3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
4Q1DA 2Q9BA 4TLBA 2G1JA 1F2UB 3VHLB 1W36C 1KOFA 1IM2A 3ZS9A 2WKPA 4PPGA 1OIVA 5FUXA 4AKIA 1M7BA 3QPUA 3CF2A 2WOJA 2C96A 1G7SA 3LV8A 4IVQA 1QF9A 1E2QA 2ZRGA 4B6FA 3RDPA 2A30A 3RWMB 4B33A 2YOHA 2A78A 3AQ4A 2REXB 1G8FA 2XGJA 3RS0A 5DLQC 4GI7A 2XOKD 4LC1A 3VR1A 1IXZA 3AKYA 3VMFA 3A6PC 3L43A 2O8EA 2PX3A 2A2ZA 1TUIA 5J4YA 1N5LA 3RABA 4B3GA 4J0QA 1W7AA 5JFGA 2MSCB 2IWRA 1A82A 1GP2A 1KI1A 3FTQA 2IA5A 2R6FA 2W6IA 3W9YA 2GEDA 3WBKA 4M9SA 1SKQA 2FZ4A 4X8MA 3H84A 5C46F 5GVSA 2G0TA 3Q5DA 4FW9A 4AWXA 1Z63A 4ILEA 1ODFA 3B2EA 1E9FA 2NZJA 2IC5A 3GFPA 3LW8A 1XTKA 2OSBA 1TEVA 3Q7PA 1P72A 1XTSA 3BC1A 2DFTA 2KBFA 4DLSA 1LNZA 1D6JA 3CNOA 4A2PA 1GRQA 1R8SA 1HE8B 4DRZA 3BB3A 4D4LA 3PUVA 1ZCAA 4DB2A 1TX4B 3NWJA 3L0OA 4HAYA 4M9XA 1BKDR 5H8WA 4ZKEA 1C4OA 1YQTA 1LVGA 1U0HC 2DY1A 5TDHA 3MG9A 5A0FA 1GDDA 1NN3A 3NXSA 4QBGB 5KYKA 3QG5A 2J0VA 2XNDA 2VLIA 1XMIA 1FTSA 2BOVA 3E2IA 3QKTA 3ZS8A 1FOEB 4HZUB 4E22A 5BW8A 4H1UA 5K8UA 2J9RA 4AD8A 2FA9A 4LZZA 3FMPB 1CF4A 4DWJA 1XMJA 4OBEA 4MYTA 1RFLA 2HF9A 1TF2A 2FSFA 2ZRCA 3R7WA 4QM7A 1QVAA 3KTAA 521PA 4Q9KA 1JALA 1E9BA 1HEIA 5EE1A 1SKYE 4TTPA 4K46A 3AP1A 1SXJE 3HU1A 1E4VA 3ZVNA 1ZU5A 2RAPA 1RIFA 1FL9A 5DE3A 3I73A 1KDRA 3RRYA 5L3QB 1QHXA 1XJCA 3AP2A 4DXAA 2A7QA 2YWHA 3U44A 4EJSA 3AB3A 3QUSA 2ONJA 4TT3D 3THXA 4FIDA 2FPMA 1I2MA 1TADA 5GVRA 3ZIAA 1KMQA 1ZMXA 1QRAA 2ZIAA 3KQKA 2AK3A 5M04A 5A4JA 2F43A 2ZRIA 4OHZA 2ERYA 3UXMA 1JQJC 5FUYA 3UWKA 3RS5A 4Q9LA 2ZI3A 3BB4A 1GIAA 1WB9A 3QF7A 4EPTA 4L9WA 5EP2A 3W5JA 1GRRA 3NVAA 1W44A 3ASYA 3QKUA 2R6AA 1OE0A 4BWYA 2CE7A 2Z43A 5P21A 2C95A 3D3QA 5SZKB 3UWOA 3IBYA 4LHVA 2ZSFA 3GEIA 1T3SA 4QL3A 3TW4A 3U60B 2ZRDA 2YYZA 3HR7A 1EFRD 2V1XA 4KFRA 3PUWA 2RGBA 4GSYA 3ZVLA 2BC9A 5B30A 3FMOB 1SULA 5KNCA 1A2KC 4DDVA 2XX3A 2ZUCA 4HAWA 5EP3A 4F93B 5JRZA 4QOSA 4PO8A 2WSSD 1N6IA 4BFTA 1G5PA 5KU1A 1NSTA 2REOA 1M74A 4TMXA 5LPNA 3TGPA 4HYYA 1TQ2A 2IYYA 4Q1AA 5ELXA 5F3WB 1F2TB 3A58B 1P60A 1US8B 4OQNA 1R2QA 1OFUX 4HZUA 3OIWA 3SC3A 4DKXA 2IF2A 3A1VA 1Q0UA 1G19A 4LHZA 1Z6GA 2QMEA 3EIQA 1JJ7A 3EG5A 3U6KA 4D25A 4X8OA 1N5JA 3PXGA 5D3MA 1ZD1A 1KSHA 1OXXK 1ZNXA 3LA6A 5KTYA 3ADBA 3HR8A 4IRUB 2HYIC 2ZS7A 4PZZA 2A5YB 2QE7D 2CDNA 3Q8XB 3DVLA 1TMKA 4D4JA 3ZJYA 2CL6X 5DISB 3TMKA 1XPUA 4I1OA 1EXMA 4TMZA 5FL3A 3N70A 4IOKA 2UZ3A 4BUJA 2R65A 2BBTA 2B6HA 3UPUA 5G41A 3AF4A 3ZH9B 2LKCA 3CRQA 3KQLA 1M1YE 3VKGA 1CS4C 5F9HA 4ON9A 3MWJA 1MABB 1RW4A 1IN6A 2QTFA 4D0LB 1P62B 3O8BA 2ASEA 3L8YA 1Q1EA 3LDAA 2QE7A 3U61B 4XD7A 2OESA 5TV2A 2GCNA 4TSFD 2UZIR 1E32A 5JZVA 2B7BA 3F5FA 5HZHA 3MGCA 4TWZA 4F4IA 5JLJA 1FZQA 1P4SA 3LWNA 5TB5A 1S9HA 4OK5A 1DAGA 2PH1A 1ONBA 2IYTA 2WJJA 4M1SA 4P0TA 4QNRA 4QHSA 1KGDA 2JJ1A 1XF9A 5E7MA 3GJ5A 1UKEA 4Q7KA 2W2VA 3T35A 4AKHA 1J7KA 1HV8A 4LV8B 2J7PA 2VHUA 1DG3A 3H2YA 4GDFA 221PA 2GJAA 2GKSA 1G5RA 3HDTA 421PA 4Q9HA 5FTJA 4B73A 4JJZA 5JI2E 1LS1A 2EWVA 4DHEA 5BQ5A 4E09A 5CM8B 4P4SB 3LQRA 1XRJA 1T3LA 4R98A 2L0XA 3TK1A 3K0SA 1QHNA 4M22A 2WWYA 1PLJA 2IYZA 5KHOC 2ORIA 2IK8A 1N6OA 1TU3A 1HQYE 2C04A 3WHLA 3GEEA 4F91B 2ZRKA 1IXRC 4P3YA 2A5FA 4YXWD 3NHAA 4DIEA 1EFCA 2HV8A 3SN6A 2NO1A 4JLOA 1II8A 4HLUA 3QXCA 1OH8A 5KO2A 1OH7A 2W6ID 3JZMA 2W2XA 1E9SA 1ZUIA 2H8KA 2NIPA 4ASUD 1OT3A 4UNQA 3TKLA 4I1UA 3D6TB 3W5IA 3G5UA 2Z5FA 1IJEA 5FOSA 1SXJB 1Z22A 4ZDIA 3PR1A 3MCAA 1NL3A 2JLRA 1ELOA 2H7VA 4C0AC 5KSZA 3LX5A 3UG7A 4R2IA 1B0UA 5G3YA 4UXHA 3ASZA 3BBPA 1Z6AA 4EDHA 1DEKA 1DVRA 4JVNA 5G53C 2ZUBA 4I81A 2C8VA 2GNOA 2OHFA 1OF1A 1ESMA 3LXXA 3T5GA 3D8BA 1UFQA 4DLUA 4JLDA 3SI7A 4DLTA 1JAHA 2EW1A 2NO0A 3CUEF 4ZCLA 2ZRAA 3RSLA 5KOYA 3GLFB 5EJEA 1OFTA 2IYRA 3LVRE 4V0ME 4BEBA 1Z29A 1UPTA 2CHQA 1DAIA 4UQOA 4M2LA 4A15A 1G7CA 1JNYA 1RJ9B 4Q01A 4Q4JB 4TMVA 3RAPR 4DT1B 4BGDA 1NP6A 1RE0A 2DCUA 2VP6A 3BRWD 1KJWA 3WRXC 3CR7A 3A4NA 3W8NA 1KO5A 4ZPXA 5FOVA 3MWLA 4WZ6A 4MH0R 4GBMA 1H8HA 2IHBA 1W47A 4KYUA 3AGQA 3AVVA 3EWSA 2ZROA 4TMKA 1E1QA 4ZDWA 4Q4AB 1N6PA 4WXPA 2QZ4A 1TPZA 4TL9A 4L9SA 1II8B 1DPFA 5H70A 1K5DA 3B8HA 1Z0AA 4URZR 2LWIA 3J81k 3KKPA 1GVNB 1OHHA 4M1KA 2CL0X 3PITA 1R0XA 4DLWA 3K9GA 3BFKA 3QVUA 4KAXA 2PEZA 2FV8A 2O0JA 2FFQA 5DI3A 4D81A 2ORVA 1DOAA 1F48A 1MRNA 3LAWA 5LD2C 3EZ7A 4K8OA 5FOUA 4XJXA 1AS2A 1OJLA 1OXSC 4MGZR 2O8FB 2ZS8A 1S96A 3IIKA 3KJEA 4HDOB 1RYFA 4MUAA 1AGPA 4M4SA 1OHHD 1ZM3A 3QPVA 2OG2A 3LW7A 2X2FA 3K9NA 1UKZA 2QN6A 3MLEA 4LJ4A 3GLFA 1ZNYA 2VF8A 4TTQA 5CITA 1E9RA 2KE5A 1QHHB 1P2TA 3SBEA 4JVMA 3QEJA 2AXNA 1T8TA 1XTJA 2XXAA 2O5VA 4HB3A 1PLKA 3LRPA 1OV4A 2ZJ5A 4ITRC 1MR3F 2CMKA 4NONA 4B71A 4BFZA 5KUTA 1VKJA 1AZTA 5DHFA 5DNYB 3PUZA 3A1SA 1XD2A 4OK6A 4HUTA 3AF2A 1LS6A 3RS4A 4G5GA 4DJTA 2G9NA 3FYHA 5DI9A 1WMSA 1XCGB 1P2SA 1UKYA 1Z83A 3K53A 4D82A 3EPLA 2W2TA 1NVXQ 3WP0A 4ARZA 4ZI3A 3SYNA 2HJVA 3OZXA 5EQTA 2C03A 2YJTD 1KHTA 3SHWA 1VCIA 4MRPA 2JLZA 4P4UA 4US1R 3G82C 4A36A 2W83A 2PEYA 3CWZA 5L3QA 4JYCA 3CR8A 3TSOA 2O0KA 4GMXA 1NBME 2F3RA 2OAP1 1GRNA 2NPIA 3TBKA 5JBQA 1EK0A 4PPQA 2IS6A 1OKKD 4JL5A 4KI0A 1OW3B 2P65A 2CNWD 5AK0A 2JJ2A 