3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
b'MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
4A8JA 1E99A 4HDCA 1G16A 5KOYA 1TUIA 4B3CA 3CONA 4LHZA 4WBSA 2ZI3A 1P9RA 4OKSA 3U61B 1M1YE 1VG0B 1CKEA 3EXAA 3F3YA 2XNDA 4EQ6A 5AJZA 3B2EA 5AJWA 1W4BA 3NDBB 3CNLA 1IXZA 2W2TA 3UMRA 3P4YA 5IDVA 3OZXA 3ZIAD 1L4UA 2FX3A 1YZLA 3FWYA 2QMUA 1FFHA 4HAYA 3V00A 4AURA 5FTMA 5KDDA 1AK2A 3OEHD 1W7AA 1R5OA 4JSTA 3EA0A 2JGNA 1RRFA 1MABB 1N6OA 2G88A 1FTSA 4YMSA 5EE1A 3KKOA 4N0DA 3BH0A 1S9DA 1KGDA 4TL6A 3GLGA 1MO5A 3IBGA 2IYUA 3U3OA 2WMOB 3R7WA 3X1XA 3LDAA 4PSAA 3IGFA 2JJ1A 4POAA 1S3SA 4GMXA 3U7HB 3BB4A 3IDQA 2IWHA 2XSZD 3B5JA 5E7JA 1C1YA 3UG7A 4PC2A 2IT1A 2J1LA 2ZIAA 3BJIC 4V0KA 1K5GA 2H92A 4HAWA 4TYWA 1PJRA 3A4LA 3PUVA 1M7BA 4AYTA 1XCPA 1FP6A 1ZYUA 3PITA 4JBXA 2WJYA 3WHKA 2ODWA 3ZIAA 3PV0A 4A0RA 5L3SB 2ZRJA 3FFBA 4B3FX 3Q72A 1OF1A 4D0LB 1V5WA 2ZRPA 5EJEA 1OYWA 2ZU0C 4YXWD 1ZU5A 1E1RD 3WBJA 5F3WB 1ZM4A 2O0KA 5G53C 2XZOA 2H18A 5L3RA 1DEKA 3DOFA 1ZP6A 4Q9HA 1EX7A 2JAQA 3H1TA 3H0KA 3TVTA 2RGXA 1FX0A 1MR3F 3HU3A 3WNBA 2P6NA 4DIDA 3I5XA 2ATXA 1VG9B 2BCJQ 1II8A 3GMTA 5A5GA 4MKHA 2EYUA 1T3HA 4K46A 1DE0A 2G6BA 2RCNA 4C0QC 2XTZA 4OJQA 1IM2A 1CRPA 3LA6A 3CRMA 1PVOA 3FHOA 5C46F 4JBWA 1G7SA 4BASA 2ZR7A 4NYIQ 2QAGA 2FEMA 3VR6A 3GEHA 1Z2CA 2VRWA 2WV9A 3IIJA 4QHYA 5BYJA 2JLWA 1R10A 1E2DA 3RRMA 5AUNB 3K9LA 2EQBA 1RZ3A 4E03A 5FUWA 4HB0A 4Q4JA 5EP4A 1SGWA 3JZMA 3OF5A 1KI3A 3QIAA 5EXPA 3FOZA 4IXMA 1KJZA 2MSCB 2XJ4A 4TMWA 4V0LA 4C30A 4Q1DA 2VYFA 4J0QA 1KZ7B 3HU2A 3C7KA 1GNPA 3ND9A 4A15A 3N70A 1R6BX 5ANRB 2V6JA 3DO6A 4KFRA 4NBSA 1H8ED 3TQFA 1M7GA 3C15C 2QPAA 4DZZA 5CYPA 5E7IA 3U4QB 1COWA 2FPLA 2LWIA 4BFTA 4DSNA 1VYTA 2J7PD 4CEIA 3SOPA 5GJBA 3VHXA 1NJGA 1UADA 2C8VA 4MITA 1M6NA 2CE2X 4LCBA 3I5YA 2WICA 3FMOB 4LHWA 1HE1C 4QNRA 5H68A 3PEVA 1BMFD 2ATVA 2JIZD 4URZR 4V0NA 3NC1C 4M9ZA 5JWHA 3BERA 2XJ9A 1SVSA 3ZZTA 4MKGA 1NG1A 1GOTA 4QBFA 3RS7A 1QF9A 1B23P 5JI2E 4Q66C 1FMJA 2CVHA 1YR6A 3CLVA 5FUXA 3GLFB 3SYLA 2W6JA 2GZHA 2DY1A 3E1SA 3DM9B 3DZDA 2YWFA 1SVLA 4CEHA 1X6VA 2JJ2D 2O8FA 2B6HA 3I62A 2H17A 4O3MA 1XEWX 3WNCA 1ZNXA 1G19A 4L4UA 4EKDA 3RWOA 2LCFA 3AV0B 1TU4A 1HE8B 2A3RA 5DN6D 5AK0A 1NNEA 2AN9A 3NEJA 2QP3A 3A4NA 4IJMA 4PC3A 1MH1A 1XD2A 4P3YA 4DSTA 1MOZA 4NP6A 4XSHA 3WMGA 1Z8FA 3EZFA 1P7CA 1U99A 2GA8A 4IOKA 3QVUA 4LHXA 3WRYC 1KJWA 2ZJ2A 3CW2A 2JIZA 4Y0VA 4DC9A 2BBTA 4L9SA 1XJCA 4PSVA 3TK1A 2F55A 2OM2A 2RGGA 3L8YA 5GVSA 2C9YA 3HYTA 3EIQA 4Q02A 3AM1A 5JS7A 3HPQA 1NN5A 1CBUA 2WZQA 1U8YA 1G7TA 1XU4A 2CLCX 1HT1E 3L82B 2OLKA 4KBFA 1W1WA 3PEUA 2Z5FA 4F93B 2J0UB 3DMDA 2WIBA 1E2GA 2FF7A 4PC1A 3HWSA 4RFSB 1XX6A 5DN6A 3TLXA 1XPRA 4AI6A 5G41A 1JEEA 4TMXA 1A4RA 3THXB 4M8NE 3I73A 4BZPA 2IYRA 5H1YA 1OXTA 1TEXA 2OCAA 2C95A 1NVUQ 1TEVA 1P60A 1Z08A 2X77A 2ZYWX 4A2PA 3UPUA 3A6PC 3AVXA 3VNUA 1QHNA 2J41A 4HAVA 5DISB 3WHLA 1N25A 3DEFA 2ZETA 4E22A 3MFYA 4DDWA 4DCUA 4G01B 4A0FA 1YE8A 1Z0JA 2O8DB 4WZ6A 4CIDA 1E2MA 3CF0A 5JMTA 2W2VA 4XWOA 2KE5A 2NZJA 1BYUA 3BWDD 1NMYA 2GNOA 1Q1EA 2AFIE 1TQ6A 2V55B 2VTKA 3KTAA 4TLAA 3QBTA 4BLRA 2I3BA 3EZ7A 3OIUA 1T5IA 3AVUA 3I3SR 5JSZA 4TT3D 3GD7A 5BYKA 5IT5A 1G4AE 2RHMA 4V02A 1QDEA 2H8KA 5CB6A 3A37A 2CBZA 4XIGS 4C4PA 2QA5A 1E9AA 2OCBA 2ZE8A 4HDQB 5HCIA 4M1TA 2UZIR 1OFIA 4BFSA 3ZLJA 5HTKA 1GDDA 2JDID 4W5WA 4X8OA 2ZVQX 3UMSA 3C8UA 3VKWA 1QHHB 2DFNA 2KBFA 1H8HD 1CEEA 3W8NA 1O87A 1OPXA 1EGAA 4MYCA 3K0EA 3W6OA 4RKEA 2PMDA 2WKPA 1NY5A 5J40A 1LS6A 1RYFA 4LBZA 3R8CA 3C5CA 1ZUHA 3CNOA 2BJVA 2BVNA 3UWKA 2J0QA 2VP2A 5K8LA 4UXIA 4WAUA 1ZINA 4IDPA 3R8FA 4AWXA 2J46A 3LBIA 1CR2A 4ZPXA 1QVRA 3T35A 4HAUA 3VFDA 4BUJA 1UBEA 2PX3A 2QG6A 4GT1A 2WJGA 4G3XA 5FOWA 3MWKA 2CHGA 1Q1ZA 1TQ4A 2R2AA 4TL8A 3GP8A 4ESVA 3CPJB 4QC2A 4QRHA 1T8TA 5EE3A 1DO2A 4B35A 3Q7QA 1UKEA 3OHMA 1G21E 1ZNWA 4MQBA 1W0KA 4GNKA 3ETLA 1KSGA 4URVR 2QU8A 2HT1A 2ZE7A 2OBLA 3Q8XB 3RSOA 3ZJYA 1FUKA 1G6HA 2ZJAA 5C4GB 1TF5A 1WCV1 2XZLA 3U2QA 2NO7A 2LKCA 4NYIR 3CNNA 3QKSB 4FINA 1CLUA 3RABA 1DAHA 4MA4A 5BW8A 1SZPA 3EZ6A 2YC2C 1AKEA 4W9MC 5IHPA 4US0R 3MWLA 4Q1CA 5KU1A 2W58A 5BQ5A 1OHHA 2IS2A 4OI0A 4C7OB 3GJ7A 1E6CA 1Y63A 2GJAA 1CIPA 3TAUA 3HJNA 2IK8A 1XEFA 4R2IA 2W2XA 2WOJA 1JAIA 3CZQA 2EVWX 4Q4HA 2CVFA 1RRGA 2CK3A 4D4MA 2GXAA 3RLFA 2GETA 4I99A 1HUQA 4QM6A 1Q20A 5IK2A 1G5PA 1KMHA 1Z3IX 4IFBA 4KFUA 2BDTA 2QBYA 3KB2A 1WBBA 2PJRA 1NL3A 2F9LA 4LJ6A 5TVKA 3SJZA 3QKRB 1OIWA 4JLVA 1E1QD 5L3QA 3K0FA 1JR3D 4K8OA 2WWIA 4AK9A 4DLTA 5K8TA 2OBNA 3ZD7A 4DIEA 5GADl 2HCBA 2JCSA 5AUQA 1R5NA 5EE0A 4ZCLA 4Z8YA 4EFNA 2BEJA 2P2LA 4RZXA 3NTUA 1T6NA 2IL1A 4L5BA 1VDZA 5BXQC 4H9GA 1N6HA 1US8B 1UBCA 2D2FA 4FIDA 4F4CA 4FMDB 1G1MA 2IUTA 3D6TB 2E1RA 1ZD8A 2WOOA 4XTRA 2HXYA 4CT4B 4LYFA 4EPTA 1KNXA 5M04A 4LV5B 3A1VA 4NCJA 4WXPA 4HAXA 2A30A 1WDTA 2CNWD 3RS3A 3PEYA 2R6FA 2O8EA 3K09C 1GUAA 2FWRA 1KKLA 5JCZA 3SBEA 3B82A 1AQUA 2AXNA 4G0NA 3RRYA 4IOLA 5G3YA 1RC8A 2GCOA 3LW7A 4FCWA 4AG5A 3SNHA 1W5TA 4LJ7A 1P2UA 1MT0A 2W00A 1E2LA 3T1VA 1RFLA 3VNVA 3B1XA 3TUIC 3B85A 5HZHA 4TMTA 4MYUA 1W47A 3LLUA 4HUQA 2OE2A 1NY6A 