3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
4RD6A 1G16A 1Z63A 1YHNA 4PX9A 2WOJA 3LBNA 3FMOB 4URWR 5K8IA 2IS4A 2EQBA 2ZANA 1G3IA 2DR3A 4HAUA 2RGCA 1NMZA 2IF0A 2FSFA 1Z47A 1WA5A 1E9CA 4KV9A 5ANRB 4GZMA 5H1YA 1DADA 3FTQA 3KTAA 5CK5A 3KFVA 1S96A 3QSYA 2EU8A 1KZ7B 2VH5R 4IDNA 4MGKR 4TMKA 4CT5A 5JWRA 1CRPA 4Q21A 1HV8A 3GPLA 5L3QA 4B71A 4DJTA 1KK0A 4ZCMA 5AJZA 3BH6A 2DB3A 3WYGA 2ZRGA 1UKYA 3LA6A 4O2LA 2ZUCA 3ASZA 2N1BA 3PUVA 4PSKA 1QHHA 3AVOA 4LJ5A 2QPTA 1MV5A 4QM7A 2BJVA 3LXRA 1MO6A 3ZZ0A 2H8KA 3E1SA 2OCYC 1KO8A 1VCOA 3PCRB 2P5TB 3GCGA 3M0EA 2JLRA 1OFUX 2ZSEA 2VP5A 4PC2A 2G6BA 1GOTA 5BW8A 3ZVNA 3ZQ6A 2RB4A 1D9ZA 4NYIR 4KFTA 1GNRA 1KZGB 2ZS8A 4JYBA 4MA4A 4Q4LA 3KTAB 1ZAKA 2GEVA 2WMOB 4GP6A 4OHYA 3OHMA 2GRJA 5B58C 1Z83A 1XWIA 2BIFA 1G7SA 1G7RA 1TUIA 4OQNA 4US2R 1QG2A 2QGZA 1Q12A 3TR0A 5L3QB 1N6KA 2JLQA 4HLQB 4EQ6A 4UNNA 2FGKA 2HDNB 5E3HA 5JFGA 3KQKA 3I5YA 5J4KA 3F5FA 1G17A 2VRWA 5DHAA 4B44A 2FSGA 2FZLA 4C3ZA 4RD3A 1GRQA 1DAHA 3AVVA 4B3GA 2CE7A 3ICEA 3NIBA 4YQFA 2NZJA 1P3JA 2GZDA 3BK7A 3PIRA 5L3RA 1AZSC 2ZRLA 3IIMA 4HEJA 3L2OB 1A5TA 1XEXA 4JLNA 1HQCA 4JJZA 3K0FA 1G6HA 4M21A 4O25A 3FKSD 2WSMA 4Z8YA 3LQQA 4CEJA 3AVQA 3RS4A 1XU4A 2OBLA 2FWRA 1E2EA 1XEWX 2X8AA 1VIYA 4QJ4A 3VTKA 3SS8A 3M1IA 3X2SA 3WNCA 1T91A 2G1KA 3LXXA 3QVVA 4ON9A 2ZEJA 3AVPA 3K9HA 4UQOA 1KO5A 3OEHA 1ZRHA 3AB3A 4JMPA 2W0SA 4LDJA 1CXZA 3SQXA 4B3DA 2XTNA 4OI1A 4C0LA 4EQ6B 2J45A 4NYIQ 4YDSA 4JLKA 3AUYA 3MMPA 1T5LA 4Q9HA 4WIAA 1LFDB 3B2EA 5L3VA 1F48A 1OE0A 2G0TA 3A1TA 4LJ8A 3A4LA 4JBYA 1QHIA 1U0JA 4EPTA 2VP9A 4TTQA 1CIPA 2ZVQX 4TYPA 3DO6A 3U44A 1W0KA 2OUKA 3GQBA 5DI9A 5EXSA 4OBEA 5H70A 3TW4A 1PLKA 1XEXB 2F1JA 3K0FB 1RIFA 5FH9A 1DOAA 2BMDA 1QZXA 2WVJA 2XSZD 1R4AA 3MSXA 4RVCA 2V3CC 5FBLB 3RC8A 3B1YA 5LB2A 2QL6A 2EFGA 3LVQE 1KI7A 3H1TA 2IUUA 2EVWX 3K70C 4XIGS 4QKQA 1X1SA 4NHOA 1SVLA 2BKEA 3R8FA 1EWQA 5JHGB 3CF0A 1T8UA 4TSFD 1AS0A 1KKLA 1W7AA 3VX3A 3TKLA 1CJMA 1CEEA 4B74A 1FQJA 2A3RA 4MRNA 4IFEA 1VHTA 3IIKA 4QC2A 1U0HC 4D4MA 4I81A 1G8GA 3QXJA 2VL7A 1OXVA 3RC3A 2ODBA 3NDBB 1Q1ZA 3U44B 2Q21A 1OB2A 2GXAA 1N5IA 5BQ5A 2DWQA 3U3KA 4ZDIA 2VP2A 2AL7A 4DLSA 2DHRA 1J90A 1LS1A 3EAQA 2N42A 4G1UC 3WY9A 2REOA 3KJGA 1OIVA 5KDOA 3JZAA 2F1RA 4B6FA 4BLRA 4AKIA 4C0JA 4RZUA 2O0HA 4IOKA 4XVRA 1A2KC 1N6IA 1DARA 1UBGA 1WF3A 4QBFA 2P6RA 3ZVRA 3I92A 3RNLA 1E4YA 2RGNA 2Q3MA 3AGPA 3RDPA 3JVVA 3KXKA 3BGWA 1TF7A 3F0TA 2GESA 1ZMXA 2ZUBA 2HV8A 4WA7A 4ERNA 2BM1A 3PUYA 1RYHA 1IN4A 3OFNA 4DSTA 2KBEA 3W9YA 4W5JA 3V4FA 1FQKA 2OAQ1 4TTRA 3REFA 1KMQA 2QP4A 5J40A 3LFUA 4MYHA 1LF0A 1GKUB 1SXJD 4TMWA 4EPXA 1KI6B 1E0JA 4ASUD 4P4SA 4LJ4A 5FL7D 4LC1A 3BB3A 5TXGA 2WWXA 1AGPA 4A2QA 2HLDA 4GBMA 3QNUA 4Z51A 4F4IA 3K1JA 4UXHA 2QBYA 3EXAA 3OIVA 4M1WA 1IN8A 2AD5A 4Q7MB 5C4GB 2ZYWX 2F3RA 1RJ9A 4YMVA 2XGJA 4PC1A 1VMAA 1AZTA 2D3WA 2ZE5A 1OV4A 4AC9A 2XXAA 3W5IA 3TBKA 3T61A 1JAIA 2PX0A 1WRBA 4PSAA 1ZD8A 4B3CA 3QXHA 4DLUA 2AHOA 2R44A 3O8CA 1Z08A 4TQ9A 1XX6A 4PQRA 5G3YA 4WBSA 1L7VC 3IGFA 3CRW1 4GZLA 4F92B 4B73A 1XJCA 3U7FB 1E9RA 4DVGA 4Q5IA 2D74A 5HKKD 1XNJA 3FDIA 4UJ3A 3HJNA 4JLOA 4TYWA 3BC1A 3DMNA 3DZDA 2FU5C 2ZRCA 1TADA 2FPLA 4M1SA 3SYKA 2I4IA 1GVNB 4P4SB 2QG6A 2FFBA 1KGDA 1Q1EA 4HB3A 2FZ4A 4I1OA 3LVRE 1R0WA 2KBFA 1U81A 1KKMA 1AKEA 2WOOA 1RYFA 4DCTA 5KSOA 4LBWA 3ZLJA 3CX7A 4GI7A 3I3SR 3SBDA 4A6PA 1W4RA 2QI9C 2JDIA 4YMSA 2QBYB 4WVFA 1RJ9B 1Q3TA 2ZAOA 4KFUA 1KI9A 3CNLA 4EIWA 4TLAA 4HLDA 3BFXA 5DHFA 2QRZA 4JKYA 2C77A 3ZYCA 1KY3A 2ASEA 2DFNA 3TH5A 2GCOA 2G77B 4C9BA 4G5RA 3C14C 2QSZA 5KU1A 1E0SA 5EQTA 3DM9B 3LD9A 3MFYA 5F3WB 3SC3A 3ZQJA 1GM5A 2GILA 1TUEA 4JVSB 4Q47A 4DIEA 4A36A 2KE5A 2ATXA 1E2DA 4GPTA 1QHSA 1GNPA 3TUIC 2NPIA 1LB1B 2IEZA 1YRAA 2YNMA 1R5NA 2DYKA 4C0HA 2XX3A 3MCAA 2EFCB 4DB4A 3IBGA 4YLGA 1N5LA 2VTKA 2REXB 2ANCA 3JVUA 2V7QD 2NPFA 1VHLA 1FFHA 3ECCA 3TUZC 1DTSA 3THXB 2P3SA 5G41A 5BXQC 3A36A 3GLHE 4UNRA 2AKAB 2A5JA 3KL4A 3L0SA 4ESHA 2XNDA 5P21A 4N3NA 1J8YF 2ZQ5A 1KJYA 4EPVA 4GRAA 3N70A 2R65A 3B9PA 3QVUA 4C0SA 2GCOB 4TMVA 2FDCA 2R2AA 1JXOA 4AG6A 3BE4A 1Z0DA 2GXSA 3B9QA 2OBNA 1ZJ6A 4UNQA 1Z0KA 2QM7A 2L0XA 2NQ2C 4P3YA 5FOXA 4R2IA 3OIYA 4HAVA 2XJ9A 4HB0A 3AQ4A 5FI1B 4BECA 2JLVA 4LYHA 4A0HA 4DEYA 2HXSA 1TQ6A 4QHSA 5FTJA 1G4AE 2ZVPX 5FTMA 3VR4A 4KITB 3W5JA 3P32A 4OI4A 1TL7C 2IW3A 2AWNA 5AR1A 2CJWA 3B8HA 3AKCA 4NKRA 5F2EA 2PZEA 2QENA 1Z8FA 4NCIA 4DCNA 4YXWD 2OV2A 2JLXA 1B0UA 2QAGA 1G41A 3ASYA 1TMKA 2P67A 2IWHA 3B78A 1HTWA 4YMWA 1FPMA 4DLZA 2Q9BA 3TSWA 5FUWA 4BLOA 1P60A 4MH0R 1WMSA 1YRBA 4PQYA 1ESNA 1W2HA 4LX0A 1CJUC 3UMFA 3EZ6A 1OXSC 2FH5B 5SZJA 1Z28A 1Q44A 4KYUA 4Q7JB 4LHZA 3RVBA 4LRWA 2BJWA 1N0VC 4I4LA 3T12A 1CTQA 2A5DA 2OLKA 2H7VA 1W2GA 1H65A 2FNAA 2WJIA 4BRWA 5IHPA 2CLDX 5CM9C 5JJIA 2PZGA 4XD7A 1GL7A 1UADA 2ONKA 3H86A 1E1QA 2BEJA 3GFTA 2O8BA 2O8EA 5KYKA 3SOPA 2CMKA 5BN4A 1ETUA 4RCYA 3Q7QA 4LV6A 3AP2A 2CJWB 1AGRA 2XTMA 3A1UA 3C41J 3GJ6A 4ZDJA 5GVSA 1H8EA 3CLVA 1EX7A 2IYSA 5G3ZA 2X1VA 1W0JA 2IYTA 1SVKA 1WE2A 2QUZA 4MYCA 2IK8A 2YYZA 2RGGA 1KAGA 3OESA 4JLPA 3ADBA 3LH5A 1W36B 