1VDZA 1BO6A 4LRWA 4BLQA 1W0KD 4ZO4A 1R7RA 2J46A 5AJVB 5JMTA 1AM4D 4LHYA 2WIAA 2IL1A 2DFLA 1OKKA 5HCNA 2OZEA 3WP1B 4EPWA 1YZLA 3X1YA 5AUOB 3DM9B 4C30A 1NLZA 4YMWA 1OIXA 1EX6A 2V6IA 4BRWA 2V7QD 3RS7A 1IN4A 4PHFA 3K0CC 1PVOA 2DYKA 2GXQA 2BBOA 4PSKA 4EFNA 2ZRJA 2GHIA 4GOXA 3BFVA 3CRRA 3VKHA 3A37A 1Q1QA 2IS4A 3FGNA 1KK3A 4R2HA 5KSYA 3K70C 3I8XA 4DDTA 2J87A 1JR3A 3FPAA 4TYQA 2KWIA 5GJWC 1GFIA 1JBKA 3EXAA 1E99A 5KDOA 3CNNA 1X8JA 1W4RA 1E9DA 1KO4A 2V1UA 2CVHA 4LWZA 1XEXA 1N6LA 4BECA 4FN5A 4AYTA 2WWXA 5CK4A 2VHCA 3VR2A 3LD9A 1COWA 1A7JA 1GG2A 2CCJA 4B32A 3PEYA 1NLYA 4RJLA 1Z0IA 3B85A 4LHWA 4RD6A 5HKKA 4Z8XA 5B57C 1AN0A 3NC1C 1G3UA 3C16C 3QXSA 4RD4A 3ECCA 4XH9B 5JJKA 5F9FA 1U81A 2IUSA 3GJ3A 4MGKR 1QHIA 4W5WA 3TJZA 3QQ5A 4B2IA 4IXNA 4JKYA 4TLAA 1W0JD 5H68A 4AURA 4BFUA 1DBSA 1R8QA 3R8CA 1LV7A 5CLLA 3RWOA 2HYDA 3TQFA 2IXEA 3B6EA 4YMVA 5AUNB 3QF4A 4XSGA 5C2JB 3DOEA 3FFBA 3BD9A 1E2KA 4ZCIA 4CW7A 4PTLA 1P9RA 1UBEA 3KZ1E 2HF8A 1T91A 3EC1A 1UADA 5BYJA 3WYFA 4LK2A 3C7KA 5DSZA 2O0HA 1KI3A 5FBQB 3UMFA 5A5GA 3LBIA 2HT1A 3SQXA 2CJWB 3CO5A 1QHYA 3SDZA 4TL7A 4IDNA 1RRGA 4C0KA 4DCTA 1NJFA 4NYIQ 4TQUS 1IY1A 1D5CA 3LH5A 4NL4H 3VX3A 3D31A 2EFDB 4QBHA 2OFWA 1KMHB 1KIMA 1KKMA 1W4BA 1GNQA 1X86B 4A8JA 1I4DD 2EWWA 1HT1E 4AC9A 2KSQA 3DKVA 4JZKA 1NLFA 2CLCX 2RH5A 1FNNA 3IQXA 1BOFA 3MWYW 1FPMA 1M7HA 4PQRA 3O8RA 2V7QA 3I1FA 1KYIA 3IQWA 4O0MA 2XJ4A 2BMJA 3NH9A 1CLUA 3C5HA 1Q21A 3EWAA 3X1DA 5HE9A 4CGZA 1KI8A 1FP6A 4URUR 1N6HA 2REBA 3K0AA 4D2IA 1KK1A 1YZQA 2ONKA 2VHQA 1HE1C 2GRJA 5JI3E 1XXHA 2PT5A 1R10A 1WDTA 4NBSA 2CCGA 4IDPA 1EWQA 3IO5A 1NY6A 4UNRA 2CVFA 5HPYB 2B7CA 4MGYR 4RD1A 1CP2A 3EIHA 3MAAC 3B7GA 3VAAA 4V0OA 1YR9A 3ZZTA 3I8SA 4IDOA 2AN9A 2P5TB 4IDHA 5C1BA 4LJ6A 1W49A 5EE3A 4HAZA 1W2HA 2V8OA 1B23P 5CLQA 4PPNA 2PZGA 2VRWA 2F1HA 5FUVA 3IUYA 4MQBA 1QHGA 3I4LA 2AFIE 2G0NA 2QM8A 3P32A 5JCZA 4A92A 3L0SA 4BFSA 4H1VA 1MABA 5LBIA 1KI7A 3CONA 1T0JB 2E1RA 3W3AA 2JATA 3LXRA 4Q7LA 3RRZA 4FMDF 1GKUB 1MO6A 1Q44A 3ZZUA 4Q1FA 1LY1A 3IEVA 3K09C 3BGWA 4U5XA 2I4IA 1N6NA 3GJ7A 4JL8A 3SQWA 3WMGA 1X1RA 1HYQA 3BH7A 5CYPA 4NCNA 2YVUA 3Q5EA 4PC3A 3K0EA 4HB0A 1K6MA 2VEDA 4U02A 4EPRA 1XCMA 1WF3A 2WICA 2FPKA 2IUTA 3SJBA 2WSSA 1F60A 3THYB 4CEIA 4FI3C 1CIPA 3TNFA 4A0FA 3TSWA 4QJ3A 1YR6A 3TVDA 2IYVA 1W36D 3TLXA 1JXMA 1WRBA 2VF7A 1SVOA 1QDEA 1YRBA 1AZSC 4JBXA 3KKNA 5JWOA 1K5GA 4YLGA 2GK6A 1JAIA 2H57A 2CBZA 5J5CA 2FWRA 4A9AA 1G5TA 3BB1A 3HJNA 1RRCA 5D3MB 5FPTA 3RSOA 4TL6A 1ZCBA 1YRAA 2J0UA 1D9ZA 4O3MA 4JVLA 2AX4A 4QXAA 3LY5A 1IBRA 2YNMA 3DMNA 3OHMA 4HDQB 2Q3MA 2NGRA 3ZQ6A 5E7IA 1SVIA 2GDJA 1M2OB 3IDQA 3MWKA 4POAA 3EX7C 1SXJC 3ZIAD 2HXYA 3BS4A 2BMEA 2QRNA 4F4JA 2QORA 1RC8A 2F7SA 1SVSA 4PO1A 1NN1A 4A0GA 1XD9A 5DYIA 2O8CB 4GOJA 3ZZ0A 4DEXA 4MKGA 3B9PA 4G3XA 1QVRA 4LUCA 3VR4A 4JSTA 3TR0A 1P7CA 5JEEA 5JJLA 3GLIA 3FMIA 1PUIA 3BXZA 4RD0A 4G5SA 1Q22A 1CBUA 1EGAA 1H8HD 1E94E 2JAQA 3NTUA 3QY0A 4MKHA 3GP8A 2FSHA 1AIPA 3GLGA 4IVRA 4QGAA 3KDSE 3M1IA 4JLBA 2CCKA 5JECA 1E1RD 4GOKA 2JEOA 1IONA 1XZQA 3BH6A 2YWFA 3WNBA 4O25A 4D80A 4OYHA 2QSYA 4QC2A 1E2NA 2BBSA 4LJ5A 3RRNA 3KJGA 2ZVPX 3LLMA 4NDZA 4W5HA 3CF6R 4B3XA 3FVQA 1XEWY 4A1FA 2JASA 2E87A 621PA 4CEIB 2Q3HA 2ODWA 2EFGA 4QKQA 2BEKA 2XXAB 4CDGA 1GTVA 3GLHA 2FNAA 4XWAA 4M53A 8OHMA 1KZ7B 2F9LA 3AP3A 4A8JB 3NKVA 2R9VA 2CNWA 2OLKA 2XZLA 2FMXA 2JCSA 1G8PA 2VYFA 1KY3A 5JSZB 2V3CC 2ODBA 4KYIB 4GZLA 3EZFA 1H8EA 1VECA 3H0KA 3CF0A 4UJ5A 1E2GA 1E9AA 1KJYA 1TNDA 1NMXA 1FX0B 4NYMQ 1EX7A 2RGDA 5AUPB 3ND9A 3C4JA 4B44A 2OO7A 3S1AB 3CH5A 1YHNA 1E2IA 3THOA 3B1XA 4PSAA 5EE9A 1CJMA 4CEJA 1YR8A 3U44B 1OB2A 1QZXA 2A5GA 1Y63A 3NEJA 1GITA 3OFNA 1GAJA 3PIRA 1TF5A 4Q21A 3GLIE 2WJVA 4PZYA 1MO4A 4XVUA 3KKQA 1XDBA 1E9CA 4ZV4A 3JVVA 1ZAKA 4KHZA 4M9ZA 1G7RA 4L8GA 4KSBA 2QTVB 2VL7A 3C8UA 5F2EA 1OYWA 2D4HA 2NG1A 1KZGB 4PAMA 2N1BA 4B3FX 3KL4A 2D2FA 5JHHB 2VA8A 4PHTA 5EXSA 1S3GA 1D8TA 2WOOA 4JT2A 3K9HA 1IY2A 3GEHA 1TL7C 2FGKA 2ZYWX 2B8WA 3W6OA 2X8AA 1QHSA 3U7GA 3OIYA 4V02A 1AS3A 1X1SA 3QOFA 4KXFB 3NG1A 1DE0A 3BH0A 3T1TA 3RS2A 2BCGY 3KXKA 1COWD 2HT6A 5E4FA 4NYJR 4BLOA 3A8TA 1CXZA 3MRSA 3QKSA 4IOMA 3R9XA 4DCSA 1JEDA 4OI0A 1SVMA 5BN4A 5FOTA 3B5JA 2GETA 2ZEJA 1EFTA 1JQLB 1JJVA 1WP9A 1NY5A 3BJIC 3AVWA 3QNUA 1NMYA 5HCIA 1R0ZA 1ZM9A 4L4UA 3PFIA 4JIMA 4CEJB 4V03A 4TT3A 4ZI2A 3I92A 2X2EA 3KJIA 1UKVY 3VR5A 1Z2CA 4PHGA 3AH8A 3WY9A 1TF7A 1GL6A 2AKYA 2JDID 2X77A 4DLRA 2XITA 2ZAOA 4IOJA 4BQSA 1XXHE 4XSHA 1L2TA 3QKRA 2HUPA 3EW9A 4B76A 2AKAB 3TUJC 2F43B 1E3MA 2ZTSA 2D62A 2QAGC 1E79A 1L8QA 1ZM7A 3BE4A 3U5ZB 2OUKA 3TR5A 2J45A 2B21A 3H1TA 3QF4B 5AJWA 3UG6A 3PEWA 3T34A 4OL0A 2Q0HA 5FTNA 2PZEA 5CDFA 5DH9A 4LDJA 3CBQA 3K1JA 1DAFA 1VPLA 4IJMA 1EG7A 4QGGA 4MDEA 3WBJA 4BLRA 4Z1MD 2F1JA 1GM5A 4HUQA 1JECA 4AK9A 2ZE6A 1U8YA 4BZQA 2GZHA 2GF0A 4R7ZA 4ZDKA 2K5UA 5CJPA 3OEHA 4Q00A 2C9CA 4YDHB 2OV2A 4HLCA 2BBWA 1Z47A 5LB2A 5D3QA 1D2EA 1NG1A 1XBTA 2WKQA 4KO8A 3UK6A 1F2UA 2LKDA 4PX9A 2WZQA 3IIMA 3C15C 1ZIOA 3W90A 2KJQA 4Q03A 1KDPA 1X8KA 1W4AA 2WMNB 2VSFA 3X1WA 1ZIPA 2W0SA 2UKDA 