1VCIA 1Z6YA 1VCOA 2ZTSA 2R6CA 3VR5A 1BYIA 2OT3B 3B1WA 1Z6XA 2FGJA 3LLMA 3W9YA 3OAAA 3EASA 4Z1MD 2V9PA 2XGJA 4URUR 2IYLD 4I4LA 3I8SA 4DT1B 5JECA 4OK5A 3B13B 3LD9A 4US2R 2OAQ1 2QE7D 2NO0A 4KSBA 2QRZA 1ZUNB 1ZM9A 2K5UA 3AP2A 4KYUA 2P6UA 4YLGA 3SBDA 2GZDA 2GXSA 1OFHA 2IYZA 3FMPB 4LWZA 4ZDWA 4Z51A 4QHTA 2CL0X 2W0SA 4FMCF 3LO5A 1OYYA 4MKFA 2F1RA 2RHDA 2IBMA 4P4SA 1EX6A 4FW9A 5CK4A 1MKYA 4BE7B 3S1AB 3EIEA 3MD0A 4G5RA 3RC3A 4GBMA 2OLJA 4PHFA 2OILA 1XMVA 1G20E 3PUWA 4PC7A 5J47A 3SQWA 1II9A 4IDHA 4IXNA 2D2EA 1GRRA 3LWNA 4DEXA 2GJ9A 3PVSA 4ARZA 3CX8A 2IUSA 1VKJA 4RSGA 3RS5A 1OT3A 1F2UB 3FMFA 4D4LA 5D3QA 1R2QA 1XZPA 1RW4A 4FD2A 2ZRAA 1ONBA 4ITRC 1E9CA 1X3SA 5DGXA 4Z8XA 5FTKA 4TN1A 4PZYA 3X2SA 4FWTA 3QXCA 3E2IA 3QENA 3VTKA 3DMNA 3QOFA 5LB2A 1XEWY 3THWB 3CRVA 2IYQA 2OXRA 3SEAA 3KL4A 3EA5A 1Z5ZA 4BZQA 4KYIB 3LW8A 4A8JC 4DLWA 1G4UR 2ANCA 4B6FA 1QHYA 4DCNA 4LBWA 2FFAA 1E9FA 3K1JA 1R0ZA 3KFVA 1YKSA 2O0JA 4TTRA 4M1KA 3LY5A 4B3GA 1L8QA 5J4LA 5DIFA 1AGPA 5FPYA 1P72A 2B92A 4TL9A 3OIWA 4HLCA 4CDGA 1IQPA 2ZSFA 2HT6A 5TDHA 2XB2A 4NCKA 2ZI7A 3NHAA 5AJXA 4HZUA 4N3NA 1GKUB 5KNBA 1E0JA 3OIVA 2EWVA 4DB2A 4EQ6B 1B0UA 2WJIA 4X8HA 3AF4A 5KSPA 2A5DA 2J9RA 1W36D 1F48A 1XMIA 1RVDA 2ZJ8A 1G3RA 1G8GA 1ZD1A 4OI2A 1YZQA 4OQMA 1M2OB 3KX2A 3K09A 3KJHA 1E0SA 1G9XA 4KLZA 4LSGA 2G1KA 1OXVA 2ZRDA 4DLSA 2MMCA 3WYGA 2VEDA 3C14C 5F2EA 1HH4A 5BN3A 2JLUA 1P2VA 2DHRA 2PT7A 2ZJOA 4M1YA 1BH2A 2NGRA 5K8IA 2HEIA 1E0KA 3CPEA 4N0EA 3CRW1 3HR7A 3GLGB 1AGRA 3NEYA 2IYTA 4RZ2A 4BLOA 3IBYA 4O2RA 5TY0A 3TR5A 1HA3A 1JB1A 2FOLA 1NSFA 2C96A 3KKMA 1J99A 1P2TA 4IDNA 4PAMA 5DI9A 5J4VA 4KI0A 4XTCS 3ZVLA 2ZR9A 2ZAMA 2FMXA 1N6NA 3LX5A 3GLHA 3MG9A 1KMQA 1QHGA 3PUYA 4R98A 1P3JA 4A6XA 2GCNA 1DARA 2V6IA 5BN5A 4URXR 1SKYB 3NWJA 4OL0A 1Q1QA 1WRBA 3PENA 2G77B 2H7VA 5K8UA 1K6MA 1MO3A 4Y0AA 1X8KA 3TNFA 4DJTA 5F98A 1U94A 2C99A 2ZUBA 3NIBA 4GFDA 3MSXA 4S2EA 5JRZA 4LUCA 1KJYA 3SDZA 2RGBA 2RGEA 4B47A 1GSIA 4Q9IA 4NTZA 1GKIA 3FYHA 4FN5A 1RJ9B 4QJ3A 3KB1A 1DPFA 1FX0B 1CR0A 4JLOA 3WBKA 5KUTA 1FL9A 5FTLA 3QJYA 3IEUA 2VO1A 2EFEB 4PHTA 4DCTA 3ZD6A 4QHSA 4L8GA 3RYTC 2V8OA 2G9NA 5AUPB 1CRQA 1F60A 4LYHA 2HDNB 4QNMA 1AZSC 1G17A 2TMKA 2FGKA 1E2QA 1E9DA 4PQRA 4F92B 4O25A 4LRWA 1E2FA 2FNAA 4B75A 3AP1A 2D3WA 4QGFA 2VP0A 3HYRA 3LXXA 4RD6A 1YZTA 1OH7A 3R9IA 1FMLA 4DB4A 2NOAA 1KI4A 1ZC3A 4PZLA 3BFKA 3K70C 2PCJA 4LBYA 3QPUA 1Z07A 3EWSA 3K0AA 2FEOA 1ZNYA 3TW4A 1NVVR 4HB2A 4LPKA 2IYYA 4Q4JB 4P4UA 5AJYA 2ZRHA 4X8MA 2OCPA 1U90A 4EJSB 1TQ2A 4RJLA 4ZDIA 4LI0A 3K0CC 3SJAA 2OO7A 5F9FA 2X8AA 1GRNA 2VQSA 4KBGA 1WQ1R 3GJ4A 1VIAA 3T5DA 4DSOA 1R4AA 2A5JA 2R6AA 4TSFA 1SXJB 4MH0R 3BFXA 5C1BA 3M6AA 3TSOA 1IXRC 2WSSD 2ZRKA 2C78A 2VHUA 3MJHA 2OCYC 4B3DA 2GVDC 3U5ZB 4Q4LA 4JVSB 4NYJR 5J4KA 2VHTA 1MRSA 1TAGA 5GVRA 3X1DA 1E2NA 5FTJA 1XTQA 2BM0A 1L2TA 2B21A 2NO6A 1S2MA 4DLYA 1S9HA 3BIFA 3M1IA 1S4QA 1GP2A 1YJ5A 2ZRCA 3ADDA 4AY2A 5IRCD 1W2GA 1XD9A 3WYFA 1JBKA 1BOFA 2QPOA 1U81A 2OXCA 2QTVB 1HEIA 2R65A 1TF2A 3B8HA 4JMPA 1NN1A 4K81B 3B9PA 3BK7A 4QJ5A 3FHTA 4KODA 3VKGA 5HKKD 2HJGA 3K0SA 2ZI4A 3K53A 5E4FA 3JVVA 1Q3TA 2I1VB 4FI3C 3K9NA 4BLPA 3EG5A 4IDOA 3X1ZA 2N42A 1Z6AA 3T61A 3DDCA 2IYVA 2V1XA 1OKKD 5DI3A 3OEHA 4B48A 3FMIA 3REFA 3KQHA 3TKLA 4P4TA 4OQLA 4B43A 1KZGB 1EFCA 3KJEA 4OHWA 3MJRA 4P32A 4UNNA 3V9PA 4X8LA 1D6JA 1OIXA 4DLXA 2VPPA 4CEJB 3LVQE 2CCJA 3VHLB 1TADA 3RHFA 1BS1A 1NF3A 2X1VA 4LC1A 1Z0AA 5E3HA 4Q21A 1XXHA 3VU9A 3ZVNA 4AKIA 4OQNA 2BBWA 1EG7A 2F3RA 4YMTA 2J0SA 4M9XA 5UKDA 2F1IA 3GJ5A 4LX0A 3P1JA 1AS0A 1LVGA 2GF0A 2PMKA 2QT1A 2WJVA 5B57C 1TPZA 3ZVRA 2XSZA 2DFTA 2PT5A 3BE4A 4XOIA 4FMBB 1JECA 1XMSA 1NBMD 1KK3A 721PA 1XCMA 1SXJD 1VYVA 2QENA 2XOKD 3P26A 1PUIA 2NPFA 4LDJA 4TQAA 2HLDD 2N46A 4NDZA 4IVQA 2BV3A 3EC1A 5KDOA 4Q9LA 3CR8A 4TZ0A 1LTQA 4DUGD 1KI8A 1YRAA 4HYYA 4LJ4A 4YXWA 1NRJB 4KU4A 1E1RA 3EZ9A 2QM8A 1CU1A 3Q3JB 4LJAA 5EE9A 1U9IC 1Q44A 1WMSA 2CEAA 1CJVC 2JLQA 1W48A 3NXSA 4IOJA 2CDNA 5JWRA 3ZQJA 2QP9X 2VF8A 4WIAA 3WP0A 1T0HB 5TARA 2VLIA 5FH9A 3IO5A 1DS6A 2YV5A 1VG1A 3GEIA 3K0CA 2P5TB 2DCUA 2QSYA 1WF3A 1KAOA 4JIMA 3W34A 1A82A 1E32A 4PPGA 1EFHA 1YVDA 2BBOA 2VSFA 1EK0A 5EZ5A 4HEJA 1VTKA 2SHKA 1OW3B 2ODNA 4NU0A 4CT5A 3T5GA 1LFDB 1R8QA 3OFND 3ND8A 3ZGXA 1PLLA 2R6DA 2HJVA 3SI7A 3KTAB 5KSZA 1LB1B 2V7QD 5GJCA 3RAPR 3IIMA 3GLHE 3W5JA 1RIFA 1YZNA 4YDHB 1MABA 2NG1A 3GJ6A 4NL4H 4QG7A 5KHOC 2V1UA 1OSNA 4I1UA 3QXXA 4JL8A 4ZI2A 3CR7A 2EFGA 4JJZA 3SZRA 1IXSB 3FGNA 4NCHA 2A5YB 1P5ZB 4DLUA 3KUCA 4EPRA 2Q6TA 1NVXQ 2XITA 2JLXA 2CHQA 3CRQA 4BFWA 1CJKC 4XJXA 1H8EA 3ONWA 5LPNA 3HP1A 1R0YA 3KQLA 1Q57A 1GAJA 1EFUA 4JLJA 1R8SA 421PA 1XZQA 2FU5C 5IF9A 2J7PA 2ZI5A 1UFQA 2NQ2C 2NIPA 1P75A 2QMEA 5L3SA 3F8TA 821PA 2QNRA 3N2EA 2GHIA 2X19A 1BMFA 5FI0B 4OHYA 5J5CA 4M21A 1W46A 1AJEA 2BCGY 4GSYA 5JCPA 1SKQA 1SQ5A 4W5JA 3VX4A 3CUEF 5HR5A 4KV9A 4LHYA 5SZIA 2IS4A 3BS4A 1G6OA 2WIAA 4NYMQ 1UJ2A 2VA8A 1Z0KA 2IC5A 1G5TA 3JZAA 521PA 4TQUS 1ZM2A 5HE9A 1E3MA 4TWZA 5FOUA 1UEIA 3LVRE 1AA9A 4ERNA 2ORVA 3B78A 4HAZA 1V43A 2JJ2A 3GJ3A 3VMFA 1L7VC 3C41J 