3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
2FFAA 4PQYA 3LXXA 1XMIA 1D6JA 2VP0A 4KAXA 3G5UA 2RHDA 1ZNZA 2O8FB 1VCOA 5H70A 2E9SA 2O8EB 1OJLA 4DDWA 2GZAA 1N2CE 3MG9A 2GXQA 4PO1A 2GJKA 1QHHB 1N5JA 4NYMQ 4X8OA 3QEJA 2YNMA 3K9GA 1G6OA 4QC2A 2JA1A 4LC1A 4TLAA 4OHXA 4TMTA 4JIMA 4OQXA 3WRYC 5AUQA 4KLNA 1LVGA 4MGIR 4NDZA 1G3QA 1E0JA 2ODWA 1C1YA 4X8MA 5L3QB 1DAIA 4S35A 3NBYC 2IYTA 1TF5A 1NI3A 5L3RA 3UANA 1GVNB 2LCFA 2XZOA 3KDSE 2IXEA 3I8XA 2ZRLA 5FR1A 3WNDA 1QF9A 1SVOA 2ZUCA 1XDBA 3OFND 4B33A 3DKPA 2GJ8A 4YXWD 1B23P 1CR4A 3QJYA 3PUXA 2A9KA 2K5UA 5DSZA 1UADA 4ACBA 2GVZC 1J8YF 2XEXA 3BGWA 4EJSA 3EZ7A 5FL7D 1E79D 3WYGA 3FTQA 4O2RA 2WICA 5KSZA 4C0BA 2HCBA 1PJRA 2GZHA 4ILEA 1Q1ZA 3MCAA 3SHFA 621PA 5GJVC 4DUGD 4URUR 1XF9A 3R9IA 3NHAA 2XSZD 4FMDB 4WVFA 3D6TB 4OK5A 1LFDB 1YR7A 2HT1A 1CEEA 4BFYA 3GCGA 1JI0A 4C2TA 1UBGA 4ZDJA 4RJLA 3ZS9A 1PV4A 3LAWA 4QM7A 1RYHA 2CLSA 4IDOA 4Z8YA 3EAQA 4IEIA 1HE8B 2OILA 4V0KA 3QPUA 4KSCA 1YRAA 3KUCA 5FTMA 4LX0A 1E9DA 2J0UA 3DKVA 3GMTA 4QJ5A 4A8JB 1W36D 4TTQA 3I5XA 2ZJOA 2F6RA 4CEHA 2QORA 2CLCX 4CDGA 5C46F 1X8JA 4AYWA 3PCRB 1GNPA 5FTJA 2PH1A 4EQ6A 1MOZA 2VP2A 1J7KA 2WJVA 3RSLA 4TL6A 4BFVA 1GRQA 4DDVA 1JQLB 2D06A 5TB5A 3ND8A 3NC0C 1XJQA 1KI3A 5J40A 2AHOA 3RS5A 2WMNB 2WWIA 5JFGA 1IY2A 3BH6A 4QOSA 2J5XA 1TUIA 4NHOA 2PCLA 2FPMA 3T35A 4OHWA 4A9AA 2EFDB 3TVDA 2DB3A 3SJZA 2PX0A 1Y63A 3C8UA 3KUDA 3RANA 1CKEA 1ZJ6A 4GMXA 1XBTA 2YZ2A 4TLDA 4XWKA 4XVRA 4KCGA 1D8TA 1NVWQ 1P4SA 4KJZA 4POAA 3DZ8A 2QTFA 1A4RA 1ETUA 2FDCA 4AD8A 1R2QA 2A78A 3NC1C 4P33A 4ZIRA 3X1ZA 2NG1A 1E98A 2IK8A 3U61B 3B9PA 2V9PA 2RCNA 4BRWA 1BIFA 2ZRFA 4U7DA 1NG9A 1II0A 4C7OB 2CHVA 4U5XA 2ZE8A 2F55A 1RIFA 1WP9A 1US8B 3F0TA 3ADCA 1Z6TA 4AWXA 4DT1A 3THXB 5BYJA 2JJ1D 2OLKA 4MA4A 1SKQA 2XZLA 3U4QB 3KKOA 4AIIA 5L3VA 5KSOA 4HZUA 3MRSA 2CNWA 4DCNA 4E07A 1VG0B 4DLRA 1DPFA 4D25A 4Q4AB 1Z3IX 2HJVA 3KX2A 2QAGA 2GCOA 3EIHA 4V0MA 3KZ1E 3LBIA 5B30A 4B44A 1XU4A 1D9ZA 3EC2A 4BLQA 4GOKA 5LD2B 4AYTA 3WBJA 1E0KA 3GLHA 2BMDA 1MRNA 4DLUA 4JVMA 3CONA 1OB2A 1W1WA 4A2PA 4RD2A 2FNAA 1GKUB 4GDFA 2EFGA 1RE0A 5KTYA 2QBYB 1E0SA 3CH4B 4Q1EA 4U02A 2GDJA 4QGHA 