEQA 4JBYA 4UNSA 1GRQA 2HLDA 4ZKDA 1KI4A 4UKDA 1UADA 4WXPA 4OI2A 2KSQA 2V3CC 2HCBA 3F5FA 4P33A 2W2XA 2F9MA 4A8JA 3TRFA 2O8BB 4KHZA 4KV9A 1P60A 3PUXA 1E96A 1OV4A 1TADA 2C5LA 4F4JA 3B85A 3S1AA 4X8HA 3CM0A 1O3YA 3A37A 1IQPA 1FMJA 1QDEA 3GEIA 4Q19A 2A5FA 1RFLA 3ZIAA 1KTVA 3A1TA 4A0GA 3RAPR 1HT2E 2BBOA 2VSXA 5TB5A 4YQFA 4KO8A 1NVVR 2PMKA 2IYWA 4ON9A 1DAIA 1JI0A 2YJTD 4Q18A 5KOYA 2NO7A 3F8TA 2IYLD 3HPRA 1EX6A 2ZI5A 3RNLA 3UATA 3QVUA 2PX3A 4HLUC 5DNYB 1C1YA 1NN5A 1R10A 3DO6A 4PXAA 1FP6A 4PZLA 2D7CA 3QQ5A 3TR0A 5CB6A 1RRCA 1ZUNB 1Z06A 1Z22A 3AV0B 4OJQA 1OB5A 4HDQB 2W6JD 3ECCA 3EG5A 2P6NA 3SYLA 4O2RA 1DELA 1Z2AA 3OZXA 1NIPA 2QQEA 1WRBA 4LGMA 5JEDA 1TQDA 4B3CA 4RD4A 2PEYA 3JVUA 4BEBA 1P3JA 3JVVA 2I3BA 4M9SA 4Q00A 1QVRA 4LV6A 5FTJA 3T1TA 1ZNYA 4NTZA 5D3MB 5FPSA 1L8QA 2F55A 3KFXA 1NG9A 4BFWA 1ZVQA 3UWOA 3EW9A 4EDHA 3QG1A 1MO3A 3QXHA 2EFDB 4JBWA 4TLEA 1DO0A 1KDPA 1PUJA 3M6AA 2DWOA 3EPKA 1E9RA 3KJHA 1E99A 2XNDA 1OLOA 2WMOB 3THXA 2EWVA 2RH5A 1XBTA 5FBWB 3FHOA 3H0KA 1QHYA 4B74A 3VU9B 3KJIA 4JSYA 5B64A 121PA 3GLHE 5GJWC 3VR6A 4EPVA 1A2KC 1KI3A 1LW7A 4Z8XA 3GPLA 4TT3A 4ZCLA 1G19A 1SQ5A 3T34A 2Q3MA 2B92A 221PA 2ZU6A 2RKOA 1GWNA 2QP9X 2OFXA 3K0AA 2P65A 2J46A 3O8BA 1XTKA 1Z0IA 2Q0HA 1JB1A 1Q1QA 2J0UB 3BAFA 1DADA 5JWOA 1RE0A 3L8YA 2FDCA 2F43B 3GCGA 3MWJA 5DGXA 2FGKA 5CLLA 1TX4B 4DJTA 4NCNA 1W36B 2XITA 1EXMA 1U94A 1J8YF 4CT4B 3ADCA 2RB4A 2FGJA 3CR7A 3FE2A 1SULA 5FBRB 4TYPA 4QL3A 1E98A 4BECA 1DAGA 5DI3A 5TV2A 4Q7KA 4ZI2A 2Z0MA 1W5SA 3HU3A 4KLZA 1WE2A 3BC1A 4GBMA 3DPUA 4OHVA 4TLAA 3TR5A 2XNDD 2KBEA 1F48A 3REGA 2RGDA 3R9XA 4LHYA 3QEJA 2OBNA 4HLUA 3C41J 3WP0A 1X1SA 3BERA 1Z5ZA 1FMLA 2C04A 3X1DA 4HAWA 1NN0A 2AKAB 4KCGA 1YZQA 1ODFA 1W0KD 1JR3A 3KKMA 4JT4A 5FOTA 1Z6YA 2XTNA 3CB4A 4ITRC 1ZUHA 4US0R 3AKDA 1GOTA 1K5DA 4NMMA 4WA7A 2DFTA 4KSBA 1NLZA 4TMWA 4IOKA 2PCJA 3TUIC 5C2JB 1XCPA 4BLOA 4ZIRA 4DCVA 1E2FA 1ZNXA 821PA 1W4CA 5KDOA 2ZRNA 4JLVA 4YMWA 1OKKD 1XJ0A 4C0BA 2QU8A 2WIBA 3CPJB 4CW7A 5KU1A 3GLHB 2GHIA 1I2MA 5DISB 1RW4A 4JVLA 4AC9A 2CVHA 4TSFA 3EZ9A 4YXWD 3ADBA 2LKCA 2WPDD 1PJRA 2J3EA 2V6JA 1KNXA 4FN5A 4AY2A 3ZVLA 4V0NA 4CZ2A 1JR3D 2NOAA 2VP2A 2WOJA 4ILEA 5L3RA 1US8A 1E9BA 1QHGA 3EC1A 2QBYB 3AF2A 2ZS9A 1Z6XA 1II0A 2DYKA 2B7BA 1Z6GA 1KY2A 4ABYA 3M0EA 2CHGA 1A82A 4LSGA 3X2SA 5HPYB 4QGAA 5J4HA 4URYR 1SKQA 2D4HA 1OE0A 1G5TA 4KBGA 4DIEA 1AS0A 1OT3A 8OHMA 4M9QA 4LHZA 1NI3A 3BE4A 1KZGB 3K09A 1XPRA 4N0EA 3C16C 3OF5A 1IONA 3IILA 2PEZA 3IHWA 4DSNA 1Z0FA 3AM1A 521PA 2QP3A 2ZANA 3ICEA 5B57C 1DOAA 4AYWA 4TSFD 4YXWA 4DDVA 4PZYA 1KK3A 2CNWA 5HCIA 4QM7A 1N25A 1LTQA 4Q9JA 3DZDA 3AUYA 4B2PA 1R4AA 1ZD1A 3P26A 4IXNA 4FD2A 3SYKA 2WVJA 4D4JA 5CDFE 3WYFA 1P73A 4DZZA 3QF4A 3G5UA 3FMFA 1TPZA 4YDSA 4UNPA 4LJ6A 5GJBA 1D2MA 2FPKA 1XTQA 2O8EB 1KJZA 2IF0A 2LCFA 1VDZA 3SNHA 1G21E 3VNUA 1EFUA 1XDBA 5J47A 4Z1MA 4MQBA 2IWHA 4OQFA 3PIRA 3OEED 4LPSA 4LBZA 4TL9A 4B2LA 4O3MA 1D9ZA 2ZRJA 4OHZA 4KLNA 4QHTA 1FL9A 2GJ8A 4JLAA 2C95A 2CCKA 3NBZC 1YZGA 1XEFA 4BGDA 3N5CA 1KO1A 2XZLA 4A6XA 4EPYA 2A7QA 2QE7A 1XD9A 3IHLA 2ZJZA 3TSZA 4DLSA 2AFHE 3SOPA 1T0HB 3WRYC 4YMSA 4J0QA 2FSGA 4UNQA 2Q21A 3R9WA 1QHXA 1QHHB 3W8NA 4RZ2A 4UJ5A 4FIDA 4F4CA 4RVCA 1COWA 1MR3F 1CR0A 2ATVA 3VR1A 1K5GA 3CIOA 4BLSA 2PH1A 2GXAA 1JEEA 3RVBA 3U3MA 1W0JA 1OHHD 4B71A 1T9HA 3G0HA 2GK6A 2QAGA 4GZLA 1BO6A 3I5XA 2W6ID 4A9AA 1E2HA 3W5IA 3OIVA 5KSPA 1VG0B 2Z5FA 3Q8XB 3I72A 1GVNB 1CIPA 4H1UA 2IWRA 3RRYA 2IYSA 1YJ5A 3FFAA 2YVUA 3OIWA 2FWRA 4OBEA 1ETUA 3PUZA 2ODWA 4A15A 4HZUA 2ERYA 2BEJA 3WMFA 2OG2A 1T6NA 3UG6A 3KKNA 2OV2A 2DFNA 3GFPA 5J4LA 3FKSD 3CRVA 4A0FA 2AK3A 2ZITA 1GFIA 2YWEA 4R98A 4QRHA 4MYCA 5J4VA 1ZC3A 3IBGA 4OK5A 1IHUA 5CIQA 3KJEA 4Q1CA 1LS1A 3BK7A 2YOGA 3ICQB 4KU4A 4CEIA 2O0KA 4LHWA 5LBIA 1M8PA 3EIQA 3B9PA 4NZYA 2BOVA 5DSZA 3ETLA 3KB1A 5KSOA 5FPYA 2GESA 2VLIA 2F1HA 5AJXA 3MRSA 1S0UA 5L3QB 4N0DA 1D2NA 1AN0A 2DHRA 3UMSA 4XVUA 2RHDA 1F6BA 1NG1A 4DB2A 1KI7A 1P2UA 2RGCA 2XOKD 3CPHA 5JMTA 1CR4A 4NCHA 3MGCA 2V4ZA 1XCMA 4Q1DA 4PO8A 3GFOA 2RAPA 4QNMA 