1LVGA 1X86B 1NVUQ 3GJXC 4KLNA 2G9NA 2LKDA 5IDVA 3UKDA 2WBLC 1GILA 3IPXA 4K46A 1VCNA 3ND9A 5CIWA 2FPKA 2J3EA 4FI3C 4TQUS 4TQAA 4RD4A 5DE3A 2Z43A 4DUGA 2FPMA 2QMUA 2W6ID 1YE8A 1P62B 1XDBA 3LV8A 2AWOA 3U60B 5EXXA 3G0HA 1P4SA 2J7PD 5CDFE 4QL3A 1E2JA 1KO4A 2OAP1 3I73A 2O8EB 4B48A 4DDTA 4D80A 1O87A 2NO6A 2QSYA 3MWYW 5LPNA 2HEIA 5K8UA 4NZYA 5KPJA 1G4UR 4F7WA 4P0TA 3HPRA 4MYUA 2CHVA 3AP3A 4B3XA 4OK5A 3WHLA 1KNXA 1NBMA 1XB2A 4JBXA 5FBRB 3SE0A 5GJBA 3V4RA 4V0LA 5FR1A 1GRNA 3EZ2A 2EWVA 4CVNA 3FOZA 2VHUA 2H92A 4BWYA 1DAEA 3QG1A 1EFHA 1OLOA 4CF7A 3SDZA 4MRSA 4DEXA 1TX4B 1XXHA 4TMXA 4IOMA 4M8NE 5KNCA 1Z0FA 2PH1A 4IOLA 5GVRA 1KDRA 1M74A 8OHMA 4PANA 3ICQB 1P9RA 4KSCA 2J0VA 2PT7A 3THWA 1G5RA 4DB2A 1W5SA 3C5HA 1XF9A 4RJLA 1P72A 3EC2A 3RRMA 2JIZD 4NYMR 4R98A 2G88A 3B1VA 3CR7A 1E9EA 1ZD1A 4LBZA 3KKOA 4YC7A 1YZNA 2A7QA 2ZJZA 5FI0B 4Q1BA 1D8TA 4CEIB 1C9KA 1M7HA 3CNOA 2CNWA 3IBYA 1BMFA 4LBYA 3BAFA 2YWHA 2MMCA 1IXSB 3A6PC 2ZU0C 4FCVA 1P9NA 1BKDR 3L0IB 3CNNA 3VR3A 3U5ZB 5FOTA 5FTNA 2XZPA 2QZ4A 3NKVA 3A1WA 5CB8A 2VYFA 3DVLA 5G40A 3RS0A 4KSBA 2OCAA 1GZSA 2V1UA 1DG1G 2CCGA 3GFOA 4PHFA 2BKUA 2HCJB 1OHHA 2C9YA 4GOKA 4TZ0A 2R6FA 2VP0A 2V6JA 1XXHB 4KJZA 3WP1B 4KBGA 2IUTA 3HDTA 4NONA 3X1WA 5JI2E 5L8VA 1TNDA 1N3BA 3GD7A 3Q5DA 5TARA 2RGBA 4DLWA 1TF5A 3THWB 1CR4A 4ZO4A 1AA9A 5FUXA 1S0UA 4URXR 1F6BA 3X1XA 2ZJOA 2WSSA 4DLVA 2WTUA 3X1ZA 4WZ6A 4AURA 2OHFA 3I72A 1DBSA 2OO7A 5FOUA 1VTKA 2B6HA 4EDHA 4QGHA 1A4RA 1NY5A 1FZQA 1S1CA 1X1RA 3AKEA 3W3ZB 2GWHA 3EA0A 3KXLA 3RS2A 2QAGC 2ZJAA 3FHOA 2JJ8A 3A4NA 4WZAE 4ILEA 4AYXA 3Q3JB 1KK3A 3SNHA 2JJ1A 4NYMQ 1W36C 4F4JA 5HR5A 2H5EA 2NG1A 2WHXA 1E2IA 4Q03A 4BEJA 1KSFX 2GZAA 4IKEA 2QQEA 1KSHA 2ZRMA 2ZUDA 4MKHA 3MD0A 4CW7A 4ZDWA 3ZH9B 1FUKA 4M4SA 2VHJA 2ZSBA 1RC8A 4NE2A 2B8TA 1DS6A 4BFSA 1Q0UA 5TY0A 3VAAA 4PC7A 1YZTA 4H9GA 1VYVA 1WP9A 2ZE7A 3RS3A 3SFVA 3ADDA 2ODEA 1XEFA 2FEOA 2GKSA 3RSLA 1N6OA 1ANKA 1PLLA 4FWIB 5J5CA 2JEOA 2ZITA 3QF4A 4NU0A 4DT1A 4HYYA 3CF6R 3TLXA 2ZJBA 3GFPA 4FMCF 1ZW6A 2ZRJA 2J46A 1SKYB 2YC2C 4OJQA 3TJZA 3ADCA 3GMTA 3W6PA 1H8HA 4HAXA 2GETA 2Z5FA 3EIHA 2A5YB 4AKEA 5JZVA 2QTFA 3ZGXA 3SQWA 4R71A 4KU4A 1N6NA 4UNPA 5JEEA 5IK2A 4BZPA 4URZR 1N0UA 1GL6A 5JMTA 4JSYA 5D3MB 4EAQA 3QOFA 2FE4A 2JLZA 2GAOA 3K8YA 4JSTA 1VECA 1W4CA 4E22A 1T8TA 3CO5A 5FPTA 3GLIE 1E32A 4HAYA 3B1ZA 4V02A 2OXCA 5BYKA 3GLGA 3M4YA 4ZV4A 3EPHA 2GJ9A 1A7JA 3OEHD 2Q3FA 4G5SA 2FN4A 2XOKA 2H1LA 1J99A 4LWZA 1JAHA 1OYYA 3DOEA 1LV7A 2VF8A 3WMEA 3QF4B 2R6AA 4GSYA 1GRRA 4DT1B 1L4YA 1TQDA 4V0NA 5JJLA 2FA9A 3P27A 1T4GA 3K70B 2HT1A 4TL9A 1M34E 3ETLA 5TDHA 2CHQA 4IOJA 5LDDC 2CE2X 2JA1A 2GA8A 2ZIAA 4RZ2A 1P73A 4U00A 5CB6A 1ZC4A 1Z29A 1W0KD 3R7WA 1Z0IA 3NXSA 3B82A 3CRMA 3VHLB 2QGNA 3UXMA 1KI3A 2C78A 3NH9A 2IYWA 3B1XA 2NO9A 4JT4A 4DSNA 4BGDA 1NIPA 2OILA 4Q9LA 4W5WA 3D3QA 3FFAA 2D2FA 2V1XA 3N2IA 1FL9A 1KYIA 1Q3HA 4QFMA 2AKYA 3HP1A 3GEEA 3MLEA 2JLWA 4HLCA 1OB5A 3GLGB 1P6XA 1UBCA 2ZI3A 3NH6A 5J47A 1VYTA 1KDPA 4US0R 2H16A 3PEWA 3CBQA 1DPFA 1HE8B 4EPYA 1D2MA 1DAMA 2F43A 4LJ9A 1G291 2HJVA 4G01B 4I1UA 1AS3A 1XTKA 4OHXA 4AWXA 1ZIPA 1XMJA 2QTHA 2VIIA 3PITA 4JLVA 4RZXA 1XTQA 2IX3A 2WAYA 4BASA 1VCIA 2FSIA 4TT3A 3EX7C 2X77A 2VLIA 1ZYUA 4HATA 1P2TA 4ITRC 4BLTA 4HLUA 2ZI6A 4OQMA 1WB9A 3QEOA 3R7WB 3PFIA 2XZOA 2ZJ5A 3K0CA 1KIMA 2YV5A 1NVXQ 3HPQA 1G8YA 2DBYA 3NC1C 3AVTA 1K5DA 3O8RA 1K8RA 5TMPA 1QHHB 1W47A 4TYQA 4LCBA 4P4UA 1R0XA 2B7CA 1M1YE 1U94A 3WMFA 1FNMA 4DCVA 3BBPA 5FPHA 2VP6A 3MWLA 3KFXA 1T9HA 1ZNXA 3FHCB 1NN5A 4HB4A 1A2BA 3GLFA 2JLUA 4OYHA 1L2TA 3ZD6A 2CL7X 4L4UA 4N1AA 4PC3A 1GWNA 4LHVA 5EE9A 4RSGA 2F43B 1CBUA 2GJKA 1XMSA 4M9ZA 4RZ3A 1AM4D 3KQLA 1NVVR 2O0JA 4Q02A 1JR3D 3QI2A 1RE0A 3OFND 4G3XA 4AG5A 4TLBA 1COWA 1E94E 3WYAA 3O8DA 2O8FA 2OLJA 1J70A 5DIFA 3BS4A 1DELA 4M22A 1YR9A 1FTNA 4NL4H 4DIDA 4XH9B 1XPRA 3AVXA 4BEBA 3QF7A 1NN3A 2J59A 2UZ3A 2DFKB 2PMKA 1QVRA 1VYUA 1CKEA 2ZU6A 4M9SA 2HLDD 1W4AA 1MO5A 5JBQA 1NLYA 3I32A 2WM9B 3WNBA 1IN5A 1ZNZA 3IHWA 1GL9B 4OL0A 1GAJA 3UMRA 5H68A 3EPKA 2ZYUX 2Q3HA 2IC5A 4TLEA 1GKIA 2QT0A 2GDJA 1OIWA 1XCPA 3GLFB 4CEJB 3CR8A 5J4YA 1AKYA 1KI4A 2E1RA 2QN6A 1T3LA 1GFIA 1IN6A 2WAXA 1MRNA 2WJHA 3PEVA 5KNDA 1SULA 5J4HA 2QMEA 2OCBA 1RRGA 1P75A 1HH4A 1WDTA 3AF4A 4JZKA 3W8NA 1Z0AA 3Q85A 4S35A 4TYNA 3KKPA 5KSPA 3GJ8A 1QVAA 2P6NA 2RKOA 2E87A 2GK7A 4Q7LA 3QE0A 2O8FB 3GJ5A 3L8ZA 1NF3A 2GF0A 3N5CA 1C4OA 3IPYA 3SFZA 1WQ1R 4TWZA 3EASA 2GHIA 1ZM4A 1II9A 3OIWA 1NVVQ 2WJVA 4II7A 4AYTA 5C2JB 1KTVA 1G1MA 3AKDA 1DEKA 5FUYA 2DFLA 2MSCB 5EJEA 1ESMA 1HQYE 1S1MA 3A1VA 3P26A 5IF9A 3NWJA 4X8OA 2JDID 3CX8A 5FBWB 1JI0A 2EYQA 4B43A 4ZI3A 2ZS9A 2GBLA 3IQXA 1G8PA 3FVQA 1UBEA 4LYFA 1N6HA 1LW7A 3LLUA 3HU1A 1G8HA 4B2PA 3AVWA 4XSHA 1XEWY 1OXTA 3B1WA 3VX4A 3TSOA 4Q1AA 4DC9A 2A2ZA 4URYR 2OT3B 2J41A 3UG7A 2W6JA 5E95A 1HE1C 2AN9A 4F4CA 1G3MA 1OT3A 3H84A 5FOWA 1S9HA 2V4ZA 5FTKA 1XZPA 4FW9A 1SVOA 2Q9AA 3AEZA 2FFHA 4DBLC 3U6BA 2GCPA 2AK2A 3GJ0A 1E2GA 1ZNYA 1G64A 2AFHE 2ZI9A 2GTPA 3IIJA 4MDFA 2OCPA 4S2EA 5FPSA 2ZXUA 1KMHA 1RKBA 3AKYA 5CYPA 3U3MA 