1E1RA 1L4UA 3LWNA 1R0YA 3PUWA 3R9WA 4PC1A 4RKEA 2IHBA 4JT2A 3KKMA 4Q18A 4GZMA 2VP9A 4D4KA 1HE1C 4MUBA 4TMXA 4US1R 1DO0A 5HKKD 3WNBA 3QIAA 4YMTA 4MQBA 1T5IA 2BKEA 1QVAA 1V43A 2OCPA 1Z08A 2WAYA 3M0EA 4RVCA 4PR0A 1SHZA 2JDIA 4WXRA 4M22A 2DCUA 3UWOA 3CRQA 3NDBB 1D9XA 4LUCA 1II9A 2IWHA 4Q19A 4ZKEA 8OHMA 3IILA 1CULC 1Q57A 3K0CC 4ESHA 4ZI3A 2BEJA 2JLXA 1S3SA 2HYDA 1WBDA 2AFIE 1XEXB 3HR7A 2GK6A 4WOPA 2OBLA 1XD2A 2OBMA 1I4LD 1RRPA 2RH5A 2W2TA 4PSKA 4YMVA 3T06B 2CMKA 1SXJE 2ZPTX 5BW8A 5KHOC 3K9LA 4QJ3A 5HZKA 3B1XA 3U3OA 5E7JA 1E0AA 2C99A 2HCJB 1XZPA 3JZMA 3ONWA 4M1KA 2ODBA 5J4LA 2WWWA 4PZYA 2C78A 1GL6A 1RJ9A 1H65A 1JXMA 1JEDA 2QSZA 5KPDA 4M9ZA 4D0GA 3IO3A 1T0JB 3LH5A 4HB2A 3QI2A 3RRZA 4HYYA 4MGKR 1EX7A 4PAOA 5FOSA 4XVUA 2OFOA 3H86A 1RFLA 4I1VA 2F9MA 4B3CA 3FMIA 4EPVA 2IEYA 1NIPA 2J46A 1G291 3KJEA 3PEYA 2V8OA 2J0QA 3KJGA 3GJ8A 4US2R 2AD1A 5FOWA 1HA3A 1M1YE 2AKYA 1KO4A 4NPHA 3A6PC 1RW4A 4CZ2A 3OEHA 4KBGA 4NCKA 2XTZA 1W4AA 4QG7A 4M9QA 4Q4JA 4JMPA 2EFCB 2X2EA 3ZS8A 3GLFA 1G8HA 1DAHA 4JYCA 4EFNA 4LJ7A 1G5PA 3CF2A 5J47A 4DCTA 4XIGS 4N0DA 2X77A 4PZZA 4LDJA 2DHRA 2Q3MA 2J3EA 3RRNA 3CX6A 4Z1MD 2FFBA 5P21A 5JSZB 3AP1A 2ZAMA 4F91B 2LKCA 1RYFA 4MRNA 5DYGA 4DLSA 3GLFE 2ZRMA 1R5OA 2WWFA 3NH6A 2G9NA 4HI0E 4D80A 3QSYA 4LJ4A 1GIAA 1ZAKA 2QENA 2B7BA 1VCNA 2KSQA 1JR6A 3OEEA 3BC1A 2I1VB 2CJWB 3KQKA 4OI2A 2YWFA 2DFLA 1H8HD 4B74A 2VQSA 4OHYA 2ODNA 2WKQA 2X1VA 2UVQA 4LV8B 1PUJA 2C2HA 1SXJA 4DSUA 4DLWA 3CNOA 2GJAA 3RS7A 5GJBA 4LGMA 2JASA 3BB1A 3THXA 3B7GA 1H8HA 4G1UC 2VSXA 4BLSA 3GLGB 4NYJR 3PEUA 2HF9A 4M0LA 1IONA 1IXSB 1TMKA 1MABB 2F7SA 5E7IA 4AC9A 5JWHA 4JKYA 4JSTA 3B1VA 2IYWA 1G3MA 1HYQA 2W2XA 5KOYA 2EFEB 4NYMR 4DLVA 4Q02A 5FBQB 2ZRPA 3LXRA 4V0OA 1JR3E 1BH2A 3U6KA 4QBGB 3CWQA 3GJ3A 2W0MA 1U94A 4UXJA 2FU5C 2ZR9A 4GP6A 4Q1FA 5LBIA 4ARZA 1Z63A 1NP6A 4A8JC 2FPLA 5AWFC 3R7WA 3SDZA 1IJEA 3IGFA 1W0KD 2XAUA 1I2MA 4RZUA 2OHFA 3KJHA 3LW7A 1RJ9B 1ZUIA 1ZRHA 2ZU6A 3BFKA 3CRMA 2B7CA 1JQJC 4RFVA 3SC3A 2REXB 4ZDWA 4Q48A 5JWRA 3K0FB 2Y8EA 1FTSA 2FSIA 2N42A 4YONB 4JLJA 2C95A 2QRNA 2ZS8A 5KSYA 2IYSA 3G82C 3GPLA 4OQNA 3RSOA 1FFHA 1OB5A 4BLRA 2H16A 