4AC9A 4DKXA 4XVUA 5KSYA 2YJTD 2QTHA 3U3KA 4LJYA 2QZ4A 3GLIB 4CRWB 3THYB 4ON9A 4A9AA 4I1VA 1FQJA 3PUXA 1IN8A 1IY2A 2DB3A 5LDDC 1RE0A 3ZQ6A 3LXRA 3KJGA 2VSOA 3B6EA 5JEEA 4BWYA 2GVZC 2OFWA 1P6XA 1YZUA 2QGNA 1U9IA 3OESA 2F6RA 5E7MA 3D3QA 5CIWA 3WMEA 4MUAA 3LV8A 4RZ3A 3MUFA 1XPUA 1VMAA 1T4GA 1WB9A 1DAKA 1XTRA 3IUYA 2QTFA 5SZJA 1A5TA 3BAFA 3RNLA 3MLEA 1G5RA 4BFUA 4ZKDA 1GTVA 4KAXA 1KAGA 1ZC4A 3CX6A 3QF7A 1AM4D 3NBZC 5KSOA 1KK0A 2ANBA 4EPYA 2J3EA 2FZLA 1X8JA 4GOJA 4EPVA 4I1OA 2H5EA 4MRVA 3IO3A 4A2QA 5TMPA 3SHFA 1FNMA 1XTJA 1NMXA 1W49A 3EC2A 4LGMA 4BEJA 1XEXA 3QPWA 5CDFE 2A7QA 4XD7D 1NLYA 3EPHA 3BBPA 3IPYA 2GF9A 3K0FB 2GBLC 2ZJBA 4G5QA 4UXHA 4M1SA 4MYTA 1AN0A 2AXPA 1DOAA 5CM9C 2EWWA 1WBDA 4YONB 2J5XA 1YR7A 1OXUA 2GXQA 3O8CA 3UWOA 4RY2A 4DLRA 3ZS8A 3U44B 4RD2A 1SHKA 2AWNA 2Z0MA 1XXHE 4LJ8A 4PXAA 1CJTC 3LBNA 4TTPA 2W6ID 4JT4A 2IS6A 4B6EA 1ZRHA 2XNSA 4C0AC 4F38A 3WNDA 1TU3A 1DAEA 2HUPA 4B2IA 1KSFX 4OI1A 3K9HA 4TYQA 2GESA 2ZRBA 4Q1EA 3QG5A 5AUOB 1OIVA 1GL9B 4EPWA 3PJRA 3LAWA 4B33A 1W44A 1EFTA 5FFMA 4C3ZA 3DM5A 4TT3A 1N6RA 3AVOA 4B3BA 1VYUA 4EFMA 1G3MA 1U0LA 4QL3A 1Z6GA 4ASUD 3L0OA 4HDOB 4A0HA 1T0JB 4LK2A 1J2JA 1GZSA 3BFVA 1KKMA 2IX3A 2JDIA 2HYDA 3A8TA 1GL7A 2Q3HA 1IY1A 3L2OB 4TLEA 1H8HA 3D7MA 1E2HA 2AKAB 1RKBA 1KK1A 1FP7A 4HUQB 2C03A 4B71A 4HI0E 5DO9A 4CZ2A 4ZDKA 3NHBA 1Z28A 3BB1A 2V4ZA 3UKDA 3PIRA 1HTWA 1E69A 4IHQA 1KDPA 2REXB 3CB4A 5FOTA 3I61A 3QEJA 1JALA 3CO5A 3GQBA 3RVBA 1N6PA 1ZIPA 3KQUA 2XXAA 5CJPA 1L4YA 3HR8A 3NKVA 4P33A 4UNQA 5FOVA 5P21A 3ZS9A 4OK3A 4L15A 1I2MA 4JLAA 1NMZA 3IQXA 1GM5A 3VX3A 2J0UA 4GP6A 2F43A 3AUYA 1D8TA 4QGGA 4LOAA 4OI4A 3O47A 1YZGA 3FDIA 1G3IA 1SVOA 2OZEA 1A7JA 1NBME 1KTVA 4KFSA 3LH5A 4MUBA 3MAAC 5FUYA 4F91B 4OQFA 3GPLA 3G0HA 3LNCA 4EUNA 2J7KA 3THXA 1RRPA 1ZBDA 2ZVPX 3KXLA 3RDPA 2P3SA 1D2MA 2CE7A 5L8VA 4Q01A 5C18A 1CJMA 2F1JA 2FSGA 3CF6R 1R0WA 1S0UA 3LQQA 3KUDA 4LZZA 3PEWA 3HPRA 3G82C 2YVUA 2AD1A 3KZ1E 4JJKA 2PX0A 1H65A 3PG5A 3WY9A 2BC9A 4A82A 3E70C 5KYKA 3W3AA 4B76A 1JJ7A 1A2KC 2WWYA 3TE6A 2GJKA 2YHSA 1XB2A 2AD5A 4FWIB 4L9WA 1NG9A 4M1MA 2D7DA 3QBVA 2ERYA 2FSHA 3D31A 4B2LA 2J0VA 2PJZA 3KQNA 1G41A 4W5HA 2HYIC 2XB4A 1U8AA 1HYQA 3SR0A 2W0MA 3TMKA 1E9EA 2GBLA 1KI2A 4I81A 5FPKA 4ACAA 5EP2A 1FQKA 5H8WA 3CX7A 4YC7A 1IAQA 1QHHA 1MRNA 2ZSEA 3SJCA 1E0AA 1E9RA 3GFOA 3R9XA 4DRZA 3QXHA 3AVYA 3CKLA 1W0JD 2GAOA 1IN7A 1YHNA 3QUSA 4G5SA 3O8RA 5EZ6B 3KKPA 2CCKA 5E95A 1II0A 1I2DA 3EPJA 5G40A 2RGNA 4JKYA 2AK2A 2JLVA 1E1QA 3QG1A 2O8CB 2Z83A 1JR3A 4HUTA 3EW9A 1K5DA 2PCLA 2XAUA 4H1VA 4BEBA 2AK3A 4ZV4A 1NIJA 1J8MF 2O8BB 2G1JA 4EIWA 1I4TD 1G18A 2AKYA 2CJWB 2PBRA 4QBIA 2WPDD 1OLOA 1LF5A 4MGIR 4BQSA 2GXUA 2V3CC 4TZ6A 2ZEJA 2WWHA 1OH8A 1OJLA 2GEUA 4EPXA 4W7SA 4KO8A 3ICQB 3M0EA 1QRAA 4F7WA 3P27A 4HB4A 1M7HA 4Q48A 4GDFA 3C4JA 2QRNA 3IHLA 1NLFA 4M1WA 3GJ0A 5D3MB 5HZKA 2ZRLA 2EFCB 1W36C 4DDVA 1XNJA 1SULA 2QMHA 1Z0DA 2CNWA 3Q9LA 2QPTA 4G1UC 1EFRD 4WOPA 3NH6A 5SZHB 3R9WA 2BOVA 2A5GA 3MWYW 4XWKA 4Q4AA 1F2TB 3QKSA 5KPDA 2XEXA 3GEEA 3THOA 4R7ZA 2VP4A 4GPTA 3CPHA 1S1MA 5LD2C 3ADKA 4U02A 1HQYE 1IHUA 2AHOA 4KHZA 4ACBA 2V54A 5CITA 1JAHA 4TTQA 1KYIA 2BMJA 2RB4A 2D06A 2WWXA 3N2IA 3AKDA 4NZYA 4D80A 5B30A 4C7OA 1J8YF 1DTSA 2QL6A 3QSYA 4M22A 3MRSA 4GZMA 4LJ9A 1WA5A 4QFMA 2Z4RA 4URWR 1LV7A 1QG4A 4QM7A 3SJBA 1UAAA 4Z1MA 3HDTA 2YOGA 1YU9A 2XTNA 4EFLA 3QF4A 2NZ8A 3EAQA 2MMGA 3QXSA 4ZO4A 5DNYB 2KI5A 2QE7A 1G64A 1KI6A 1OB2A 2GZAA 4PPQA 4TLDA 4B74A 1N2CE 1P4SA 3DVLA 4AKHA 3TVDA 2WAYA 2VHQA 4HLDA 4KCGA 3VQTA 5FBVB 3AGQA 4GZLA 3Q5DA 3IHWA 4HLUC 4PR0A 4WA7A 4C2TA 2C98A 2F9MA 2L0XA 3QKRA 3KXKA 3GLFE 4XVRA 3T1TA 3K0AB 1OXSC 3CF2A 2VP5A 1JPNA 2RMKA 5TV2A 3WRXC 4KVAA 4B3XA 1ZMXA 4QOSA 2JLYA 3E5HA 4A8JB 2ZI9A 3AKYA 3SQXA 5FR1A 3DL0A 4B34A 1E4YA 2NO1A 2ZANA 2ZITA 1NIPA 4OJKA 5FBQB 2CCGA 3TQCA 1G3UA 3IKJA 1D9ZA 3EX7C 3GFPA 2OFXA 2F7SA 1OXXK 4RKFA 3I8XA 4P31A 5JJKA 2VIIA 1Z22A 4D2IA 4DBLC 3OE7D 4JLKA 5JWOA 2GJ8A 1US8A 1EWRA 4DDTA 3KKQA 1UKVY 4BECA 4P0TA 4GOKA 3CWZA 3CH4B 1IBRA 3JVUA 2BKEA 2QT0A 4H1UA 3LRPA 3EPLA 4FCVA 4FMCB 1PLKA 1AKYA 4KFTA 4LC0A 4LJ5A 4Q5IA 4RZUA 4TLCA 2LKDA 3UG6A 2REOA 2Q0HA 3REGA 2YC4C 2JEOA 5JRJA 3NBYC 3R7WB 2B7CA 3ASYA 2VF7A 1KI9A 4BLTA 5FI1B 3UATA 4EAQA 1OH5A 5HCNA 4JVLA 2Q9CA 4NKRA 1X1RA 3CWQA 2N1BA 3L43A 121PA 1FZQA 1X8LA 2ECKA 4D81A 4JVNA 3AVQA 3MMPA 1M74A 4TYPA 1Y3AA 1P2SA 1QHSA 2ZU6A 1DADA 1OFUX 3KFXA 4D4JA 4DT1A 2QM7A 1IN5A 2IYSA 1KI7A 5FPSA 2ZJ5A 5DI3B 1DAMA 5EXSA 1M34E 1OFTA 4IDQA 1FTNA 4JKIA 4Q1BA 1YQTA 4V03A 1N5IA 3SFZA 4PZZA 2AL7A 2Z4SA 3ADBA 3QEOA 1GITA 1ZW6A 3FPAA 3P4XA 3SFVA 2R62A 3VU9B 4QGHA 5KDLA 1DAGA 1JNYA 2ZUCA 1II8B 3T34A 4C0SA 2PZGA 2P0EA 3VR4A 1JPJA 5C4MA 2A2ZA 3IILA 5ELXA 1VPLA 5HPYB 2XTMA 1PV4A 1XJQA 2F3TA 1CP2A 1D9XA 1T8UA 4NHOA 3M4YA 3W8RA 4RD0A 2P65A 1E79D 1RPZA 4JL5A 1HURA 8OHMA 2ZRNA 2QAGB 1F2UA 3FHCB 3IPXA 4BZXA 2XNDD 3BC1A 4U00A 1AS2A 1CR1A 4C0HA 2Q9BA 5EXTA 1G8YA 2QAJA 2WAXA 5EQTA 3QKUA 2G0TA 4AD8A 3I1FA 3PR1A 1FNNA 2DWPA 4OHVA 4HLUA 5EUQB 5JI3E 1TNDA 1ZM3A 2D4HA 3QKTA 3U3RA 