4PSVA 2YHSA 2ZRPA 4BFTA 3TQFA 4YDHB 4RD0A 3LBIA 3EIQA 1ZM2A 3LW7A 4W9MC 1WBBA 1U8ZA 1P2VA 1EFTA 4PO8A 1E2KA 2ORVA 5KO2A 4N0EA 2WWGA 1PUJA 3IQWA 4QHTA 5CM8B 2KWIA 1S9DA 3RS5A 2ZRIA 5KNBA 3H4MA 3CWQA 4IDHA 4XWKA 2A9KA 2YOFA 4D26A 4M1TA 4F38A 2XNDD 4G0NA 4I1VA 4HZIA 1SXJE 1TU4A 1HEIA 4QHYA 3BFVA 4V0ME 721PA 1M2OB 3QXSA 4Q9KA 2BHRA 4MUBA 1RRCA 2KI5A 2A5FA 4YMUA 3R9WA 2FX3A 1MABA 4HLUC 3UWKA 4CEHA 3BWDD 3K0CC 1DAIA 4OQLA 2YKGA 3BIFA 4GMXA 2GVZC 1L8QA 5ELXA 5E7MA 1LF5A 4LY6A 1TTTA 1MR3F 421PA 3GP8A 3RSOA 2C04A 3HWSA 4BZQA 1XTSA 1KMHB 4IJMA 4US1R 1D2EA 2KJQA 3BORA 4OK6A 4BPBA 3AV0B 1YR8A 1BH2A 3BH7A 1XFAA 1OPXA 2GEUA 2FSHA 4W7SA 2BCGY 3FKQA 3I8SA 1UDWA 3KX2A 4I99A 5LBIA 1N5JA 1KAOA 4L8GA 2ZS7A 2C5LA 4IEEA 5DISB 2WZQA 1JJ7A 3ZVLA 1Z0JA 3W6NA 4UXJA 1W36D 2IXGA 4GOJA 3GJ4A 1MO3A 1R0ZA 1I2DA 1DO2A 3A58B 1MABB 2OM2A 4JYCA 3FWYA 1NLFA 2XXAB 4L15A 5DO9A 2A5GA 1S3GA 3AP1A 3QKRA 3SHFA 1Q1BA 2ZRHA 1LY1A 2PLRA 2ZTSA 3C15C 1YZQA 4JKIA 3AF2A 4PAQA 4IVQA 1U2RA 4NPHA 4LPKA 4XD7D 3K09A 1KDOA 1V5WA 1E1QD 1E2FA 3BJIC 3R20A 4NDZA 2ANBA 5DGXA 3VKGA 2YWEA 5AK0A 1IXRC 3N2EA 4XOIA 5E7IA 3IKJA 1U99A 2XAUA 1QHNA 2ZRFA 2D7DA 3BH0A 2PMDA 4HDQB 4CRWB 3KB2A 5JS8A 1D5CA 4QXAA 1XTRA 5FFMA 5BN3A 5L3SA 1OSNA 1H8ED 1Z3IX 2CK3A 2QNRA 1JXMA 2G3YA 1W0JD 4F91B 3I5XA 4JLDA 1NSTA 2F6RA 2JGNA 1U90A 1EFUA 4O2RA 5DN6A 1KHTA 2BDTA 3NDPA 3VR1A 5F9HA 2Z4SA 2A78A 1QHGA 1Z06A 2DCUA 2GCNA 4AKHA 1ZC3A 2EFEB 2EW1A 1OH6A 3NHBA 4XTRA 3T1OA 3DZ8A 2QQ0A 2X19A 1OKKA 2VBCA 2IXEA 5AWFC 5KOYA 1G9XA 1OW3B 1T0HB 3NTUA 3QKRB 4LK2A 2QMHA 1JR6A 3AH8A 4M1MA 1P7CA 3ZJYA 1MRSA 2C03A 3TIFA 4IEIA 3EC1A 2ZRBA 4Y0VA 1IM2A 4RKFA 4TL6A 1E2QA 3HU3A 1A1VA 2GBLC 2J7KA 4EJSA 3AM1A 4QJ3A 2BMFA 1XCMA 4DXAA 5L3SB 3BB1A 3ZIAD 2P2LA 5LB4A 3Q7PA 3RHFA 1U9IA 4RKEA 2AFIE 1IHUA 1NBMD 3D31A 1Q1QA 1YZGA 2ZJ8A 2F3TA 1CJVC 1CF4A 1Y3AA 4RFSA 2RMKA 4TYYA 2FMXA 1S4QA 1T0JB 3PG5A 2WWFA 4U5XA 4BUJA 2PCLA 2IYRA 1J8MF 4DSOA 2PZFA 1R2QA 2PBRA 4LJ7A 1N5KA 1VKJA 1XBTA 5HE9A 5BYJA 3ZD7A 5EZ5A 3I62A 4DRZA 5J4VA 4C2UA 2ZR9A 5HTKA 3FFBA 1W5TA 4FCTA 4M9XA 1CRQA 3VHXA 2OEPA 2ZSDA 5A4JA 1Z6AA 1G8FA 4RD1A 4Z1MA 2IBMA 1W4BA 4HI0E 5FOVA 2C95A 2TMKA 4WAUA 4B47A 2NIPA 1UBFA 5C46F 5DNYB 4EJSB 1FTSA 5TVKA 2CCKA 2WV9A 2CNWD 4IXMA 1BMFD 2ZJ2A 2QTVB 3W8RA 4AD8A 4JLBA 2ODWA 4DLYA 1YJ5A 3ADKA 3TAHA 3LX8A 4Q1EA 2V55B 4B75A 2WWHA 3UG6A 1R8QA 4MKFA 3EG5A 5DYGA 2YWFA 2PT5A 1ZM9A 4PPQA 4QNMA 3Q8XB 4C0QC 5DSZA 4OHZA 3X1DA 121PA 4RFSB 1OHHD 2FF7A 4DDWA 4PHGA 3OZXA 5KSYA 2C96A 2QAGB 4NCNA 1E2MA 1FP6A 2GXQA 4EPWA 3CRRA 1RRPA 3ZDQA 3AF3A 4M1OA 3RS7A 3VQTA 1E1RD 1W1WA 3QPWA 4NTZA 3NBXX 3CONA 5LD2B 1EFCA 2WSSD 1E79A 2O5VA 2IWRA 1KOFA 3T15A 2B7BA 2WIBA 2G1JA 3EARA 1DG3A 1SZPA 3QEJA 2RHDA 4GL2A 2QE7D 2GAAA 5EP2A 1FW6A 3DM5A 1R5OA 2F55A 2V54A 4MRRA 1F2TA 1T6NA 1KNQA 3GLHA 3SYNA 3IO5A 3IO3A 2JCSA 2JJ1D 1FP7A 2O8BB 4D25A 2FG5A 4ZKDA 5JI3E 1BOFA 4N0DA 1WXQA 4OKSA 1N6PA 3BXZA 2J9RA 2J0UA 3GEIA 4NYJQ 1II8A 4W5HA 1Z5ZA 1DO0A 3LQRA 2YJTD 4PO1A 1OXXK 2XZLA 2NO7A 3CWZA 2UZIR 3PR1A 4OI0A 3K0AA 1SQ5A 2VHQA 1E2NA 1E96A 3SZRA 4FWTA 4PQFA 3FGNA 4QGAA 2WPDA 3K09C 1J2JA 1G21E 2RGXA 5IRCD 5HE8A 5AUNB 3DDCA 2IYYA 4GFDA 2LCFA 1OFHA 3R9IA 1NN0A 4TLCA 2F7SA 2IYUA 3REGA 5CIQA 1Z07A 3FHTA 2FV8A 4LI0A 1VG0B 1NNEA 3K70D 2YZ2A 2GVDC 5B57C 5JECA 3MJRA 1YVDA 1F2TB 2RGAA 4KODA 3P1JA 4ACBA 1Q21A 2XB4A 3GLHB 3FMFA 1GSIA 4TMZA 1H8HD 3HR8A 3WMGA 4PZZA 2Z4RA 4C4PA 1NKTA 2WJGA 3PUXA 1R10A 2JJ2A 2XEXA 2QORA 2PX3A 2J0UB 1QBKC 3OEEA 1YR6A 1II8B 4JL6A 3RRYA 3A4MA 4OQFA 2I1QA 1ZUNB 2CCJA 3EWSA 4LOAA 2MSEB 4DLXA 1T3SA 2ZI7A 3K0AB 1JEEA 1LTQA 3BB4A 4NCKA 1G20E 5FBVB 4HDCA 2H17A 4Z8XA 1NSFA 5TB5A 2XOKD 4KCGA 2ZREA 4BRUA 2ZYTX 1IJEA 4HDOB 4EJSC 1LNZA 3TNFA 1FMJA 1OH8A 1CJKC 4Q66C 4RCZA 2IUSA 521PA 5SZHB 1JQJC 4PZYA 4Q1CA 4KYIB 4U7DA 2OFXA 3EZ7A 4K81B 3T35A 2ERXA 1S2MA 1XMVA 3D7MA 1G6OA 1U9IC 2VQSA 4FMDF 1CULC 5AJWA 1Z6YA 3K53A 5KPDA 1W46A 3UMSA 3D6TB 4L9WA 2RH5A 3LWNA 5G53C 1N6RA 1ZU5A 4KFSA 1P61B 4M53A 4WOPA 4RFVA 4QJ5A 1E9DA 4LZZA 2QA5A 1E2LA 2QT1A 3CZQA 3G5UA 1F3OA 1OIXA 4B2LA 4IFBA 4A8JA 4JJKA 3H0KA 4M1YA 2FFQA 5LD2C 2O52A 5BN5A 2QMOA 4TL8A 1JPJA 2V6IA 5C18A 1KO7A 3EZFA 3B7GA 1D6JA 4LJ6A 5EP3A 5AUQA 3UATA 6Q21A 4KLZA 5EE5B 4L5BA 2O8DA 1JBKA 5CDFA 5BWMA 1V43A 5KUTA 4K8OA 4D82A 4TT3D 3HYTA 1VG8A 5JWHA 1VDZA 2G0NA 2IYZA 3RAPR 1G5PA 4Q4HA 1YKSA 4MUAA 1RVDA 1XD2A 4CZ2A 4D4JA 4MRVA 2C9OA 2CEAA 3S1AA 5J4LA 4AI6A 1G3UA 4C0AC 1ZP6A 4CT4B 4ZKEA 1G3RA 2F1HA 3MGCA 4PXAA 1IN7A 2P65A 4B35A 5M04A 1TQ2A 2VA8A 5AUOB 1NN1A 2LKCA 2R6CA 2VSXA 4QOSA 4A8JB 1I4DD 1EFRA 1T3HA 1NJGA 2QP9X 4Q4JA 1U98A 3VR2A 1X8JA 1JB1A 2CBZA 3OAAA 3LLMA 3C16C 1O3YA 4YMTA 2ERYA 2KB0A 3T34A 1SVIA 2KSQA 2O8DB 1FOEB 2QAJA 2JAQA 1I2MA 1MH1A 4M1KA 4XWAA 1QHXA 2CLCX 3B85A 1COWD 3NBZC 2HF8A 4P33A 1WCV1 1HUQA 4EFLA 2FOLA 4G5QA 3B5JA 3K9GA 4UKDA 4XVQA 5CLLA 1XRJA 1PVOA 4U02A 4C7OA 3NC0C 2R6GA 4Q4HB 1JQLB 1SKQA 2HYDA 1XD2B 2PJZA 1NI3A 3S1AB 4B6EA 3EWAA 1IONA 4IVPA 4RY2A 2GJAA 1NG1A 2QY9A 3NBYC 4PTLA 4JLAA 