1FOEB 3N5CA 2BMJA 1Q3TA 4D26A 1KY3A 4PQRA 2DPXA 2BWJA 4JLAA 5JS8A 1R4AA 3SOPA 1AA9A 5DI3A 1OKKA 5EP2A 5KDOA 1O87A 4BFTA 1CJKC 3M1IA 4PXAA 4C0LA 1TQDA 3TBKA 1BYIA 1ZC3A 3K0AA 3RHFA 3P26A 2QY9A 1TU3A 4JT4A 1S1CA 2Q9AA 1YJ5A 1ZVQA 2KB0A 4Q9JA 2IX3A 3RC8A 2ZJYA 2GJSA 5HTKA 1BMFA 4DVGA 1NN1A 1ESMA 3JVVA 4JL5A 3CX7A 4EPWA 2HF8A 1XWIA 4CF7A 4F4IA 1W4BA 5C18A 2REOA 4TZ0A 5ELXA 1NMXA 2GTPA 1T4GA 1TQ6A 2OBNA 5H1YA 1XNJA 3N70A 5TXGA 2QPTA 5FUYA 1UEIA 1P2TA 1KSJA 3DM5A 3IBYA 2R6AA 4C0JA 2R6FA 2V4ZA 3R8FA 4FW9A 4Q47A 3VKGA 4Q4HA 3SZRA 4OYHA 2D3WA 1QG2A 3AF0A 3RNLA 5G3YA 1G64A 4WZBE 3I61A 1DAGA 3NTUA 3H84A 2MSCB 3SQWA 1R5BA 1G7CA 3GEIA 2XNDA 2CL7X 3FMPB 5FH9A 4OBEA 2W0SA 4NYIQ 2GESA 4IFBA 3RC3A 1SVSA 4PQFA 4WA7A 2ZROA 2CDNA 2ZEJA 4M4SA 5EP3A 1RRFA 1ZIPA 1IN5A 4C0KA 4GRAA 1E2KA 1PVOA 2DBYA 2P65A 1KDTA 1ZU4A 2I1QA 4CEIB 1B0UA 5SZHB 3U60B 4M8NE 3ICEA 1LF5A 3NEYA 1AIPA 1GTVA 2GVDC 2QT0A 1P62B 1YZLA 3IPYA 3HYRA 3OHMA 2ZE7A 4M1OA 2H1LA 2W83A 2ERXA 2OLJA 1E2LA 3A36A 3K0FA 1UDWA 4ZDIA 1E4YA 3NVAA 4IVPA 1KY2A 4GZLA 4IVRA 1E9FA 1OFIA 3A4MA 4OQLA 3AKEA 2AR7A 4AKGA 1KSHA 2WSSA 4LOAA 4JLOA 1MO6A 3K0CA 3PENA 5F98A 1QDEA 1JECA 2F9LA 2O0KA 2V6IA 4MKIA 3MUFA 4AG5A 4WIAA 3ZZTA 5DE3A 2ZRHA 2CEAA 5HZHA 1CJUC 1FL9A 4LJAA 3I72A 3LNCA 5J4KA 3JVUA 3THWB 3MWKA 3ZYCA 3CW2A 2D7CA 3KXIA 1TAGA 2OV2A 2X19A 2Z4RA 3OF5A 1G3IA 3C5CA 4Q01A 1SVWA 4M9XA 221PA 1W4CA 1Z47A 4C0QC 1FPMA 3U3MA 4F4CA 5CYPA 2FJUA 2AFHE 1TQ2A 4HAUA 4QHSA 3UWKA 3A1WA 1EFRD 2F1JA 2VPPA 3GEHA 1KI2A 3SJAA 1GSIA 3T1VA 2P6UA 2QP9X 2FFQA 5HCIA 1MH1A 4OI0A 5KUTA 4P4UA 2ZRCA 4RD0A 1G1MA 1TQ4A 1D5CA 1W2GA 3M6AA 1N0UA 2MMGA 3PEVA 3ZVLA 1N6OA 4EPTA 2GKSA 2P5TB 4URZR 2P3SA 4NTZA 5D3QA 5BN5A 4TT3A 1ANKA 1FUUA 1FUKA 4PZLA 5JEEA 1E2PA 1ZM4A 1SHKA 3V00A 4URYR 2G77B 3L2OB 4XWAA 4LJYA 5KNDA 4OK6A 1KNXA 1ZC4A 5IT5A 1E2NA 1M8PA 2D74A 3BB3A 5A4JA 2QP4A 3PUYA 3W6PA 1G9XA 3PEWA 2ANCA 4BFXA 3Q85A 3B1ZA 5CIWA 3L8ZA 5BXQC 5F2EA 2WJYA 4HUQA 1OHHA 3LLUA 1ZCAA 3I4LA 1YZTA 5HKKA 1XX6A 3A37A 1N5KA 4E09A 3FVQA 2O8DA 3EARA 3THYA 2G88A 2J9RA 3HP1A 1OE0A 4AURA 1QHSA 3BH7A 4B47A 2WPDA 2OFWA 5TDHA 4W9MC 1CBUA 2JGNA 