3THWA 1UDXA 2ZR0A 3B7GA 3AVWA 3K70B 1NKSA 2A5FA 4LY6A 1G7CA 4EJSC 3TGPA 1AQYA 3C16C 2ZE6A 3QPVA 4A4DA 1FOEB 4N1AA 2IUUA 1TUEA 4S35A 3TSZA 1E94E 4QJ4A 3RS4A 4DXAA 1SHZA 3A4MA 4JZKA 1I4LD 2GK7A 2GTPA 1JR3E 2WSMA 2IEZA 1Q0UA 1TF7A 2OAP1 2JJ1D 2IXFA 4Q18A 1J7KA 2D74A 4ZIRA 3QVVA 2VL7A 1IOZA 1JQLB 1J70A 1N5KA 4GI7A 1XDBA 1E79A 1ZNZA 5J4YA 1NN3A 2BMFA 4CEIB 3RANA 4HLQB 4BFVA 3TW8B 5KNDA 1QHXA 3B60A 4Q03A 3BGWA 2GK6A 2JLZA 1XCGB 2DR3A 4PO9A 4RD4A 4PAQA 4EDHA 1KO5A 2GEVA 2PEZA 3RRNA 4WZAE 3G5UA 1KOFA 2YWGA 5J4HA 1OB5A 1CS4C 1E9SA 2FN4A 2IYXA 5GJWC 2OBMA 2GDJA 4V0MA 3WYAA 4NCIA 2OESA 2OSBA 4GMDA 2UVQA 5CDFA 4LV6A 2E9SA 2UZ3A 1F6BA 1Q1BA 4PC6A 2FFQA 1MO6A 1P61B 2WSSA 2H57A 4MRSA 2FH5B 1KHTA 3ADCA 1ODFA 4CEHB 2O8FB 2VH5R 3U6BA 1ZIOA 3UIEA 3B1YA 3EZ2A 3CIOA 2QROA 2BJWA 1F3OA 2AFHE 3F5FA 1U8ZA 1N0WA 1XD2B 4D6PA 3CH5A 3LFUA 2C77A 1HQCA 4CVNA 4E07A 4JYCA 2O0HA 1KO8A 4PO1A 2DWQA 3W90A 5JFGA 4AKEA 4KITB 1JXMA 4XWAA 1ZM7A 5HKKA 3K70D 6Q21A 5GJVC 1XTKA 5JEDA 1N0UA 2JA1A 3TRFA 1RJ9A 4B32A 4XH9B 1E2PA 3TJZA 4URYR 3VKHA 2DBYA 1C4OA 1CXZA 2F1HA 2GKSA 1UM8A 1VCNA 2JLSA 1PLJA 2JASA 4JYBA 1LS1A 3SYNA 2C2HA 1ZUIA 3U60B 1OKKA 4M2LA 5AJVB 1FUUA 2FFHA 5FTNA 1UKYA 1P62B 3EPKA 3AP3A 1COWD 3KKNA 2KBEA 2CMKA 2PLFA 2ZJYA 1IY0A 1Q12A 1G8HA 4TL7A 4D0NA 1X1SA 4KJZA 3FKSA 5G3ZA 4OK6A 4GL2A 2QN6A 1UF9A 2A9KA 3DZ8A 4YDSA 2ZJZA 4EJSA 1D2EA 4F4IA 2E87A 2FPMA 4KVGA 5AWFC 1VIYA 2ZS7A 1R7RA 3X1WA 2BHRA 3NC0C 4BFXA 2CLDX 4UJ3A 1VHTA 5C2JB 1FPMA 1AZTA 1QZXA 4NPHA 4RCYA 4M9SA 5DE3A 4CW7A 1NBMA 1SXJA 2XOKA 2RAPA 4M4SA 1T3LA 4OQXA 4UNSA 5CK5A 5EUMA 5DYIA 4O0MA 2W6JD 2HLDA 4PO8A 1KNQA 1KK2A 4JS0A 4G5OA 4JLMA 1XMJA 4HB3A 3TUJC 4DUGA 1DAFA 5CB8A 2PZEA 5JSZB 5KNCA 3UXMA 4JVMA 5DHFA 4Z54A 2ORIA 2Z43A 4R2HA 2DFKB 2WTUA 5CJ2A 4A36A 3FFAA 1GILA 1XEXB 3W3ZB 1XPOA 2FDCA 2GCPA 1LW7A 4JLDA 4Q7KA 1N0VC 1JJVA 4BLSA 3GJXC 3B9QA 2IEYA 3T1QA 2IHBA 4A2WA 2BBSA 4PTLA 5FUVA 1Z47A 4RD1A 4ABYA 1Z6TA 4LYJA 3SHWA 1Z29A 2ZE5A 1ZD9A 4Q7JB 4KSCA 3W6NA 4BRUA 3EARA 2H16A 2OFOA 1TQDA 1SVKA 3OFNA 1E4VA 4G5GA 1UEJA 1J90A 2ZRIA 4U7DA 2ZROA 3NVAA 2G83A 3MWJA 4PPNA 4RVCA 4D4KA 2QQ0A 4BPBA 2V7QA 4M9QA 1R0XA 2ZQ5A 4UQOA 2RGAA 4CEJA 5CYOA 1W4RA 2ZS8A 1ZCAA 2EFHB 1KIMA 1GWNA 2CL7X 2WMNB 2Z6VA 4PAOA 3T06B 3TUZC 1N5LA 1NSTA 2FSFA 1JR6A 3PXGA 3EIHA 4MDFA 2A78A 5L3VA 3FKSD 5FL3A 1VG8A 3RS2A 4ZDJA 2B8TA 4QKQA 4YMVA 1K8RA 4IW3B 5LBIA 4B73A 4F4JA 4ESHA 4HZIA 3BH7A 3BOSA 3ZDQA 1FW6A 3R20A 4ZCIA 2PZFA 2QP4A 4A1FA 1KY2A 2FPKA 5FPHA 3OEED 2XXAB 2YOFA 3NDPA 1CR4A 1UKZA 4HATA 3T12A 4E5UA 4MRPA 2WJJA 5CM8B 1W5SA 3I72A 4Q7LA 1G8FA 5JJIA 1U98A 1NLZA 3ASZA 2F43B 4Q19A 1OE0A 3O8DA 1S1CA 4NH0A 3U6KA 2PEYA 3C5HA 4CGZA 1BIFA 1DO0A 1PUJA 1U0HC 3DPUA 4ZCMA 2ZS9A 2NMVA 4D25A 2RGDA 4Q4HB 3P20A 1T9HA 1U2RA 1ZJ6A 4O2LA 2WM9B 2KJQA 1JEDA 2ZSDA 2GJSA 5FOXA 1Z63A 1N6LA 1ZCBA 3H4MA 1Z0IA 1KMHB 4MGKR 3U4QA 1KDRA 4JLPA 2QBYB 2ZRMA 4V0ME 3HU1A 3IQWA 4WW0A 2HF8A 4JSYA 2ZRGA 3WMFA 3GLGE 4BLQA 2NTYC 4LYAA 5DYGA 1AS3A 3U3MA 5L3QB 4JLBA 1G8PA 1IJFA 1YZKA 3AVVA 3AKEA 1CTQA 3OEEA 4XSGA 2UKDA 4OHXA 1SVMA 1X86B 3H86A 2EFDB 5H70A 4AG6A 4II7A 3TIFA 4KXFB 2IXEA 2FE4A 2BWJA 3FTQA 5FPTA 1SKYE 1VCMA 1NN0A 2ZUDA 2CLSA 5A4JA 2RGCA 1DELA 3TBKA 2VSXA 1W0KD 2CXXA 3KDSE 3L8ZA 4Q1FA 3GLFA 5SZKB 4BFYA 4DVGA 1YR8A 2ASEA 1G3QA 4PANA 2RGNC 4UNRA 4UNPA 2FG5A 2YYZA 1E9BA 3BRWD 1PZNA 3RS0A 4A92A 3SYKA 1E96A 2BIFA 1SVIA 2O8EB 3MCAA 1KY3A 2J87A 4BGDA 4TQ9A 1G7RA 1WP9A 4BRWA 2HCJB 2GCOB 2YOHA 2IXGA 4IFEA 1XP8A 4R9UC 4RCZA 4WVFA 4XD7A 4PPFA 3I32A 1OH6A 1C9KA 1R5BA 2GILA 2KB0A 3T15A 1CULC 1OHHD 3ZVMA 3AQ4A 2AX4A 3KJIA 3NG1A 4D26A 3CRRA 4UJ5A 4M0LA 4UXJA 4E09A 221PA 2EYQA 2HF9A 2FFBA 3A58B 1T3SA 5F9HA 4I1SA 4YMWA 4NE2A 1E2EA 4MKIA 4PFSA 2OV2A 2CL6X 2W6IA 4Q9JA 5EXXA 3WXMA 1P73A 2ODBA 4HSEA 3RWMB 3ZH9B 4C0KA 4FMDF 4QBGB 2ZXUA 4GP7A 3ICEA 3V4FA 5BWMA 2CK3D 2Q21A 3D8BA 3EWAA 3FKQA 1MO4A 5IK2D 2WWFA 1XTIA 1GNRA 5JZVA 3AGPA 1GKYA 4CF7A 1XRJA 3FVQA 4RFSA 2WWWA 1M8PA 4P4SB 3UMFA 3GLIA 1DG3A 1SXJE 4ASUA 1WXQA 2ZI6A 4Q4AB 3THYA 1LNZA 3PCRB 5KPJA 1U0JA 3BD9A 2O52A 2WHXA 4XVQA 1NVWQ 3AF3A 3GFTA 3H2YA 1Q21A 1JQJC 3WP1B 4ARZB 2DWOA 3FB4A 3B1VA 2QY9A 3J81k 2O5VA 2QSZA 1A1VA 2O8DA 3QNUA 4RD3A 4RFVA 3SE0A 4MGYR 1CF4A 4IRUB 4PSKA 1QG2A 3AEZA 2ERXA 3QF4B 2DYKA 3VR3A 2IS1A 4AYWA 1KI6B 1EWQA 2IWRA 2IYWA 2EU8A 2OG2A 2HV8A 4Q7MB 2J59A 2W83A 1BKDR 1RYHA 1ZAKA 2ZM5A 2JLRA 3AF0A 4Q1AA 4B44A 1IONA 1KSHA 5JS8A 1ESMA 1HT2E 4PX9A 1RRCA 4DLVA 4TMKA 3AH8A 4OYHA 1NVVQ 3IEVA 2C04A 5FBRB 4A0GA 4YQFA 3Q5EA 2QI9C 4LPSA 2D62A 2VHJA 1UDWA 4OHZA 1I4DD 2WBLC 3I4LA 3AF2A 1HV8A 3B1ZA 2ZSBA 5DH9A 3ZZUA 2FJUA 2WWGA 3V4RA 3QY0A 2YWEA 4HZUB 2R44A 621PA 2PH1A 3U44A 4PHGA 1IN4A 2RH5A 3U7GA 3OAAD 3ECCA 1TL7C 3SN6A 3CM0A 1N6IA 4AYXA 2YWHA 4B2PA 1ELOA 2AWOA 4Q47A 4MYHA 1VHLA 2GEDA 4MRRA 3NBXX 4NYJQ 2ZSAA 2Q9AA 2YZ2A 3GJ8A 4V0OA 1Z06A 5DSZA 4C9BA 2KSQA 4US1R 4DDUA 5JJLA 1ETUA 1Z83A 4TMZA 2Y8EA 5FOSA 1DVRA 4AIIA 1XWIA 3K9GA 5JHGB 3TAHA 4D82A 2QUZA 3DHWC 4PQYA 3X1YA 3RRZA 4MDEA 2G3YA 2YINC 