3J81k 1RZ3A 3WYFA 3CPEA 4IHQA 2PEYA 2JATA 4GOXA 3QJYA 4OHWA 3WBKA 2B21A 3THYA 4C30A 4C2TA 2IS6A 3VKHA 1NRJB 4XVUA 3EW9A 5JRJA 2BBWA 1AJEA 3I1FA 3HR7A 221PA 3IUYA 4Q4JB 2GK6A 2ZSFA 2NGRA 4MRPA 3KJEA 1TU3A 1Z6XA 4CDGA 1S3SA 3DHWC 2W83A 3L0OA 1FMLA 1Z22A 1UKVY 2ZI4A 3WNDA 2HUPA 4LHXA 3UPUA 2ZJYA 3MAAC 3VMFA 1KI1A 3OE7A 4P31A 5CJ2A 2MMGA 1DAFA 1HYQA 2J87A 1KDTA 1NMXA 3MG9A 2OFWA 1UJ2A 1HY3A 1WBDA 4BLQA 4XWOA 4C7OB 4PFSA 1N6LA 3ZZTA 3U7HB 1JPNA 1U0LA 2WWWA 4UXIA 1E98A 1PZNA 4PPGA 1RW4A 5EP1A 4BFZA 3SHWA 2OSBA 5AJXA 2GNOA 4MKIA 5EZ6B 5C1BA 2GJSA 4IRUB 3THYB 3TQCA 3EPJA 3G82C 2Q9CA 2ZRDA 3TRFA 2F9MA 3RLFA 4LHWA 2FGJA 2DPXA 3KKMA 4QG7A 5HZHA 3EZ9A 1KI2A 1EGAA 2B8WA 4FIDA 2VF7A 1Y63A 2MSDB 5B2ZA 3TGPA 4DCSA 2WICA 2OESA 1YU9A 1JEDA 3LDAA 1HT1E 1ZCBA 1Z2CA 1NKSA 2IHYA 3PV0A 1OH7A 4BFVA 3R9XA 2C99A 3DMDA 2W6JD 5EE0A 3D8BA 2F9LA 3LNCA 5EUQB 2BEKA 2W0MA 5H8WA 2IA5A 1L4UA 3Q72A 4DDUA 1ZIOA 1N0WA 2AXNA 3B13B 2EYUA 3VR6A 2ZI5A 3U3JA 4A8JC 3CKLA 4KVAA 1KO1A 3UK6A 2JLSA 4MITA 1NLZA 2PLFA 1OYWA 5DYIA 3E5HA 2BWJA 2HCBA 1JR3E 4GT1A 4V0OA 3GLIA 1XZQA 2R9VA 3SEAA 2VHCA 1IY0A 2EWWA 3CZPA 5UKDA 1PV4A 4URVR 1KK2A 4Q9JA 4EFNA 1R0YA 1G5TA 3SR0A 1GKYA 2GF9A 3BFKA 4LC0A 5EXTA 3PENA 5FL3A 1CU1A 2ECKA 4JIMA 4A9AA 1HT2E 1AK2A 4FMDB 1C1YA 2RGDA 3PEUA 4MGIR 3RWOA 4IDOA 4UNSA 3CX6A 1OFIA 2OE2A 2RHMA 2Z6VA 3KB1A 3GEHA 3PQCA 1G7TA 2QM8A 3GJ7A 2BMEA 4LPSA 4PZLA 1UEJA 3QG5A 4Q19A 4Q48A 4B33A 4JL8A 5FTLA 3WBJA 1EK0A 2GZHA 2ZPTX 4ACAA 4V0KA 3MUFA 2VSOA 3LO5A 3SU8A 3U7GA 4AY2A 4BE7B 4M2LA 1ZNWA 1JECA 3JZMA 3ZVMA 2GXUA 1F2UA 2ZROA 1P2UA 1JJVA 2P6UA 2Q6TA 1F5NA 2W00A 3UIEA 5K8TA 1KY2A 3UWOA 1KK1A 2BM0A 3IDQA 3GLIB 1EXMA 4A82A 3LBHA 1ODFA 4JVLA 4XSGA 3T5GA 1I4TD 5CITA 2ZYVX 3QBTA 2BVNA 1P9WA 3TR5A 3P4XA 4E5UA 5B64A 2ZETA 1UFQA 3W90A 4G5OA 3C5CA 4JL5A 2WJYA 2SHKA 2QPOA 5EE3A 1GNQA 4JBWA 2YOHA 4NBSA 3TAUA 4KBFA 4CGZA 2HXYA 3PUZA 3U4QA 3C8UA 1G3QA 1IBRA 4PPNA 3GJ3A 5AJYA 1KJZA 3SI7A 4A92A 2D2EA 2O0KA 3P20A 4FMCB 4RD2A 3U3OA 3CH4B 3KUDA 2IEYA 3E70C 4NP6A 2AX4A 2W2VA 4OQXA 5FBQB 5D3QA 3FYHA 4V03A 1SHZA 821PA 1BYUA 5SZKB 1NL3A 1TEVA 4O0MA 3DL0A 1F2UB 5GJWC 1BS1A 1IJFA 2W2TA 1KI6A 3T1QA 3WRXC 2XTZA 3LX5A 2ZSAA 1Z2AA 2ZRKA 1CR0A 5B30A 2ATVA 1HA3A 1GTVA 2FFAA 2C8VA 2BV3A 4QRHA 2CK3D 4DLRA 4JVMA 1IQPA 5SZIA 1KSGA 4A6XA 4HB2A 1J7KA 1UDXA 2HJGA 1A82A 1D9XA 3KJHA 1M6NA 3IEUA 3FKSA 1EG7A 4P32A 2RAPA 5DN6D 2WJJA 4OHVA 4P4TA 3IEVA 4LYJA 4EKDA 3C7KA 5A5GA 3AF1A 3U4QB 1W48A 4B3BA 3A1SA 5FPYA 1XP8A 1LS6A 3BOSA 1E99A 4JLMA 3E2IA 4Q1FA 4C0BA 1D2NA 5KDDA 4ESVA 4BFUA 5CYOA 1AQUA 1OKKD 4ZPXA 4ZDKA 2NMVA 3NG1A 1JR3A 3Q5EA 3CB4A 1SVSA 2BBTA 4MYTA 4ZIRA 2X2EA 1S8FA 5CJPA 1E3MA 3MWKA 4NCJA 2J0SA 1ZVQA 4MQBA 3SJZA 4FXPA 3SBEA 1I4LD 2VPPA 4EUNA 5F98A 4PHHA 1E9AA 2R62A 4E09A 3MRSA 4B3FX 2CL0X 1Z6TA 2OG2A 2WKRA 2YWGA 3AF0A 3CIOA 3CRQA 3W3AA 2QROA 4FMBB 3DKPA 1HURA 4HSEA 3AGQA 1B23P 1E69A 2ORIA 1Z6GA 1GUAA 1VG1A 2CLSA 3IHLA 1CJTC 2BBOA 4FN5A 3HYRA 5IT5A 4R7ZA 1TPZA 4DLTA 4IDQA 4LJYA 5E7JA 1RRFA 2Y8EA 1KSJA 2IS2A 2X2FA 3DKVA 3OIUA 2P0EA 4HZUA 4MDEA 1VG9B 2XSZA 2ZRAA 5EP4A 4QBIA 1CS4C 1GG2A 4NH0A 1DVRA 3FPAA 4URUR 1YQTA 2WIAA 3CRVA 3RABA 4DDVA 3TUJC 3V9PA 1U8AA 4ZIRB 2XJ4A 3SJCA 4XJXA 4D0NA 1QF9A 4TSFA 2CL6X 4PC6A 4A0FA 1ZM7A 2D7CA 2RCNA 2W58A 4Z1MD 4B32A 3CPHA 4CEHB 2J0QA 2AD1A 2E9SA 4NMMA 1OXUA 1ZU4A 3HU2A 2ZR0A 2IXFA 3BERA 4CYMA 4JS0A 3QPVA 5JEDA 2I1VB 2IYLD 3ZS9A 3QY0A 4LSGA 2OBMA 3C4JA 1IY2A 4M9QA 5HCNA 2H18A 2QPAA 1EWRA 3QENA 3CM0A 3I8XA 4D81A 4C0KA 3PJRA 4B34A 5JWOA 3THXA 4QGFA 1EESA 2IYVA 1QHYA 4Q7KA 2NOAA 3KJIA 3RANA 2VP4A 4BZXA 3OF5A 1XJQA 4HZUB 4A15A 4HAZA 4Z54A 1E9FA 2OFOA 4KI0A 4PR0A 5E4FA 3B60A 2I3BA 4WZBE 1NY6A 2PEZA 1PUIA 2N46A 3KZ1E 2ZRNA 2F1IA 1Q20A 3NHAA 1G7CA 1DAGA 3BD9A 3NVAA 4OI2A 4ARZA 2WKPA 4DZZA 1E9BA 4JVNA 5GADl 2XITA 2HYIC 3QPUA 3F8TA 1G18A 1E79D 3RRZA 3W34A 5GJVC 4D6PA 3VR5A 3IILA 4Y0AA 4FD2A 3K9LA 4DUGD 3ND8A 5JCPA 4X8LA 2ODNA 5EE1A 1N25A 2C9CA 1QDEA 4A0RA 4DCUA 1VIAA 3DOFA 1GP2A 3SN6A 2ZR7A 1US8A 4MKGA 4TMTA 3NEYA 2YC4C 1BO6A 4EPRA 1E4VA 1SXJA 4ABYA 3K9NA 4ASUA 2UKDA 4V0MA 1X3SA 2OXRA 4POAA 3KUCA 5FL7A 2V8OA 3BRWD 1X8LA 4QBHA 1E0AA 3VNVA 2Z83A 3PEYA 4D4KA 4IVRA 1PJRA 1N2CE 5FUVA 5GJCA 5A0FA 1GDDA 621PA 4HUTA 3TK1A 4O3MA 4ARZB 3FMIA 1P2SA 2HT6A 1OFTA 2WPDD 4AIIA 4BFXA 5AUPB 4TLDA 4TTPA 3U6KA 5JSZA 4KHZA 5JHHB 1NBME 2K5UA 4OJKA 2BMJA 5JJKA 3TVTA 3U3RA 2CHGA 3VNUA 1XD8A 4BFWA 3O8BA 4EFMA 2NO0A 1TEXA 1T5IA 3LY5A 1XXHE 1GIAA 2WKQA 3EA5A 4QBGB 2DWOA 3QXCA 3F3YA 1JNYA 2D62A 1Q57A 1QG4A 4GMDA 4TL7A 1TF2A 5HKKA 4LV5B 1US8B 4DKXA 4LJAA 4KAXA 1IOZA 1XTIA 1PLJA 1SXJB 4IDPA 3VKWA 1XJ0A 2RGNC 2VSFA 4NYJR 2JJ2D 4FINA 1II0A 1AQYA 5JCZA 2GJ8A 3K0EA 4DWJA 4PAMA 1TQ4A 3OEED 4JT2A 3U7EB 4JLJA 4DHEA 4Q9IA 2IS1A 2H57A 2WWYA 4LUCA 2PJRA 3T06B 4BQSA 1JALA 2AXPA 2D06A 2PCJA 2ONJA 1MO4A 3AVYA 1DAKA 5KSZA 3V00A 3EIEA 3L8YA 2B92A 3CF2A 4ZCIA 3PXGA 4D4LA 1X6VA 4QNRA 4B2IA 5JSZB 1W44A 3KQNA 3R8CA 1BIFA 2FEMA 2P5SA 3A8TA 4Q1DA 4ZCLA 1NVWQ 2AK3A 4R9UC 3PVSA 