5EQTA 1WRBA 2BV3A 2Q3FA 4P0TA 3NWJA 3ZZ0A 1MRSA 4KFUA 3GLIE 3BBPA 1VECA 2IWRA 5LPNA 2P6RA 1XTKA 2ZUDA 2QPAA 2GETA 3LLMA 5JEDA 4LHZA 2CHQA 4BZQA 4YC7A 1G3RA 1KHTA 4GFDA 3T5GA 4A2QA 3QKTA 5JZVA 4DB2A 4IOLA 5FBWB 4B76A 5JLJA 1MR3F 1Z22A 2AWOA 5J4VA 3W6OA 1S1MA 4LHVA 5KPJA 2W6JA 2YHSA 4LBYA 2CBZA 2VHCA 4FMBB 4XD7A 2IYRA 1R0ZA 2JCSA 1AKYA 4LPKA 3HU1A 5KU1A 1E2JA 1IJFA 1OH6A 3DPUA 1Z29A 1KK0A 2CK3A 2QAGC 5CJ2A 3RS0A 1II8A 3ZDQA 1IXRC 3CZPA 3LDAA 3NHBA 4UXIA 1UAAA 1SKYB 1W49A 2ODEA 4HZUB 2X2FA 2NOAA 4CEHB 5CK4A 1F2UA 2GCPA 3OAAA 1BYUA 3TSWA 1KGDA 2CK3D 3MGCA 4V0LA 4PO9A 2XZPA 1ZD8A 4BZPA 2KI5A 1NVVQ 3Q5DA 4URXR 4RY2A 2DYKA 1Q1EA 2GEVA 4DZZA 1X8KA 3OEHD 4H1UA 4HATA 4BUJA 3LY5A 1EFTA 2YJTD 4GNKA 3SS8A 3RVBA 1W44A 1X86B 4CEJA 1YZQA 4G5SA 2IYZA 4KSBA 1GG2A 1KDRA 3P20A 1Z5ZA 1XMSA 3E5HA 1NF3A 1VKJA 4WXPA 4BFZA 3REGA 3QKRA 421PA 4NBSA 2D2FA 4R9UC 4EFLA 4Q9HA 3SQXA 4LJ6A 1E9BA 4E03A 2C9YA 1P72A 2P2LA 4PC2A 1NVVR 1K6MA 2BMFA 2Z6VA 4PC6A 4R98A 4LYJA 2G0NA 1E2QA 2QEQA 5DO9A 4HUQB 1X3SA 3W3AA 3VX3A 1QHYA 1ZM7A 4C0AC 5F3WB 1JJ7A 3WYFA 2OZEA 5ANRB 1UBFA 1JR3A 4JLNA 5JJLA 1KI6B 1COWA 1CXZA 2BMEA 4E22A 5KNCA 3EIQA 3FFAA 1P73A 2XXAA 2O8BA 3VMFA 1US8A 3PJRA 3QUSA 4LYHA 2FMXA 4M21A 2QE7D 1JALA 4Z8XA 5K8IA 1P9WA 4EQ6B 2R9VA 1CJTC 1OV4A 3I5YA 1W2HA 1GFIA 3LQQA 2GXSA 4OK3A 3GJ0A 1NRJB 2ZTSA 1E69A 4TN1A 4NH0A 4NL4H 1OFUX 1CF4A 1J2JA 1NVXQ 2VHJA 2QAGB 1KSGA 4BFUA 3TGPA 3T1OA 2EQBA 1JJVA 4F4JA 4FWIB 2BOVA 1JPNA 2AXPA 1QG4A 3QEOA 2GXAA 1TX4B 4HDQB 3WMGA 4LC0A 1HURA 1GZSA 4TYWA 1IN4A 2A7QA 4Q1BA 4OHZA 4CT5A 1KJYA 1ZBDA 4IDPA 2AD5A 4K46A 5EUMA 3EZ6A 2VA8A 1UDXA 1Z6XA 2HXYA 4DIEA 2XJ9A 2FN4A 3KQNA 4B34A 4HDCA 4JLDA 3AGPA 521PA 2PZFA 2PMKA 3RWMB 2JLQA 3ASYA 2RGGA 3W34A 4ZI2A 5AUPB 4IDHA 4DIDA 1CU1A 1JAIA 1VDZA 4BFSA 1KZGB 3B5JA 1UEJA 5E7MA 3UK6A 5KO2A 3CNLA 4HAXA 2OXCA 3CRW1 4ZIRB 6Q21A 3VNVA 4BRUA 5TARA 1G7TA 3FYHA 3DL0A 1R6BX 3R20A 3SHWA 5C4MA 1S9HA 4M53A 1CRQA 3SFVA 3GJ5A 1NSFA 3GJXC 3GLFB 3Q72A 2J7KA 4FN5A 2QN6A 4QNMA 4B3FX 2XITA 3QVUA 2BIFA 3DO6A 4QGAA 3J81k 4L9SA 1XMJA 2ZR7A 4O3MA 3K70C 3NG1A 2IF2A 4JJZA 5FI1B 1NSTA 1U8AA 3RWOA 1OW3B 