3NBFA 4NYMR 5A0FA 4ILEA 4DEYA 3VAAA 3T1OA 1A2BA 2QGZA 3I92A 1GIAA 1TX4B 3OIYA 2ZPTX 1E2KA 2RKOA 3IIKA 1GVNB 1T91A 3GLHB 1W0JA 3L0SA 1XJ0A 2GAAA 3LQRA 1XTSA 2IF2A 2J45A 1N5JA 4A6PA 4JBYA 1N3BA 1Q22A 3K8YA 5TXGA 2R9VA 2MSEB 1MV5A 2ONKA 4DSUA 4AKGA 2PL3A 1W36B 1XFAA 1P9NA 2WKRA 4PQFA 3MGCA 3U7FB 5DLQC 2XZPA 2D7CA 5B58C 2G0NA 2I1QA 2OUKA 2QEQA 5EP3A 3LBHA 1XD8A 5FBLB 1W2HA 3PQCA 3TSWA 5KTYA 2WPDA 5B2ZA 2WKQA 1NJFA 1YRBA 2ZYTX 2BMDA 5CIQA 5LD2B 4NCNA 5B64A 4TYYA 2X2EA 2PLRA 5TB5A 2IF0A 4IVRA 3BB3A 4R71A 1D5CA 2NPIA 3PUZA 2Q3MA 2YNMA 4ZI3A 5DHAA 3TH5A 2Q3FA 2ZREA 2EW1A 3AUXA 4QBHA 3N5CA 2YKGA 5FR2A 2JATA 2BM1A 1NKTA 5FBWB 3U7EB 3A36A 2JJ8A 3U3JA 1Q3HA 4FCTA 1D2NA 1ZVQA 3L0PA 4C0BA 4BFZA 5KO2A 1E98A 1EFRA 1CJUC 4NMMA 4QGAA 1JI0A 4Q9KA 4MRNA 4TLBA 1S8FA 1KO7A 2B8WA 3W6PA 5AR1A 2H1LA 4M1OA 4DWJA 3Q7PA 1VECA 1E2JA 1GG2A 1W4CA 4PHHA 4M53A 4LHVA 1LF0A 3L0IB 2ONJA 2MSDB 4D0GA 2OHFA 4DCVA 2ORWA 1KDTA 1GL6A 4OBEA 1N6KA 1UBGA 2HXSA 4ZKEA 3VR2A 3AB3A 4MGZR 2KWIA 4WXRA 2ZRFA 1DAIA 3BXZA 1HY3A 4IKEA 2C9CA 2FZ4A 4DCSA 1KI1A 3RSLA 1Z2AA 1EESA 1W4AA 4IEEA 3SU8A 1UBFA 4KLNA 4ZIRB 3CZPA 5LB4A 4GOXA 2GRJA 1DBSA 2P6RA 3A1WA 2GWHA 2IHYA 3QE0A 3UANA 4LV8B 4JL6A 2ZAOA 3ZZ0A 4JLNA 2ZYUX 1QBKC 1KO1A 3NH9A 4Q00A 3P32A 1P9WA 1S96A 2REBA 2O8CA 2WVJA 3A1SA 2R8RA 4C0JA 3Q85A 2DFLA 2C9OA 5FL7D 3H84A 2X2FA 2IA5A 1NI3A 2O8BA 3QXJA 4FXPA 2BMEA 3AF1A 2CJWA 2C5LA 1T5LA 2DPXA 2VHCA 3GLIE 1JXOA 3AVPA 1KSJA 4IEIA 4QXAA 3OE7A 2B7BA 5JBQA 4YMUA 4WZBE 1GFIA 3UK6A 4NONA 5EP1A 5CLQA 5D3MA 1ANKA 2CHVA 4CYMA 3A1UA 1E2IA 3W5IA 2VP6A 2BEKA 3PFIA 2P5SA 4JT2A 3BORA 3DKPA 2XX3A 4TMVA 3VR1A 1F2TA 1G291 1XXHB 2ZYVX 1XBTA 3S1AA 3SC3A 1YR9A 3O8BA 4C0LA 4LBVA 1QHIA 2I4IA 1S3GA 1LY1A 3DOEA 1NP6A 2QQEA 2IW3A 3A1TA 4UKDA 5CLLA 1XF9A 2FV8A 3CBQA 1O3YA 3FE2A 5FL7A 3SS8A 3BH6A 1TTTA 5JHHB 2FSIA 1SVWA 1ESNA 1QVAA 1KDOA 1TMKA 1Z0FA 1EXMA 1BO6A 1UPTA 1AIPA 3QI2A 4L16A 1WE2A 4TSFD 2R6GA 1F5NA 5BN4A 2VBCA 3DKVA 3RC8A 2QAGC 4DLZA 1DG1G 5HE8A 1OV4A 2P67A 3TR0A 2WJHA 5JLJA 3ZYCA 3GCGA 3LX8A 1IN6A 3QQ5A 4GRAA 2QMOA 1IJEA 1GRQA 2OEPA 4C2UA 2VP9A 1ZU4A 2AR7A 5EE5B 4IVPA 3AKCA 2NO9A 2ODEA 2FA9A 3KXIA 4TYNA 3AVTA 2QORA 3F0TA 4DHEA 1GNQA 2BKUA 1SXJC 4U5XA 4IOMA 1KO4A 3KQKA
chains in the Genus database with same CATH superfamily
1FWKA 4OUDB 2EEYA 1TUIA 5K4GA 5I7RA 4F4FA 2XNDA 1W59A 3FWYA 5CA0F 2OO5C 1Z0SA 1M2OA 3WKAA 4QUJA 5LN1A 3CUSA 2B4PA 3UWMA 2XH8A 2CJPA 4OHMA 2DLNA 3R5FA 4UVHA 1Z45A 4ZVFA 3DF7A 2H92A 4Z0NA 5KFEA 3L7CA 4DM3A 4G4GA 3VV2B 3HKCB 3PITA 5C32A 4B3FX 4BBPA 3LK6A 3M1YA 3PHBE 2O0KA 1OI2A 2C54A 1PIWA 4C11B 2WSEC 1ND6A 5IQ6A 4PYMA 3I5XA 5HZGA 4ZVKA 4YP5A 3B54A 1EAMA 2G6BA 2RCNA 3E3MA 4C0QC 4H0CA 4RF2A 1MHTA 3U4DA 1LW2B 3W60A 2WV9A 3IIJA 3VC3A 4YMLA 2R5FA 2O2JA 5DOZA 3ER9A 1GJRA 1A5AB 4ZYVA 1SGWA 2MB0B 1KI3A 5LXYA 3N9UC 4N3CA 2OCIA 2I3AA 1Z1ZA 2WTNA 5BQFA 4L72B 2VYFA 2W25A 1MG5A 3DMRA 4S1PA 3LF2A 4BQFA 3M9WA 5J59A 1WXFA 5K20A 1CNEA 5EIAA 5LQUA 2WSCC 3BMNA 1HBNB 1COWA 4F45A 3A9CA 4IXWA 3SOPA 3TW8A 3COPA 1CY7A 2FVRA 4J0FA 3PIIA 3TQOA 1N2CB 5CFNA 1X7XB 3NORA 3TLAA 1WHVA 3EGIA 5CX1A 2JHGA 3ITEA 2FTKE 3DM9B 2QMQA 2RB7A 1V1MB 2ONYA 4YVFA 1KMNA 5CFMA 4DQQA 3AV0B 4MRAA 1HE4A 1WMAA 4YAWA 3L04A 2Y1WA 4RESA 2Q27A 3RUAA 2Y71A 1U99A 3SKVA 3ILSA 3CC2S 3GF4A 4J49A 4IFVA 1XLVA 3TK1A 2OM2A 4DYHA 1JVSA 3M33A 4NECA 5ALRA 4LF5F 3MNFA 1G7TA 5K03A 1BJKA 3L6UA 2X5NA 5K8OA 3RTCA 3MD9A 2Z5FA 1SPXA 3FPGA 2IY9A 1E3WA 2FRXA 1MZVA 3TLXA 1BJRE 3HY3A 4YRSA 4OY3A 2J3JA 2GF2A 2XLCA 1SUFA 1V3QE 3RYCA 3GPIA 4HEA6 1FUIA 1JYEA 4WZ6A 4BP9A 5SY9A 3UQYS 3E9MA 5B6IA 4QWDA 1ZJYA 4LZWA 2KRRA 5DP1A 4TT3D 4F8JA 2JDID 4M5HA 1TKDA 1X9WA 1QHHB 2FGOA 1CEEA 2HNBA 4DMZA 3D6FB 2QZJA 2JPDA 3K0EA 1WU8A 1U3CA 1U2ZA 2OMOA 1ZINA 1RI4A 4S1VA 2CQ0A 4MSUA 3CNQS 2X6QA 5DBEX 5KYWA 1P0IA 1Q1ZA 4PZAA 5KYGA 4W6ZA 3KJFB 5AMXA 4ND4A 5LUBA 2AMFA 2HPAA 2ZE7A 3V5RA 3GFZA 3S1TA 1M1XB 1FJXA 3FK4A 3RABA 1XRMA 1PRYA 2ONCA 1N2IA 3GDGA 5KU1A 3I04A 4O4GB 5IDYA 2G0JA 4B9UA 2NSLA 3S6EA 3QSYB 4DMUB 1JWBB 3DDIA 3BGRA 1XEFA 1S1TA 4LX8A 1Y1LA 2EVWX 4W92B 4ZQGA 2UUCF 1KMHA 1I30A 4KFUA 3DWEX 1WNEA 1EU1A 4FPXA 3SJZA 4FDTA 3PPWA 1YJUA 2OBNA 1C3XA 5IKXA 1OWPA 3DZKA 3ZJVA 1XQ6A 3AH6A 4FYYB 1V37A 2P2LA 4RZXA 2BEUB 4CO5A 1L5YA 3DEJA 4CKZA 2UVPA 1T05A 2PI5A 1J21A 1Q7YT 1ZD8A 4YYZA 2OIHA 2HZ7A 3A1VA 4X54A 1UVIA 4PYKA 3JQDA 1TL7B 1KZ6A 5IXYA 4RQBA 3R0IA 4OH1A 2IIBA 4D98A 1Y1TA 3P45A 1K68A 1JS1X 1ISGA 1S6QB 4JI2F 3VJLA 3EGWB 2AYMA 5A6PA 1BYIA 2OT3B 4B3RB 1BKYA 1UJ4A 5J2NB 4JNKA 3B13B 4OK5A 4PRFA 4KSBA 3R3WA 1ZUNB 1U9CA 3L9WA 1H6BA 3SBDA 4MUEA 4QYZJ 4N7RA 4DXHA 2CL0X 4JR0A 1FP4A 1KOLA 1QP8A 5JCJA 3SZLA 1XJWA 3H7IA 3LWZA 3LH2S 1WXDA 1JPUA 3O84A 1H69A 1VKJA 2OCXA 3MAAA 2NSDA 3D6MB 1VHIA 4YCCA 2OEKA 2LGJA 3IWLA 1XA3A 2LQ8A 3N79A 1V5IA 4PZYA 2HMTA 3QENA 1ZRMA 1MC8A 1CUSA 2XE7A 2D0IA 3LW8A 4LVNP 2ZBQA 3K1JA 3CEJA 4TTRA 5HM6A 5A9TA 3FZYA 3LECA 2ZI7A 3K5WA 3CEMA 3OIVA 2P75A 2FDNA 1RAIA 1XTBA 2BGRA 4X8HA 3AF4A 4P7JA 2R4UA 1QGOA 1IN1A 4CM9D 5F1KA 3ROFA 2ZYSA 