1ZW6A 2ZRHA 1OFIA 1E0KA 2C2HA 1U8ZA 1Z3IX 2IYLD 2QAGB 3GFOA 3NBXX 1NVUQ 4QHTA 1OFHA 4PSVA 4ACAA 1G7TA 2V54A 2JIZA 2GEUA 4QJ5A 3NEYA 1X3SA 5BYKA 4WW0A 1KSJA 3HPRA 2G83A 5E3HA 4KODA 1LB1B 4NZYA 3QXXA 2GBLC 4C3ZA 2ATXA 1W2GA 2DB3A 3TE6A 4LYHA 3UANA 4C2TA 2BWJA 5K8TA 5CB6A 2Q9AA 3W6PA 1GOTA 3K8YA 5JSZA 2NO7A 3QXJA 3I5XA 1JPJA 4FWTA 3IIJA 4OHXA 3AVUA 4Q9JA 4LYJA 2W6JD 1A1VA 2FFHA 2OAQ1 1ZC3A 2C77A 2A3RA 1LTQA 4TMWA 2FZLA 4IKEA 1FTNA 4M1OA 3KFXA 3SYLA 3ZLJA 2HCBA 2RGGA 4BE7B 5FPYA 3DZDA 1FQJA 4JBWA 4N0EA 1ZUNB 2DFKB 4P33A 1FQKA 1DARA 2C9OA 4TLEA 2ZYVX 2MSDB 3CRW1 4URXR 2O8BB 4A0HA 1Z0KA 2ODEA 2RGEA 2CEAA 2GA8A 1Z07A 4URWR 2NZ8A 2W0MA 4UXJA 4OI1A 4A82A 1XPOA 2ZQ5A 4GNKA 2V4ZA 1L7VC 3RVBA 1VG0B 4LV6A 4TQAA 4DCNA 1HY3A 3LLUA 2ZVQX 2QG6A 1CR1A 2OLJA 1VG9B 1E0AA 3VKWA 4QNMA 1IN8A 1HA3A 3EC2A 2V6JA 5DIFA 5L8VA 4CZ2A 5BWMA 4QHYA 1U94A 3OIVA 3B78A 2FSIA 3FDIA 2RGCA 1Z0DA 1US8A 2XSZA 2P5SA 1T9HA 4OI2A 1Y3AA 2PBRA 3W6NA 1XNJA 2AHOA 1C9KA 2IXGA 1KKLA 1XEXB 4FCWA 2WHXA 1KI6A 3ONWA 1XMSA 2FPLA 4WBSA 5L3SB 3Q3JB 5IK2D 2F9MA 4G5QA 2Q3FA 2ANBA 5LDDC 2YKGA 4HI0E 1AQUA 1J90A 4YC7A 3FKSD 3JZAA 2QY9A 4RFSA 1ZYUA 2YZ2A 3KUCA 2JLUA 2OM2A 1R5NA 4OQXA 1VYTA 2OT3B 3R20A 2G1KA 4LC0A 2IT1A 2WV9A 1AJEA 3EA5A 3VU9A 1JR6A 3N2IA 1NVVQ 2J3EA 3LFUA 2IXFA 2FU5C 4BPBA 2J41A 1ZU4A 3SYKA 3W8RA 2NTYC 2QPTA 3CX8A 2WWHA 3HP1A 4US0R 3FKSA 2AD5A 1SXJD 2XNSA 2NO6A 3UMSA 4U00A 3BORA 2WBLC 5IK2A 2IHYA 2QROA 3BK7A 1J2JA 4Q4JA 4OK3A 2QPAA 4V0KA 2FOLA 1D9XA 1SHKA 3TUZC 3U6BA 1NF3A 1G18A 1UAAA 2QUZA 4BASA 4RCYA 3K9LA 5HE8A 3A1UA 1OSNA 1DAEA 4DT1A 4DUGA 1XTRA 1U99A 5KPDA 3R7WB 3FWYA 2GJSA 2WWIA 4MYCA 3SFZA 1G17A 2ZR9A 4Q1EA 2EYQA 3IO3A 2TMKA 1HUQA 4DSTA 3CB4A 1XPRA 3V4RA 1MKYA 2N46A 1ZUHA 4TYNA 4Q4AA 2XNDD 2XTNA 3QSYA 2J0QA 1UEIA 4NU0A 2ZRBA 1U2RA 3P4XA 2F55A 2A9KA 3A4LA 2GVDC 2P67A 4OKSA 4C0BA 4IVPA 1G291 1OPXA 1X6VA 3B1ZA 1FNMA 3VFDA 2BJVA 2ANCA 1IN5A 2D7CA 4DVGA 3RC8A 4L16A 3CX6A 1BIFA 2R6CA 4CIDA 1VIYA 5EUQB 3B60A 2RGNC 4JLPA 4LX0A 3U3JA 4I99A 5BN3A 1VCOA 2F6RA 5CM9C 4QM6A 3T5DA 3V9PA 3IPXA 3BWDD 4W7SA 5KNBA 3PUYA 3THWA 4TLDA 4LJYA 1BYUA 1PLLA 3SE0A 1OH5A 1CR4A 1KI4A 1M6NA 2OCYC 1RPZA 3WNCA 4HAUA 3F0TA 1KK2A 3WMEA 2ZSEA 4PHHA 2ZJOA 3AEZA 4KJZA 3KFVA 4O2RA 3SFVA 3UKDA 1NIJA 3MMPA 4PFSA 3CKLA 5CK5A 4JLVA 3DEFA 2FEMA 1PV4A 4RCZA 1AKEA 3GJ4A 2UVQA 2PL3A 3GLFE 2FJUA 3GLHB 3O47A 3OEEA 3Q85A 3FHTA 4LJ8A 4Q4LA 1NMZA 3EZ9A 4TN1A 3PUXA 1T0HB 4Z8YA 3R9WA 4GL2A 2ZRNA 4IDQA 1G4UR 2ODNA 1VHLA 3QIAA 1G3RA 1XB2A 5FTKA 5K8LA 2HDNB 2RGAA 4NP6A 3NBYC 3OF5A 1MV5A 1UBCA 3AM1A 3WHKA 4E07A 1TUEA 2QT1A 2Z83A 1IOZA 4MA4A 4MYHA 4FWIB 2BCJQ 4UXIA 1SVWA 1TU4A 4HAXA 1FX0A 4BLTA 2PLRA 1ANKA 3CX7A 3MJRA 4WVFA 1YZTA 2JDIA 4HB4A 2O52A 5J4VA 4LBVA 1GNPA 3SR0A 3OE7A 4N0DA 1XWIA 4KLZA 4DZZA 1P9NA 4UNPA 2OBLA 3LBNA 4N3NA 2IW3A 2Q21A 5E7JA 2DWQA 2JLQA 3PV0A 2EFCB 3F8TA 4US2R 2JJ1D 3UIEA 1DO2A 2CLDX 5JRJA 4DSUA 2E9SA 4MKIA 4EKDA 4LBYA 1N0WA 4C7OA 4HSEA 2P2LA 1Q12A 3GD7A 4RFVA 3ICQB 2OXCA 4DLXA 4B47A 2VBCA 5AJYA 3AVPA 5C4MA 3DPUA 1LF5A 1HT2E 3B9QA 4DLVA 3RYTC 4TZ0A 1BMFA 1CJVC 1DG1G 2WWWA 1I4TD 4YQFA 5HZKA 1KMHA 3Q7QA 4PC2A 1CKEA 5AJXA 2WPDD 1VCNA 1IN7A 2RKOA 3PEVA 4Q7MB 4Q1BA 4RKEA 3V4FA 4UNSA 2VP5A 4D0NA 4EUNA 1GNRA 2GXSA 5IRCD 1CRPA 4MKFA 3SZRA 1TQ6A 1U9IC 4NYIR 4S35A 4DBLC 2RHMA 3IILA 2EYUA 4JBYA 4LOAA 4Q4HB 2F1IA 2ZYTX 4XD7D 1XJ0A 3U7EB 3U3MA 3AF1A 4KLNA 1C1YA 3HYRA 5DHAA 1GUAA 3SS8A 3CM0A 3QJYA 4JVSB 1F5NA 3M4YA 4P32A 2WIBA 2G3YA 3N2EA 1U98A 1ZBDA 3T1VA 1E2PA 1BH2A 3H4MA 1NRJB 1ESNA 1SZPA 2CK3A 1Z0FA 2J0UB 3IPYA 2BM0A 721PA 5DGXA 2MMGA 1KSGA 3ND8A 4MUBA 2V9PA 2QP4A 1CJTC 2BVNA 1AK2A 4OJQA 2H5EA 2FFAA 5KDDA 2IX3A 1RRFA 4LBZA 2GCPA 1A5TA 4XTRA 3EPJA 3S1AA 5AJZA 4B2PA 2CK3D 1G8GA 2H92A 2I1QA 1NJGA 4EQ6A 3AVTA 4PC6A 1G1MA 4V0MA 4Y0VA 4BFVA 4Q1CA 3GFTA 2DPXA 1U8AA 3TQCA 2RGNA 1G9XA 2BMFA 3IHLA 1H65A 2AWNA 3ICEA 2QI9C 1ETUA 3CRMA 3KKOA 2EVWX 1ZNZA 3AKDA 1P3JA 2QGNA 1N6RA 2XSZD 5FPHA 2BHRA 4H9GA 1HTWA 3GLGB 4URVR 2JLVA 5L3RA 2VSXA 1XFAA 4A8JC 1Z5ZA 2HXSA 4PZLA 5FTMA 3AVYA 1IQPA 4KBGA 1RZ3A 4MRRA 4OJKA 5EE5B 2VP2A 4BFYA 2BM1A 3DO6A 3QEOA 1SVLA 3T61A 3GLGE 3FFAA 2YWGA 1RRPA 5B58C 3KQHA 1QG2A 2Q9CA 2VSOA 5DN6A 4MYUA 4EJSC 4M21A 3QKSB 4GMDA 3P1JA 1VG1A 2DHRA 3AV0B 1Z28A 2NO9A 4HLUC 2VP4A 5E95A 4B3DA 2FE4A 4NMMA 4Z1MA 2IF0A 3TAUA 3X1ZA 2FX3A 3MSXA 3WYAA 4ESVA 1P6XA 1DADA 2QRZA 1E9EA 3QE0A 3O8CA 1OXUA 2ZU6A 2QP3A 3FHOA 2IUUA 2XEXA 2ZRMA 4EFMA 3F3YA 4NHOA 2QA5A 4KFUA 1GSIA 2WJHA 1EESA 2FN4A 4D0GA 4Z51A 3TSZA 4IEIA 2ZE5A 3E1SA 4B34A 3A1TA 4JLNA 1R4AA 2HLDD 1R6BX 5K8IA 2VP0A 2IS1A 5JWHA 1NBMA 4DLYA 1TQ4A 2VHJA 1GL9B 4RZUA 5CIWA 3PVSA 2NMVA 1RVDA 1G8YA 1G64A 1YJ5A 1ZNWA 3K0FA 1XX6A 4C0SA 3IHWA 2G77B 2WMOB 4EFLA 1LFDB 5JCPA 2ZRPA 2DWOA 1I4LD 1II0A 2IEYA 2IYQA 3K0FB 2Q6TA 2ZR0A 3ZVMA 3K09A 2W00A 3L2OB 4NYJQ 2XZPA 1ZD8A 3C5CA 4FINA 2GWHA 1XXHB 4EIWA 1KK0A 1T6NA 4KBFA 5SZJA 1KO1A 3AVXA 2N42A 4OQFA 3K70B 1W5SA 2WJGA 5TY0A 1OLOA 4LYAA 2PLFA 2ZRLA 3A1WA 3KXIA 4NCKA 2YC2C 2WJYA 2ZI9A 