1NLFA 2JGNA 2OCBA 3U3RA 5EXXA 3W8RA 3X1XA 2OLKA 5FOXA 5EE9A 4GOKA 1QHSA 2TMKA 1SVMA 3BRWD 3DM5A 4XJXA 1G7TA 4IOJA 3V9PA 4CT5A 4IDHA 3C14C 3NHAA 4FMDF 1SVWA 2BM1A 4JL8A 2V9PA 4G5OA 3QXXA 2I1VB 4IDOA 3SBDA 1DARA 3QXCA 1P2VA 1US8B 3GLFE 3WNCA 1ZAKA 4ARZA 1TF5A 4B76A 5DN6D 3D7MA 3I8SA 1DO2A 1ZCAA 2FFAA 2FSIA 4GI7A 1EFRA 2QAGC 3BIFA 4KXFB 5BYJA 5EZ6B 3BB3A 2ZYWX 3C4JA 1N0VC 5KHOC 2RGXA 4TYWA 1YZKA 1KKLA 4HB4A 2AWNA 3FDIA 1ZBDA 4DCNA 3RSLA 2JAQA 2WJJA 1HEIA 5G3YA 1N6LA 1F2TA 2H1LA 2P2LA 2CK3D 4TL7A 5JLJA 5JS7A 2ZPTX 1XWIA 2V1UA 2I1QA 2ZM5A 1XTIA 3L8ZA 3GEEA 3NEYA 3TW4A 4I1OA 1DG3A 4HLDA 3PUWA 2BIFA 1Z0AA 2HF9A 1SXJB 3VX4A 5FUVA 2Z6VA 4Q5IA 1XTRA 4FMCF 4ASUD 4IDQA 3DM9B 1ANKA 4L8GA 3EC2A 5EXSA 2G88A 3CWQA 3GFTA 1ELOA 4MKFA 4RKEA 2AL7A 2QT1A 4UQOA 3X1YA 3FMIA 2ZJ8A 1I4DD 4LPKA 2JJ2A 5K8LA 2CE7A 1WXQA 1E2NA 3QOFA 4F93B 4CEHB 3CX8A 3Q85A 4DDUA 4A0HA 1N6KA 4NONA 2FSFA 5AUQA 3AF1A 2OBLA 3K53A 3A8TA 1FZQA 4B35A 3TGPA 4DT1A 5CYOA 5EJEA 3MAAC 3RSOA 2YZ2A 3VR4A 3AVVA 1E9SA 4OHXA 1SHKA 1GKIA 1O87A 2VPPA 3CLVA 4DDTA 4A2PA 4BLTA 4BEJA 1W0KA 3OEHD 3Q7QA 1NJGA 1BS1A 1RRFA 1N0WA 4JJKA 2V1XA 1ZCBA 1XTSA 2ZRGA 4DXAA 4C9BA 5JHHB 3UPUA 1ZYUA 4HATA 4LYFA 2EYQA 1FNMA 3ZZUA 2GVZC 1LY1A 4MGIR 2GAAA 5IK2A 1ZU5A 1Q3TA 3RABA 1DG1G 1KK1A 1RYHA 3C5CA 4Q21A 4LBYA 4PFSA 1K6MA 2YNMA 1EWQA 3AQ4A 1JBKA 2JASA 1AS3A 1YVDA 2OLJA 2XNSA 3EZ7A 4JT2A 1R2QA 1AA9A 3TQFA 4PZZA 4I1UA 4Q9LA 5K8TA 1U8ZA 2BVNA 2FZ4A 4NCIA 3EZFA 3MMPA 1T5IA 4G5GA 4C0JA 3EPLA 2YINC 1MV5A 1FNNA 1LVGA 1NSTA 4GOJA 3D6TB 1JPNA 1XFAA 3FMPB 4B3BA 1U81A 3A4NA 1D6JA 1E2QA 1U0LA 3K8YA 2F1IA 1T3HA 3AB3A 1FUKA 2QNRA 1G7CA 3HJNA 3KTAA 1DBSA 1QHHA 1MO4A 1S4QA 2KWIA 4JVNA 1NMXA 1T3SA 2HJVA 2X77A 1BOFA 3BJIC 4Q01A 4E22A 1NVVQ 1AQYA 4MYTA 4AK9A 2ZE6A 2WAYA 3THXB 1Y3AA 5FL3A 4C0AC 2REXB 4TYYA 4LJYA 2D2EA 2ZJBA 3Q9LA 1KSFX 1N5KA 4DDWA 2AKYA 4TT3D 2H16A 4GMDA 1XEXA 3W6PA 4GSYA 4QHYA 3B1XA 1KGDA 2PZFA 4M1TA 2CJWB 3IQXA 4X8LA 5HZKA 3G82C 1HH4A 1K8RA 1OIWA 3L2OB 1N6PA 1BKDR 3MCAA 4BFSA 4L4UA 3IGFA 5FOVA 1PZNA 5JI2E 2KB0A 4QBIA 1E6CA 1Z29A 1KOFA 1KDTA 2FZLA 5LD2C 2XJ9A 2DPXA 2FNAA 2R6CA 3MJRA 4JLOA 2QUZA 1G20E 4M22A 1E32A 4Z54A 3LWNA 4O2LA 1PV4A 1NKSA 2GF9A 2JATA 4XSGA 3HR7A 3UMFA 5KTYA 2O8DB 2ZRCA 4ERNA 3TKLA 1NRJB 2IXEA 2P5SA 4RCZA 3D3QA 4KYIB 5DI9A 5FPTA 1CJUC 3AEZA 4DRZA 3GLGE 2FX3A 2QAGB 3QVVA 1LFDB 4RD2A 3RS2A 4FWIB 1NF3A 3KDSE 4I4LA 2IYUA 4CEIB 2IS6A 2OO7A 3CWZA 3KB2A 2D2FA 1N6RA 3K9GA 3LVRE 3T06B 1IJEA 2AXNA 2ZUCA 1OFTA 1EK0A 2PJRA 1VCOA 3ZQJA 3P4XA 2DWPA 4UXJA 4H9GA 2EWWA 4AIIA 2YHSA 4W7SA 4F38A 5AK0A 4NYMQ 4GP7A 1RJ9B 4WZ6A 2WZQA 1W0JD 3AVOA 2J0QA 3DOEA 2GRJA 1LNZA 2IHBA 4B3DA 1E1RA 4EFNA 1J99A 4OI0A 4NH0A 2QN6A 4R2IA 1E2KA 3EIHA 1F60A 1Z3IX 4ZDJA 2HXSA 1QRAA 1QG2A 1T5LA 4YMTA 3ZD6A 4B3FX 2ZSFA 1FOEB 1NY6A 5IDVA 3SHWA 4V0MA 3Q5DA 3U44B 4WZAE 3IO5A 1IXSB 2FU5C 3KQUA 2QPTA 1FW6A 1MABB 4C0KA 4DLXA 2AD5A 3TSOA 4A0RA 1GM5A 1UBCA 4TZ6A 1NVXQ 2QSZA 3TAHA 2X19A 3B1WA 4MGKR 1ZM3A 2ORWA 1D5CA 2VF7A 5DH9A 2IYXA 2HCJB 2HJGA 1HE1C 1GDDA 2QRNA 5FR2A 1XPOA 1OFHA 2YWGA 1KAOA 3HDTA 3GJ3A 3AVWA 1P5ZB 4N3NA 5JRJA 5KYKA 1OKKA 1X8KA 1OW3B 3PUVA 2Y8EA 1E69A 4JLPA 4LWZA 1XXHE 2H92A 3W5JA 3EX7C 5EE5B 1G7RA 2VIIA 1FX0A 4ASUA 1CJVC 4HAYA 2R62A 4M1MA 3JZAA 4GT1A 4GRAA 1YR8A 2A5DA 1XU4A 1IJFA 3HPQA 4PO9A 4M9ZA 2FPMA 1XEWX 2JJ1A 3OE7A 2R6AA 1P7CA 2QQ0A 1ZUIA 1XMSA 3H1TA 4P4SA 1E2DA 4LHXA 4HUQB 5CM9C 3CW2A 3B6EA 1ZJ6A 3QNUA 4Q9IA 1N5JA 3GMTA 2GZDA 1BYIA 3THWB 5L3VA 2ZXUA 3SN6A 2XSZA 3AF0A 3IQWA 4DKXA 3KKQA 2Z4RA 1Z28A 4M53A 4RZXA 2NMVA 1N6HA 2MMCA 3FHCB 2IEYA 5ELXA 1U99A 2F1JA 2J0UA 2GEVA 2VHJA 1N2CE 1AGRA 1M7HA 1W4AA 3IO3A 2OESA 3IKJA 1RYFA 4HUQA 1CR2A 4LJ4A 2Q3FA 5EXPA 1DVRA 2GJ9A 1MO5A 1GL9B 1JQLB 2IEZA 3MWYW 3PITA 2LKDA 4JJZA 3AF3A 1KI6A 2DCUA 3CKLA 1JEDA 3U4QB 4X8OA 1OB2A 4URWR 4HZIA 3QKSB 4DSUA 4D2IA 4DLZA 4DB4A 2Q3HA 5FTMA 5LB4A 3GJ5A 2ZRHA 1KO5A 3ND9A 1E3MA 3P32A 1HV8A 1TU4A 2JJ1D 3NIBA 1XD2A 2PLRA 3RLFA 1XPUA 3I73A 4GOXA 1AIPA 1TMKA 3EIEA 3O8RA 