4BNDB 3PNVA 2M3DA 5FHQA 2DHRA 4KRFA 2AXEA 2H2WA 2ACMA 2HEIA 2O23A 2X41A 4M7WA 3TRIA 2XRZA 2LD4A 3L8EA 1UZLA 3Q0AA 1D8YA 4PAMA 1P2TA 3A9TA 3IUMA 4OV1A 2B4RO 2DVIA 1SVNA 4AZVA 1T6ZA 1QHGA 3N6NA 4BY9E 3KG0A 1KPGA 1DARA 2VPWB 2P77A 2GC8A 1Z62A 5A8RB 1ZD3A 3DHEA 3IEIA 4DJTA 2HFSA 2WFZA 2MINB 1WKKA 4FN5A 3DI6A 3FUTA 5IEBA 3HBMA 1ZSVA 3H2ZA 1RB0A 2LVBA 3QU5A 2QWXA 3ZK8A 4HJXA 1I7NA 3O0TA 3L7LA 1GSHA 4PQRA 4PG6A 3LT4A 2R4FA 3L06A 4P6QA 1NA5A 5AIBA 5IX8A 2NOAA 4AQDA 2IYIA 1ESZA 5ALEA 1JLAA 4ZCPA 1U90A 1I7SB 4HDRA 4BOYA 3T5DA 1E92A 1M75A 3BCSA 2O50A 3TTXA 4LREA 1CS0A 1PR9A 1JRLA 1R16A 1FKOB 2BM0A 1EIZA 2NQTA 3JTOA 4M6WB 3BK2A 4N65A 2P35A 2W70A 3KQSA 1Q1GA 1AHIA 3SICE 4EW6A 1U81A 4KVFA 2DRAA 4K81B 3PR4A 3H5AA 2UUCJ 3LSYA 2QFIA 1EB8A 2I4LA 3CB2A 2I1VB 2B9VA 3WMWA 3HADA 2E18A 3RAGA 3IT0A 1U7XA 4E13A 3SPXA 3BWCA 3ODPA 3HSDA 3FMIA 2B4UA 1MFPA 1ZI6A 1HG1A 4BC9A 4P32A 4DLXA 4I7FA 4OBWA 1W7WA 4IYQA 4YR0A 5DNAA 2AW3A 1PW5A 2J3IA 4U8VA 1KWGA 1LVGA 4NPAA 3PD1A 4DCMA 3MD1A 2CW5A 4FMBB 1JECA 1I1NA 3TX0A 2NUAA 3KXDA 5IJXA 1LTQA 4JI2J 3HM2A 4QOEA 4OPMA 1I01A 1RBLA 1XMOF 3NAHA 2YNIA 1VLQA 1T4CB 5J2TA 2V74B 3R40A 3RR2A 1DJLA 4Q16A 3CXRA 4JIMA 4LQLA 2HHJA 2IDLA 1YS9A 3M4NA 4KL8S 2SHKA 3MWEB 3R76A 4U9RA 4IX1A 5I42B 2ZBDA 2HHXA 4NLPA 2VYQA 3OFND 2Q2NA 4D1YA 1XNQF 4Y7DA 2EBHX 3PC7A 2XIQA 1Q84A 2XLJA 4LR9A 3IOYA 4QLBA 4ZIVA 3I28A 5TLSA 2DT5A 4I6GA 2R84A 4F97A 1YJNS 4LE0A 2JFVA 1Q57A 3WOVA 4JLJA 421PA 2FU5C 2B61A 3RHTA 3J81Y 2QV6A 4WP3A 3QAEA 2MCFA 1FDDA 3SLKA 5KTNA 4ND1A 2A1IA 1RKQA 2NSYA 1KAEA 3UFBA 1XYVA 1QQ7A 4PZ0A 5KOHA 3D0OA 1Z0KA 1G5TA 3RBXA 2FRDA 1WDLA 4HAZA 4I6EA 5F5LA 2ZDOA 1YTLA 3I9JA 1TAHA 3D1JA 4G6ZA 3U3KA 2OFFA 2XG8A 1QUFA 3AL3A 3PUXA 1BXNA 1NPKA 2EDCA 3B6EA 1RQ7A 5CFRA 3ET6B 2GVZC 1QYXA 1ULRA 4CM6A 4H54A 5TEWA 5AD1A 4ZYZA 3TP2A 1O89A 2BDEA 4CCYA 5SZJA 2PX6A 1TQ8A 1UT5A 2EFJA 1L4HA 2H31A 2GCIA 4R2JA 3LT1A 2DH9A 3MR6A 4LGMA 1IVNA 4K9RA 3H5VA 4I4TF 1FEEA 1LDBA 5I9BA 4MA5A 2HWTA 3DPIA 2Z0MA 4PXAA 1RHRA 4F72A 3LBNA 2YMQA 3A12A 1TYZA 2CJYA 2I9KA 3K9HA 3R5JA 3L02A 3ZW7A 3CPWR 1R00A 3AVOA 3IB3A 4RGQA 4HDOB 3OMWA 3DAOA 2FQ1A 3CVYA 4YUVA 1VJDA 2JC3A 1X15A 3GSIA 4QG3A 4HUQB 4B71A 3WWOA 4CT0A 1NKVA 4IR9A 2D5LA 4DC1A 1KDPA 3OOHA 3TIXB 1K66A 3OJUA 5LBUA 3KQUA 1HYSB 3JQ7A 4URQU 1SC4A 1OMSA 4JLAA 2AEMA 4MVJA 1FSPA 1QHEA 2JGMA 2F5GA 2WZBA 4X71A 4FYJA 4WV3A 5ABPA 3N5FA 4Q01A 1D3AA 3KUDA 4GPD1 3PEWA 3BBCA 2GBGA 2B7LA 1E5VA 3WY9A 1LDNA 3MM4A 5C5CA 4B76A 3JTMA 1J09A 4FWIB 4S05A 2HU7A 2CB9A 2XZTB 1TL3A 3KQNA 2W0MA 5ITZB 1VQSA 3SCLE 1MRNA 1UPXA 1E9RA 3FETA 5A4AA 3PX2A 3ITHB 3HFSA 4S0MA 2AJLI 2GBFA 4DJ5X 1VBZA 1O6XA 1FQOA 1YQHA 1VMBA 3A3OA 1I4TD 1J0DA 2B6NA 4PKDB 1EDOA 2E4UA 2DG2A 1PD1A 2HLPA 4H4CA 3NGKA 4L4XA 2ENWA 5F33A 1XNQJ 2JCXA 1XNJA 4KO3S 1KQFB 4WZAA 1SG6A 1A7UA 1Y5IA 4Q4AA 1X42A 5L39A 1BMDA 5LD2C 2ASJA 4QR2A 5F9LA 1TTHB 3FUUA 4A5SA 1U1DA 1HR0F 3X1LB 4I0WB 5I8PA 2YW9A 2XYQA 4B45A 4NG5A 4DM4A 2AFHA 4TWJA 2AX0A 4ZK6A 3G17A 1G98A 1WXXA 4KCGA 1MX1A 3LP2B 5CAEA 3KXKA 4Y2JA 3CF2A 4GKBA 4USUA 1L5ZA 1ZMXA 4NX2A 4Y67A 5BW6B 1UPCA 2BZSA 2RNEA 3RU2A 5T3UA 4YRQA 4EO7A 5KAMA 4O33A 3OE7D 3LIPA 4MPTA 3DNMA 1K8QA 3V4PB 3V8QA 4BECA 4GOKA 3CWZA 4EG7A 4CETA 1Y4ZB 5H16A 2L2QA 2DT9A 4KO0A 3QVKA 3LUFA 5L38A 2DISA 2VNIA 2AFIB 3HCDA 2R6HA 4RUAA 1S2DA 2N3OA 3RU7A 3KT6A 4PLPA 2RGUA 5TX7A 3ZWWA 2ZU6A 2GZ3A 3A3NA 4D4JA 3GXBA 3JQRA 2FPGB 1RUSA 4U7TB 1AY0A 3IT3A 4IG3A 3P4XA 4G1FA 3E2PA 2R79A 1PGOA 1IOLA 2QZ8A 1YRTA 1HDZA 2YNFA 5A6SA 5IXSA 3FHCB 1O6BA 3OZ7A 3B4DA 4J16A 2XNDD 3BC1A 2JFUA 4UQPA 1R8CA 2D1QA 2NV2B 1AZSB 4IUDS 1OYDA 4DQXA 4AD8A 3IWXA 3F9CA 2GHWA 4QJ4A 1U7LA 5DCLA 1SN7A 3A9WA 4EL5A 3AUAA 1IHDA 1WSBA 1SO8A 5K20B 1I3NA 3BMNB 4CIXA 1OWXA 2X22A 3TW8B 5B55A 4EA7A 3CCJS 4KAAA 1Z2DA 1XQ1A 4MKRA 5CYQA 1WW8A 1S6PB 2KT3A 1ZH6A 2HKEA 3PRDA 5CNJA 4V0MA 2UVQA 3NBMA 3QU2A 5CX1B 2FFJA 4CI9A 1NQOA 2VC2B 3JQAB 1ODFA 5B6PA 4H59A 2B1QA 3SZMA 3KQOA 1MB0A 3LYLA 4J37A 4YDXA 1AMOA 2C77A 1LEHA 2OMLA 4QPJC 1XTKA 4EKGA 3DYAB 2IYFA 1I1OA 4RVDA 3UBTA 3SYNA 1RBQA 4M2LA 4RVOA 3DJYA 3H5RA 5AHRA 4M5JA 1COWD 2CMKA 2HGSA 4F2RA 1E4OA 2I6UA 4S3MA 2I33A 5JASA 1WTBA 1X1SA 1AKTA 4KJZA 2QN6A 3OR2A 3A04A 3RVPA 3HFKA 4Y6LA 1B93A 5K8VA 2O5EA 3IGVA 3NOGA 5K0TA 3RYCB 5H3HA 2ZBUA 5B09A 4BFXA 2O14A 3KHSA 1IWOA 2XB9A 1TZKA 3N07A 2IBTA 1YA8A 4JS0A 1HR0J 4KSYA 2E21A 4M1EA 4Z54A 3Q0EA 5LA6F 2E3JA 3R3UA 3GEGA 1GILA 4WBNF 5BNWA 3G8YA 2B0CA 1AMNA 3Q3IA 4O4LA 3SVTA 4ZITA 1U0EA 4YXFA 3GJXC 4LNUB 1RXOB 2OHDA 3CNEA 1DEHA 3NJ4A 2G80A 4RHUA 4EJ6A 3W6NA 3T7SA 1KKHA 4ZHRB 2VJOA 1E4VA 1UEJA 1T0BA 1S76D 4D4KA 2RKIA 2ZVDA 4I5FA 2XMUA 3KFLA 1ZIXA 1D2HA 3ZHVA 4QW8A 3EFOA 4YAFA 4MUNA 3NDIA 1J22A 3PHHA 4XGNA 1MRZA 5FL3A 4ZYWA 2DFVA 3I82A 4JC0A 1ZH8A 3WQBA 4Q0BA 4K9KA 1TEHA 5CA0A 1KMIY 3T12A 4IDKA 5HI7A 1YI2S 2VF5X 2QIOA 4OIMA 3IP3A 2C5GA 4IHAA 4YJKA 1YB4A 4U7UD 1S1TB 2QMWA 3QO9A 3TB4A 2BKAA 2NNLD 1KMHB 5B1EA 2XKKA 5LC1A 5D4PA 2DZDA 4HV4A 1Q8BA 1CTQA 3A3PA 3KLVA 3L1HA 3OTHA 3G89A 1X5PA 1V35A 5JXSA 1T05B 