4PC7A 1WA5A 2LCFA 4QJ4A 2FG5A 3LQQA 1S9DA 2QENA 5EP1A 1E0SA 4TYWA 4B3BA 1E2EA 1Q1ZA 821PA 3KUDA 3W3ZB 4FMBB 2ZJBA 3U7FB 1JI0A 1G41A 3RHFA 4P4SA 2KI5A 4LHXA 1Z08A 3U4QA 1Z6YA 1Z6XA 4DSOA 2H1LA 3GLIB 1A2BA 1W46A 1DELA 5FOXA 4Q47A 2MSEB 4WXRA 5KDLA 3U7HB 3NDBB 3VU9B 2Y8EA 1ZC4A 1XMVA 2R62A 1Z06A 3REFA 4YMUA 3SOPA 4OHVA 4HLQB 4Q48A 5J4LA 4JLJA 4TLCA 5FPKA 4F38A 4YXWA 1KSFX 1ZINA 5TARA 1FMJA 3V00A 2ZJAA 4M1TA 1S4QA 2ZI5A 1V43A 4DUGD 4AI6A 2RGXA 1E2MA 3I72A 3FE2A 3SJZA 2FH5B 4TL8A 2MMCA 1Q57A 2HCJB 4W9MC 3G0HA 4LY6A 4EPYA 2DFNA 3ADKA 3FKQA 3ZDQA 2EFEB 4KVGA 2BDTA 2R2AA 1WXQA 3TH5A 3ZD6A 2J1LA 1RKBA 4URYR 2C9YA 4GRAA 1E2HA 2AXPA 5IT5A 5C4GB 1R5OA 2A5JA 3N5CA 4C9BA 4ESHA 2IYXA 1PJRA 2PZFA 4JMPA 2QEQA 2CXXA 3AUYA 2JJ2D 1U0JA 4IOLA 5FOWA 3KQUA 3DKPA 3LNCA 4JS0A 1XD2B 4MRSA 1NIPA 4PAQA 4UNNA 4CT5A 5BXQC 2R8RA 4UKDA 2O8BA 3PJRA 1VYVA 2Z4SA 1E0JA 2WJIA 5AUQA 5J4KA 2QNRA 3HPQA 3LBHA 1U90A 3WMFA 1CRQA 4G5RA 4DDUA 2GXUA 3NH6A 2ZRFA 4M9QA 4MRNA 5FL7D 1F6BA 2GTPA 1E69A 5FH9A 2AR7A 3NHBA 3QPWA 4Q9IA 5J4HA 2P6RA 1ZP6A 2GJ9A 3PENA 4HDCA 1E2LA 1MO3A 1SXJA 3QG1A 3U3RA 1NN0A 4B43A 2WWFA 5FI1B 3AF3A 2X19A 3OIUA 1T4GA 3I3SR 4F92B 3QKRB 3FB4A 1EWRA 1VTKA 3OEED 5DI3B 5EP4A 2BMDA 3RNLA 1Z6TA 1P2UA 2IBMA 2WAYA 1GWNA 1ZM4A 2XB4A 1UDXA 2J7PD 4HEJA 3ZGXA 4C0JA 5SZHB 3K0CA 3I62A 1R0YA 2FSGA 1W1WA 1R5BA 3M0EA 2QGZA 2J7KA 1QHHA 2IYSA 1JR3D 1SQ5A 2J5XA 4E03A 1SGWA 4KSCA 2HJGA 3SJAA 3L8ZA 2P6UA 1UJ2A 4RZXA 4LV5B 4M1MA 1E2FA 3CPEA 2W6JA 3CIOA 2WVJA 3OFND 4RD3A 5F98A 5KSPA 4R71A 2VHTA 4JLKA 1BS1A 1WCV1 3WYGA 1W5TA 2DR3A 1TTTA 3AVQA 4JLMA 3AGPA 4ZIRA 1M8PA 1YZGA 3C41J 1YZKA 5B2ZA 2P3SA 4DSNA 3H86A 4CEHB 2HLDA 2VIIA 4TQ9A 3THXB 4GZMA 2QBYA 2JLYA 1XEWX 1N25A 5FI0B 1Q20A 2I1VB 1K8RA 1W4CA 5AR1A 2OILA 5J40A 4B6EA 1TEXA 1X8LA 2ERXA 3MUFA 4QBFA 5CDFE 2KBEA 4G1UC 2AD1A 1LW7A 3MD0A 1NKSA 3R8FA 3EIEA 1XP8A 4RSGA 2QAJA 2JLSA 2ZYUX 4QBIA 6Q21A 1E6CA 2XAUA 4HUQB 1DAHA 2VQSA 4XWKA 3EA0A 4GFDA 1PUJA 2YC4C 4M1WA 4RZ2A 4XIGS 4LYFA 1M7GA 2ZJ2A 4G0NA 4AG6A 4O2LA 1NBMD 3PG5A 3FHCB 1MH1A 4A6XA 4GP6A 1IAQA 4UJ3A 4AYWA 3BFXA 1UM8A 5DN6D 1E4YA 3IBGA 5KNDA 1NI3A 1ZVQA 4WZAE 2JLXA 1W36B 2YV5A 3DZ8A 4P4TA 1SHZA 3TVTA 1HQCA 1J70A 2GAAA 4PC1A 3THWB 3HU2A 2PCLA 2GCOA 1G16A 3GLHE 1KNXA 2B8TA 2OE2A 4NCHA 4FMCB 1SKYB 4YMTA 4Z54A 2BKUA 2QP9X 4CVNA 4CEHA 3P4YA 1KY2A 4AKGA 2PMDA 2VPPA 4JLAA 3T06B 1OH6A 1S3SA 1DAMA 3M6AA 5FBWB 4B3CA 3EPHA 3ZYCA 4ZDJA 2GEVA 4PQYA 2QMOA 1XTIA 1MRSA 2QL6A 2VH5R 1ZRHA 1AGRA 1QG4A 2D06A 3T1QA 3BOSA 2AL7A 3CPHA 1G6OA 4C4PA 3NC0C 1JEEA 4F4CA 4AG5A 2GF9A 3OAAD 3DHWC 4L15A 1D2MA 2GZDA 4B2LA 1O3YA 2WM9B 5GADl 4PANA 3EZ2A 3ADCA 3GPLA 1BYIA 2NOAA 3JVUA 4QRHA 4RY2A 4BZPA 4LI0A 4BLSA 2QTHA 1VIAA 2Z6VA 1G3IA 3T12A 2O8CA 1MO5A 5EXPA 2ZJZA 4EJSB 5CB8A 4PXAA 2Z4RA 3TIFA 1KAOA 4MGIR 2QQEA 5FPSA 4D4KA 1CTQA 4IHQA 1UF9A 1CULC 5J47A 1AA9A 5FBLB 2C5LA 3QI2A 2DWPA 1NKTA 5JHGB 2WTUA 5JJIA 2GXAA 4AYXA 2V55B 5JS7A 5AWFC 2ZPTX 1J8MF 4LSGA 3SHFA 1S0UA 1XCPA 2CHGA 5IHPA 1FUUA 1EFUA 5CJ2A 2ZAMA 2SHKA 4TZ6A 4RKFA 5FR1A 3ETLA 4NPHA 3CH4B 2PMKA 4QG7A 1UBFA 1TQDA 3VR3A 4YDSA 3ADDA 2CL7X 4I1VA 4BEJA 3VTKA 3QBVA 5ANRB 3O8DA 4C0HA 5DYGA 1VCMA 4TYYA 3QVVA 4OI4A 3CPJB 1YZNA 4RD2A 1FMLA 4IEEA 2C99A 2GILA 1Z0JA 1CU1A 1E1QD 4KITB 1R0WA 4MITA 4M0LA 3EAQA 3HU3A 3ZD7A 3RLFA 5DO9A 3LX8A 2OCAA 4LPKA 4NH0A 1NVVR 3NBZC 4FCTA 2OBMA 3CZPA 1I2DA 1AKYA 3KXLA 1YKSA 4OHWA 5FBVB 3VNUA 1QBKC 5KSOA 3EZ6A 2F1RA 5EXXA 4KV9A 4A2QA 2YWEA 4DIDA 2GESA 5FFMA 1FFHA 2GAOA 4FCVA 2EQBA 1IJFA 2YINC 4K81B 4NKRA 5CYOA 3P26A 2PX0A 1GKIA 3RRMA 1AQYA 1P75A 1YVDA 1G8HA 5JS8A 2ZM5A 4G5OA 3A36A 3K70D 3WNDA 5EZ6B 2ZETA 3WXMA 4DLZA 1N0VC 2XB2A 4CYMA 1JPNA 2ZU0C 4PQFA 1GKYA 1JXOA 3CW2A 3DDCA 3GMTA 1NNEA 1WBDA 3FOZA 3U4QB 3W34A 1UEJA 3P20A 3QENA 4Q66C 4TSFA 3UMRA 4JYBA 4C0QC 3L0IB 5G3ZA 1P5ZB 3RC3A 3VX4A 5C18A 2D74A 3GQBA 4Q7JB 4JSYA 1E1RA 2C98A 3GJ6A 1UDWA 4WA7A 1NSFA 4ERNA 1N6KA 2F3TA 2J59A 4C7OB 4FXPA 2ZITA 1EFRA 1V5WA 1O87A 4E5UA 4BLPA 4F7WA 2JA1A 2OEPA 2WKRA 4OQMA 4AKEA 3CZQA 5FUWA 3CRVA 3KQNA 2GJ8A 4MDFA 2GJKA 3U3KA 1JB1A 2ZI4A 3EARA 4TMTA 5FTLA 2FDCA 2ZUDA 3A4MA 1OB5A 1CJKC 1S8FA 2NPFA 2VTKA 1HH4A 1SVKA 4CF7A 1IXSB 2PT7A 4LJ9A 3DM5A 2BIFA 1CR0A 3B82A 3THYA 2WAXA 1KI2A 2J0SA 3B13B 2ECKA 4JL6A 4WOPA 2PJRA 2FGJA 1H8ED 3L0PA 4MRVA 3NIBA 5LB4A 4TYPA 2QT0A 2P6NA 2R44A 2GK7A 4OHYA 2VP9A 5EE0A 1OYYA 1IY0A 5JEDA 3LO5A 5EUMA 2D3WA 4JJKA 3SNHA 3IEUA 2FEOA 3MFYA 2G88A 5CIQA 4L5BA 3B1YA 2ZE8A 3UATA 2ZXUA 3AKCA 2O8EB 3AF0A 4DCVA 2QM7A 3L82B 2GZAA 2XZOA 2IS2A 2IYUA 2OFOA 2O8DB 3AUXA 3FMFA 1Q3TA 3BAFA 1YR7A 4IW3B 1T3HA 2GVZC 4RFSB 5LD2B 1GL7A 3ZQJA 5GJCA 3AVOA 4G01B 1A4RA 2D2EA 4NCJA 2BJWA 4IXMA 4DDWA 1FW6A 2ZANA 1XD8A 4B75A 3KKMA 2QU8A 3TW8B 1DAKA 3SJCA 1FUKA 2GCOB 2IEZA 5EZ5A 3BIFA 2PJZA 3NBFA 1N5KA 1J8YF 2ORWA 5KPJA 3PEUA 4NCIA 1MT0A 4QGFA 1G6HA 1W0JA 4QFMA 2X1VA 1FP7A 3IKJA 1OIWA 3K0AB 2OCPA 1E2JA 3GJ8A 4XOIA 2D7DA 5HKKD 1ZD9A 3REGA 2QPOA 4LCBA 4YONB 1VG8A 4PR0A 3IGFA 4Q02A 2OBNA 3SEAA 4ARZB 4S2EA 3KJHA 