4BRWA 1IY0A 1CJMA 3OHMA 3PUYA 3PVSA 5CJPA 3TQCA 4NYJQ 2DFKB 2GJSA 1IN8A 4PQFA 4IFBA 3WRXC 2ZR7A 1OH7A 3AVUA 4EFLA 1XMIA 3QXSA 2OEPA 1U98A 2GETA 4OKSA 4BRUA 3LNCA 1KI8A 5F2EA 1D9XA 4QOSA 5DLQC 3SJBA 4D4MA 1E0KA 3N2EA 4CF7A 3PENA 4LI0A 4QHSA 2CCJA 4GPTA 4B32A 2JDID 4TLDA 1Q1EA 2F6RA 5J5CA 5JWRA 1GUAA 3B9QA 3X1WA 1J70A 3EPJA 1P9NA 2VF8A 5J4YA 2AN9A 1H65A 2RCNA 3LA6A 3VX3A 3GLIB 4D82A 4RD6A 1E9FA 1RVDA 4D6PA 1BH2A 4I1VA 5DE3A 4QGFA 5IT5A 3U61B 4KSCA 2V7QA 3SC3A 1GTVA 5CB8A 4MDFA 3EA0A 5SZJA 2ZTSA 4DSOA 3THOA 4EPWA 2GTPA 4B47A 2XXAB 1XMJA 4PC6A 5CK5A 1QHNA 3CF0A 1Q57A 1U2RA 5A0FA 5K8UA 1UM8A 2OFOA 3LLMA 3B1VA 3L0PA 4FCVA 2A9KA 2VL7A 5E7JA 5EP1A 4JMPA 5FPHA 3DVLA 3SI7A 3PFIA 4RSGA 3U7FB 1SVOA 5EE0A 5HKKA 2D3WA 1QVAA 3QJYA 1L4YA 1HQYE 4TMXA 2ZI6A 4OQXA 1LF0A 3TMKA 1BMFA 3SS8A 2W58A 4Q1EA 2JLVA 2Q9BA 4RFVA 4IEIA 3U7GA 3FHTA 2P0EA 4FCTA 2FN4A 4YMVA 2KE5A 3SDZA 1VIYA 3ASYA 3U7HB 5JJIA 4D4LA 1NJFA 2J7KA 4AKGA 4TMTA 5IRCD 2WSSA 3QPUA 3WMGA 5EE3A 2CL0X 2WIAA 4Q1BA 3GLIA 1J7KA 4AI6A 3GD7A 3K0FB 4FW9A 4D0NA 2IW3A 4NCJA 2W2TA 5P21A 1RRPA 4W5JA 4XD7D 1OXTA 1I4TD 2RGNA 2ZRPA 3LQRA 5J40A 4D25A 1N5LA 1P61B 3NHBA 3ZDQA 4CEJA 3ZZ0A 1E9DA 2BKUA 2IYZA 2OBMA 3H2YA 3EXAA 4A82A 4FMDB 2V6IA 2ANCA 1HTWA 1NN3A 1XD8A 4LJAA 4PPFA 3BBPA 2V7QD 3DOFA 2YOFA 1GRNA 4BPBA 1IXZA 3UK6A 1NLYA 1YR9A 1IN7A 3PR1A 2NPFA 3K9HA 2WMNB 4Q7JB 1PVOA 1AJEA 2ZRLA 2PLFA 2QSYA 1G3RA 1GAJA 5F9FA 2IA5A 4QJ4A 3ZVRA 2FPLA 5KSYA 3LQQA 1Y63A 4HB3A 5SZIA 4P0TA 4DT1B 1II8A 5CLQA 1SXJE 3MWLA 2O8FA 4EPRA 2XTZA 3B1ZA 1S9HA 2IYVA 1Q12A 2OT3B 4EJSA 1XRJA 3MG9A 4I99A 1DAFA 2OUKA 4QKQA 3MSXA 1WDTA 3L43A 2KI5A 6Q21A 2OHFA 4AYXA 2PCLA 2VQSA 4NDZA 1U0JA 3NG1A 2UKDA 1HURA 1W49A 4LK2A 2J45A 2QM7A 2BHRA 3VR3A 1XB2A 4TLBA 5FL7D 4LUCA 1WP9A 2RGAA 2ODNA 5G53C 2JLUA 2A5JA 2NGRA 4M21A 1Z6AA 1HYQA 4HLQB 2IUUA 4IHQA 4WOPA 1GZSA 4DCTA 1B23P 3GLFB 1VKJA 1KK0A 4BLRA 4OQMA 3TUJC 3RS4A 1QG4A 2AR7A 2RGEA 4IOMA 4Q4HB 1XXHA 3VKHA 1GRRA 1KMQA 2WM9B 3AUXA 1T91A 5FTNA 3R7WB 4II7A 3GJ4A 4LX0A 3HYTA 5DYGA 2R6DA 1GNQA 4TN1A 3WP1B 3UIEA 4B33A 4HB0A 4KFRA 1OXUA 3GEHA 2QAJA 2BJVA 3LAWA 4LCBA 3RANA 2H7VA 2X1VA 2OM2A 621PA 2VHUA 3QKUA 3DMNA 1G4UR 4KFTA 4PSKA 4C0SA 1SHZA 2NO9A 2I4IA 3CF6R 2WWWA 1W36D 1NBMD 4WZBE 4M0LA 1IOZA 1JR3E 2GVDC 5KPDA 2ZJYA 2YWFA 2ORVA 5EP4A 4WXRA 1P2TA 4LZZA 2XOKA 1KMHB 4IRUB 3R9IA 2GCNA 5AUOB 5SZHB 2KJQA 3E70C 4P3YA 5JCPA 1U90A 1R7RA 2UVQA 4KJZA 2NZJA 3BS4A 3NBYC 4GMXA 4M1YA 1D2EA 4Q66C 2G83A 3W9YA 3A4LA 3HYRA 1NN1A 1G16A 1G8FA 1UPTA 3CPEA 2HLDD 2NG1A 1S1MA 4DUGD 5BXQC 1AQUA 4TTRA 4DLUA 4HUTA 1IAQA 1EFHA 3IDQA 5E7MA 3PEUA 4A6PA 1XJQA 1YE8A 1ZINA 3D8BA 3F3YA 1P6XA 5JFGA 1F2TB 5AJYA 1KSHA 3FPAA 2JEOA 4V0KA 4X8MA 5HE9A 2QPAA 1KZ7B 2ORIA 4HLCA 3IUYA 3PEWA 5CDFA 1F5NA 1DPFA 2YYZA 4YC7A 4Z1MD 4BZQA 3EWSA 4P4SB 3K1JA 3QUSA 1RIFA 3L0OA 3QIAA 1SXJD 1JAHA 4LDJA 4LOAA 1VYUA 4MYHA 2QY9A 4LJ8A 3N70A 1W1WA 3RHFA 3CH4B 4Q7LA 4D0GA 1G291 2IHYA 1N3BA 5BW8A 1E9EA 4TMZA 4FMBB 1IBRA 3AVYA 1KNQA 2CXXA 2QMOA 2J7PD 3B60A 3O8CA 4LY6A 5E3HA 5H8WA 2GJAA 3CO5A 1CRQA 4MRRA 2WJIA 3PXGA 4IOLA 4TTQA 3K0AB 3CH5A 3CX6A 3DEFA 4AKEA 1TEVA 2AX4A 2ZSBA 4URZR 2VP4A 1GKUB 1W47A 3AVTA 4BZPA 4NHOA 1ZP6A 4XWKA 4Q02A 2GBLC 2ZI3A 2GILA 1HUQA 1BYUA 3W6OA 4C0QC 1RZ3A 4RZUA 1AS2A 2BM0A 1KO4A 1YRBA 5DHFA 1BIFA 4C7OB 3CRQA 3RDPA 5LPNA 1II9A 1U0HC 1Z2CA 4K46A 2V8OA 1UKVY 1YZUA 1KDRA 3TUZC 1W2GA 2WWHA 4ARZB 3OEHA 2J9RA 4U00A 3GJ7A 4LV5B 5F9HA 3K9NA 4HAXA 4MYUA 5L3SA 1QBKC 1LB1B 2NIPA 2CJWA 2W6JA 3I1FA 3EPHA 4YDHB 3BORA 3GJ6A 1YR6A 4JLBA 3ZH9B 2X2FA 2XTMA 3GJXC 4HYYA 3KUCA 3I61A 4QBGB 2RHMA 1HQCA 1XF9A 3FKSA 4MA4A 4C0LA 4OHYA 3R20A 4XVRA 4RJLA 1YZLA 2IX3A 4V02A 1DAHA 1ZRHA 5BN5A 1DTSA 4BZXA 2GEUA 3TAUA 1TF7A 4HZUB 3QI2A 3FKQA 1LS6A 1S8FA 1VG1A 4O25A 1FTSA 3DKVA 2FEMA 5EP2A 2EYUA 2V54A 5JZVA 1W36C 1OJLA 5KUTA 2IUSA 3ZS8A 4JKYA 3CNLA 3EASA 2P5TB 3FOZA 3NTUA 3P1JA 4NYJR 3KQLA 3T12A 5JJKA 2VP0A 2L0XA 1Q20A 3GQBA 3T61A 1JAIA 1W46A 1DEKA 2SHKA 1WF3A 2JLSA 1VCMA 2IXGA 3P27A 