2TMYA 2C22A 1SK9A 3L8ZA 1TYEB 5AM3A 5IBPA 4UNRA 2J87A 4P22A 2I5JA 4C14A 5BYBA 1C50A 3VZIA 4R9UC 4I46A 3HUUA 1V9LA 3TANA 3P45B 3FJ2A 4NBRA 1GT8A 5D0RA 5CDGA 2XCRB 4UFPA 3FGOA 3LKVA 3ZCXA 4QR0A 4PVCA 2ZXUA 5BWMA 4QYRA 5FLXU 2R7LA 1UEUA 3LWBA 1H73A 3ZZPA 3LQ2A 3D4OA 2QMXA 1RAGA 3T3NA 3FVQA 1DG3A 2GO9A 4GO7X 1ZS6A 3ZTTA 1XJWB 4XVQA 1KQSR 2XYRA 3B1VA 2PRJA 1XF1A 4NWIA 4MB0A 3MAAB 3OSUA 3D3KA 1AUXA 1L3UA 1U0BB 1Y89A 4Z0PA 2WQ7A 3EB9A 1H2RS 4MICA 1V5IB 2YPZA 2XCAA 1YQEA 2HH9A 2BE2A 2DLCX 3OLWA 2JLRA 1IEQA 5H9FK 3IMKA 2VLBA 4NBWA 4M0UA 2L42A 5FBRB 3O6QA 5BNTA 3O4JA 2VHJA 3E9ZA 1I4DD 2OO3A 3AF2A 1VP9A 2ZSBA 3B6JA 5HRCA 2VU5A 3RB3A 2DUMA 2D8AA 1TL7C 1Y80A 1SVUA 2AX1A 3P9QA 4KN8A 3PXAA 1EM8B 5ETQA 4FFMA 3STVA 3MTBA 1LPOA 3LDUA 1WC3A 3BTUA 4TVBA 3OT4A 3EIFA 3G5LA 1XUOA 3TAHA 3ON5A 5JCJD 5J2QA 1KQNA 5K8CA 4Y3CA 4I9UA 4FPIA 4LHEA 1IJKA 2JC1A 2JFQA 1VM6A 1N5JA 3JD1A 3IUBA 1K8YB 2IELA 4AKGA 4W6QA 2G5CA 1U49A 1SUEA 3GRVA 3ZW9A 1WHSB 1SELA 2I0FA 3K5MA 5B58C 3IOMA 1XZEA 2XIJA 3RVJA 5I7FA 3GTYX 1ILWA 3V6MA 1YCDA 1KLNA 1NZJA 2EC0A 3BB3A 5HRUA 4EG3A 3T7IA 3ZNNA 2YKGA 4NE9C 1MMFB 5FBWB 3DLEA 4QGAA 1WI6A 2SCUB 4ZGGA 4TLBA 3ETNA 2DGSA 1WOSA 3NT5A 2P2CB 1Q95A 3BKXA 4XDZA 5AK6A 3Q7PA 1W4CA 5LBTA 4LKRA 3TI0A 4MUGA 2ONJA 1Q0ZA 1BNCA 2ORWA 4LRYA 4MGZR 3KQYA 3V6DB 1U3DA 3BXZA 3DAPA 3OPYB 1Z2AA 3ZI0A 4H6PA 4URGA 5LB4A 4BQPA 5TGZA 3EVCA 3A1WA 2OYRA 3D6HA 4H60A 1CQJA 2W22A 5AXCA 1OOEA 1JJIA 2O8BA 1KQPA 2HFKA 3GAAA 3O2SB 4TTVA 3K92A 3UI3A 1S5PA 4KWEA 4MCIA 4EZIA 5JUWA 2MYFA 1TECE 3BPSA 1EVYA 2O0MA 5GP1A 4XUCA 4I7FB 2BGJA 1PFGA 4OJ1A 2LDYA 1MBZA 4YRPA 4KN6A 2FSIA 5GAGU 3W06A 1Z0FA 2ACVA 3QI2A 5B3KA 4WADA 5BN4A 2XY6A 2NUAB 2J6SA 4TWIA 4TNOA 3ZYCA 2Q8QA 2QRVA 2F17A 3AKCA 1DFHA 2WZ1A 1BOOA 1EFDN 3D1VA 2HFUA 3AI7A 1SAYA 5JMWA 4U5XA 4CMAA 1KO4A 3M6UA 3ENVA 3G8QA 3MB8A 4LHZA 5BMOA 3PDCA 5HF6A 1RU1A 1QJCA 4P5DA 1VG0B 2W7AA 1LBTA 1IXZA 3UCXA 2IDEA 1U1OA 2BUAA 2AN3A 5FTMA 4II2A 3FPEA 1ZR4A 1R5OA 1N6OA 2PKXA 2QX6A 1V25A 4PYJA 3KKOA 1XU9A 1AB5A 5MGNA 2G1AA 1D1UA 1MO5A 3MM8B 2RS8A 3WS7A 2JJ1A 1FFXB 1FERA 5B0DA 3IV9A 1PR3A 2AGPA 2ICAA 2XPCA 4V0KA 4HAWA 4CR8A 1WULS 3ZIDA 2X8JB 4LSWA 2HWXA 2WD9A 3FFBA 1O97D 4OHOA 1SXHA 5H4HA 1OX4A 1SB6A 2XZOA 1QC5B 3NOCA 4P93A 5KOHB 4MKHA 1T3HA 1Q7EA 4O0NA 3UQZA 3R7NA 1QAJA 3T95A 2O1XA 2ZR7A 4QBUA 2JGAA 4DJFC 2PZ8A 1J8VA 5BSWA 3PC8C 4LOKA 1T1GA 1K0VA 2Q1LA 3FOCA 4PZ9A 4CTNA 1UPMB 1HPZB 3TWOA 1QD1A 4DANA 5E6UA 3VU3A 2DIUA 4A15A 5J2MA 2H7CA 1ZK0A 3DO6A 3ITKA 1AQ6A 1GNTA 2ATIA 3W5YA 2FPLA 1YGYA 1Z37A 5FPPA 2YX1A 5GJBA 2Q66A 2W6CX 2I3DA 1F3VA 2K8GA 3FOBA 4CLUA 1NG1A 4KBIA 1HWKA 4A23A 2R6R1 4GPAA 1RHRB 4USTA 2CJYB 3DKRA 2W8LA 3WNCA 3WTCA 3R41A 3W7VA 3H97A 4YY3F 2FZWA 4AYBD 1WDMA 3WZ2A 3LSTA 2XGSA 1JDBB 2FLVA 4Q02A 5JS7A 4RUHA 1GKLA 3JQ7B 5A9RA 2F9FA 4JC8A 2AD9A 1W1WA 1YVUA 4WLNA 1GZ7A 4QWMA 5GPBA 4CTOA 2JIOA 5L9XA 3R7SA 1U0SA 2X1FA 4ZAFA 3NIWA 5DISB 1YI1A 4X6UA 3WYEA 3DEFA 4WE1B 2BW7A 2V7TA 1Z0JA 4EA6A 1AXGA 4YUZA 1AKQA 1BYUA 1EARA 1G20A 4BLRA 2I3BA 3EZ7A 3AVUA 2BOAA 4QVGA 3I3SR 5DNWA 4CM4A 1TL3B 3QMMA 4KQ9A 1FYWA 3ZNJ1 4AROA 1UKBA 1BHNA 1X4CA 4Y6IA 2F8EX 4WCFA 4W5WA 3JVDA 2WYHA 3C8UA 3Q2IA 2PPLA 1O87A 2GHQA 5KVCA 3SMQA 3MR5A 1PBAA 1T1RA 5K8LA 3A3OB 4ZPXA 3CE8A 3VFDA 3LP1A 3CEPB 4MVJD 5LCXA 3OICA 1B0PA 4FS2A 4MPJA 4W8HA 4N6NA 2JLCA 1GN9A 1HLPA 1O96A 4WZAB 1HNWF 4UVDA 1DIHA 5IT9A 1Y5IB 2MQ8A 4HD8A 2QTBA 2O01C 3RAFC 4BV9A 5LKAA 2RUSA 3ZXYA 1WUTA 3EVZA 2AFHB 4QVKA 4Y2GA 3GG0A 5IFMA 3N3AC 1DKQA 3TOXA 2CVFA 4CCSA 1P7YA 2IFXA 1UA1A 3RK1A 1G5PA 3JTEA 4O0IA 1VB3A 2OHJA 5JBIA 4RK6A 2AG6A 5CAEB 4P52A 2GHVC 5TVKA 2VICA 2BW0A 2OHIA 3T99A 5K8TA 2HCBA 1DC4A 2QW0X 3DXSX 4QO8A 2BEJA 3ULKA 1JE0A 3FMBA 2DH7A 1Y9OA 4G1BA 5I7VA 3JB9k 2WOOA 4XTRA 2DR9A 3A0RB 4PSDA 4MQEA 3UTCA 1EFAA 3KJQA 1N5OX 5COQA 3V4ZA 4KQMA 2R2RA 1QFSA 2VDLB 5ETVA 3ZDRA 3QZ7A 5JSUA 3HXPA 3T94A 2OORA 4HRAA 4IYRA 4ZCRA 1VCOA 1ID8A 2QVGA 3QQPA 4URUR 3UA3A 4MR9A 4UCXA 3JYPA 1U8WA 4HT3B 4UEWA 1G66A 1QTIA 1YSJA 1NJSA 2F1RA 4OZLA 2KJVA 2RI6A 2ZJ7A 3CCCA 3BMQA 4I4TA 2OILA 1KVQA 5J47A 2D2EA 3ABIA 5A6SB 4D3YA 1U0TA 4PZCA 4D9KA 3PEFA 5IMBA 3TEFA 2ZRAA 1E9CA 1B7GO 2POQX 3O82A 4PGHA 2DGVA 4PYLA 4AWBA 3E2IA 3OPMA 4YY3J 1BHSA 2HVEA 1PNVA 4B7ZA 4B0OA 4DS5A 4LVOP 5CG2A 1NPPA 2RSLA 2FFAA 1E9FA 5DBFA 2YWKA 2RH3A 1I7QB 2E7ZA 4C4SA 3BD7A 2IVMA 3GT4A 1T4MA 5KBYA 1MF7A 5TDHA 2XCUA 1YKWA 5FP0A 3FTPA 5BUZA 2A35A 4OX6A 4EQ6B 2VCHA 2FY1A 2FW0A 1ZD1A 1TUWA 5H3LA 3IL2A 1JZSA 3IAM6 4DA9A 5D4NA 2HMUA 1P2VA 5EJ8A 5D6NA 1BH2A 2QK4A 2I38A 1YJVA 5J2TF 3OECA 1AGRA 4USHA 4E98A 4D9MA 3IBYA 4O2RA 4LMBA 5J4VA 1N6NA 4XDHA 1WC6A 1HWLA 1X2BA 3EBOA 4PXCA 1K2VN 4WOCA 1DMRA 5K8UA 1E3JA 1U94A 4FLMA 4GFDA 7ADHA 1NW5A 4D3HA 5DGCA 3QIPA 4E7OA 1FF2A 2A9PA 1T3GA 2X1GA 3OT1A 1TRKA 1AZSC 4BV8A 3KEMA 1E2FA 1EHIA 3QWIA 2DQSA 3JTPA 1Q1AA 3ID6C 3VDXA 3OR2B 3SMVA 2OCPA 5C8ZA 3K0CC 1HNWJ 1SC3A 3DDOA 1U2DA 4KMRA 3FJYA 3GJ4A 1APBA 5ETLA 3NONA 4H6XA 1V8ZA 2OCYC 2BP7A 3U5ZB 4DA7A 1E2NA 4O4LB 1M33A 3KQVA 1WZ2A 2IJRA 3NOOA 