3Q3JB 4YXWA 2ATVA 4B2PA 1NBMD 4D4JA 2QA5A 4F38A 2ERYA 2CVFA 4RSGA 3GJ4A 1E6CA 4TQAA 4PSVA 3SN6A 5FL7A 3TNFA 2BHRA 1E99A 5H8WA 3W90A 3UATA 4PC7A 3EPLA 2Z43A 4TMKA 5H68A 1MO4A 3IHWA 5AUOB 1SULA 1P3JA 1SVMA 2FZ4A 3CZQA 1KAOA 4HAYA 5AJVB 4NMMA 2V3CC 3TUJC 2ZYUX 4D0LB 2VHQA 3KKPA 1E2MA 1OLOA 2NIPA 4JS0A 1GNQA 1U0LA 2B8WA 3DDCA 1UBCA 3IQWA 3BFVA 5JBQA 1PUIA 2J87A 3P4YA 4II7A 3LFUA 1N0WA 1EESA 2DR3A 2ZYTX 5B57C 2C96A 3QXHA 3ZLJA 3WXMA 5LDDC 4AKIA 2DWPA 1FX0A 3TQCA 4Q4JB 2BBWA 3T12A 1W47A 4PHGA 2FEOA 1N5LA 3PIRA 3LQRA 5F9HA 2C8VA 2WOOA 2XB4A 1Q44A 4IW3B 1Z06A 4P4TA 4YMWA 4DSNA 4IXNA 1WE2A 1L2TA 4YMUA 4B2LA 1NVUQ 1PLKA 2OSBA 1N6HA 4RCZA 1P5ZB 1XPUA 5F9FA 4LHXA 4TL9A 5L8VA 3CBQA 2A3RA 3CLVA 1KK3A 3PFIA 1MV5A 4L16A 1OH8A 2B92A 2GILA 2C5LA 1XXHB 1FNNA 3FOZA 4RKFA 4B6EA 2VH5R 1LY1A 3WNCA 5CIQA 2IW3A 2ZUBA 4GMDA 5EP1A 3PQCA 3I1FA 1EGAA 4PSAA 2VO1A 2V1XA 2RGAA 1UF9A 4JKIA 4FINA 2WSSD 4AYXA 1VYVA 5DIFA 1ESNA 2IUTA 5G41A 1JB1A 3C15C 1AS2A 2D62A 1NJFA 1VG1A 1XP8A 5CM8B 2EWWA 2IS2A 4KVGA 2F1RA 3VR6A 4XH9B 5G40A 1CTQA 4C2UA 1MABA 1K5GA 2AL7A 3VHXA 1ZIOA 1G8FA 1UKZA 3GD7A 4JLVA 1R8SA 4N3NA 4MGYR 5L3SA 4KFRA 1NLZA 1Y3AA 2Q9CA 1XD9A 5HE9A 1IN6A 4FI3C 3BFXA 3ZH9B 4DT1B 2OEPA 5EE3A 4DUGA 4PHHA 3MWLA 2ZS7A 3CWZA 4QKQA 2PJRA 2JJ1A 3N2IA 5BN3A 1KKLA 5FUXA 1E9SA 1A1VA 1GILA 5BN4A 3B8HA 1CR0A 2I3BA 2WJJA 5J5CA 4OL0A 5FTNA 3SNHA 4BASA 1PZNA 121PA 1CS4C 4ARZB 4DEXA 2NGRA 3AF2A 1U0JA 3CF0A 5J4YA 4FMDF 4TYPA 2YV5A 5GJWC 1S4QA 2JLWA 1CRPA 1OFHA 1Z6GA 1E2HA 1DEKA 3RDPA 5JECA 3CPEA 2WHXA 4JLPA 3BJIC 1EK0A 2J7PD 2QGNA 4M1WA 4Q66C 4Q1DA 4Q4HB 5DH9A 2OT3B 1N6LA 3IIJA 3UG7A 2ZRJA 3EW9A 5JRZA 1AGPA 5D3MA 3UXMA 3WP1B 2ZJBA 4JLBA 1JBKA 2QG6A 2ZI6A 3AVVA 3TRFA 4C4PA 4P32A 2F43A 2ZJ2A 3VX4A 2ZI7A 1IXZA 4YMSA 5BYKA 2Z83A 4Q21A 5SZKB 3X1WA 2XTMA 4BGDA 2OO7A 1ZU5A 3TR0A 5K8UA 1XJ0A 3AUXA 4FIDA 1E94E 1VTKA 2PEZA 3X2SA 4EJSB 4B43A 3NXSA 1KAGA 4I1SA 3DVLA 2ZJ5A 2IYVA 2JDID 3IEUA 4DCSA 1OHHD 2DY1A 4DRZA 4MYTA 3W8RA 4Q1AA 2PEYA 1J70A 2NO0A 2ZI9A 2ORWA 3O8RA 5FBVB 4IEEA 4OI1A 1NLFA 3ECCA 4G5RA 2ANBA 1FMLA 4YLGA 3TMKA 1N6KA 2QTHA 4I1UA 2HYIC 3LRPA 1QRAA 2PLFA 