4LHYA 3NEJA 1E0KA 2RGEA 4Q00A 3X1YA 2Z0MA 2Q0HA 1MOZA 1XPUA 4IXNA 3QUSA 3T5DA 3L82B 2J5XA 3I61A 4AKGA 4LV8B 1KI8A 1Q22A 2NTYC 4LGMA 4M0LA 4WW0A 3KKQA 1FUUA 4PHTA 3RWMB 2CXXA 2WWIA 3T1VA 3QIAA 2IT1A 1NJFA 1NIJA 4BLSA 1ZM3A 2GEDA 1ZBDA 2QEQA 2REBA 3WP0A 3MWJA 1U8YA 4HUQA 3O47A 2V7QA 5FOSA 4A4DA 1SKYE 3L0PA 1UEIA 1CP2A 1TAGA 1ELOA 2IYQA 4UJ5A 1FX0A 2BC9A 3KXIA 4G5GA 1OJLA 3WRYC 4LYAA 4A2WA 2G83A 3QKTA 1BYIA 3WHKA 1SVMA 4R2HA 3ZZUA 3KDSE 1K5GA 2LWIA 3QKUA 3H2YA 3VFDA 1RPZA 1IXZA 5AJVB 4MGYR 5KTYA 1M7BA 3NBFA 3QXXA 5CLQA 4CEIA 2IL1A 1ZD9A 1QRAA 5HPYB 3KQUA 4QM6A 3SJBA 1YZKA 1XCGB 2VO1A 1GITA 3TE6A 3ZIAA 1ZINA 2YOGA 2W2XA 3WXMA 2YVUA 1XPOA 1MT0A 3LW8A 3LAWA 3T1TA 4HUQB 1R8SA 5FPKA 1EFRD 3ZS8A 1XD9A 2AR7A 4AYWA 2C2HA 5IK2D 2CVHA 4E07A 1E2HA 4YXWA 2HF9A 4E03A 2DWPA 1SHKA 3W6OA 4IW3B 3OAAD 1FX0B 4QGGA 3TW8B 5DH9A 2BCJQ 1AIPA 1G19A 2C98A 5DLQC 4X8MA 1XTJA 1NG9A 4HAWA 1P5ZB 2BBSA 4XTCS 3TVDA 3CPJB 2ORWA 4CIDA 5K8LA 1VPLA 1E2PA 4J0QA 2NO1A 1NMYA 1SXJC 3RRNA 2YINC 3QQ5A 2ZM5A 3FMPB 3GLGE 3L43A 1CR2A 3FB4A 2O8CA 2VEDA 2ZAMA 1R6BX 4WXPA 1XMIA 3M6AA 1UKZA 1MKYA 4LBVA 2PL3A 2UVQA 5F9FA 1CR1A 1NP6A 3CW2A 1R7RA 3TSZA 1UAAA 3MJHA 4X8HA 2ZE8A 4PPFA 2VHTA 3I4LA 3Q9LA 1IAQA 5KHOC 4YONB 2D4HA 3SJAA 5JLJA 1E1RA 2QRNA 5TV2A 3DEFA 3CH5A 4D0GA 2CVFA 2WMNB 2XNSA 3CUEF 4H1UA 5EXPA 3U2QA 4ZI2A 3VU9A 3OE7D 2IF2A 1ZUIA 4D0LB 1AN0A 3QKSA 4Q4AA 3EPLA 4I1SA 5CK4A 4B76A 4BFYA 3THOA 1YR7A 3AUXA 1F60A 4TN1A 3DPUA 2QE7A 2QP3A 2JASA 2W6IA 4KO8A 1M8PA 2O8CB 5FR2A 4TZ6A 3KKNA 4BLPA 3A37A 4NCHA 2EFHB 1K6MA 2V9PA 1IY1A 2J7PA 4AK9A 4Q01A 4FCWA 1W49A 4Q18A 4L9SA 3K0SA 4L16A 5D3MA 5HZKA 1M7GA 2FJUA 1KJWA 5EUMA 5DI3A 4F93B 4OK3A 1UM8A 2OZEA 2ZE6A 5HCIA 1ZCAA 4GDFA 1SVWA 1SGWA 5JRZA 1DE0A 5KDLA 4A2PA 4MGZR 2R8RA 1EX6A 3AVUA 3VU9B 2JLYA 5C4MA 3ONWA 2R6DA 3QKSB 4A0GA 4GNKA 4Q4AB 3B6EA 2QU8A 4KVGA 3SYLA 1FNNA 4PAOA 3P4YA 4H1VA 4D2IA 1X8KA 1UPTA 3FE2A 1CLUA 1UF9A 1ONBA 1YZLA 1R5BA 3GLFE 2NZ8A 2IYXA 2EFDB 3KQHA 1E9SA 2CDNA 5JS7A 3PUWA 4PO9A 3TMKA 1UKEA 2A30A 1VCMA 4GP7A 2J1LA 2JIZA 3QBVA 1YZUA 1OH5A 2IHBA 4KXFB 3UANA 2XB2A 3U61B 1OF1A 2DFTA 4A1FA 4DSUA 2BOVA 3LRPA 1AS2A 3RYTC 1ZUHA 1RFLA 4WXRA 5DI3B 1E6CA 2DY1A 4KFRA
chains in the Genus database with same CATH superfamily
4RD6A 2DHEA 3PXGa 4U7HA 3FRYA 3ANNA 2PX5A 2WQ6A 4TYMA 1Q4RA 4F25A 4YAOA 1WA5A 3IG1B 1LZLA 5H1YA 4M0KA 3RQIA 2HZCA 2PFGA 4BXOB 4Q12A 2YRWA 2P2NA 4COOA 1XZEA 4LY9A 3JR7A 5HF9A 1V9OA 2R7MA 1MO6A 3IT1A 2C5AA 5IM0B 2OCYC 5EERA 1BDIA 2VPWA 4YCLA 2CD7A 1NA5A 2AT1B 1U3FA 3ZQ6A 2IEAA 4QJBA 4YO8A 5DPMA 4GP6A 3ZE2B 3FSRA 2HWTA 5NLLA 3AHDA 3TX8A 2W4CA 4ENSA 1Y80A 2YIJA 2P9QA 1Y4AE 3F5FA 3KEFA 3U7IA 3EQ9A 3OLVA 4OHKA 1GRQA 1PEKE 3F71A 3DEZA 5LQMA 3PYGA 2L69A 2OXFA 5CHCB 4XJSA 3TTYA 1C0LA 4BNVA 1SIBE 4L74A 4J2HA 2JFBA 4RM3A 4X91A 3EQ8A 4JOCA 4QXRA 3BSYA 3SQXA 1DDIA 1MLDA 2XMDA 2PL1A 3W3AD 1Z56C 4R0MA 4WIAA 4D8WA 3OHSX 5A3SA 1PIWA 1PX0A 1QHIA 5LLDA 4EPTA 2OD9A 3C14A 1ECBA 4HRAA 4B3MF 2JFPA 4ED6A 1E3WB 3TTXA 4FDFA 2BMDA 4RHXA 4YIKA 5KS2A 4IH9A 3AM4A 2CKMA 2R6ZA 2X1AA 3RHTA 4DX6A 4OJ3A 2D54A 2H85A 5JYBA 2OKCA 4JELA 4KACA 1FBNA 2ZKTA 4QC2A 1ZKDA 4DDFA 2CKWA 3S8SA 4EZ6A 5KOXA 3QXJA 3RC3A 1W5EA 4CLLA 4B6RA 2GXAA 4WKBA 4DBQA 5DB4A 1TM7E 2NV2B 4RGYA 1XQIA 2G7MC 5IT9Y 2WVFA 1H2ZA 2BMBA 3LT5A 4DJAA 2MPUA 1IM6A 4C0JA 4RZUA 3WLAA 2M8DB 2ZC3A 4ZLJA 4PCLA 2Q5HA 1TL7A 5KZMB 1TF7A 2HV8A 2BM1A 4TXMA 4DF4A 1ZCZA 3KHUA 3VH1A 3FSGA 1JLEB 1N2HA 3LFUA 1CJUA 2FZGB 3CXCR 4P4SA 1SU8A 1RK8A 4UXHA 4HT7A 3GT0A 3CJ5A 2QA4G 1ZH2A 4W6QA 2RSLA 1MPTA 1QIJA 4F1KA 3HN6A 1RWOB 3W5IA 1ZK0A 5F76A 1EKXA 3LWMA 3QE2A 4U3JB 1C1DB 4PX3A 4B17A 1TIBA 3DMNA 1Z33A 4W99A 3C4VA 3J7Z5 4DFMA 4JI3J 1YHYA 1J6UA 1N5YB 4O4IB 2WOOA 5B7GA 1YS9A 1KC1A 1ONPA 3VAZA 4XJVA 2BFEB 1JH9A 1HW8A 4FQ7A 3TA0A 2BJHA 2QSZA 3PXXA 3OBBA 4KDRA 3VZBA 1HXHA 1JHQA 3UCZP 1CUUA 2TMYA 2VL1A 2XX3A 5DBFA 2QX7A 1JK9B 1V11A 5DNCA 3U3ZA 2APJA 3THXB 3PTAA 2NPOA 2W2OP 2XNDA 3VC2A 1SC9A 2NZXA 1KJYA 1OAOC 4YQZA 2DH6A 2ZUEA 3WK5A 4DR3B 4KAAA 3VVLA 1RABB 1X1EA 2FI1A 1OBHA 5A2GA 1G5QA 5DOVA 2QN2A 2QW1A 4HAVA 2M8HA 2XJ9A 5KIAA 1FK8A 3RR2A 5IC6B 2W9AA 3OLAA 5FTMA 2MSWA 1U5AA 1H3FA 1KDZA 2DYAA 4YT2A 3ANXA 4EH1A 1Z8FA 2JH9A 1FJGJ 4DU8A 2LIVA 2J3LA 3QK7A 3RV4A 1TMKA 2R3VA 4ZVTA 1FMFA 3FBGA 1QVGR 4BO8A 2VJVA 3EZ6A 4JUBA 4PWZA 1MJGM 5CX1B 2ZJ7A 3PGJA 4I4LA 2MQLA 4WE3A 1EE1A 1KHWA 2XYVA 3JYQA 1ETUA 1AGRA 2XTMA 5GVSA 4IKPA 2AP6A 3AI2A 1U02A 3S01A 4XCVA 4MYCA 3TX2A 4BNJA 1ORWA 1XCJA 2XHCA 2G9NA 2WBLC 3OC0A 3OKFA 1M83A 2XODA 4BX0A 4RENA 1S57A 2W6ID 4QYZK 2EEYA 4LR7A 1XDBA 3U60B 4FFLA 4U8YA 5JTUA 1MENA 1BVUA 1O87A 4F4WA 5AESA 3H5YA 1M5HA 2JCBA 2HMYB 3DMYA 3ADAC 2W4MA 4CVNA 3DEYX 1TX4B 3ZWNA 3EVGA 2JC0A 5JCOC 2YNMC 5ICCA 2XUIA 1FCAA 4G07A 1C0TB 1OQAA 2JIZD 4R98A 1GKLA 4CCWA 5E6RB 1VBKA 7YASA 2ZNZA 2CZCA 2P6OA 5CR9A 1QO0A 3MJVA 4LBYA 3Q0EA 3CRZA 1NQAO 4DR4B 5I3UB 1DLOB 1R6UA 4NA2A 4DV5F 5L8VA 2X5NA 4TM7A 1QLHA 2RGBA 4EKEA 3X43A 1RQGA 1S0MA 4UBMA 4TTTS 3WFZA 4WSOA 3PPYA 4ZO8A 1DBPA 