5TVKA 1Z2AA 1KDTA 4IFBA 4D26A 2ATVA 4EPVA 3T1OA 1J99A 2WSMA 2H18A 5H1YA 2O8DA 4C2UA 3OAAA 3OESA 4FMDB 3B1VA 2XOKA 3D7MA 1E98A 4M8NE 4Q5IA 5GJBA 2YOGA 2ZREA 3QXHA 5EXTA 1NVWQ 2G6BA 2RCNA 4AIIA 3RS3A 1U0LA 2ZR7A 2RHDA 1N0UA 2QQ0A 4V0NA 4HB2A 1P73A 4GT1A 5IF9A 5BN5A 4U7DA 3NDPA 2ZJ8A 3OE7D 4RVCA 3EASA 3R9IA 3I32A 2FF7A 3LVQE 1KDOA 1WE2A 2H16A 3OEHD 4YMSA 4XWOA 4EAQA 4IFEA 5L3SA 2O8FA 3AKEA 1G20E 2QSZA 4CT4B 1ZJ6A 4V0LA 2OCBA 2OFXA 1S2MA 4Q18A 4C0LA 4GPTA 4AY2A 3E70C 3GJXC 1KTVA 2AFHE 4KFTA 4X8HA 1CEEA 2Z0MA 3TRFA 3CLVA 1G3QA 5SZIA 2WPDA 1GZSA 1E79D 2BV3A 3TUIC 1WBBA 3VNVA 1Q1BA 1UBGA 4ZIRB 3HYTA 3TAHA 4Q4HA 4XVQA 4ACBA 1DTSA 2EU8A 2ZS9A 1MOZA 5JWRA 1S1MA 4RZ3A 3P27A 1M34E 1RYHA 1VHTA 2PCJA 5TXGA 2W58A 4OQLA 3C14C 4HATA 5IDVA 3GCGA 4QGHA 4II7A 4D6PA 2WWGA 1II9A 1VYUA 2R6DA 2A5DA 1G3MA 4ABYA 4DEYA 1W0KA 4BFXA 1XEFA 3E5HA 2QMHA 1F2TA 4W5JA 4DC9A 2IYWA 1VMAA 1KNQA 1TAGA 1Z8FA 2ZJYA 1U9IA 1XTQA 1BMFD 4WIAA 2ZI6A 1CR2A 2VO1A 4KVAA 5UKDA 4R9UC 3KX2A 5FR2A 3CNLA 2XTMA 4KFSA 4N1AA 3VHXA 1KI9A 1G4AE 1Q3HA 3CWQA 1D2NA 5G40A 1T5LA 5B64A 2IWHA 2P0EA 1AS0A 3HWSA 2BKEA 4A6PA 4LGMA 2BEJA 3PQCA 1KO8A 2ZI7A 3U2QA 4BFWA 2CJWA 3WRYC 4NYMR 3T15A 4DB4A 4HAVA 1NN5A 4A0RA 1YE8A 1HURA 2CHVA 4LBWA 2DBYA 1KAGA 4LJ7A 4ZKDA 1IHUA 4PPFA 2AK2A 3GJ0A 2H17A 2JIZD 2XJ9A 4KU4A 3RANA 3I61A 4JT4A 1KO7A 3QBTA 121PA 5GJVC 1JR3E 2NQ2C 1L4UA 4CRWB 2ZSDA 3SBDA 1P9WA 3X1XA 2FFBA 3EPKA 3KB1A 3DOFA 4GP7A 1LF0A 4FD2A 2R6GA 4HLDA 4PAOA 2CE2X 1OXTA 2YHSA 5HTKA 2JJ8A 4ASUA 3ZVRA 2YOFA 1RJ9A 2KB0A 4WAUA 4D4MA 2JLWA 3KTAB 4P31A 1KJZA 1WQ1R 2XTZA 4ZCMA 5FBRB 3B1WA 3VR6A 3DMDA 4WZBE 4A2WA 5FL7A 1EFHA 1CJUC 1N5IA 2ZSAA 3Q9LA 4XVRA 3MJHA 2HEIA 4Y0AA 4Q19A 4BZXA 2QBYB 2QMUA 4I1SA 1XU4A 2B92A 1E2DA 4FMCF 4LPSA 2ZE7A 2EFHB 3SU8A 4LJAA 4NTZA 1GILA 1KI6B 5L3VA 4KCGA 2RMKA 3VQTA 2QAGA 3I5YA 1ZM2A 1NG9A 3BERA 2C78A 2I3BA 4EPXA 1N2CE 2CLSA 1F3OA 2AWOA 4NE2A 5TMPA 2GBLA 2OXRA 1DO0A 1YZUA 2JGNA 4A4DA 4DCUA 1T8UA 5HR5A 1PZNA 1DS6A 4JKIA 4X8LA 1E96A 1XZPA 1P61B 1S1CA 3PCRB 1L4YA 3X2SA 4B48A 4XTCS 3DL0A 4B35A 3KB2A 4B74A 4BRUA 1P2VA 3U3OA 4I4LA 1OXVA 1YU9A 1T5IA 4EQ6B 4PO9A 3Q72A 1G21E 1N3BA 2RB4A 2ZSBA 4TTRA 4M1YA 1XJQA 4HZIA 1W48A
chains in the Genus database with same CATH superfamily
4C8ZA 4WWSA 3SIPA 1PFVA 3CF2A 3SX0A 2P41A 1GYPA 5K9ZA 1ADYA 1BVYF 4F11A 4G1MB 5IOLA 3VMFA 4TTIA 3U27A 3RABA 4ISCA 4X4OA 2P62A 4HV4A 3CX4A 3H7IA 1WB4A 2HKIA 3B2EA 2IFTA 1H4SA 1E9FA 1FDAA 1P72A 4PRLA 2PMHA 3EXIB 3N6RA 3ZWYA 1TX4B 2OV6A 3N9UC 1BKDR 3ZQUA 3FGOA 2JCGA 1BHQ1 3HBFA 3KR1A 3FGZA 2QVCA 1VFJA 3MG9A 2HNZA 1NN3A 1JUDA 3OEYA 2QC3A 4UHJA 3GNTA 1VL0A 3GG9A 3F5SA 3GA7A 3WK8A 3H4DA 4YV0A 4INJA 2YNHB 2LCQA 3EVEA 2HWUA 2JIRA 1SCJB 1ZU5A 5IXSA 5KFZA 1MOPA 5CYQA 1VK8A 2C5FA 1JU3A 2D8MA 4RBTA 3EIOA 1TADA 3FTEA 3R41A 3OOEA 2C5HA 1RWKA 2D2IA 1DAPA 3UXMA 3FPHA 3PCTA 2HSEB 2JGAA 2YRXA 1D0VA 1W44A 3CFYA 4KTTE 1S1XA 5KYWA 4R8UA 1JHPA 3KYLA 2ZM6J 3HR7A 5B30A 1ECBA 1Q7YT 2H7XA 3KJFB 1F2TB 3SLRA 5J1SB 4HZUA 3DOOA 2C31A 3M3PA 5BQFA 4YB7A 1C3OB 2W4IA 3PNVA 2QE7D 3Q8XB 5FO1A 5G4DA 1GTG1 3I76A 3OTWA 2Q1XA 3U48A 4B9VA 1MABB 3VVMA 1P62B 5A4FS 5D4OA 3G7NA 2UZIR 3T3HA 4TS1A 2V4JA 1ABFA 5HZHA 3IN5A 2XLBA 1FZQA 4JENA 4B0OA 3S2SA 4QYIA 2XMKA 2FJWA 4MNTA 3TR6A 4KZKA 4FXWA 1T9VA 2I7XA 5GGYA 3T35A 4AKHA 3A3PA 5B37A 3UNGC 1EDZA 3HDTA 4HFJA 4DL7A 1TD9A 2VPXB 4PR6A 4MUFA 5J2UA 3ZHSA 5GOTA 2JNWA 3EUWA 4DSLA 3WHLA 1S6PB 3F6BX 2JFZA 2VJDA 2NIPA 3EVOA 4O4LF 3Q8WA 4J0FA 5FAKA 1OLUA 1FDVA 3QJ5A 4RX6A 1KJ9A 3IAHA 2PKXA 3RHTA 3MFHA 1Z25A 3ZE1B 1UWBB 3SIWA 3AONB 4R41A 2X3GA 5LM7E 4N8EA 1ESMA 4DLUA 3IS3A 3CCSS 4ZCLA 1YOVB 4GC6A 2O19A 1SQ6A 3WLOA 1CWUA 1CVRA 2LDIA 3DKDA 4O4JB 1VQKS 4TMVA 4DT1B 4NF2A 1RE0A 4W1QA 1VGQA 4AY5A 4ZPXA 4O4RA 5ALUA 5H4GA 4HNVA 4P72A 1H8HA 3MM6A 3AGQA 2UZ0A 3EXYA 1B1AA 1FVHA 3FWZA 5C3MA 4TL9A 4UOFA 4P53A 4KAXA 2PEZA 4EM6A 1RXWA 5FB3A 4DVJA 3LAWA 5ETRA 4DV6J 3U62A 5HG0A 1RT3A 5EJ5A 2C00A 1OHHD 3V8QA 3B2QA 1CB0A 3GH3A 4RMIA 3SR3A 3IVRA 1Y4DE 4IQGA 4DLBA 3GLFA 4TTQA 4X1IB 2KB2A 5IF3A 2W2NA 3QEJA 4N5HX 2CFRA 3UDCA 2Y9MB 4ITRC 3WV4A 3RK1A 1S6UA 3X1LB 5DNYB 4WXHA 5IM5A 1F60B 5JAMA 1LUAA 3FX2A 4W9RA 3OZXA 2ZTUA 4MCAA 5KSWB 5BVHB 2D0IA 1C2PA 1DI0A 4ZIWA 3V6KA 5FDLB 2QRVB 2XVAA 4UM8B 5T7LA 1NBME 4U7UD 1H2HA 1Y82A 3V4IA 4JL5A 2P65A 1DDOA 1EEXB 3N6VA 4PYIA 1W88A 2B4OA 1KDYA 2WIAA 5TGDA 1J9GA 2HGMA 4JKOA 3ZK7A 2RHTA 1EWTA 3QWIA 2DIVA 4I46A 4R7TA 1E6KA 1QJHA 4IHJF 4PSKA 3EIFA 2DUJA 2W2LD 4AF6A 3JVDA 1Q7BA 3I8XA 1R4MB 2O1PA 3AR9A 1LBHA 2IH2A 1W4RA 2CKDA 3AEQB 2OEJA 2YHUA 4DR4J 4TM7A 1NLYA 4LHWA 5HKKA 4XWWA 1ADJA 3MR2A 4P2BA 4KV8B 2IBOA 3QQ5A 4AURA 5TPWA 5F1PA 2YIDA 5U4XA 4XSGA 4DV2B 3BD9A 5CRIA 1X5PA 3VJRA 1XDDA 2BJHA 2M1ZA 4F7VA 5DSZA 13PKA 4O4IA 1BRMA 1G55A 4W1SA 4UTNA 3Q7EA 1E92A 4Z0HO 2YNFB 5C53B 2KSQA 1GLVA 4JOSA 1CSEE 3BWXA 2LEPA 4GVLA 4FHCA 3MCUA 1EWQA 2CVFA 3WB9A 4MGYR 1I7DA 4M0MA 2I9SA 1RBYA 5CH5A 1L1QA 2PPLA 3AG5A 3TZHA 4PPNA 2BMWA 4DCOA 1QGOA 5EG5A 4ZTUB 4FKBA 5KFPA 2C2KA 3L0SA 4GU5A 