2WJIA 1XD2B 4A0HA 3EA0A 2P5SA 3CR7A 1Q21A 2CHGA 2JLUA 4CIDA 1G19A 2REBA 2H17A 1U2RA 5AJWA 3U7HB 3Q7QA 3ADDA 4GOXA 1NL3A 1KMHA 4UQOA 2EFHB 3UG6A 5C1BA 1NNEA 2HEIA 1OXTA 4G5OA 1A2BA 1P61B 3L43A 1A82A 3WYAA 3HWSA 2GAAA 2O8EA 1XB2A 4JVLA 5KDDA 3QXJA 5AUNB 1NKTA 1Z28A 2QROA 3QKSB 4NYJQ 4QL3A 1NJGA 3P27A 2QL6A 1E3MA 1W48A 2ORVA 1KI6A 1OYYA 2FF7A 2RHMA 3CO5A 3H1TA 1P9RA 4UKDA 1BOFA 5EXXA 1T9HA 3TQFA 3AP2A 3LX8A 3LBHA 1MO3A 1W36B 3HDTA 3HJNA 4TSFD 2OCBA 4Q4AA 1N6IA 3LVRE 4QJ4A 5A5GA 3I8SA 4LV5B 1GKYA 1UKEA 5KSPA 1I4DD 1XXHE 2OESA 4ASUA 1OIXA 2WTUA 4V03A 4B48A 3KQUA 2FV8A 3AM1A 2QMEA 2WIBA 3V4FA 4MRRA 4GBMA 2NTYC 1Z6AA 1ZMXA 2AX4A 2GXUA 4JVNA 4MYHA 2JLRA 1IY1A 4I4LA 3VR2A 3DHWC 4B3DA 2O8CB 1RZ3A 4HB0A 2BBOA 2A5GA 1FW6A 4MRSA 1XXHA 4EDHA 4MUAA 4KITB 2WWGA 2OM2A 3IQXA 3UMRA 4N1AA 4IRUB 4UNRA 3U44A 5JCPA 2FWRA 1I4TD 3TSZA 4OJKA 2YWEA 5CDFA 4C9BA 2GF0A 1NMYA 3UKDA 4B35A 4W7SA 3K70B 4TLBA 2BEKA 5EXSA 1DADA 2Z0MA 5EE1A 1M34E 4LHWA 4L9WA 2WWXA 3NH9A 4DWJA 3H2YA 3GLIA 1G21E 4CVNA 1TNDA 2YOFA 3OEED 1G5TA 1X1RA 3K9NA 4AI6A 2BBTA 4LK2A 3RYTC 3RLFA 3Q9LA 1NN0A 4AK9A 1YR8A 1IBRA 1ZYUA 1XJCA 1FQJA 1DE0A 3U4QA 4BZXA 2QAJA 5A0FA 2J41A 3EZFA 5FL3A 5L3SB 3V4RA 5AJYA 4B73A 1UM8A 5FPHA 5B2ZA 3ZJYA 1GAJA 3AVOA 4IJMA 1M7BA 1N6RA 3I3SR 4P31A 4NE2A 4JVSB 3O47A 1U81A 1VHTA 4J0QA 5FOVA 4LBZA 4JLKA 5IRCD 4B3GA 5HR5A 3QF4B 3MWJA 4ERNA 3K1JA 1S2MA 2O52A 2ZR0A 1G18A 1UKYA 3OE7D 4HLQB 5CM9C 3LA6A 2EYQA 1RVDA 5JMTA 1JXOA 1U8ZA 4H9GA 4B71A 2IHYA 4MH0R 3BXZA 3FGNA 5CB8A 1R10A 3IHLA 1E2FA 4S2EA 3ZQJA 4NP6A 4W5HA 1KK1A 1JPJA 2WJHA 2X8AA 3IDQA 4TTPA 4D4LA 2N1BA 1YQTA 3AKDA 1KI8A 2OAP1 3WHKA 1OH7A 4AKHA 3MMPA 1M6NA 4KODA 1AZTA 1PLJA 4KYIB 1HY3A 4KXFB 2PX3A 2ZSFA 2GCNA 4DBLC 4QBHA 5E3HA 3BWDD 2WWYA 1W7AA 5B58C 5FPYA 2VIIA 1WXQA 4QFMA 4FXPA 2BKUA 4NONA 3QY0A 4P3YA 4C30A 4LZZA 4GOJA 3ZVRA 1E9CA 2ZAOA 1XCGB 4BEJA 1YR6A 4OHVA 4FMCF 2DFTA 1M7HA 3BD9A 2P67A 2WSMA 3GLHE 1AZSC 3CB4A 1RRCA 3P4XA 2GHIA 4TMVA 1LB1B 2GEUA 4AKEA 3ICQB 5EXTA 2AKAB 2CL6X 2E1RA 1ZM3A 1OXVA 1G8GA 4ON9A 2VSOA 3S1AA 4A0GA 2BM1A 4XOIA 1ZNXA 2R44A 5GVRA 2BJVA 3R8CA 5E4FA 5CDFE 4JLMA 5EZ5A 