1H9AA 4CTMA 3KOAA 4EY7A 3BBBA 3ZU2A 1WQ4A 2VWQA 1KSFX 3L6DA 1BWPA 4BFSA 5LYJF 4PC7A 3SXPA 2WVBA 1P2BA 1CP3A 4WFZA 4GOND 5B6IA 3GFPA 2ZRJA 4C78A 2H48B 4MQUA 3TRJA 4DRYA 2C8LA 2CQDA 4X20A 3NBPB 4EB3A 2ZFUA 2CV0A 3RSFA 3TS1A 4EAQA 2DR9A 3CO5A 2HDWA 5KG1A 4XOUA 2YXDA 2O2GA 4YN3A 4WH0A 1MQSA 2XD9A 4WCDA 2DNHA 3FF4A 5FOQA 3C5WP 3DOIA 3FBCA 5TDHA 4IOJA 4KREA 1ZZFA 3WAGA 2JA1A 2WTFA 2EEZA 3EUNA 1W0KD 2JZNA 4FHDA 3DYAA 3ISNC 4MZDA 3TD9A 4X7RA 3N2IA 4GXQA 3AT1B 3KHTA 2D69A 4Z37A 5HVNA 3GFBA 4X7PA 2ZI3A 1AB8A 3JWHA 2NXEA 1C7IA 1HE8B 2F43A 3RB6A 1KDNA 1TZ0A 1VCIA 3Q98A 3E58A 2FOIA 5LYYA 1N75A 4JENA 1P2TA 2X41A 5DP1A 1QHHB 3RUDA 1DKRA 2JFGA 1R0XA 2LQ8A 5ALQA 1RTHA 5B0DA 5TGZA 1MXHA 4TN2A 1T5BA 1N2XA 4BHTA 4X97A 4MCHA 4L4UA 1LPNA 3F4KA 1ZL0A 9LDTA 1JR3D 4WZMA 1TYAE 5JCJA 2OH2A 2JD2A 3D0QA 3AVXA 2HQBA 4PG4A 3WSTA 1F0XA 1CQJA 3IHWA 1P7VA 2H51B 3DAOA 4DBZA 5E5NA 1ADCA 4TLEA 2QT0A 2PO5A 4WGFA 3LHFA 2H11A 3ABSB 3D0IE 2ABWA 3PEVA 2QRQA 3GJQA 2HSEA 3TGLA 5DV9A 3Q85A 4J7XA 4Q7LA 3L8ZA 2XMUA 1SU6A 3TZLA 1UVLA 4FYYA 2GKGA 1THMA 1WOMA 2DHXA 2VFRA 2GBLA 2GZSA 4RXTA 1YNSA 4Z4HA 3R5SA 3B1WA 1QLJA 4M7WA 1L5FA 3UF0A 3BXEA 5L46A 4FYMA 2EBWA 3P0HA 3LPMA 3K89A 3M2TA 3OM9A 2CFXA 4IMIB 3NHSA 4R2JA 3IQWA 2H8GA 3H25A 2ADCA 3OZUA 3EM1A 1HR0B 1OXKB 4ANDA 4XZ3A 1XGKA 3T7KA 1U28C 3GHYA 3R9WA 4HLUC 2CYBA 3H18A 2XNRA 3KL2A 1T2VA 2JGKA 1X70A 3PHGA 1AO0A 4QU8A 1HYHA 1UQRA 3DXXA 2QN9A 4TWRA 2F4VJ 1SL2A 5EJ2A 1OPXA 4JEMA 2J0WA 1ST3A 3I8SA 4AWBA 3KX2A 3H4VA 2HJHA 5ALLA 2ZIGA 1N5JA 1KAOA 4F45A 1QTIA 4RHYA 1OPZA 1Z0JA 1F8YA 1Q16A 3FTCA 1GX6A 1A9XB 1R0ZA 4DSLA 3I0RB 5IVHA 3I2FA 2XXAB 5JDIC 3EBPA 3UAXA 4GMKA 3RU2A 4AZ3B 1PQWA 4NV3A 4XOIA 1X77A 2D7DA 1ZGAA 1NB7A 3SXUA 1MGPA 5F35A 3PEEA 1OA0A 2Y66A 3KHHA 4W5TA 5DETA 2Q2QA 4F91B 5K6AA 3A9CA 2A78A 2YXLA 1OH6A 3T9DA 5C8ZA 1ZETA 1HW9A 3PK0A 1U1QA 2BI7A 3N87A 2O6LA 1TK9A 2L42A 3O8LA 5K0JA 2JANA 4L75A 2BMFA 4KKOB 4M7PA 5LP6A 1MQ9A 5FLXY 2DU8A 2WE7A 3J7ZT 2PSEA 3ZNOA 3D0HE 2HRUA 4BU1A 2WWFA 4U5XA 1BS2A 2IOYA 2B20A 4QBTA 4MX8A 5E6UB 2JI8A 4C2UA 2ZR9A 2VCHA 3RTBA 3OKPA 4F21A 2X6QA 1YZFA 1TVCA 1U9ZA 3PDIB 3TWZA 4EJSB 4P38A 3T5MA 1L4HA 4IXMA 1UJ4A 1BMFD 3NT2A 3UAOA 5F78A 3OECA 4MKFA 5IYZB 3QNMA 1PT6A 1Z4JA 2FSPA 4YEDA 3CUUA 2V4JB 2AZTA 3QPWA 3FRZA 4B3TB 1SCKA 2AIRB 3NKYA 4LY3A 3C16A 1BUXA 2QUJA 4F26A 3IO3A 4CLRB 3TZEA 4HGQA 2O3TA 1JX6A 1TFWA 4R81A 5IVPA 3V4SA 2XDQB 2WTMA 3E9ZA 1OA1A 2YNFB 1NUQA 4Q2MA 4MTCA 1UP6A 4H4KA 3VSDA 4TLCA 5BR7A 1GGNA 3LHKA 3HYSA 3KVVA 3CSDA 4OMFG 4HVTA 5DN9A 4ES1A 3UFXB 4NBLA 3MR2A 3GLHB 2XB4A 3NBKA 5JPIA 4CCYA 4KLRA 3L5OA 2O6HA 4JYPA 4I5FA 2W8LA 1WXHA 2G8LA 2XOKD 1OREA 4MVJH 4HDOB 1UKAA 3L1VA 3VJLA 2X1MA 4GEKA 1Q7CA 2ERXA 2DUNA 1EJ7L 3CJSA 5KPDA 3HYNA 2P2SA 4MYDA 1LNSA 2WWTA 3Q11A 2XE6A 4NI5A 2XC9A 3PHEA 2RHGB 1FNSA 4Q7AA 2BFCB 2RB5A 4D8XA 1VPTA 4EYSA 3ZK9A 1H4TA 5HA5A 4U95A 3V2HA 3WGQA 3B53X 4ZTUB 1ITZA 4N0MA 3IAAA 5CDFA 4KEAA 1HNZB 2WLSA 1EDOA 4B6SA 5CB0A 3HYTA 4QD3A 2CLLB 4WZZA 1UJ6A 2BCEA 3KWJA 4MUAA 2Q6CA 4CZ2A 4DM7A 4KY3A 4TV8A 5KFDA 4YT8A 3HZEA 1HL3A 1HWKA 5EUHA 1EBUA 1DQPA 1M2WA 3KKLA 4PCQA 3RB8A 3OQ6A 2X3GA 1Q7GA 2O8DB 5JAQA 3G79A 1ZK2A 4HS4A 1NF9A 5CYFA 2HF8A 1GPAA 3B5JA 2AC7A 3DLEA 4EY8A 1EJBA 4B6EA 1GGEA 4FOOA 1Y5NA 3N6XA 5JVDF 3VKHA 2BRUA 1TO2E 2QJTA 3HR7A 1V7ZA 5B1YA 4C7JA 5JIBA 10MHA 4YRRA 3MWDA 2JKVA 3DPSA 2ZI4A 2HNDB 5F0WA 4UTRA 1CY7A 2GO1A 2ZB3A 5DNVA 3L92A 2A18A 3VTZA 5GADI 3NHKA 3WX8A 2JFQA 4C7OB 1FUEA 4MKAA 3M5DA 2X8LA 1VKOA 1YL7A 4KO0A 3EPJA 3G82C 4NLWA 2X9NA 3E8SA 1RPJA 4W1PA 3GFFA 4WY5A 1W26A 3O2IA 4FIDA 3FPLA 3TGPA 2RH8A 4M8KA 1OBCA 2HKIA 4QWBA 1YT5A 2IHYA 2F8SA 3UCFA 2YH1A 1B3BA 4RPCA 3B13B 5C8YF 1CDZA 5DQHA 4CYUB 5IUJC 5HKAA 3H3JA 3HZRA 4DUZB 1CPYA 1JYEA 3CCJS 4R8LA 1XVLA 1NU4A 2OP5A 2PKXA 2R1TA 5FL3A 5DTRA 1AK2A 2VBZA 4IINA 4XM1A 3M70A 2EZ4A 4AB1A 1CS4B 4BGVA 4RNOA 3IA2A 3MOGA 1P2UA 4UQPA 4QOFA 4OBXA 4EYIB 2W00A 1DX9A 5BUSA 4I7FB 5CITA 3TR5A 1QTRA 1W8DA 1JLAB 2HRQA 2WJYA 4X6XA 3CNEA 2WJZB 1K6IA 2HXYA 3PUZA 3GJ3A 3AIIA 1FRIA 1NOKA 2IEYA 2Y9HA 2W2VA 2FWMX 821PA 1E6YB 2BJ3A 4CDNA 3HMKA 4X9XA 1WWHA 3AFGA 4ZMMA 2ZSAA 1Z2AA 5GMEA 4ES3A 4FOSA 4KGXB 3MPVA 2C8VA 3S8MA 2BV3A 3DE0X 2J5KA 1KSGA 1UDXA 3U4HA 3THRA 5C81A 3ZC4A 1YR1A 4AMGA 3KOWA 5FPKA 5FPYA 4Q1FA 4BP9A 4PG5A 1D8YA 4QWEA 3HGMA 3HV2A 1WPQA 4NWBA 3DWGA 5C42B 1GLNA 1XK7A 4E5NA 2VPPA 1S1VA 1HZJA 1NV9A 4G0OA 5ETPA 1W1UA 3DKPA 3O2SB 1E69A 2MHNA 1B70B 4RDIA 1TELA 2BPOA 2HPZA 2YN0A 4LJYA 1B15A 3EA4A 2E82A 2K2WA 4IDAA 5AXCA 3R5FA 4Z0PA 3UTCA 3TMAA 2WIAA 3R5AA 2P9HA 3S28A 3VH4A 3ZGVA 3DP9A 3OT5A 1D2GA 4AAYA 1J5OB 4EO9A 2E9SA 2Z8YA 1RWWA 5BQPA 1KEWA 3MJCA 3MXHP 2OBMA 2HHTA 4IYQA 4JOQA 4DYHA 3E9DA 5AVQA 4ZJLA 1MNAA 5AW3A 3SKVA 5ECYA 2XMWA 4J91A 2WSFC 4GI5A 3M9NB 1PS0A 1UEXC 1G7CA 1QK5A 4ETXA 4CKEB 4KW7A 1G63A 3VR5A 3Q6NA 1ZX1A 4BV2A 5G0UA 4BYGA 5JCPA 4DR5J 1LWCB 2VQEF 3ZEIA 4OQEA 5LJ3Y 2ID8A 3R24A 5FL7A 5CA1B 3VNVA 5IC5A 2HFVA 4OZJA 2R66A 4DQVA 3G9QA 3R7SB 1H2BA 2I76A 2AXEA 2XVYA 3PYDA 1YRWA 5KNCD 