1ITPA 1MA0A 3ZE0B 3H75A 3NT4A 3V6KA 3CZ5A 3HFVA 2H4JA 3QYYA 4KODA 1BY9A 1EE9A 4QOTA 2EKPA 2KM8B 4AX8A 5AK5A 1C9JA 5IKOA 5DXAA 2N42A 1WMEA 1S2LA 4PUOA 2RKIB 1RAOA 3DV2A 4OQLA 3F46A 3RIXA 3TLGB 1U2CA 4WXYB 1AV6A 2GZ2A 3DT9A 3RHFA 3EFOB 5FA5A 4LX0A 3MJVA 1AS0A 4DCJA 3EVBA 1DY3A 4QYMA 1QP7A 4I3HA 1E2UA 4Q0BB 3KCNA 1MB4A 3M5CA 2R7KA 3B53X 2V4UA 3M1LA 5CA0B 3CKKA 5M5BA 3M6XA 5DBOA 3CO0P 4YRGA 3TJMA 2J8ZA 4FONA 3VVMA 3T3PB 2BJDA 4XD2A 4NENA 5JW6A 4DG9A 4BNTA 3QO9B 5FH9A 3IO5A 4CQMA 4OHUA 3M2RA 2MR6A 3C16A 1A82A 2O3SA 4DL7A 1Y5LB 4FEGA 1SQEA 3CT4A 4PFJA 3BAZA 4FZ3A 1H7XA 4AY6A 4AJKA 1XTTA 3UD4P 4PWWA 3DT8A 3A3PB 4F4YA 2AOTA 1LBSA 3KZKA 4MVJF 4JMLA 1YOVA 4MEJA 2P9CA 1EP3B 4G8BA 5A0YA 4FJ0A 4JJZA 3G0BA 3SZUA 4OLHA 2MJLA 1XZQA 4W5RA 2JVRA 2QMEA 5D7NA 3F8TA 5JAZA 2R7OA 3N2EA 1UQTA 5KFCA 1AJEA 2BCGY 2LQJA 4NFLA 3W04A 4EF5A 3OFEA 4FYKA 5A4MS 1VQ1A 5EX3A 1UEIA 2PA0A 2ORVA 1BTOA 2ZIEA 2W4IA 1RAGB 4C3OB 2XWQA 3DV9A 1VQOS 4EUSA 2J08A 5TMBA 4JELA 4L8LA 3ZHCA 5KMGB 2FPHX 2FKAA 4P5EA 1T4GA 4HXYA 2EZ8A 3IUYA 4YCJA 1JF8A 2OZVA 5KFYA 1NSAA 3IMQJ 1SBNE 3QF7A 1AKUA 2C9BA 1UBKS 4LT6A 3OPVA 2XBPA 5J43A 3FCUB 2BE2B 1RXUA 3WWZA 2LFVA 2U1AA 1W49A 2LCIA 3K94A 4RTOA 1GZHB 4ND6A 2HB6A 3WGOA 4XM2A 3SMZA 4MI6A 3ZV7A 5HK4A 3RB4A 4AY3A 4LF5B 2W2MP 2HUPA 4CYUB 4BQIA 3PJRA 3QG5A 2VUSA 1Y3DE 5FFMA 2ZB3A 3QVJA 1JKJB 3N2GB 4FGLA 2CJ9A 5J2QB 1QPBA 1NONA 4YPFA 1PCXA 2F90A 5IANA 1IBMF 2DH6A 1VJTA 2FOIA 4HI0E 1U11A 3NHBA 4ZDKA 2XOXA 5EUBA 2IRYA 1ULHA 2QRHA 1P7WA 2VRBA 2AI1A 2J0UA 2G72A 4QGGA 4UEJA 4WBNA 3MAAC 5AHWA 3VKFA 3V7WA 4Q24A 3EWIA 4UZBA 3LQQA 3DLEB 1NW3A 5LQDA 2YVUA 3TX2A 2VA9A 5TF0A 4BAZA 4HTFA 1DDIA 2GJKA 1RU2A 4P1ZA 3FCVA 3D31A 4AF8A 4G65A 1U8AA 4F21A 1Z4KA 3TPZA 4ACAA 3Q7RA 4M5KA 3TAMA 2FJVA 2FHPA 4C6HA 3UJ9A 1FQKA 4M54A 2F3JA 1E0AA 3OUYB 1YHNA 4Y98A 1XDDA 3D6HB 1PFKA 3QV2A 3KKPA 2Y9PB 4F3RA 2QIFA 2OPPA 4OZNA 2ZZTA 1I80A 2B5JB 1JR3A 2ZOSA 1CQJB 1RWUA 3PFHA 4BEBA 2O8BB 4EUVA 3WLTA 4QE3A 5D4OA 1OXMA 3MM5A 3ICQB 3M0EA 1D2CA 3ZY3A 3IHLA 5HVFA 5CJJA 2DGUA 2NAPA 2EFCB 2QR5A 1L3IA 4LWPA 2JIPA 2UUCB 4OHCA 3N75A 3DOLA 2A0WA 4R7ZA 1FHTA 3HCEA 4HNAA 5T6MA 3VZCA 2MYUA 5A2QU 3KLEA 4RTRA 5F2NA 2RB4A 3N2IA 1CT9A 1QIMA 2WK1A 4Z7YA 3S8MA 4TXNA 3F2VA 1LV7A 2FN3A 2ZH2A 1N5SA 2BYTA 2KI5A 3OSPA 5KYXA 2W24A 1P4SA 3FQKA 1J0CA 1RWWB 3ZU2A 4PX2A 5CXTA 2Z1NA 3VSEA 2F9MA 2GYVA 1YDLA 3HA5A 1R8JA 4XVRA 2IOHA 1RE1A 2PD1A 2V0GA 4JI2B 3FOWA 3V5NA 3FGVA 3QTBA 1OXXK 1YCGA 1TI7A 4JLKA 4HDAA 4H3VA 3GMSA 1WY5A 3O31A 3EDCA 2EGHA 3NZEA 2XXBA 3FR8A 3SBXA 4UE6A 4W4TA 1E8NA 3SIXA 1VSQA 4WKCA 1D4OA 2JD1A 2HNDB 3IAAA 2FPPA 2NYVA 2YMMA 2NSHA 2W2QP 1MVOA 1K7SN 3DXXA 2AF4C 3L5OA 1XAGA 1XRQA 4XEHA 4XARA 1N5IA 2Z4SA 2B1RA 3T34A 4BMZA 1O6ZA 1C3OB 4RHEA 1JPJA 1PV4A 4FHDA 3TLZA 1UQUA 2VT2A 2ZRNA 4YRFA 4BZXA 4U00A 2NZYA 5EXTA 5E5NA 3KDAA 4H7KA 3D54A 1WKBA 4M46A 1IBMJ 4ZOSA 3AVWA 1CY0A 4A48A 5E6UB 5KT2A 4YGYA 3TVYA 1NR7A 5J2MB 1Q0UA 1AYEA 2JJ1D 2DGOA 3HDJA 2EG1A 3ND7A 3CIZA 1PQUA 4B08A 4CO1A 3UMJA 2FJBB 3G2KA 3VMMA 3H5TA 1ULAA 5A0VA 4EUFA 2PEZA 4MWCA 2PTGA 3HWX1 4CIOA 1JG3A 1JKIA 1P61B 4RXTA 3NAZA 3U39A 4XR9A 2QTZA 4C7JA 3AT1B 1X9MA 1AUDA 4A26A 3IBFB 2QX8A 2ETVA 4UDXX 2R6ZA 4CH0S 2XUZA 3CH5A 1G2PA 3LFUA 1JNZB 3CNHA 4DR7F 3W79A 2Q6CA 1RYRA 1WETA 2Q6LA 2FRDC 1NI5A 1N0UA 3AR5A 2X9QA 1BWRA 4O0LA 2GPYA 1W5FA 1C4OA 4CFSA 4QUDA 3DLLQ 3NOQA 4F9GA 1UEVA 3W2TA 3UMYA 1YACA 3R6LA 1PGNA 2VDUE 1UF9A 2I1RA 3S4YA 1F8GA 4LVNA 1GZ6A 1CEXA 4HQ0A 1F9EB 2XNKA 4RZIA 1P4HA 2XOKA 1A3CA 4M4SA 1BJTA 1IL0A 1JHRA 2WU8A 3QVMA 3FZEA 3MINA 1KK2A 1G20B 3CJ3A 3CY6A 2G76A 3K9BA 3NCPA 4CM4B 4ZDNA 4KWIA 1QMGA 4MKYA 4I1IA 1JAXA 4WCFB 4YJDA 1WOPA 2EIXA 1LBHA 3D1OA 1SPBS 2ZE5A 4KSCA 1PZGA 2IH5A 1DUSA 4DBVO 3BEDA 3S2FA 5DRYA 1BD4A 1JLSA 3NVAA 2C4NA 2V4RA 3H3XA 1X0FA 3L4SO 1XMOB 1R0XA 3R3SA 1DLJA 3IV6A 2HMAA 4AXJA 2FSFA 1LNQA 3KK0A 1JDBC 3EQZA 1QYCA 2DKOA 1P1JA 5EEHA 1FW6A 1GY8A 2XDQB 1QIJA 1ACMA 2E4YA 2HJ9A 4S04A 1XNQB 4MRPA 1RACA 2WJJA 1TC2A 1W5SA 1Q8LA 2W6OA 3O8DA 5IS2A 1RJWA 5EVCA 2ZYAA 5BYRA 3TZWA 3WOHA 4PLTA 2V94A 3HU1A 2HF8A 4ML3A 4L5JA 3BSCA 5HBGA 1ZW1A 2AYBA 1U5BA 5FWXA 1Y9EA 3AXKA 2BL4A 4K1XA 1XAJA 2E4VA 4DZTA 1SKYE 1W93A 2GPAA 2IPMA 3DH0A 1W5BA 1F9AA 4AMYA 3OZWA 2PX2A 4A92A 3RS0A 2FJDB 3T9CA 3C5EA 3KJQB 1UZHA 2PXCA 3JZFA 1P9QC 4W7IA 4DWVA 2KG0A 1BHJA 1Y6FA 1OH6A 3Q3VA 4WASA 3CRRA 4UXJA 3KOXA 2H59A 1T3SA 4KXXA 4IQ0A 2W6IA 1IJBA 5JZ9A 3OQ6A 4MR9B 4QFBA 3X0DA 3EWAA 1U1PA 4IIBA 2FW9A 1GHTA 4RFSA 1CE8B 1ZN8A 3PQ3A 1XCJA 4C29A 1R50A 4INOA 2KMLA 2J3QA 1JBQA 4I4TB 2WONA 3M8WA 1P29A 4OU5A 4EQZA 1JQJC 4QO7A 1U31A 3U4MA 3N8KA 5IVHA 1Q8KA 4RD3A 5EJGA 4RVNA 2UZ1B 4DR7J 1CUZA 3I9NA 1QVGR 1ECPA 4GIBA 3PDWA 4B44A 4Q1AA 1YQXA 3IGNA 5AHXA 4UDOA 5JS8A 1KS2A 3J7AC 2DHXA 1V7ZA 1UDWA 1G5IA 4KE5A 2PK3A 5KI6A 3HCFA 2D0OB 3BIWA 3QFFA 5EIFA 1N6IA 4B2PA 1JMYA 2XGPA 3HKDB 1ETUA 2ZJ4A 1DVRA 4AIIA 3QEMA 2LQBA 3B6IA 5IKMA 1T7PA 1Z33A 2ZPTX 1H66A 3IIKA 2IPXA 3WJAA 4I4BA 3KV1A 1DWQA 1SEPA 2IF2A 3WZMA 3QX9A 3T3OA 1RFGE 4K4WA 1F17A