2IYYA 1Q22A 3T1QA 3BORA 4MKGA 3I32A 4D6PA 3U6BA 3L0PA 2IS1A 3BIFA 3K0AB 1EG7A 3VU9B 3ADKA 2QPOA 3FDIA 1XEWY 1T6NA 3CIOA 5DGXA 1CP2A 1HEIA 4UJ3A 1AS3A 1GUAA 2CCKA 2Z4SA 4HLCA 2PZGA 2IT1A 1E4VA 1T8TA 2C03A 2BJWA 2G3YA 2GCOB 2P0EA 1E79A 2R6GA 2JLZA 3BERA 2EU8A 1NG1A 3HPQA 4TYQA 2DFNA 1OIVA 5FUVA 3KTAB 5G3ZA 2CXXA 1OPXA 5UKDA 3DMNA 4PANA 3K09C 3NBFA 5LB2A 4KO8A 3RRMA 1IN7A 5FOUA 2XSZA 3EASA 3P1JA 1OFTA 1NLYA 1MKYA 1TEVA 3FHOA 3MSXA 4D82A 3ASZA 4RZ2A 2AK2A 2ZVPX 4E5UA 1M7GA 2P6NA 1GRRA 5BWMA 4HDOB 4PAQA 4MRVA 4B3XA 2VBCA 2VP6A 1DBSA 2XX3A 2A2ZA 4TQ9A 1GOTA 1Q1BA 4PX9A 1GDDA 2C98A 4IXMA 2J45A 3QVVA 1X1SA 2DWOA 3ND9A 2YOHA 4XVQA 1Q20A 4FCWA 1RC8A 4IDNA 4X8LA 1NIJA 2JIZA 2ONJA 4R71A 3D8BA 2ZRNA 1DAKA 1W0KA 4M9SA 2EVWX 5IF9A 4WZAE 1NMZA 3PVSA 4V02A 1KDOA 2OUKA 2ZE6A 4FWTA 3ZD7A 2QT1A 1G3UA 2NPIA 1TF2A 3FHCB 4LI0A 4ZDKA 2GWHA 1XMVA 3CNNA 3IKJA 1W5TA 1JEEA 2PL3A 2CCJA 1QHHA 4FCVA 3UMSA 2IS6A 2O8CA 1G7SA 1W4RA 4R2IA 5FBRB 3EPHA 4IHQA 1AKEA 4DEYA 3CPHA 3TIFA 2QU8A 3A1TA 1VIYA 2IC5A 2KE5A 2V54A 3HPRA 1W0JA 3V9PA 4DDTA 3U5ZB 4K8OA 4OJQA 2Q3HA 1QHNA 4TMZA 2NZ8A 3K9HA 2QBYA 1II8B 3AEZA 1SGWA 3KFVA 4Q4LA 3L82B 2BBSA 2D2EA 5JCZA 2AXNA 1KJWA 2NO9A 4I99A 3WHLA 1W0JD 2Q9BA 4A0FA 2XTNA 3QXSA 4Z54A 1Z0IA 2FE4A 1T5LA 2ZJAA 4Y0VA 4OQFA 1GRNA 4UNQA 3QKSA 5CK5A 3MJRA 1L8QA 3MWYW 1KIMA 3BB4A 4KYUA 3WMEA 3W3ZB 2YOGA 2YVUA 4I81A 4HEJA 4RFSA 3GLGA 1FMJA 2PJZA 2VHUA 2VF8A 2C04A 2WBLC 2ZSBA 5FPSA 2QMHA 1N6PA 1TL7C 3N2EA 3U2QA 4A2WA 4MITA 4DLXA 2PZEA 3U7GA 3PITA 3SBDA 1E2EA 1Z0DA 4IOMA 5JWOA 2OCYC 4OI4A 3QF4A 3UMFA 5IDVA 1R7RA 4KFSA 3DZDA 5SZIA 2GA8A 3L0SA 4MDFA 3EXAA 3KFXA 1M2OB 5CB6A 1NN3A 1OH5A 1IHUA 3CR8A 3NDPA 2XOKA 1EFRA 1VPLA 2ZXUA 2OG2A 3A58B 3REFA 2PLRA 2CVHA 4UXHA 1KMHB 1DG3A 3SYLA 2WAXA 2ATXA 4EIWA 3CUEF 3GLHB 5KNBA 4FCTA 5SZJA 1U90A 4QM6A 2QGZA 4UNSA 2XOKD 2KJQA 3IPXA 5FTKA 5TV2A 3SFZA 2CE7A 3KKQA 3MFYA 4LJ5A 3AVTA 2H57A 5FFMA 1F2TB 3TH5A 4URWR 3B2EA 3ZZUA 4EUNA 2DWQA 4TT3D 2BCJQ 5FPTA 3A1UA 4BEBA 1AJEA 2RMKA 2VEDA 2O0JA 5CJPA 1N3BA 1LF0A 2OXRA 4OKSA 1AS0A 5JHGB 2LWIA 2WOJA 3AVYA 2Q6TA 1E9EA 1OXXK 3TJZA 1YU9A 2HXSA 5DI3B 