3KJXA 2JI9A 4J6EA 2CHGA 5IQ6A 1KJQA 3QVXA 4DQDA 2ZJ1A 2D5CA 5TPWB 4MZXA 2PGDA 3GGJA 4M49A 1S9GB 3WO0A 2VDWA 1YZ7A 2MYNA 2VZEA 3QBCA 4NFLA 1RT6A 2E18A 1KEZA 2XI4A 1ESEA 3OETA 3DOKB 1YNOA 3T06B 2D06A 5LA6F 1MO4A 2DGSA 4RJJA 1R4NA 2XR1A 2GKOA 3NG8A 4KHPF 4D4LA 5T67A 1X6VA 4OIMA 4B2IA 1BXZA 1VI2A 2JRLA 2CD9A 5CAAA 2YRXA 2HSDA 2VOPA 3Q87B 1JS1X 4C7VA 4Q00A 2AQKA 4CQNA 3T5DA 1WUTA 4WW0A 1QV9A 3KKQA 3UK1A 3VWSA 3T1VA 4TWAA 3K16A 1ZM3A 3F4BA 2R7KA 5EN1A 5J23A 2E6KA 5EUCA 4HWSA 2F2TA 1H2EA 2ATCB 5JAPA 5EIHA 1BYIA 1I3OB 4AO6A 3RASA 4XYBA 2BJ9A 2LWIA 3ZD9A 4RH0A 1NI5A 3OKCA 4QM6A 5BOSB 5IWAJ 3WXMA 1RKIA 2FVPA 2KJWA 1OGJA 4ROSA 5IK2D 1R8YA 2H1VA 5DH9A 3QHPA 4PXEA 1LI5A 2OCXA 3MM5B 5E4TA 2YVAA 1PC4A 2NYUA 4CIDA 4XPEA 4J0QA 1TMOA 3DGFC 1SXJC 3PHBE 3IQDB 4QXQA 4J76A 4RZIA 5AKJA 1CR2A 3MEQA 3IOCA 1OX5A 4IMRA 2LU2A 5B1DA 3T3NA 1ZO8A 3MN1A 1MB9A 1XAIA 2M4MA 1IAQA 5ETVA 4FFNA 4RTNA 3WS7A 2YZ7A 1IKYB 4QYZJ 5ADVA 3DEFA 3NP5A 3T0GA 2M98A 2IDZA 3EPLA 5KVQA 3BYRA 3THOA 4BKPA 3AQPA 1SCUA 1K5HA 2GEJA 4TKMA 3MT0A 1F1JA 4OSPA 4NI2B 2FJUA 4LA4A 1IBMJ 4PWUA 1MB2A 1RTJB 2DLDA 5HCIA 2ZDOA 3UNGC 2X0DA 3TOQA 1P17A 4JYZA 1VP9A 1AV6A 2A9RA 1AX9A 1F60B 5HDQA 1WSBA 4WNCA 3GN2A 1QH0A 3QIVA 4N3BA 3KE9A 5CX4A 4Q16A 5IDYA 2C5EA 2I1LA 3DBOB 4WCFA 3UANA 2XCAA 1OF1A 5I7RA 3NATA 3H5SA 3SX0A 3M8PB 5MGNA 3CY6A 2K4MA 5ICEA 1Z63A 1PZEA 4C11B 5EKTA 4O3NA 1DBIA 3O83A 4TVBA 1UXJA 3DLKB 2C0QA 2GYYA 2W98A 2BH2A 3KT6A 4KQIA 3RTVA 3QT8A 3P0EA 3W6ZA 4MV7A 3L4BA 5A4KA 4FBGA 1FS5A 4QPPA 3W2VA 1VHQA 3PUVA 4NS4A 1TJ3A 4F4KA 4JT8A 4EJFA 1S1WB 6AT1A 3DZCA 2HBRA 1G0OA 2DNGA 1L8OA 2YKMA 3TKAA 3PT9A 1UZHA 5DLDA 4C0WA 3LI2A 4H7KA 1G7SA 4I9UA 1PS9A 2FMIA 1QZUA 3CJ4A 2HDNB 4I2NA 1TK3A 2FJPA 3LPNA 4R5HA 3AEUA 1RJWA 3ICEA 4FFDA 3RIEA 2WY2D 5JD3A 4CMIA 1LV5A 1OWMA 3IRXB 1UM9A 3O75A 3GIIA 2RGRA 3L7LA 4QJ4A 3SS8A 3M1IA 4EM6A 3LXXA 2ZBUA 2FVSA 4UQOA 3D8HA 2WK1A 4YV2A 3SGLA 2QXTA 1PIEA 3K1YA 3AUYA 2HHXA 3U9SA 5L3VA 2A57A 1F48A 4Y2PA 5KHLB 3BF8A 5IMSA 4X85A 2F1JA 2Y67A 3GYNA 3HSJA 1RIFA 3JAKA 1IQTA 3KLMX 2EFGA 4C4OA 3K57A 1RGVA 3CF0A 4ZN1A 5C37A 1FX2A 2X6RA 1B1CA 3G8SA 2QV7A 1AFIA 2ASJA 3EUFA 1JSLA 4F4FA 2CJBA 3AIMA 1VHWA 4GGOA 3IIKA 2X1GA 4C8YA 2OCIA 4Y2HA 4P72A 4N9QA 1RFGE 2RJNA 3HJTA 2DWQA 3ZW7A 1NX6A 1EX8A 5KDOA 1J56A 3R40A 2RHLA 4O02B 1RWNA 1FFXB 4EJ0A 2YTCA 3PW4A 3ESQA 5LQDA 4EMSA 1VQPS 4E5MA 2RGNA 1DEXA 4S0XA 5GV7A 3GJTB 2NX2A 1Z25A 2O2CA 1D0EA 3GD5A 4RM2A 1N8RT 1WMFA 1NJ5A 4TKUA 3BEGB 2WYOA 4KIWA 2P8SA 4EKNB 3OW2R 4L0CA 2EARA 3QIPA 2F1FA 3ER9A 4J2TA 1SG0A 3SLRA 5DSXA 4IR9A 3SHOA 4ZQHA 3SKYA 3KVNA 2ZWVA 5AW8A 4PC1A 4AUKA 4ALKA 3QLUC 4UU8A 2H9ZA 1LRLA 4KBIA 1UXGA 3KK3A 7AT1A 3T1HB 5D77A 5KVCA 4B73A 1YJ8A 1K3TA 4UJ3A 2Y92A 5LN1A 4X93A 1QE5A 1GVNB 2PZAA 1YCHA 5ETOA 3HL0A 3BJZA 1W9MA 3LVRE 2AOXA 4R1TA 5KFZA 3HHNB 2ZYGA 1O57A 4J0KA 1D1UA 4BQOA 3CNLA 1K2VN 2AJ8A 2WVDA 3K5PA 4J5OA 2QTMA 2R2SA 4NLGA 2DNNA 2VPYA 1IEQA 2FZEA 4IYJA 3ZUGA 1RI2A 3TNJA 2NUUG 2UDPA 4HT5A 1OZ0A 1HDIA 1DAPA 3MUMP 3K4QA 2DYKA 3W06A 1TUVA 1RIIA 4N8NA 2XVAA 3MUVP 4CF4A 3DDUA 3FF1A 4DPXA 1Z4UA 4ECWA 5TR9A 2A5JA 4I4TA 1C81A 3EXEA 1CUEA 1GZ7A 3GELA 4GRAA 1Y8AA 2VAXA 1RSZA 2AW5A 1QJHA 3TLKA 1ZJ6A 1NDHA 4L0MA 2Z2XA 4D9EA 2QUAA 5DW3A 1D2CA 5PGMA 5IFMA 2D5IA 4A0HA 2CNKA 4Q34A 1AURA 3JQAA 5MHTA 4RX1A 4KITB 2B5JB 3Q3VA 2V6BA 1NTOA 1JLHA 3AKCA 3G9UA 5ER6A 1NFRA 4NCIA 3T7DA 3L1HA 4XX0B 3H65A 4OREX 3V2UC 1IVNA 4IIJF 1F5CA 5BYRA 3GSIA 3WOHA 2GC8A 1EFKA 4MT1A 4QUIA 5GP1A 4BNIA 4TUYB 3QEMA 1O95C 2UXDJ 4PBSA 2HQFA 2F1KA 5BVHA 1W2GA 2WJIA 1GU0A 3RF6A 4ZOLF 2MLYA 2HWXA 3SFUA 3KUXA 2R6R1 4EHKA 5C5IA 1XMXA 1KDYA 1JAZA 2QUZA 1A1SA 2ZH1A 2ZM6J 4H7JA 4IX1A 2QUBA 3LZ6A 4TXLA 1BVHA 4PAGA 4K46A 4RPGA 2WHQA 4FI3C 2AFVA 1QCYA 2GO7A 5EXXA 2YCLA 3G0HA 3UD3P 4CMGA 1QFMA 1O51A 1EM8B 5BR8J 2C58A 4I64A 3DMGA 2QN7A 1JJCB 2XI2A 4P3KA 4YLEA 2FCRA 1LFAA 1LWNA 5AW7A 1C9EA 3D0KA 1VLMA 2H92A 3HT0A 3QG1A 1EFHA 1Y8QA 4Y2UA 2ZB4A 4CG3A 4M95A 1XXHA 4M8NE 5I9SA 1ADBA 4NOMA 3ICQB 1G5RA 3ZZ1A 5HFAA 1AXEA 1K7FB 1ZJ4A 4LBZA 2X9VA 1B14A 1Q2UA 1PJ7A 1RXUA 2J0EA 1Y6FA 2FTRA 2X7IA 3GUHA 1IATA 3P9ZA 4BC0A 3QE3A 2QC3A 1RA6A 3MOZA 4DDMA 3I4HX 1GZSA 1SHJA 2BKUA 2V6JA 5KOIA 3B1FA 2IUTA 3UT0A 1YCGA 3RE1A 4ED3A 3IT0A 1MZVA 3ZJTA 4ZEWA 3HBMA 3KLGA 5IUNC 4LIRA 4Y9TA 3D1QA 3LCVB 1YS4A 5B3LA 2JJ8A 4L5IA 4WZAE 4B7CA 4ECZA 3DE2X 5LMNF 3GTYX 1Q6YA 2P5YA 3EMDA 3K6JA 2W6CX 4J3JA 5JNWA 2YFHA 5KJ1A 4FB5A 2YS7A 1LW2A 5ECGC 2X2OA 4QIVA 3KYJB 2WUEA 2H52A 2VQFF 2ZCUA 2OPRB 4XGKA 5JALA 4OUDB 2KB2A 5E1BA 3L01A 4J03A 2ZRQA 4EI8A 4E7OA 1N6NA 2KX7A 2YYSA 3Q2OA 4JI8B 3D2AA 4JSYA 3HNPA 2JLZA 5HS4A 4IJKA 4LSZB 2DM6A 3D1VA 4NYZA 3L4SO 4NULA 3EE6A 5EPUA 4ZS6A 4G5SA 2BKNA 1J99A 4LWZA 2C2ZA 4NIMA 4BATA 1TAUA 4WCVA 2J4DA 4Z9AA 3CS3A 2IVFA 2FB0A 4EZEA 1OZAA 4D42A 4E2XA 4AUEA 4ED5A 5K9FA 5K0TA 1EE9A 3GU0A 4NV0A 5A7GA 4BIMA 4MDHA 3L1KA 4NENA 1RP7A 3GLGB 1UBCA 3EBLA 5A4IS 2G9QA 2KRRA 4US0R 1FE4A 1MWZA 4G01B 4I1UA 1XVIA 1P6UA 4N6GA 3QT5A 4GGMX 4IUBS 4BASA 1W6UA 3ROXA 1OI7A 