2WUVA 3CR3C 3CJ5A 2B2XA 3QOYA 4W63A 3WOVA 3BREA 3RG6A 3ZZUA 2BPOA 5JAUA 1J56A 1P9OA 3HDVA 2P27A 5DX0A 1EH5A 3ES9A 4PC3A 3K0EA 1ZGAA 2D1QA 2I1LA 4XXHA 2FPKA 2XCTB 4I2PA 3A4TA 2WFMA 2IYVA 4LMBA 3VR3D 2TSYB 4GPBA 1VE1A 2LXUA 1DIRA 1IHOA 3JQAB 3U0VA 3KOWA 4PY2A 2C8LA 2MJUA 1IBRA 4NLLA 2G07A 2NGRA 5KC8A 1C7ZA 2J9DE 3MPWA 2BMEA 1DLIA 4CLRA 2H1RA 1SB6A 4F4JA 4MW9A 4RU1A 2XUGA 4DV0F 4CLXA 1Y34E 3ZZ0A 4MKGA 4HGOA 3AXKA 5JEEA 4CYUB 2VNJA 3NTUA 3LY9A 4J37A 1OLXB 4FKMA 1GMWA 1N36F 4C5BA 3A1CA 3BH6A 2YWFA 4WINA 2R2UA 2QE6A 3RKRA 1KJJA 5JAHA 2B4UA 5FYQA 3MMSA 1ECGA 2DCUB 2I0XA 2FNAA 8OHMA 3ZW9A 3NKVA 1F9HA 5JSZB 4HDKB 2D5CA 5AOVA 3ND9A 4BKOA 1N9ZA 2N1MA 1YR8A 1Y63A 2FUNB 2WJVA 3I5MA 4RW8A 4USMA 4BMPB 1V3ZA 2GBIA 2BRLA 1IZ7A 1T94A 5C25B 3HB4X 5HF6A 3R3TA 2PKQO 1VQOS 4L3NA 4UEQA 3U4GA 1AS3A 3GNQA 4KXFB 4E08A 5A62A 4BRZA 5F8LA 4IIYA 1NSPA 2XBPA 3VAHA 1REVB 1EFTA 1C2TA 2DGQA 1R0KA 3C15A 2A67A 1F7UA 4USJC 5JPIA 5E9JA 3R7SB 2QD3A 2FUG6 4PSUA 2H5JA 5B6JA 2C3MA 1NF2A 4HT5A 4U7JA 1AA1B 2HUPA 3EW9A 4LSZA 4UZCA 2O7RA 4WFZA 1DEAA 3M6IA 1ESZA 3HKEB 5KYVA 2ACMA 3REQB 5HFAA 3W8EA 2GS9A 4NU5A 1W5FA 4E0BA 4QG3A 4OHBA 1EVZA 3E4CA 1Z47A 4TNOA 2LKDA 3DYAA 2WZQA 1B4SA 2OV3A 2WD7B 3DYAB 3WBFA 3TOQA 2IYLD 2QAGB 2RGUA 3AJ2A 5DP2A 4PNPA 5CX1B 3JB9k 4CCAA 5KG7A 3OQ6A 4QJ5A 2G0CA 1JAXA 4AX4A 3I9V9 5E3HA 1PTJC 2CUKA 3QXXA 3UANA 1TK8A 3WR5A 3UMVA 2ODQA 4OHXA 1QQTA 2W6JD 1YQ9A 5LYJF 4DU7A 2F00A 3IEXA 1J0XO 3K05A 1CR6A 3MTQA 4MTPA 4D97A 1GMUA 4FZRA 2WQ7A 1ZA2B 4EVSA 4WN9B 2AW5A 3DRRA 3OUYA 2FLVA 4O44B 3L8GA 3LG2A 1EQAA 1UVIA 2XNHA 3EC2A 5DB4A 3UY4A 2W70A 3FDIA 2P5SA 2HVHA 3H16A 3ETGA 3OT9A 4UW9A 5F1OA 1XEXB 1PAUA 2XUPA 4QA9A 4EHAA 3GPAA 1PWXA 3DV0A 1RXVA 3ILSA 4TY8A 2QY9A 5B7NA 3TIVA 3KUCA 2NAFA 2DK2A 4AAYA 1KOGA 4P7JA 5A9SB 4QDTA 9ATCB 2J07A 3C7CB 2WWHA 3HP1A 5EMLA 3PYMA 4KE6A 1JDBB 2GNPA 4MV9A 1HNWF 2IHYA 2QROA 2QPAA 1WF0A 3IIEA 3T5MA 4LRQA 1PNVA 2G5PA 2O4UX 4ILMA 1Z4UA 1TUWA 5A04A 4Z3OA 2C3YA 4I4TF 4WA8A 4ZREA 1FVOA 4M0DA 1KERA 3IO3A 3CB4A 4YI3A 4J91A 3PDNA 4USKA 3HD2A 3NWEA 2XNQA 1U2RA 2VJAA 1Y48E 1FNMA 3OMLA 4QUAA 2J6CA 2I6UA 5I7UA 2NUAA 3FWHA 1UXGA 2X1BA 2KM8C 3SCKE 5LM3A 4YA6A 1Z7EA 2BACA 3EPPA 3RREA 5HDQA 3BWDD 1SO8A 1E6LA 4HWPA 3PUYA 3UT6A 1PYGA 2ECFA 2IPOA 1NBHA 1U7UA 3EVAA 1EHWA 5E4JA 4OOEA 4PHHA 1X42A 2CVQA 4ED9A 1CUBA 1NE7A 1HDXA 4A91A 3SM3A 3CNBA 3OEEA 2QA2A 2OBYA 2YYYA 4O0NA 2HD4A 1NMZA 2CXHA 4X4TA 3LHFA 2I71A 2ODNA 3AZQA 3QIAA 1O6FA 2R25B 3ZD8A 1U26A 2BJ9A 1YJ9S 4KXQA 2PX8A 3WYDA 2JIMA 4BS9A 5C2GA 2Z83A 4FWIB 5ENZA 3V1LA 1EK5A 2KLHA 3BQMB 2OK8A 3D6UA 4KR6A 2BFCA 3K89A 3CTPA 2HS3A 3MHPA 1M54A 1XCOA 2IW3A 2Q21A 1ZOPA 5C8VA 1CPYA 2RK6A 3PWKA 1TV6A 4YDRA 2VBCA 4EMBA 1BHO1 1LF5A 1HT2E 4DLVA 2NUHA 3NOVA 1I4TD 1Z5OA 1VCNA 4MIYA 1UK6A 1QGED 5LYJA 4D0NA 4JI8F 3X43A 4YMLA 3I9V1 2QR2A 1VPWA 3HUEA 3ZI4A 4MGHA 4LKRA 2A18A 3NOGA 2KHCA 3JSXA 3NKFA 1QH0A 5KTKA 3WDLA 5KQPA 1F5NA 2WZBA 4D3GA 1R8YA 3BDVA 5FNZA 3DHEA 1TL7B 1TUGB 1U8XX 2ID8A 4B45A 2RAFA 4F60A 4N01A 1KSGA 2BVNA 3DF9A 1C0PA 2H5EA 1HBNA 1RRFA 2GCIA 3GC6A 5LQKA 1JWWA 3S1AA 4B2PA 2CK3D 3KV3O 4ZV9A 4V0MA 4DSEA 3OE5A 1PWZA 5FPHA 4DR2B 4URVR 4XOUA 3VYVA 3DZGA 3WL8A 4C7VA 1NDLA 3L1IA 2ZYDA 4MRRA 4C6TA 3DTTA 1U0GA 2QRUA 1NYRA 3VQSA 1JXLA 1Z28A 4WY5A 3A6GA 1QFZA 3D3CJ 2QYHA 5JY6A 5KYUA 3SKYA 2CDCA 1G66A 2F62A 1GUZA 5KNDD 4S1WA 3D3JA 3WLSA 3IOBA 3TW8A 1P2DA 3NBUA 3BWMA 3HT0A 4DLYA 3EE6A 4IXTA 5CTAA 1ZPWX 2XMTA 1TOAA 4L5AA 4UFOA 3MELA 4YRQA 1ZNWA 2ZUTA 3FGVA 2J6UA 3WTCA 3UJNA 5JROA 1LW6E 1TTHB 4Y9DA 1DRWA 4EB6A 3K70B 3CE8A 1R0AB 4HNTA 4LYAA 1WA5A 1ES9A 3ZQKA 1UMCB 2YV3A 2CHFA 3LRXA 5D86A 3QPAA 4WCEQ 3R5KA 4P4SA 2ZHAA 1AROP 2P2DA 2W42A 2PMZD 2WU4A 3CC2S 3ZWNA 3BA6A 1WUKS 1S4QA 3EVBA 1VA5A 4W9MC 2QV7A 1WHSB 1XTVA 1U3WA 4K6KA 1MJNA 4B6GA 3EXFA 3O3OB 1DT3A 4C9BA 5REQB 1KDVA 3DTVA 4X62J 4UQGA 1AK1A 5BORA 1SOAA 4HH4A 4UKDA 5AMXA 3KAPA 2AKWB 3MERA 2PDAA 3NH6A 4C05A 4CR8A 4KYTA 1UBOS 4Z2YA 3O7WA 3W2VA 1E2LA 4H6XA 4PYLA 2QYSA 1WSWA 3RC9A 3FNHA 2ZWAA 4AQYJ 1DNPA 3GLVA 1T4GA 2PD1A 3ZGXA 3V2IA 2J7PD 1RYEA 3MHTA 3K0CA 1FTYA 4HTJA 4V1CI 5J2NB 4YIKA 2J7KA 5CM2Z 3GQCA 3HMKA 4RZHA 1BWRA 1NW3A 1TYZA 4B9EA 1LKZA 5AHRA 4R7GA 4RD3A 5CB4A 2ROPA 1M76A 4QPTA 1W5TA 4ZA1A 3RIYA 5ALIA 4TQ9A 3UB2A 2AV6A 2JLYA 3P45B 5F8IA 2CMGA 1Q14A 4A8TA 1AUXA 3EIEA 4MCHA 3IP6A 6YASA 4G24A 5C81A 2F4VJ 4LYFA 2WHRA 1EDDA 1WV0A 4O2BB 4A6XA 4BJ1A 1IAQA 1SU6A 1MD9A 2OBBA 2PUFA 3ZHTA 4LJMA 2AG0A 1SHZA 1T9AA 1YK0A 2JCYA 5AI8A 3M32A 2CNLB 2IPAB 4I55A 4MUXA 4JLAA 2UVPB 4QPCA 3X1KA 5KS2A 1XRRA 4PQYA 4JP1A 4DZTA 5JDIC 3CPHA 4HN4B 1RADA 3HDSA 4W98A 2GZDA 4PANA 5KTPA 3BZQA 2ACKA 4BZPA 2PH7A 4Z4FA 4TVBA 1IRIA 1OU0A 3DD1A 4NZ7A 1JB9A 5LSAA 1LOUA 4EHNA 5FPSA 1SG6A 2CYBA 1K0UA 3NBKA 5JHGB 4OIFA 4ZOQI 3WQHA 1BSVA 4NLVA 4H0FA 2ZAMA 3Q1LA 2OZLB 2RB5A 2JZNA 5DYGA 3I6QA 4OSOA 1RYDA 3MN1A 3C14A 4WXMA 3QKWA 5FFNA 1EFKA 3MGBA 5HS6A 3HU3A 3PPYA 4MLZA 2E7WA 2YWEA 4RUHA 2PSFA 1MZPA 4NPCA 5JO0A 1U6IA 1G8HA 3PVZA 1RQXA 4ZCSA 2JLGA 4FBMA 3CLTC 