4FCWA 1U8AA 2QPOA 3AP3A 3UKDA 2ERXA 4UXIA 5HCNA 2O8CA 3MD0A 1CKEA 2ZSAA 4MRSA 5FBQB 1Z83A 2P6UA 2F7SA 4M9XA 3L82B 1Z47A 4MITA 4DC9A 3EAQA 2ZAMA 2E1RA 2HV8A 4RZ3A 3D31A 2RGNC 3W3ZB 5TY0A 1PLKA 2QM8A 5JECA 4LYAA 2H17A 1CULC 1YKSA 5HE8A 1ZU4A 4ZI3A 1FFHA 2W00A 5ANRB 3RS7A 1KY3A 4PTLA 2RMKA 4GL2A 2FG5A 3P4YA 4QFMA 1WA5A 2O8DA 5KDLA 1N6NA 2W2VA 2EVWX 3ONWA 2FFHA 4KODA 2G77B 4LRWA 2BMJA 3QBTA 3LVQE 1TNDA 3KL4A 3E2IA 3IPYA 1T0JB 1XP8A 1VMAA 1YZTA 3EZ2A 5LDDC 3RRZA 3BH0A 1JXMA 1NMYA 4US1R 4B43A 2JJ8A 1Z0DA 4G5RA 3K70D 3JZMA 2CLCX 2R8RA 2WSMA 1J90A 3MFYA 4Y0VA 4QXAA 4F91B 4JZKA 3KQKA 1Z07A 3SJAA 1SVSA 3LXXA 4V0LA 4EJSC 2BV3A 1QZXA 1PLLA 1OSNA 3RRMA 4UXHA 2WWYA 3X1ZA 3WHLA 1NP6A 3BH6A 4LV8B 1R5NA 4BASA 2CVFA 2ZSEA 1B0UA 5G3ZA 3MUFA 4URVR 5M04A 4A2WA 1SVLA 1N5IA 1NL3A 2D62A 2VHCA 1U9IC 4BLPA 5C46F 1UF9A 3C15C 4ZDWA 2QGNA 3NVAA 3R8CA 3KTAB 3A58B 2AFIE 2GXUA 4WVFA 4D4KA 4E07A 4RD3A 2QP4A 3QG5A 5GJCA 4L9WA 2O0JA 2Z4SA 4D26A 2IS2A 4LBVA 4XWOA 3TE6A 2B7CA 2GK7A 3QENA 4TL6A 1GSIA 1E9AA 1E1QA 4B3GA 2GA8A 4ZCIA 2C9CA 3CRRA 4WBSA 1HY3A 4MDEA 3E1SA 3Q7PA 2VSFA 2ZS8A 3AP1A 2J87A 1Q21A 1UBEA 2GNOA 4HEJA 4CIDA 2BBTA 2RGBA 3KX2A 4G3XA 1G18A 3U3KA 2G9NA 5FPKA 1UAAA 1VHLA 2Z83A 2VBCA 3U6BA 1KMHA 1VCIA 5FOSA 1E2IA 1P75A 3KQNA 3SJCA 5E95A 4EQ6A 4M2LA 2ZI9A 4GDFA 2WJGA 4IDPA 5CM8B 4BQSA 3ZJYA 1SVKA 1P72A 2J0SA 2NZ8A 1JALA 1NVUQ 2CDNA 2EFEB 3CZPA 4ESHA 2HYDA 5CIWA 5B2ZA 3RS0A 5DN6A 5DO9A 5EUQB 4OHWA 5C1BA 5F98A 2ZYUX 3FFBA 3OESA 3IEUA 2ODEA 3FYHA 3DL0A 4G01B 1FX0B 3A4MA 3OE7D 3HR8A 2IF2A 3R7WA 3WMEA 3C5HA 1HA3A 3TH5A 1CBUA 1NKTA 1ZM2A 3ADKA 2CL7X 2GZAA 3LW7A 3GLFA 2W0SA 1T4GA 4KI0A 1H8HA 5KNCA 1G3UA 4KBFA 5LB2A 3UMRA 4G0NA 4L15A 3BGWA 2ZRKA 3RS5A 5FTLA 4MRVA 5BWMA 3A36A 4LJ5A 1CS4C 2BBSA 3A1VA 1GIAA 3BH7A 1KIMA 1M34E 1M7BA 2B6HA 2GCPA 3NBXX 4M1OA 2YWHA 3GP8A 3B2EA 1MO6A 5FH9A 4B34A 3NBFA 4QM6A 4JBXA 3A1SA 1TL7C 5JHGB 3UANA 1OXSC 4DLTA 4ESVA 2ODBA 3VNVA 2IT1A 1RKBA 4JKIA 3GJ8A 4Q4JA 3TBKA 4DEYA 1XEWY 4U02A 2WSSD 5EP3A 2MSEB 1Q1BA 5JS8A 1ESNA 5GVSA 1KI1A 1COWD 4Q48A 5A4JA 3IPXA 2IC5A 3H84A 2ZJ5A 2HXYA 1GILA 1ONBA 3QPWA 4Q1FA 1XNJA 2GF0A 3SE0A 4YLGA 3IIJA 5KNBA 1GITA 1UEIA 5FTKA
chains in the Genus database with same CATH superfamily
2GZ3A 2CHVA 2XHWA 5HQ8A 2HMUA 4M1SA 1KSGA 4RGVA 4TRMA 3OAAD 1JFRA 1ZD8A 1IOVA 4RTJA 4P6VF 2FVQA 2G13A 3N5FA 4QR1A 1O6XA 4FE4A 3TMAA 5TVGA 1N2SA 2APOA 3KLVA 2W8BA 1H1LA 4IFVA 5TR9A 4CLZA 3V4OA 1J56A 2F4NA 4TTVA 4RZHA 2X0FA 1U1KA 3GOHA 2OB2A 1NV9A 1RJJA 4WTYA 3QZ8A 2DKOA 1EFTA 3SIPB 4NNJA 4WV3A 2J08A 4AQDA 2ODQA 2MYTA 3LLVA 2JLBA 1UXJA 1M6VB 3VDXA 4GI5A 3IP1A 5EIAA 1YD7A 4O0NA 1HRDA 1X42A 1T9TA 1TJYA 4JI3B 2IMOA 1EEHA 1ODCA 1GAWA 3INNA 4QX6A 1XWFA 4ZJYA 1M2WA 3WWZA 4H3SA 2N3LA 4W5RA 2FUG9 1G8MA 5JISA 4B4WA 2OA0A 1GU1A 3EVOA 5D0GA 1V9SA 3W34A 2CQ3A 2KYZA 2ZAOA 4CTAB 5A9SB 3PNIA 5HYVA 3RVKA 2WINI 4G9GA 1KVUA 4OYHA 2PLNA 4PRFA 2XB6A 2GXSA 3G5MA 4BBPA 4B6FA 2JLWA 4KH1A 4A1FA 1K4KA 2PHZA 2WKPA 3EXEA 2HJHA 1EKXA 4FSXA 3FJ2A 3S4YA 4A5OA 2K5UA 4JBHA 4G8DA 4J9SA 2X8LA 1FJXA 1I2DA 2QG9A 2ATEA 1ZVMA 3I92A 2JZ5A 2FLKA 3M83A 2LQBA 5JROA 2R2RA 3Q5EA 1S96A 2ZH3A 2CSUA 3O3NB 3RARA 3KLIB 2N1BA 1JJHA 1Q6YA 3VGSA 3CZ4A 4QU8A 5K2MA 4B73A 4I14A 2WLTA 1UCFA 4KXVA 5JQGA 4AG3A 2IIQA 3L7NA 2E48A 4L16A 4V0QA 4TV8B 4JS0A 3D1OA 2Q45A 2ZWMA 2W2OP 1R16A 4B02A 4YDQA 1T8EA 4BO5A 5H1YA 2W2OA 3QLEA 2XAAA 1II8B 4PLTA 4CMBA 1QRTA 5B58T 2LPMA 2P2CA 4QOTA 5KFNA 2NWQA 5DWDA 3MAAB 3LBIA 5I9TA 4DMRA 4KREA 3NMRA 5GIPE 3W6NA 3BGDA 2R2GA 1NJSA 2PZGA 1LPMA 3UJCA 4LFCF 4H27A 1I2AA 4KE9A 1M2OB 1Y7LA 2BANA 1UWVA 5CFNA 3TG2A 3ZE7A 3JWIA 3S1LA 3C4VA 2QLLA 3W5SA 4LVNP 2C98A 5FPQA 2RC5A 5J2UB 1UVMA 3DYIA 4KFSA 1K3UB 4LVNA 4OYRA 3C3PA 4R3WA 2KB2A 1GGFA 4KLCA 2ID9A 4P75A 1ECJA 4AD8A 4OB7A 4IF4A 2ZRAA 1A71A 2FUG6 1ITZA 2CUNA 4Z2YA 2ZE7A 2NVUA 1GL6A 2F3JA 4L3VA 4UUMA 4F3NA 1WHWA 4BTVA 3LLSA 4UTOA 2P67A 3ASZA 5DBFA 3D5QA 3K1ZA 2XNQA 1YOBA 2OE2A 1FJHA 1HOTA 4ALLA 3DFFA 1BVRA 1C0TA 4L8WB 3BO2A 5E1OA 