1P4AA 4EA7A 2ZI6A 5KFCA 3RFCA 1NVFA 4QO8A 3BD6A 5BORA 5T14A 1W47A 1J8DA 4ZV7A 4C6TA 4DCVA 4FP9A 3LJKA 4RMHA 3IQZA 2HGSA 3ND6A 2CL7X 1B0TA 5F77A 1YDEA 3DE7X 4RZ3A 4R8MA 1RE0A 1RQXA 4H7HA 3TJ9A 3RU0A 2DTDA 3QF7A 1QRUA 3BBLA 3T9NA 2DFKB 2E4XA 3GH1A 4FYWA 4OGLA 4PZEA 2EDCA 2IC5A 1B8UA 3CF5Q 1YIJS 1JDVA 5C25A 2C8KA 3A3PA 2QN6A 3JSAA 3HVTA 2D00A 2YJ4A 1KP3A 3W2GA 3LC1O 3F6SA 2EVZA 1XWWA 2QMEA 4L2IB 3HVJA 3L3BA 5HCUA 3BR9A 2PAAA 3NIWA 4EHFA 1DJLA 1A2QA 1QVAA 2RKOA 2CZ4A 3RSSA 4OEHA 3GJ5A 2UUTA 4DAOA 5E6SA 2WJVA 3N9IA 4IM7A 3LUHA 2FGOA 4NLSA 3D0RA 5KFQA 4QASA 4GC5A 2DXDA 4XAQA 1MV8A 1Z5VA 1G8HA 2Q3CA 2WA2A 4H35A 5EZYF 2JIDA 2HZVA 1XZPA 2PZ8A 1GZVA 2GAIA 1TZMA 4WADA 2YWKA 2RUSA 1H4VB 2ZRPA 9MHTA 2VDLB 1ZQ9A 1PQ4A 4F3CA 1IWGA 4ZQEA 2WHPA 5ICSA 2YOFA 4D26A 4HZIA 4HGNA 5DGTA 3QX3A 1X8XA 3QXSA 4MUBA 2VOEA 3ZCVA 2IAJB 4NG4A 2VC1A 3RB0A 4NE9C 4M1QA 3KFLA 1BQ4A 3BIJA 4LFBB 5KG4A 2HAEA 2ZHOA 1ZUWA 1U3CA 1U7DA 3IT2A 3VAHA 2NP7A 4MGHA 1ZIDA 4BPBA 1YR8A 1ZN2A 1JKMA 3SJUA 1KR2A 1YJVA 4GOJA 2I6TA 1MO3A 1JWBB 3GR0A 4QDTA 4KUGA 3GCDA 5KTPA 3FWYA 4GUAA 1J2VA 1T1RA 3QKRA 4C4ZA 3U3DA 3CT4A 4PAQA 1U65A 1RMYA 2PBFA 3BH7B 4PWDA 1QHNA 3DA8A 2HCTA 3BH0A 3DCYA 3LUKA 3ZWDA 3L7UA 1W0JD 1WIWA 2XKJE 4WE1B 1QSLA 2VQ6A 1Z06A 5KTRA 5A3RA 3HDQA 3O8NA 4NJMA 1OKKA 4E6EA 1RJFA 2ZSHA 4ME6A 4LCEA 3PJGA 2FUG6 3N2LA 2ZYRA 2ZJ4A 1VSVA 4RIHA 3AJAA 4RKFA 1QTNA 4MKVA 3TG8A 4LF5F 1VBNA 3L05A 4Q93A 2I4MA 2UZ1B 4JB2A 1YZGA 3MM6A 1OY9A 2IYIA 2DGDA 2IXBA 4J2OA 1N0IA 4FYXA 3GEDA 4DRZA 3RUFA 1N5QA 5J2TA 4ABTA 2RRNA 3KQMA 4IUDS 2B4RO 3IBCA 4R84A 1EBFA 5BQFA 5I7FA 1H23A 4M7RA 4W1QA 2ODWA 3QELA 2XIQA 1OI4A 2CN1A 1R8QA 4L27A 3VR3D 1BW9A 4B5KA 1ZM9A 1Q14A 1AUXA 3R7NB 4C88A 3F5SA 5BUCA 4RMIA 4KV8B 3CRRA 3AL0C 1ST2A 4GGPA 1NVDA 4LGVA 1KOFA 3IQGX 2O2JA 1SBYA 1YVRA 1KFKB 4EECA 5F2KA 1T6ZA 3E01B 2YRFA 1FJHA 2EL9A 2GASA 5I4BA 2M7SA 2GN9A 1FDVA 3TA1A 5HO4A 1JA1A 1ZUNA 4PKDB 3I2JA 2GPWA 2LR0A 1QDLB 1X7GA 3GO4A 3D59A 3H0CA 2ACWA 2QIPA 2QD5A 3C6UB 3DDCA 4ZZ2A 1L3KA 1OFHA 3OJSA 5CVCA 2NW6A 2H1RA 4L22A 4G56A 3W60A 4C5BA 5F8GA 1AB5A 3KB6A 2VOJA 3ZTRA 1M6HA 3CNQP 4NARA 5CAEA 2QORA 4TU8A 1L4BA 4W98A 3RRYA 3FPGA 1NI4A 1E77A 4QAQA 3KBOA 2UYQA 1T3SA 4JI5B 1G20E 1XIVA 2CDRB 1VPEA 1HBJA 4Z8XA 4W82A 4P7GA 4R5PB 1Q8BA 2JZOA 1RVV1 4EYGA 1JQJC 4PAAA 3NTQA 1FFWA 3Q8SB 1CULC 5AJWA 1KL7A 3UMSA 3CN7A 1JLGA 3TDMA 5G53C 1ZU5A 3S27A 2CFSA 4LQ3A 3QU7A 1AXGA 3VTIA 2CZGA 3G5UA 1HDRA 1F3OA 2NAFA 5ILGA 2VJPA 2XUQA 2OAGA 1F17A 2QMOA 1NQUA 1TFUA 1WLYA 1SIWB 1NB2A 3W5CA 4FFBB 2YMPA 3G82B 1XXLA 6Q21A 5COBA 2R7RA 5BWMA 1I13A 1CV2A 2WVHA 4P6QA 3BXFA 4YAWA 4R7TA 1TKTB 3GNTA 1I80A 1FJ2A 4LWQA 2OMLA 4V1CI 1PSZA 4GX2A 1GAEO 3G0GA 4FXOA 3FVWA 1EFRA 1ZTTA 2W37A 1QH8B 4RJTA 4CO4A 4TXSA 4YS2A 2XS7A 3DDOA 3HEMA 2WSYB 1DV2A 2JAQA 2XRMA 2Q29A 5D3ZA 1P0FA 2WQZA 1N2BA 1R50A 4I4BA 2W2KA 5CLLA 1H2TZ 4V3BA 2HYDA 1GEHA 1PV2A 1L5QA 1BFUA 3ZNJ1 4U7UD 1HSZA 1FDOA 3RYIB 1TW2A 3D5QA 2RG1A 1KYXA 5C31A 3L0OA 1XLTC 2QL5A 3UPUA 1FMTA 2P7HA 1DAFA 2J87A 2RHWA 1ISSA 5GM2A 4ER7A 4X24A 1N6LA 3SICE 4EF6A 1JPNA 2FUEA 3RT1A 1PZNA 2OSBA 2DNRA 1JXVA 2YIVX 1VLQA 5KAMA 3TRFA 2F9MA 1HA1A 3RLFA 1SIZA 3EZ9A 3WWZA 2HGLA 3MEDA 2FLOA 2DHSA 2WICA 3RJTA 4Q3EA 3HVRA 2YY6A 2C99A 5IJZA 4PZDA 3P71T 3IOBA 1YRYE 1UFVA 4MQFB 3HV0A 1YQ9A 5UKDA 1RQ2A 4C6AA 3RCBA 5EXTA 5J9FA 3Q3GE 5A9TA 3GP9A 2BRLA 4UZBA 5E0OA 2O0MA 5JBIA 3ZDDA 1CZRA 3WIUA 1Z2PX 1N4DA 3EQ7A 5EMKA 3DZGA 3NT5A 4II2A 2I7CA 3OJFA 1TM5E 4ZK6A 2R8PA 2PE5A 4BNDA 3KK2B 2BM0A 3IDQA 1WKKA 3LBHA 5AI4A 3USZA 4RKUC 4EHAA 1QM9A 1Y9ZA 4FX2A 5B64A 2SNIE 1Z7BA 3C5CA 1GO2A 3KPYA 1SVDA 3NOGA 2DFDA 1ZR4A 4ZP7A 3SIWA 3CDAA 4A92A 2D2EA 1SPXA 3ZWQA 3KUDA 1Q84A 1VGVA 4QDKA 4Q3BA 2WZCA 1TEVA 4HCJA 5K09A 1OQ6A 1M1YA 2C28A 3JYPA 3RC9A 2GBFA 5B30A 2NAPA 1GTVA 3DR5A 1OWOA 4MI3A 1S59A 3DDWA 4TSKA 4MFBB 4K6FA 5AHOA 3EBOA 3B2QA 5DQIA 2LCWA 1VK3A 4B3BA 4O1HA 3ENAA 1D2NA 3L6BA 4ESVA 4LDZA 1QF6A 1OLUA 2PZJA 1JJBA 1ZISA 1K7XB 3FNNA 2GN6A 1WM1A 5A2QA 1XQ1A 1FDRA 2O4CA 4C7XA 1KYYA 1FLVA 3R5JA 4YUVA 3LAMA 2DRBA 3AXTA 3T3OA 1MAWA 3WYNA 3VDNB 4JI2B 4DWIA 4JI5J 2IU3A 2IVZA 3AIKA 3AUTA 4AZ0A 1SKUB 3URMA 3FMVA 1YS1X 3WJAA 1JP7A 3JD0A 1YZ6A 3ODGA 3N0WA 4Z1MD 2N82B 4CEHB 3FPHA 1NPTO 3OFEA 4ZN6A 4X6YA 4MWSA 4YK7A 2ZH2A 1IBCA 2OD4A 3RG2A 4Y34A 3C4JA 4A47A 5HQMA 5BQOA 1U8SA 3GZTB 2JX2A 2VP4A 3RANA 4CE6A 3DMTA 5B09A 1APSA 2KPOA 2K2PA 3QPUA 3K5HA 1WC5A 2CMDA 5LM3A 4D45A 3KJZA 4HEA6 1Z17A 1R8AA 5HMYA 4ZU3A 4A6EA 2C9CA 1VIAA 2V3WA 5C32A 3VGTA 1UPFA 3GIWA 2Q49A 3VC1A 1E4VA 2WJAA 3KUCA 4POAA 4CL8A 2VDMB 3PLRA 2JHPA 5DM1A 3PEYA 2Y1CA 4AJLA 2C4VA 4EHHA 3KKKA 4QWCA 4Y1RB 4C4SA 1YS6A 4DGQA 3BJEA 5BR4A 5HKOA 5EWMA 5A02A 5JJKA 4U2CA 4WECA 1H5UA 3CE6A 4DZ6A 5BNFA 2XBMA 2OZLB 2QN1A 4G2TA 3WRWA 2CVQA 4DKXA 1SXJB 4AXBA 2V65A 1CJKB 4KOEC 1TCVA 4DHEA 2OFPA 2WWYA 3VQSA 3IX7A 1JALA 3TIXB 4U0JA 5KSZA 1VMDA 3CF2A 1PK7A 2BKLA 2FHJA 4B85A 4XB2A 4MKZA 3UCUP 3S7TA 4P22A 4WZBA 1MOZA 2OFHX 1X5SA 1Y5LA 2DKNA 2XQCA 2R8BA 1KI8A 4C8LA 4TS9A 5CLGA