3SS9X 5TR9A 1IDOA 5I4MA 3G59A 4GYWA 3PFGA 4HNAB 4EA6A 1UJ4A 1NNEA 2ZFHA 4TMYA 5JV5A 2BANB 4MB0A 4Q66C 5F5XA 2BE9A 2HLHA 3ORYA 3K1ZA 1NSFA 4LGCA 1NUTA 2FGCA 2BYCA 2PFFB 4BLPA 3MW8A 4DZRA 4PUOA 4LQ3A 3HRIA 1PFWA 2Q07A 4G56A 3A4MA 4HKTA 2YKAA 5JCOC 3LHKA 4ECVA 1IN1A 2WAXA 1H8ED 5B0GA 2OD9A 3KIPA 1RQRA 2Q3CA 2DH7A 3ENVA 2WJ6A 4JNKA 3QNWA 4DZDA 3N76A 3TIIA 4OHRA 4LGVA 3QE4A 4RFSB 1Y7LA 3C8YA 1S2GA 3KHLA 4MKXA 2YW9A 4KLAA 5G0RB 2GOYA 1C9DB 2QU8A 4MV5A 3NFRA 3MD9A 1NNLA 4EGQA 3UBTA 1RT1A 2QS9A 1J8YF 2E1CA 4LZAA 3GQBB 4QFMA 3E8OA 3IKJA 5IC6B 2UUBF 5EJGA 1XVVA 1IM5A 3IMEA 1AHPA 4WZBA 5B7PA 2QJ3A 5DYNA 1RWPA 1FRJA 2XMWA 4PWDB 1GZHB 1RQGA 3ZX5A 1FJGB 3SEAA 3DJYA 2K7JA 1W6UA 1FYWA 2H18A 1K68A 2ZW9A 3O4RA 1V1RA 4CKEA 2C3PA 2AQHA 4DMFA 2C7GA 2R84A 1GQ2A 4HB2A 1NTRA 3CCFA 5ALYA 2FDNA 3OBIA 3OE7D 1FKOA 4I66A 2NLWA 4NX9A 2ZNZA 2D3TA 4IMJB 5B1IA 3R7NA 4A8QA 1P1FA 4DA4A 1WG1A 1ZJ5A 2WPDA 3R5TA 4O33A 1JB0C 1HKAA 3DFMA 2HK8A 1WBBA 4LVOA 3DL2A 1DC6A 1C1DB 2W58A 4ZQHA 3GCGA 1ULZA 2AJ0A 4PYNA 2FQYA 1YDFA 5AVRA 1NHWA 3EDMA 2HCFA 3Q0AA 1NJ8A 5EJ6A 1PV1A 1A72A 4YDXA 2LE0A 4S0ZA 4YQEA 1T5LA 2GN0A 4CIXA 2KX7A 3FDSA 1XWFA 4PQAA 3PUKA 4IM7A 3TVKA 5DN9A 3QBTA 2BGIA 1NRKA 4EG4A 4INOA 3RC7A 5BURA 1S8OA 2PL9A 4BZWA 2CXSA 2YHSA 1IZZA 1AY0A 3JXEA 5K5MA 4DPUA 1XWWA 2D6FA 4WAUA 4D4MA 1A27A 1WQ1R 3CQ9A 3PC8C 5HVFA 3UCZP 1RKQA 2HA3A 5JZMA 2GASA 2CG4A 3VR6A 2Q7XA 4PXYA 3Q9LA 4XVRA 1ZAVA 5TS2A 2ODTX 4RTSA 4ZQBA 2B92A 1IKVA 3M8ZA 2DHXA 1KI6B 4HP8A 4P81A 3QLUA 2AWOA 3QMVA 1Z0SA 4PYKA 3I0SB 2Z09A 3E3OA 2PD3A 3V8MA 3GRPA 4K0KB 4LFCJ 4WTYA 3ZU2A 1D4OA 4PAWA 4X0EA 1WPRA 1S1CA 3O95A 3ZY6A 3KB2A 1RWNB 4EQ6B 3REQA 2VTDA 3HLUA 2VNKA 4Q1DA 4O4LA 3L1KA 1SCQA 3SHTA 1RQNA 2CLIB 3ZS9A 1YDEA 1T3GA 1NKEA 1M7BA 2Z58B 5U47A 2C96A 3IE1A 2XLCA 2A30A 2VQFJ 3PQ3A 1PWEA 5EJIA 5LYYA 4GI7A 5C7OO 2XOKD 1KYYA 3ISVA 1Y3IA 4R9VA 2IWRA 3WBKA 1CRWG 2VG6B 1SKQA 1TM2A 4LYDA 4FW9A 3RTDA 5JATA 3HHLC 4GOLD 3GFPA 1QO9A 1FRHA 3Q7PA 4DUZF 4KR2A 4ZHSA 5DASA 1V1JA 3BB3A 3PUVA 1C4OA 4QOJA 4MEJA 3T9AA 5CB4F 3QZUA 4OX9B 2DH5A 2NO5A 3LC7O 5DBHX 4ECTA 3AIMA 3NXSA 1O5OA 1KFEB 1XMIA 3AL0C 4ZVTA 5CYFA 4E22A 2A7XA 3INGA 3HKDB 2RDJA 5EWLB 1ZA2A 1WZ2A 1TAHA 3HTXA 3DAFA 3MJFA 4AQ7A 2P2YA 2GVDA 2OPRB 3SQMA 1YS2X 3QUSA 2YS7A 4MV0A 5GAHI 3IAUA 3AR3A 3PR4A 3PHHA 3G2MA 3G2IA 3G23A 4J75A 4MVJP 3WC4A 2WEKA 5M2RA 2BTQB 3HZOA 2Z43A 2DPHA 4LHVA 1UPAA 3GEIA 1JF8A 4QU5A 4YRKA 1JA9A 3GGPA 1GEGA 1SVUA 1W1UA 5LOQA 5DBOA 5HQMA 3D2WA 4G1IA 1H2XA 2HEKA 1IY8A 1V37A 2HSDA 2FJ0A 3NCRA 4YROA 1KSHA 4M49A 2G4LA 4PZZA 4DV6B 3P9ZA 4K4SA 1GUBA 3N70A 2BR5A 2R65A 1R9NA 2VDUE 3GAZA 1F6WA 3I6MA 3UHOA 2IEIA 1JLCA 3L8YA 3LHSA 3MR6A 4EGAA 1REQB 1JLCB 3F5FA 3UE2A 3PICA 4JB8A 4QWEA 3L02A 2RHQB 1S9HA 4WK0B 3SQNA 2DR6A 1D1SA 4XUDA 2JJ1A 3KLEB 4Q7KA 4YJFB 5KNCH 3E81A 3H2YA 3CN9A 5IZ4A 1XZJA 1I10A 2WSCC 1LS1A 2EWVA 3BD8A 4H60A 3G82B 2BKLA 3AERB 2ORIA 2ZJRQ 5JH7F 2C04A 5DG8A 4LOLA 4IP0A 2W6ID 4MUIA 2H8KA 3WWPA 1KRXA 4U6PA 3ZDDA 2PT9A 3BXOA 2O7NA 4BVGA 1EP1B 1WD5A 3GFRA 4M86A 2VYNA 3N53A 5D4LA 1BQMA 3KHRA 4AJ4A 3ZTOA 2IV2X 4UCWA 4EDHA 1F0YA 3NNHA 4LBPA 2VDOB 2AW0A 1USIA 3PXBA 2PHZA 3OZWA 1QRRA 1RJ9B 1E6WA 5C35A 2WSBA 4EX7A 4CV0A 2XULA 3B70A 3BRWD 4V24A 1KZYC 1J2UA 2A1BA 4YNBA 3ZU3A 4GQBA 4MKAA 1U2GA 1WBJB 2GZMA 1OAAA 4M37A 2MHEA 1WF6A 1O8CA 3FPKA 1S99A 5LU8A 2RB7A 3F6CA 2MKYA 5I8ZA 4CO1A 5COBA 4MEAA 2HNZB 1MTOA 2ZAIA 2OB2A 1EP2B 1NHVA 1U7LA 4KNWA 4OX8A 3X44A 3TZEA 5I7EA 3QRRA 3GJTB 3GG2A 1WS6A 2BEUA 5A76A 1XTJA 4GBED 3I4PA 3QIPA 4Z4CA 1K7CA 2HHUA 4FHEA 1CJBA 2FQQA 1TVKA 5HP1B 1XU7A 4OK6A 1TVRB 4RANA 1GAOA 2X3DA 4F0KA 1HMVA 2HJVA 1VBXA 2QYGA 4I6GA 2OPPA 1BD6A 1NQWA 3GLRA 3O4HA 3G2KA 3S2EA 3BDEA 4QWDA 2CJAA 1JLFB 3OR1A 5TMDA 4FB5A 5AK0A 4EITA 3A9WA 1GLNA 2R68A 3AYXB 3H97A 4BE4A 1YSCA 1SH3A 4YMWA 1OIXA 2HQCA 2V7QD 4LG1A 3EMTA 3QFHA 4P3KA 4X6XA 3WYNA 4DUYB 4YY3F 4BDPA 1CNEA 4AWBA 2Y1FA 1QSLA 4TYQA 1T8SA 3UBMA 4H3KB 2I8EA 3DGFC 3Q8YA 3LYHA 3ETDA 3PEYA 4OU5A 5KFRA 2M98A 5F9FA 2IUSA 3GJ3A 4W5WA 3TJZA 4B2IA 4MIWA 1KU0A 2OA0A 1TZ0A 3U4AA 1LV7A 4CKXA 2NT4A 1EZ4A 4ZV7A 4WNYA 4WE3A 1KPGA 2OUGA 4BU1A 4J0IA 2A1TR 3CO5A 3KK2A 5IT9A 2VXYA 4MCIA 1U25A 1EVQA 4X1YB 1PDWA 3TTYA 3IDOA 3DKVA 3MEDB 1I32A 4FF4A 4Q3OA 3O8RA 4CM1A 1W6RA 2N7YA 2DHAA 2DLDA 1QONA 5J1EA 4J1QA 1KI8A 2Z9BA 4X24A 4B87A 2X7JA 3H5SA 5JI3E 5CLIA 1XXHA 1UAGA 1FWPA 4ALLA 2EK6A 3OJFA 2AN9A 3EMKA 2CQHA 1ZICA 3W5ZA 4GWLA 5CMLA 2XVZA 1S2LA 2KW5A 5LBIA 3F47A 2MZSA 5AK4A 2XUHA 5LJ3Y 4ECAA 2XGGA 4H4EA 4FF2A 2RNEA 4P6QA 1SU4A 3C2QA 1X1RA 1JEJA 4F3NA 1JZQA 3VVLA 3Q5EA 2WZ1A 4RUCA 1XJWB 4I1PA 4H7IA 1OIAA 4Z4QA 4OQQA 1W9MA 2FF5A 1O03A 1FXUA 3WQQA 4EMTA 2W8LA 3VVCA 1R74A 3AB2B 4F86A 3H87A 2CJKA 2IEDA 2DGDA 3KJNA 1K9VF 3MWKA 3ADAC 3ZI0A 2E9ZA 2CVPA 2H4FA 1SVSA 2HCRA 2NTEA 5CR9A 2GRUA 4LF9J 4QBUA 1JNRB 3PRDA 2YJ5A 1X0PA 2V69A 3C39A 5J43A 4G5SA 2EWMA 3GDHA 4G0XA 2PMEA 1YVEI 4HQNA 3MA0A 1L5YA 1NW8A 3SC2B 2BAGA 4C8LA 1WKBA 3KJGA 4JA0A 1DJQA 2BH2A 2A1UB 4TKUB 1QQBA 2L9DA 2ECPA 4ZS6A 