1SOWA 4E5MA 1E7YA 4B87A 3T9EA 1T5SA 4JSTA 4OYMA 3EEBA 1CE8B 4CI9A 1HTBA 1DS6A 2K3IA 3OSPA 1G17A 2D2VA 4RL1A 3K96A 5KFGA 2MKCA 1IZYA 3G1UA 1BVYF 16PKA 9GPBA 2XCTB 2PK3A 3HEBA 3ZWAA 5IH7A 3ETDA 9ABPA 1NCLA 1NPYA 3FVWA 4C11B 2IODA 3GT4A 4PGHA 2BHLA 4QJ3A 2VKQA 1IN5A 3EGDB 3UZUA 1TMMA 2OM6A 2QENA 1HT1E 1IHYA 1HI8A 2CWXA 1YJ8A 2ZBVA 3O0TA 3PNQA 2XMBA 3EXFB 2I8LA 3VVCA 1JXAA 2CJBA 1QFYA 2OHHA 1BSVA 5K0JA 2CB0A 1S3SA 2V7UA 2P3SA 2X0JA 5JCOC 3QIPB 2BCJQ 2GQCA 2BFNA 4GE0A 1RMYA 1SUEA 4CQMD 4YXFA 1K4MA 4WNIA 5ALPA 3UJPA 4V0ME 3TOZA 3D1JA 3GK3A 5K0NA 5JAUA 5IHPA 3AU9A 3LGSA 2ZSHA 1G6OA 3R4VA 3TJZA 4X60A 5M2RA 3MEKA 1AMOA 4LF8F 2QTVB 2NYUA 2WRMA 1SIZA 3LYAA 4AWAA 2VOOA 1UETA 1RACB 4OQNA 4X5OA 4I1SA 1I14A 2R8KA 1UWBB 4LJSA 4FYMA 1KO8A 2XB4A 1EJ2A 3VAKA 1UKEA 2B4VA 3JQ7A 2QB5A 3FBBA 4ZPVR 1KZ1A 2CPFA 3KT8A 3PW4A 2QX6A 1RC1A 2XNKA 4Q4JB 3LX8A 1V2HE 3U6KA 2BR5A 2Q3CA 1NJ8A 2HRTA 3G9CA 5GOTA 3ZWVA 3RROA 2OV4A 2JIZA 1ILEA 3KPWA 4AKHA 5CXTA 2UZIR 3CNQS 4J0JA 3EARA 4CLPA 3N2GA 2DHGA 1O58A 3EHEA 3MMBB 2XBMA 2X6TA 4QIEA 3NAGA 1H4QA 4DKJA 3L95X 5C1DA 2FEOA 1I7PA 1YRAA 4LKRA 4UM9D 2CMKA 2QLMA 4QTXA 3C15A 1X2BA 5KWIA 3KZ1E 3MOIA 4IZIA 5C0OE 1UEUA 4ETZA 3IUQA 5KFDA 2HAEA 5A8WB 4NYIQ 3V1LA 1YJWS 2QA4S 4MVJM 2N7YA 1MNAA 4J3JA 4ECQA 4YFYA 4KQHA 3OWXA 5ICGA 4ZAZA 3IT0A 4CEHA 2AK2A 4D96A 1F8FA 5HR5A 4R6WA 4OYLA 3N3AC 4UMEA 3TLAA 4KIAA 1O08A 1E7SA 4IWYA 2IU0A 1Q1AA 1KAEA 4EW6A 4C98A 3TARA 5B53A 4B7CA 2QZSA 1LLDA 3DZ8A 3M3PA 3VU9A 2MZQA 4NA1A 5HTKA 3C8MA 1H1TA 2WHPB 2ZS7A 2QLFA 5IC5A 4B5LA 5AVQA 5ABPA 2VDVE 4Y9UA 4YIKA 7REQB 2WKQA 1Q3HA 3FTQA 3R2DJ 2G3YA 4HQ6A 3FDSA 1VSQA 3MLEA 5HFJA 1QHIA 1Q44A 2L48A 3RB8A 7MDHA 3JAMY 4TKLA 3RC1A 3D6JA 5KINB 4NOJA 1P81A 4F2RA 5IWCA 2WW4A 3QLTA 3EWNA 4FHEA 1NOJA 1FUEA 4A8JA 1S97A 4V1Ak 1RWOA 1P60A 1RYZA 1BJKA 3BB5A 2HF7A 4F4JA 3TYTA 4KE7A 2HFVA 4MTPA 3DXBA 5H9VA 4DUZJ 1E6EA 3QU9A 4GM0A 3L79A 1P5JA 2WU8A 2WE7A 5TB5A 1TFYA 3FB1A 2B2CA 1BXKA 2A9QA 2ZOSA 3DHYA 1IHDA 3KHTA 1NN5A 1FP6A 2OCGA 1IY9A 1T03A 4UAVA 4IJ6A 4PQEA 4JR0A 1GPAA 3EG5A 3SYLA 5FO0A 2ZUWA 4M0PA 3PS9A 1DBDA 4ECWA 2AOTB 3KZOA 1N2BA 3GR0A 3AIKA 2NZ4A 5FTJA 5JYDA 2I78A 2SCUA 1WKKA 3TA1A 5D6NA 5TF4A 3DAGA 2VLBA 2PU5A 3A9CA 1IBCA 3GLHE 1U9CA 2IZ1A 1KI3A 4RM2A 3R7AA 2W01A 3K0AA 2J46A 1RE0A 4B3SF 3Q8LA 1NBEB 1EXMA 3UM9A 5AICA 1ZK3A 2C42A 4BECA 4KQ6A 2ZIFA 4OA8A 2EZ9A 2OHXA 3DPUA 5HSGA 3EDRB 4CUKA 2CLIB 4GOMD 3X1DA 4CM9D 1FRQA 2AX1A 1IHPA 4L3OA 1T9GS 3L46A 3EQ9A 2C83A 3CHYA 1F9EB 2FLPA 4HGPA 3OEWA 1FKOB 4DWOA 1BD3A 1Q7LB 4TU9A 1JLGA 821PA 4ZQCB 2ZRNA 3OFKA 2HBYB 1ZOLA 4JVLA 2J3HA 3C7AA 2C94A 3PUHA 4FN5A 1RAAA 1SH7A 5DEOA 1RLJA 2I1LA 2QBYB 3ZGLA 2AEMA 1RCTE 1OGJA 1K3FA 2Q4OA 1MOPA 1ZS9A 3F3KA 1ZZFA 1OE0A 2HFOA 1OT3A 6YASA 4R84A 4MMYB 3NHMA 2AFHA 1GPNA 2HPUA 1R0RE 2ZANA 4MVCA 5BV2P 5IT9A 3TA0A 2D5BA 3QYYA 3ANNA 5G0TA 3L0DA 3L7AA 3KL2A 4KQGA 3SYKA 1ULHA 2ZUGA 3CRNA 5IFLA 1TPZA 3QOYA 4OLPA 4LNUB 2WUVA 2QQFA 3M81A 4PS1A 4ENPA 5FBZA 1XU9A 1L7EA 5LP1A 4AN0A 4A6XA 3DZJA 3TSZA 4DLSA 3SOPA 2YX1A 3MOZA 4G9EA 3UJ7A 5CDTA 4D6YA 3MJFA 3DLLQ 2NU8A 2X0IA 1OHHD 4B71A 4UOHA 3LUHA 1H0HA 3VTFA 4GZLA 4EUSA 3I72A 1DWQA 4OBEA 1Q91A 5BYAA 2P6MA 3OOJA 2GUWA 1LJLA 3ILXA 3LPEA 5HDBB 1RWOB 4ANCA 1HHSA 3ILYA 2F4VF 5IZCA 2KW5A 1RKJA 2CPDA 3TR6A 2ZSKA 1ACMB 2W7PA 3VJMA 5EPOA 3ILLA 3VR6H 2IH2A 4Q4CA 4Z9YA 3TUPA 3S44A 3BCRA 5SUHA 1TVCA 3MRSA 3AOEC 2X51A 1ECBA 4LOIA 2DHRA 1XLWA 2WJWA 2W2QA 3HADA 3VJRA 2V4ZA 3PYGA 4AMVA 2KFZA 3NIFB 3A1CA 3L0YA 1M8JA 4IG4A 4CM5A 3UMGA 3VI4B 5FOXA 3PJDA 2WFMA 3P9PA 2H5IA 5CFQA 2GM9A 1CUJA 2E7XA 4OKNA 2VNHA 2PQMA 1Y5NB 2VXYA 1VXOA 2DHCA 3V5NA 3D7MA 4TS4A 4QPTA 1F1BB 4ES1A 4EHLA 5EI5A 2M9MA 1ILWA 2GSDA 2TYSB 3UHOA 1FSGA 4JI0J 5G3YA 4Y1GA 4C3VA 2H5JB 2CK3D 1WF2A 4DV6B 4KDEA 2B98A 2JGFA 3PQFA 4I1OA 1XIVA 1VI2A 4CYUB 1Z0AA 5F7OA 4BZWA 4II2A 1B3TA 3CISA 3SV3A 3BL8A 4G9BA 1DEAA 1RDRA 1VDHA 2NO4A 5FIUA 1O95D 4K50A 4URGA 2FMUA 1NW9B 4AQYF 4FGUA 4C9BA 3MECB 4HATA 1FNMA 3ZZUA 3B48A 4U7CA 3ZXSA 3E58A 1DBPA 4NASA 4PSCA 2QD2A 3WWCA 1R2QA 2W70A 4F50A 3TQFA 1G5HA 4NJOA 1T5IA 3CA8A 1QHFA 4G5GA 4YAGA 2BH9A 2V6MA 4DC1A 2QVBA 1GFZA 3DHXA 4LSNB 2YIJA 4MYTA 2FLNA 5B0DA 2XB2D 3KMSA 4NAVA 1N5KA 4DDWA 1FJ7A 4QHYA 3WWEA 5HZKA 4PEOA 1TO2E 1P4RA 1XNQB 3H9EO 1WHTB 5JI2E 5H5JA 2NV0A 4F2HA 2XJ9A 4UFPA 2YY7A 5K0EA 2V68A 4O2LA 1PFVA 3ZV4A 1I0LA 1JIXA 1NRJB 4DRZA 3UH0A 4UCQA 4DV6J 2F9DA 5TPZD 1N8TA 2PUBA 1IJEA 2AXNA 3C6ZA 3FNEA 5FHRA 3CG0A 3P4XA 1JZQA 2Q7DA 2CJ9A 1GAQA 2XS2A 4Y7CA 3V4IB 3MM7B 4C6RA 1QGYA 3LA8A 4Z9BA 4UARA 1CRZA 4ZFNA 3SHWA 1G38A 2OENG 4GW3A 1M1YA 4KQCA 1MABB 4A0RA 1UBCA 2HMIA 2QSZA 1D5CA 1HE1C 1KDNA 2GAIA 4I67A 2PZKA 1CUSA 2GHVC 2RU3A 3RUIA 4HUJA 4GT1A 3IMQJ 2I33A 4G89A 3DW1X 2Q2NA 4ZTZB 4P4SA 4HUQB 1JE1A 1IFXA 3JSXA 5E4TA 2VI5A 2BKXA 3G8YA 1XT6A 2XSZA 5HROA 4WACA 2Q1XA 2M9KA 3E9MA 2PWYA 5HIMA 2R7KA 1Q4RA 3H11A 1E6VA 2AS0A 3OT1A 4USVA 2C7GA 4Y6PA 1MO5A 3OP1A 2HA0A 4EW2A 4IF6A 4E1AA 1MOQA 5A2QU 5AI0A 1QB7A 5IT9U 1NK7A 4HZIA 2VQEJ 4C04A 1QIJA 4EHHA 2MQPA 3RLFA 4YFVA 2V5HG 1CSEE 3L1IA 4OUKX 1VB3A 4BNGA 1OI3A 1KVTA 4MUJA 4PQFA 1XZFA 1YMUA 2Q4BA 1QDLB 4TX1A 4P3PA 4MMXB 2FHJD 2OVBA 1FE4A 1L7NA 1RSCA 5D1HA 3BDIA 4YJKA 3PC6A 4BJHB 4MPTA 1V16A 4X20A 4P34A 4EGCB 1RAGB 4BVGA 3EQ8A 4QBTA 3QA3E 1O0BA 2AN3A 2C0CA 5SZJA 2OI2A 5CJJA 4RTOA 2GTIA 1Z15A 3USCS 2FPIB 1QIGA 3FMBA 1OI7A 3LLMA 1NSYA 1N5MA 1O0PA 3EXCX 4RHXA 5BUSA 1UFLA 4I5FA 1XRMA 3TMKA 1GY8A 2RGRA 4KL8S 1NSKL 2PRSA 4RFVA 4IEIA 5E9JA 4MQ6A 2PIAA 3GIJA 5IRCD 1JJ4A 1Z6QA 1EI9A 3KLFB 2YMMA 4CWAA 3MT9A 2AOVA 2VUHB 5A5FA 1ETHA 2BE2A 3NNCA 3ONVA 1UMCB 4J1TC 4BEWA 1S59A 1U0SA 2FWJA 4IG0B 1CP3A 4U9RA 4PPFA 1IEXA 4BPBA 2BOPA 2F4VJ 1S6PB 4G85A 4CBVA 4BQQA 3R40A 3MTBA 2J0WA 2IA5A 4A8YA 3IAEA 1P18A 5MN4A 3MWEA 5G0VA 3B1ZA 2W37A 2Q5EA 4B3MJ 3V1TC 2UXCF 3GZ7A 3BN4A 2DB1A 1U3GA 4UHKA 1DX4A 5LN1A 3E4CA 2OHFA 4AYXA 1HYSB 1RS0A 1QLNA 1L5HB 1WVIA 2BHRA 3ORQA 2ZD1B 2R8GA 1C9NA 4TMFA 2NSLA 3BILA 4M5JA 1Z6AA 2VHYA 1QJ4A 4O4GA 3HVTA 3LUAA 1JLAA 1XXHA 3VKHA 2W8LA 1I2CA 3QJ5A 2B2XA 3HYTA 2YWCA 3UIEA 3BKUA 4KFRA 4QZVA 2H7VA 4PAAA 1SC1A 3NHUA 1IUJA 2CDRB 1K9VF 4UTGA 1KPHA 3E15A 3CF6R 3S8MA 2GVDC 5KPDA 3RV4A 3VBEA 2ACEA 1D3WA 3DDUA 1PS0A 1P2TA 2PTGA 1QYCA 1RHJA 5BW6B 5JH7A 3MEQA 1U90A 1R7RA 3BS4A 3GG2A 1OZHA 2QE5A 1NN1A 4XAKA 1UPTA 2GCEA 3AOAA 2JFBA 3A2LA 2JEJA 2ZT5A 2PFGA 1P6XA 4AMUA 1HDCA 1WDDA 3JSRA 1T36B 1F60B 3MMZA 4C8LA 3CEJA 2RIPA 3R23A 3PCOB 4LJ8A 4CKWB 4BQOA 3UA4A 2XIJA 4HL9A 3CH4B 1U7DA 1N3BA 3AUKA 2NS1B 4GMFA 2NT4A 3GBPA 2JBHA 5H81A 1FPQA 1VGYA 1V4VA 1VGRA 2AX4A 4P22A 5HROB 1RAJA 3CMAS 2RKWA 2C5BA 2ZWAA 2LP4Y 1DIBA 4LF1A 3ISZA 4MW6A 3ZX4A 1U4BA 4O3SA 1ZKDA 4EB8A 2C92A 1KDRA 3TUZC 4LV5B 4ZVTA 5G1PA 3CTRA 4ZYUA 1JUDA 4IIJA 2X9LA 4WFNQ 4V02A 2CBGA 3IH5A 2GEUA 3TAUA 1WXWA 4RVFA 1YE3A 5EP2A 4O2BB 4TM8A 3CNLA 2A86A 3JTPA 1A8UA 4JA0A 4DR7F 2X7JA 2XNHA 5HCNA 3GRRA 2E5IA 3LPDA 2POCA 4CO0A 2EJBA 2DPYA 3H65A 4QQRA 3GIDA 1HBOA 3M82A 4BAZA 1G1AA 2R7TA 2FDNA 3X44A 3MNFA 3K59A 4BVLA 4EO7A 4A8PA 4WASA 1ZHOA 3L0CA 4CCWA 4P71A 4RLQA 4YUXA 1KHHA 4Q9AA 3A10A 3X1ZA 2GKGA 3VO2A 1B0UA 1J2UA 1SBZA 4A0SA 3O7MA 1U9IC 4C78A 2ADCA 3J7YI 1T05A 1E1CA 1I4WA 2R5NA 5IJAA 2VBIA 4QWEA 4EGSA 3H3JA 3IR6A 1E9AA 4R2MA 3CCZA 3CRRA 1G0NA 3LUJA 2AF4C 1VL1A 3H2GA 3DBHA 5FPKA 1KMHA 1P75A 5F3DA 3SJCA 4HLNA 2LCWA 2ZI9A 2GZSA 2XCLA 4GOOD 3RKUA 2CKMA 3D1VA 4JWTA 2CDNA 4R3UC 1IAVA 4U9HS 5KYWA 3RS0A 5LDHA 4KUHA 4PBSA 4EBEA 4E0DA 2CV2A 2RAFA 3FDZB 3VPBA 1V7ZA 1JXQA 1T4GA 4KI0A 2QVZX 2KN4A 2NQTA 1Q11A 2G9UA 3KHRA 3C7DB 3C1UA 3DZHA 3NBXX 3P0FA 4XDYA 4RPJA 2MIIA 1DG9A 4DEYA 3W79A 4JI0B 1NHGA 1R4NB 2GNKA 5A4JA 2Q6OA 3DYAA 3DFEA 2JVRA 4XYBA 2E5GA 1GITA 3ZN2A 3AL0C 4G4SP 1A5TA 2PL1A 4PX2A 3OXFA 2WUDA 2EIXA 3ZTRA 4N3BA 3R7FA 3MTKA 1SKYB 1VE6A 1X3LA 2QTFA 3G89A 2FEAA 4DFPA 3OLVA 4BKMA 3C3AA 3QNWA 3VHQA 4DDMA 2NQ2C 3OD1A 4NRDA 1WZNA 3RUBL 5TMPA 2AW0A 2LEBA 4BDPA 1YG0A 3CCRS 1PUIA 3GJZA 5HS6A 3EJ6A 3WK8A 1XNGA 3QNWB 3C3XA 1EUDA 3KYDB 4TV8F 2FN7A 1LPNA 4JUBA 4PR0A 4ESOA 