5DNAA 5LP6C 2OLKA 1Q6YA 3P0EA 4FYPA 1L6IA 4OQDA 4UJ5A 2OEKA 4B44A 2E6UX 3R6LA 3CHYA 3RJ5A 1L4HA 2A9RA 1RAGA 4DDHA 2K4MA 3KHSA 4FS1A 3KKQA 4DOZA 1R0CB 3PKJA 3MB5A 5T4EA 4XJVA 3W66A 5JHHB 4PHTA 3JQBC 2BKNA 1S3GA 3A4VA 4YRDA 3OIYA 4F6LA 1EP4A 3CT9A 3C8MA 2ZCJA 1AO0A 2IY8A 3B5JA 2GETA 3EAFA 3EBLA 4NLUA 4DMKA 2XSJA 5TF4A 1E4EA 2RHOA 4TYBA 2XMCA 4EFKA 2NXNA 4YASA 1LFWA 5IUNC 3RC2A 1I3OB 1LBSA 3QFSA 5T8KA 5I3UA 1GY8A 4LZJA 4IHKA 1W85B 1ODIA 2PMBA 1L3CA 2BKVA 3L0DA 1FXWF 3CZCA 3TR5A 4KIFA 2E5LB 5CDFA 1YB5A 1XTUA 4NWBA 1VPLA 4E7PA 3KLGB 2OHGA 4BZQA 3ER8A 3TCKA 4Y3UA 2YWRA 3US5A 2H1WA 2WKQA 1NLUA 5IYZB 1JT2A 4Q03A 3QLTA 2OVBA 2Y6UA 3P97A 3GL9A 3AD9C 5AVYA 1G7TA 1EP3B 1HTBA 4DL2A 4YY3B 3RKUA 3O74A 1SOWA 5KX5B 2QLLA 5TGZA 4KV7A 3I45A 3F2IA 2PUWA 2WDPA 3THSA 2A3JA 4ZHQA 2G4CA 2OAQ1 4EY4A 1YFZA 2R8HA 1LTQA 2HHHJ 4TMWA 5CEEA 4IKEA 3ELYA 3LDHA 2HCBA 3KLMX 3T4UA 3PNYA 2C9OA 3MCTA 5KFDA 1IBKF 2XW6A 4A82A 4BJ5A 5I6DA 2ZBEA 2ZVQX 4IINA 4QW8A 1HA3A 1TRKA 3LWMA 5DIFA 5IBCA 4XLLA 2NV6A 4NBNA 4ME6A 1Y3AA 3KTOA 4BHQA 1U0RA 1QRSA 3LT5A 1V4NA 4ND7A 1XMSA 2V8PA 1LPNA 2Q3FA 2E5GA 5DHRA 5CDYA 2BQUA 4E5KA 1J90A 4PFKA 1X94A 1BXZA 1HEUA 4GRIA 2YZ2A 4K1XA 3P0HA 2O57A 3ZWQA 4BWFB 1G20B 4CV3A 2WV9A 5B55A 2J41A 3G0OA 2OHDA 2XNSA 3AAWB 3QHAA 1TM1E 2WU0A 2LBPA 1T35A 6NULA 1V41E 3R0ZA 5FBZA 4RSRA 3MMCB 3CDUA 1F9AA 1U11A 3L9WA 5HE8A 2G4VA 1R0SA 1NTOA 1DQ8A 4I14A 3L6OO 1A98A 1JSRA 4DSTA 1WTCA 4PZDA 1UEIA 2XUFA 1BU5A 4CWBA 1WAMA 4FNHA 1KTQA 4KHPF 2Q8NA 1G291 3ZJ4A 4QXPA 1ORVA 5EUQB 2RGNC 2HS4A 5CM9C 1JQAA 4ARSA 3NP7A 3SXUA 1Y3DE 3ONEA 3NGDA 1PLLA 4V0QA 1DKPA 4HAUA 1DWQA 2PIDA 1J8DA 4EG0A 3EHEA 4CKWA 1OZHA 2IYEA 1AT1B 4AJ9A 2K1RA 3DEFA 3B6IA 3D1HA 1Z5PA 3GNLA 4PLVA 2VA9A 3WLKX 3EZ9A 3PUXA 1Q5YA 2HVDA 5TQ0B 2XPCA 1IHXA 5DGAA 2ZIVB 2P9YA 4XIIA 4FYMA 2HNYB 4GICA 4MYHA 2H00A 3HKEA 3K5LA 1E64A 3M1VA 4HAXA 3V5NA 5K8VA 2IU0A 3FRIA 3BBBA 3ZHXA 2BKAA 1SBQA 3P2OA 1TMYA 3OE7A 4N0DA 3GFHA 3KSMA 5E7JA 3ED1A 4IX1A 1DO2A 3RU2A 5JOQA 1PV2A 3H4BA 2OXCA 4RIFA 8ABPA 4DR3F 5JXWA 2V6MA 4YAGA 1S79A 5C52B 1F0NA 4TS9A 4PYOA 3V4FA 4RA9A 3HJVA 2AGQA 2RCYA 4DLKA 2WCXA 2MR6A 5D2CA 2JL1A 3WBBA 2F4VB 1FDBA 1JFSA 1ZUD1 4M83A 4DI6A 1TMOA 2WNHA 3HYRA 3T5CA 1GUAA 4JVSB 2HBQB 2V7TA 4I0WB 3H4MA 1Z0FA 3WG9A 5L4SA 2OPBA 2QP4A 1Y3JA 2I1QA 1G8GA 2XY6A 3K9QO 1QCDA 4BV3A 1TT5A 4YH1A 3I01A 5ED4A 2JLVA 1XXLA 2OXIA 4A6EA 4RTOA 3OTIA 2YWGA 1M0SA 3KQHA 2VC2B 3GU0A 5DN6A 1IMJA 4UQPA 4KKXB 4BNJA 1TKRA 3AV0B 3VR0A 1LXCA 2FE4A 4DYVA 1FJXA 3BO2A 2W6PA 3ZX4A 1IWAA 3QE0A 1DADA 4JC0A 3NYWA 2OL4A 2Y0CA 4DM3A 4JFAA 4WFXA 1O97C 2JA2A 5E2IA 1GEHA 5D3ZA 4DS4A 1Q7GA 3BN4A 2FPXA 1ML4A 5JWHA 2ZXEA 4B4WA 1TQ4A 3CF5Q 1X14A 1JKIA 5KJ1A 3U26A 3K0FA 3ZJUA 3L4EA 5INTA 3K0FB 5DNEA 1PBUA 2ZR0A 2R1ZA 4DDFA 1FP4B 2GR9A 3X1MA 2X0EA 5KAKA 1B3RA 3C5CA 2GM9A 3POTB 3SQGB 1CJVA 1T0TV 4KHRA 4NCKA 1EUQA 4KJXA 3P2IA 3HXPA 3J7A1 3ODPA 2B4YA 2QENA 5EP1A 3OD2A 1YCFA 3N3BC 1JHOA 4CKCB 4Y0FA 5HSGA 2J3DA 1Z6XA 3OZIA 4FDUA 3MPYA 1DELA 3W5SA 4JLJA 4TLCA 5FPKA 1GXSA 4F4KA 4BX9A 2ZI5A 5LMCA 4DUGD 4AI6A 2R47A 4HNSA 4IVNA 2DFNA 5FNVF 2ZD1A 1X1AA 4GM1A 8ADHA 2C9YA 3I58A 3CCMS 3J81A 5EEHA 1KRHA 4DCJB 2VYVD 2PZFA 2C2MB 3GIKA 4WK3A 2BFFA 4CT5A 1TR0A 5KYXB 3LC0A 1VYVA 4URQU 1E0JA 1FXWA 3O8QA 4G5RA 3LU1A 2V9CA 3AHFA 4IUBS 3OY7A 4LXGA 3GJSA 3TDMA 5CU7A 2AC2A 2P6RA 3ZBPA 3V7WA 3WGMA 4RK0A 1VJ0A 5EQDA 1HFEL 5C7PA 1CDZA 2DBBA 2Z30B 1VTKA 1E1MA 1KAQA 1ZM4A 1DZ5A 1UDXA 3GRRA 4C0JA 2PZKA 5JO9A 4OLOA 3CJRA 3JSMA 1CP3A 4GKAA 5JISA 4RTKA 3FCUB 5L9NA 3E2PA 5L3ZA 1E2FA 1QAYA 2ZWMA 3TWOA 1NBEA 3L18A 3UCXA 1SIUA 2QSWA 1K66A 5ALZA 4DSNA 1MPXA 1NQOA 5BUCA 3PQEA 4X90A 2QBYA 4IJQA 3OL7A 5KCMA 1VHJA 5EN4A 5CDFE 2KBEA 4UZEA 3H5IA 4JI1B 3BRSA 2ZAGA 3T1YJ 3NFYA 1Q83A 1LGYA 1UCFA 3R7BB 4UHHA 3O93A 1ZGJA 5C5CA 1ZLYA 2V2VA 1VE7A 1W36B 3S7ZA 2TS1A 2FHJA 3SV3A 2OCIA 4J7UA 4F0HA 1PYSB 1GV1A 3W2WA 3M6AA 1NASA 2VH5R 1C7EA 1CNMA 1MB2A 2BGMA 4M0UA 4W9NA 1UKAA 4DKJA 2W9BA 2BUNA 3H2UB 4ZP6A 4WKYA 2J30A 3MF4A 3NC0C 1MJ5A 2GF9A 3J7YU 1D2MA 1PEDA 2O54A 1N3LA 5KYUB 3SXJA 1M2HA 1P1JA 1M5VC 5K03A 3FCXA 2JAUA 4R84A 4USVA 1RHJA 2Z4RA 3HSDA 3G4SS 4DTCA 4TZKA 4ZOSA 1SL0A 3U1VA 4NPHA 1QV6A 3IAM1 4CLZA 2H2HA 3OOHA 5KYWB 2CNBA 4LQ4A 3KKEA 4R8SA 4L73A 1HZZA 3KZXA 3HUFA 3EAQA 3H7HB 5FUBA 3EN0A 2A0XA 4RHFA 2HA5A 4BNVA 2PYDA 1P75A 2ZM5A 5B0BA 2ZIGA 6AT1A 4DLZA 3T5JA 3OOJA 4HS4A 4PQFA 4JI3J 5CDHA 4PRYA 3KK2B 3FEZA 5DNDA 4HDAA 4BMCA 3RC3A 2XCUA 1EFRA 2W2KB 3K32A 2JA1A 1N56A 4RESA 1O94C 5CEJA 5FTLA 4TMTA 4ANCA 1YIDA 2ZB3A 4WADA 3EGCA 2VATA 2H4XA 2OD6A 4WK6A 3C66A 5CFPA 1JT9A 3RRKA 3LL4A 5K3AA 1TO6A 3ZE0B 2ZUFA 5A3JA 2BRUA 3I52A 3K9CA 5L4LA 1KRWA 4ADSG 2C4HA 3E5MA 2YQ0A 2PKQP 1I7LA 1U28C 2O8DB 4NHEA 2GVZC 1OLUB 2PUEA 3GW8A 3OXGA 3MXHP 3N74A 4Z4EA 1H3FA 1ZHHA 3U80A 4CP5A 5KPJA 2EG1A 2QTBA 2ZIWB 3ONVA 2GQ2A 1UXHA 2Z1DA 3DFUA 1F4VA 3NKLA 1ZHOA 4Q02A 3LJKA 3COZA 1J99A 3M8PA 2CV1A 2CXTA 4CNZA 5FNVB 4E2FA 5EGYA 1ZISA 2G6BA 2LU1A 1PBNA 5FJIA 3F9RA 2UUBB 2QQ0A 3TF5A 4IIEA 3BPSA