3HB1A 4R71A 4FR2A 2PSFA 4NV0A 3MFHA 3H4TA 3OZBA 1G41A 2B5JA 1NKBA 1GYQA 2AHOA 2ZUFA 1H72C 3WGUA 2H2IA 3C6YA 5JWHA 5FI1B 5BSTA 1S6YA 5B2FA 3ER6A 2UUCF 3NEAA 3QPVA 3AOCA 3IEMA 3AG6A 1TCCA 1SQSA 2Q5OA 3CDEA 3NTVA 1VE9A 1PC5A 5EIFA 2CZ4A 4HSEA 3KWFA 1WJ9A 3V2IA 4J9UE 2PRZA 5DGIA 3RASA 2IP2A 3CT9A 3L0SA 1CHNA 3Q0EA 2IXFA 1EVZA 2WZCA 3QY0A 2MCFA 2V8VA 5KCMA 2UU9F 3B53X 5EOVA 1Z6ZA 2QTGA 4Z4CA 1Y7IA 1M6NA 2V69A 2GS9A 3GLHA 3HFVA 1KHVA 3HL4A 4HDOB 4MKGA 5E6SB 4BNYA 5GADl 1QXSA 1KAMA 5CJ2A 2M6LA 3N3BC 3B5JA 1PJ6A 1GTRA 4ETWA 2QMHA 1YTLA 1ONPA 2OKCA 1RKVA 2XUKA 1E79A 2JLRA 3IEVA 3PW0A 2C2EA 3AFNA 4W82A 1U8YA 1T9DA 2C5SA 1ZBQA 4L5CA 3GG1A 1T05B 2V34A 4JYAJ 1E2LA 3ONEA 2EQAA 2NU9A 3N07A 3NGSA 1PSWA 1DC3A 2GVZA 4UQLA 4GPBA 4FYKA 1U3UA 3ELYA 4D9NA 2WV9A 2G4BA 1SRRA 2PANA 4COOA 4JDUA 2HQDA 3VYRB 4FT2A 2M88A 1IWPB 3WHIA 5KNDD 5C3UA 1P0PA 2AJBA 1UFQA 2AQIA 3UDEA 3W8EA 1Y1SA 3K5IA 4IQ4A 4HGOA 5D3MA 3FETA 1S6OA 4PYKA 3HBJA 4DLYA 5JDCC 4DR2F 2FCAA 4E7OA 4H3KB 3WY9A 1T9AA 2H3EB 1P62B 4EHBA 2VATA 4MAMA 3LM8A 3QSYA 4CM3A 1WTBA 1TV6B 3TEMA 2WMDA 3PI7A 2OHIA 2PGAA 5F8NA 4JLUA 1YQGA 1M2JA 3CUYA 3OT5A 2B82A 2C9YA 3MAQA 4L50A 2F64A 3HSSA 3HGTA 1S3FA 3EXG2 2MKKA 1HQKA 3OU7A 1NONA 4F8JA 4MS4B 2V96A 1QUPA 4EG3A 3WLEA 1KJ9A 1PZMA 3SBXA 3BEGB 2JIMA 1DRJA 2ZIEA 4ZPWR 4G5SA 2ETXA 1VLOA 4HDHA 4Q7EA 1QAIA 3LT5A 4RIHA 3LFHA 1Y9JA 5I3QA 4JI7J 2HHSA 3FZBA 1AGNA 3DCJA 2VDRB 1B6RA 3AZOA 5JDCA 2QLNA 4ZCKA 5CHEA 3ZNJ1 4DIMA 2OFFA 5JOQA 4A23A 4UNRA 3HN6A 3GLQA 4FZVA 3T0IA 4E5VA 2B5VA 3FEYB 3HSDA 1PBAA 1ZL2A 2CLLB 4A03A 4AUNA 3CONA 4Y3CA 1RWMA 3A0RB 1JHXA 4NXNB 2Q9AA 4I55B 1ABFA 1B14A 3PNVA 4LMRA 4S3MA 2YWKA 1EFLA 5LKAA 1E3JA 3G49A 3I30X 1IK6A 3CVWA 1Z17A 1XPJA 2H4JA 1NLUA 2Y0SD 2JCXA 4B75A 5BQFA 4UZBA 4Y1EA 1VYVA 5FWYB 4ZPCA 1YQTA 4BUZA 3PEHA 4X4SA 1DLOA 3PNBA 3NM5A 2BHTA 4QBFA 2LNDA 1GXSA 2Q2QA 9ATCA 1V41E 2G71A 1YDEA 3OFNA 4NAUA 3I76A 4ZVOB 3C3WA 1NP3A 3I1IA 4R2KA 1GX5A 2NUTB 5K3OA 8RUCA 1ZI6A 3IRVA 6AT1B 1HI1A 4DIDA 5LLTA 4BNFA 5EE1A 2ZJ3A 1CUEA 4O4IB 5AJZA 1BE4A 2XBPA 5KOIA 4A92A 3GU0A 2XZWA 4AS2A 1MABA 2DECA 3V9AA 4Q7QA 4G1CA 4N1AA 1E92A 1A0OA 1LSJA 3FB4A 5HKLA 1Z63A 2CWDA 3AVPA 4K9QA 2Q3EA 1QE0A 5AJWA 1RT2B 1NUSA 1AN9A 3GV5B 1L5ZA 1Z4LA 5ALDA 3RVPA 1YGYA 4CLXA 1QFSA 2VJQA 1OX5A 4IIEA 5F2NA 4JLDA 4CP5A 2GJKA 2R68A 3ZFVA 2JHEA 1LBTA 3T4EA 1PYSB 3LH5A 4FUTA 2UUTA 3KOWA 3R3HA 3K0CA 3R6LB 2Z57A 4M5IA 4I6JA 4ZQBA 4ETXA 4I9FA 5SY9A 4C3UA 5JNTA 2N42A 3AGPA 2OCXA 3TTWA 5EIXA 2OAEA 4LSMA 4RW4B 2CZCA 3BB1A 2JOQA 5CBKA 4EYGA 1E1QD 2BVZA 4K0RA 1QO7A 1LZLA 4Z37A 3K17A 2P6SA 3JRNA 5AVXA 2Z8YM 4PBRA 3JWPA 2WT8A 1JQBA 3E7PA 2NPIA 2R7QA 4Z7QB 1NSQA 2DX7A 3O91A 5LMNB 4DCPB 1FNXH 1SVDA 2GD0A 4I4TB 2YVKA 1U47A 1CJTB 3L8FA 2DNHA 3NS6A 3BXGA 1VKZA 4IJ5A 3DFIA 5IKMA 4B0OA 3LO8A 3T52A 3D7SA 2ONKA 3OHAA 1J5EJ 4U3JB 3NASA 4XDZA 1RU1A 2HHVA 1WI6A 5L9NA 5HBRA 3MDFA 3VAAA 3ZTOA 1ZG3A 2AI3A 1CYDA 4TV8A 4NBSA 4BFUA 5JUWA 1TK8A 5CB0A 5J1PA 3EWIA 2XVMA 1T0BA 3QVLA 4JVSB 4ZHSA 5EEGA 1IQRA 4UHHA 4OUDA 1FWLA 1BLUA 2FZEA 1YS4A 4OYIA 1X8JA 3V4PB 3H1EA 4K8OA 4LF4B 5KAMA 2QRGA 1O0CA 3WKDA 3QW4B 3CBQA 4J6EA 3BGIA 4E0BA 2Y0PA 1R3UA 2P40A 3QPAA 2CZGA 4MLDA 3W9IA 3GFYA 3H5OA 1TLFA 4HNAA 3VKWA 1R0YA 1OIVA 2V6FA 5KYNA 2MQQA 5C4GB 2WZ1A 3LSYA 1NBMA 4Y9RA 3IYLW 1C7ZA 1ODLA 3EDQB 2RCYA 3LXMA 4IKEA 4AMZA 2QX9A 1XR7A 1SCJA 1YRYE 3UXHA 2DR7A 2VH7A 4BIMA 4C8YA 1KH2A 4GVLA 3PWKA 3RS8A 4UKDA 4DILA 2YQ0A 4N7JA 1X5OA 1PR0A 1X70A 2JEYA 5TPZA 2ODAA 5SZTA 5FULA 2AJDA 2WOMB 4I3FA 4K05A 5A7FA 3A37A 1CB7A 3ZIAA 1HE5A 1WCXA 1RD4A 4ROSA 1YZ7A 2O5DA 1O95A 2YNMC 4GDMA 4UTVA 1N54B 3H1PA 4U4AA 1XL0A 3QVGA 1KYVA 2D7CA 3T5CA 1HWYA 1QYXA 4IIVA 2J7UA 3JSBA 2M2IA 2ASJA 3UMMA 4ND7A 2VNSA 2PEYA 4XYEA 2XMZA 1ZNYA 4AL6A 2OD2A 5FQNA 2IV2X 5IV4A 4ED8A 4EDHA 1SV5A 3RV3A 5C5EA 3RUEA 1D6MA 5CLJA 3LQVA 2RH5A 1VMBA 5JSQA 3PICA 4RVNA 3TP2A 2QSJA 2RC6A 4PG7A 1SBTA 1EX9A 5T3UA 2DY9A 3TZCA 4CXMA 2J6CA 2ZU6A 1GWNA 3GRPA 4USJC 1B74A 2VDQB 5HK8A 1RWWB 3V6JA 2AC2A 4OX9Y 4MW7A 5CA1A 5DGXA 1TX4B 1GCOA 4AT1B 3DQPA 2ORED 3KTFA 2HM7A 1YKGA 1QGED 5FBRB 2B83A 3QVKA 4XLTA 3RR7A 3LC2O 3KQSA 3VXKA 4AY6A 1BXRB 3DOOA 3C41J 2D1QA 4MKVA 2MYUA 4M89A 2C04A 1YJRA 1U2CA 5LDGA 3ZI4A 3DT8A 2VRNA 2C9ZA 1VL6A 1IKVA 2C3PA 4US0R 2BEVA 1U3TA 3E01B 4LDQA 1S7GA 1U1DA 5C2JB 3BG5A 2FW7A 1XCPA 3P2JA 2C9MA 4DCVA 4JEIA 1U0RA 1FVHA 4V19J 4WJZA 4QAQA 3CLSD 4EUFA 3M70A 2PKYX 5ETKA 5KNLA 3JYLA 3DDIA 4LMZA 2F67A 2VP2A 4RPGA 3RIMA 3PWSA 4HGZA 4MS1B 1II0A 1TFUA 1WUUA 1W1IA 1NQUA 2IHJA 1GKLA 3C5EA 1FYXA 1AS0A 4QQ8A 3WDMA 4N0EA 4OP2A 4R0MA 2DHEA 1PIEA 2VTBB 13PKA 1Y3FE 4N0PA 2O4UX 1F5CA 1N6QA 3LNTA 5DYNA 1V26A 2Q2OA 4DQPA 5BSHA 1R4AA 4CNZA 3P26A 4TY9A 4EHAA 4MR9A 1U8EA 1JDNA 4D8YA 4ZLNA 4LFCJ 3I64A 3IEIA 3IFEA 5B6IA 3TO8A 3PKJA 1Y5RA 1G21E 1EFUA 5J47A 1T02A 2IWHA 3N2GB 4LBZA 4TL9A 3MOGA 5GAHI 1B41A 1V0JA 3HO1A 4PVDA 5FORA 4RLHA 3CNHA 3GG0A 1I3MA 1M5KC 5IJ0B 3ZWOA 3MMAB 1RABA 4CKYA 1K66A 2AOTA 1NQWA 3KHHA 5IVPA 2DO4A 1CR0A 4NJMA 1K5GA 3CIOA 4OB6A 5ICCA 2QZ9A 4YQZA 3RG2A 1PJLA 4NYPA 4PEVA 4LRAA 4YB7A 2ERYA 1CERA 4K0KJ 4TY8A 2HBQB 2UV8A 2AK3A 5TRTA 2YWEA 2W6MA 4ES3A 1R3DA 2X58A 3UXEA 1V3UA 1ZUWA 3IA2A 2IKQA 4YPVA 5EJ6A 4KU4A 3I5MA 1T2UA 4M9CA 2OAGA 1CDEA 2E18A 1WNFA 5BYBA 1GR1A 2F1HA 5H9EJ 1S0UA 5CVCA 2GPWA 3WKBA 2Q2WA 4RC9A 3TLCA 3H2UB 2CC2A 5CP8A 2ZH7A 4LW8A 3OQHA 3UJ9A 2AUMA 3WR5A 4RGQA 1NFQA 2A2DA 1BGVA 1Y5MA 2VYND 5K0LA 4BRZA 4LDAA 4X4VA 4R31A 1H3FA 3FZNA 4C88A 4L5AA 3OVAA 4B76A 4L6V3 5DN6D 5KTMA 2XD9A 3ELBA 5LJ5Y 4XEHA 3CGWA 3VNSA 4KXFB 3BIFA 1RWKA 2ADFA 1CUCA 4FDFA 4EK9A 4L7VA 3MHTA 1TGYA 2RGXA 3ZGZA 1UBUS 5EPUA 4BGIA 4OFXA 2LQJA 2H1LA 4KAIA 2CQHA 4RO0A 4DUYB 4O3OA 1KQPA 1P7PA 4L6CA 3F7MA 2AZTA 3A26A 5F5LA 5LU9A 3TSYA 4RKEA 3ZNUA 3PNOA 2NAPA 3CWCA 4JV2A 1N6KA 3R3UA 1HDEA 1P4JA 2CXRA 3VR4A 5H3HA 5J2MA 2OAUA 2HLHA 4HMOA 3COWA 4Y6LA 5HRAA 2E5LJ 3HYSA 5JANA 4DPOA 1I1OA 2DKOB 4OA5A 1KBOA 3SFTA 2WSLA 5IK2A 4JK3A 4RWXA 1WY5A 1FDSA 4LQ4A 3IWLA 3ZW9A 5CH7B 2Q6IA 3UOWA 1CC7A 1EQMA 5AE1A 3LI2A 4MRMB 3IAS9 1XNRJ 3MM6B 5B09A 3FFTA 1GRVA 2X77A 3OMLA 4D45A 1AG9A 2AHOB 3QJJA 5INTA 4R1OA 3EGWA 4JJEA 4RK1A 2QJTA 1JKJA 2CJWB 5DHRA 1HH4A 2UXDJ 1WEHA 2VH2A 3U17A 2F4VB 1PZNA 5ESWA 2EBEA 2JI7A 2H4HA 2CQDA 4HK4A 1E62A 4GKAA 1CF9A 3CCCA 3QVVA 4DUYJ 1NF3A 2HHHJ 4I4LA 1VL2A 1YQWA 2OO7A 1IVZA 3CWZA 1IWAA 1N9GA 3KB2A 1BW9B 2QRJA 3I34X 2E89A 1YDFA 2P7HA 1DRWA 5I7OA 4AIIA 1E2UA 1FP1D 4K9DA 3P19A 1JKHA 3H9BA 2DNLA 4CLEA 4HOYA 1KE2A 1Z35A 2R2TA 3H40A 2V67A 1HR0J 2QTVA 2O14A 1OBFO 3W2EA 1T2CA 1VP3A 1LWNA 3SYMA 4B3FX 4MH8A 1OBCA 4ZVSB 2B8EA 2QPTA 4EUEA 4ZJUA 1UPUA 1STOA 3BSOA 3T9CA 4KN5A 4KQIA 2HJGA 2YKNA 5AKLA 4FF2A 1JJFA 1MQ8B 1ZK4A 1QB8A 1FX0A 1V5FA 4JUIA 3OFEA 2DQ4A 3L41A 5LWHA 1IPHA 1XJWB 2WHPA 1SD2A 1ZUIA 3CUUA 2MHNA 4OYXA 3P8BB 3QNUA 3FX2A 2ZXUA 4RZXA 4JV0A 3VH4A 1T94A 4A73A 4NBKA 1XRQA 2J0UA 3I9MA 2GEVA 2VHJA 3NORA 1CJVB 1AGRA 2Q3FA 4GUDA 2FG7C 3AF3A 1WUYA 4CIOA 2XLKA 1K27A 2C59A 3PRVA 3KJXA 2DK2A 2WHQA 2Q3HA 2XRMA 4ZVQA 3EIEA 4L5IA 3PVSA 1SZCA 1VB5A 1NKCA 2DR8A 2Q5QA 1GN8A 3H75A 1XQVA 1Y8CA 2HWKA 4D4MA 5F2EA 2HLPA 3WLAA 3DM2A 4XGRA 4TLDA 2RNEA 4H54A 3BGUA 5KG0A 2FEXA 3DBLB 1RB0A 2I9PA 1YSJA 1U0GA 4B9SA 4KSCA 5CB8A 1A4UA 2RK3A 2CGEA 2DR0A 2ODTX 2XXAB 3BFJA 5DYTA 2GJIA 1TK3A 2OFOA 4DJEC 4B7XA 1NLMA 5HS4A 3EYAA 2SCUB 4RSGA 5P8WA 1NFRA 5A4IS 4ZJPA 3SQOP 2E9RX 2Q9BA 4YQWA 3FHTA 4J1QA 5CEJA 2B9VA 3BHMA 4OLAA 4JI6F 4RIEA 3ZZPA 4AKGA 2CLFB 4EA9A 4F04A 1RM3A 5E5NA 2WIAA 2X22A 2A9PA 2CYCA 4Q24A 4CZCA 4U7FA 3QU2A 3G8CA 2M1XA 3UK1A 1VJGA 2BXJA 2K7KA 1F0KA 4ZC1A 2V6IA 4KGDA 2VJAA 1OYVA 5CB4A 4KYZA 1BDHA 3EGWB 2BI7A 1RACA 2FPWA 4HB3A 4QUKA 4IP0A 1TJ3A 4PZVA 4OAOA 4EJSA 1KTIA 4LTMA 2W5UA 3NT2A 2OUKA 1WDTA 2HCFA 5DHQA 2DJIA 5JVDA 3TRDA 1MC8A 4N3CA 3SDEB 1J8QA 2IUUA 2OQRA 1TB4A 4BUCA 4F3QA 2HV9A 3EYWA 2Y1JA 1VPDA 5DNWA 4BQPA 4W5QA 4R1UA 1RAAB 3LAWA 4EB6A 3FGVA 5EDWA 2HSEA 1XMQF 5M5BA 5EYPB 1QRUA 3DO5A 4HHJA 1WB5A 1MBZA 1PFKA 1RCFA 2C0QA 4IH1A 3AR7A 5EP4A 3P9CA 1CUFA 3HZOA 3G96A 3A6LA