1KNQA 3VR5A 1QHIA 4DC9A 2EYUA 2PT5A 3QENA 1TF7A 3K0EA 1C4OA 3ZQ6A 3OESA 4EAQA 5K8LA 2XXAB 3TE6A 1HT2E 1OSNA 2QP3A 3PXGA 4IFEA 5CLLA 3AVXA 2IS4A 3RS2A 4RD1A 3AVUA 3B13B 3GFOA 1GNRA 2JJ2A 2PCJA 3K09A 4IDQA 4RZ3A 3VTKA 2QMUA 1XEXA 4BFWA 2OE2A 5K8TA 4V0NA 3K70D 2WWHA 1W46A 1XTJA 2FG5A 2RGBA 2WPDD 2WJGA 3U3KA 1ZW6A 4MRPA 1ZNWA 2JJ2D 3EZ2A 3QXXA 1IM2A 1NN5A 3FWYA 2AK3A 1OIWA 1XD8A 2WM9B 3SE0A 2JLYA 1HH4A 2V7QD 3L8YA 3CX8A 4HSEA 2B21A 4MKHA 2N46A 4RD4A 1XPRA 1L7VC 1HQCA 2UZ3A 4BQSA 1DOAA 2HJGA 1YRBA 3R9XA 3ETLA 4M1TA 4KI0A 4YDHB 5AJZA 2V7QA 2W58A 2W6JD 5HPYB 4TL8A 1XCMA 2CNWD 5EJEA 4KU4A 2ZRDA 1TUEA 2XJ4A 3EIEA 1XTIA 1Z83A 2IBMA 2QMOA 1LW7A 3SJBA 1XEFA 2F3RA 4ZO4A 2SHKA 1EWRA 4QGFA 3Q5EA 2BDTA 4LHYA 4C3ZA 4A6PA 2IXGA 5TMPA 3OIYA 1XTQA 4DSTA 3QE0A 2QM8A 2FH5B 2LKDA 2UZIR 4FMCB 1VIAA 3BH0A 2BM0A 4MGZR 1C9KA 2W00A 2ZRBA 1F60A 3AP3A 3GLGE 1SKYE 1U99A 2ZRAA 3EZ9A 3LW8A 3KB2A 1AN0A 1DTSA 1X8LA 5IHPA 2C9CA 2CCGA 3U3JA 2ZM5A 5JJIA 4XJXA 2FFHA 3C16C 2CL0X 3KXKA 1P2UA 4EPXA 4F92B 4F7WA 3FFBA 5IK2A 2G0TA 2O0HA 2EWVA 2WKRA 4D81A 2QQEA 4ZCMA 2A30A 3QKUA 3LX5A 2H8KA 4A6XA 2BCGY 2ZREA 1XTSA 1UBEA 2HUPA 3NBZC 1ZP6A 2W6ID 2YC2C 4FD2A 2MMCA 3THWA 4JL6A 1S8FA 1KDPA 2CJWA 3MAAC 1DAMA 3TLXA 1ZUHA 3IBGA 4JL8A 4W5WA 2RGXA 1S0UA 5EP4A 1VCMA 2JJ8A 1T8UA 4BLTA 2O8DB 2RGDA 3EPKA 5HCNA 3EC1A 1YE8A 2ZSAA 1SXJD 2R6CA 2ZYVX 3C7KA 3EA5A 3ZIAA 3EPJA 2QTVB 4GL2A 2QZ4A 3CM0A 3GFPA 3SR0A 1FX0B 3B9QA 1IOZA 3TR5A 2ORIA 2QM7A 3WP0A 1DAFA 2B8TA 3GP8A 4TWZA 3DM9B 2FOLA 4NZYA 4Q03A 5AJXA 3FHTA 3CH5A 3BS4A 2QRZA 3H0KA 3SU8A 3E1SA 4PPQA 4KFTA 4DB4A 1G17A 3RS3A 4LRWA 1KO8A 5LB4A 5JI3E 3FKSA 3HR8A 4U00A 3GJ6A 2XGJA 2Q21A 2J1LA 2B6HA 4Q1CA 2JLVA 3AVQA 1IQPA 4XD7D 3AF1A 4PPFA 2ECKA 1J99A 2ZRGA 2OCAA 1ZINA 3DOFA 4NU0A 4R7ZA 3MJHA 4EPRA 1VHLA 3F3YA 5DHAA 1WDTA 3H4MA 1AK2A 3AGQA 3X1YA 2CE2X 1KO5A 1TPZA 3CF6R 1Z0JA 3BAFA 2F1HA 1N0VC 3B1YA 4DSOA 1E2DA 1I2DA 2WV9A 5DI9A 1NBME 1Z2AA 4TQUS 2VRWA 4XTCS 1N25A 3G0HA 1U9IC 1GL7A 4ITRC 2R2AA 3UPUA 4Q7JB 1D2MA 4QGGA 1IN8A 3B60A 3CKLA 2J0VA 1E96A 1SVIA 1XPOA 2V55B 2RAPA 2YWGA 1GKIA 2ZYWX 3GFTA 3K8YA 4NCNA 4HLDA 3TW4A 1T3SA 4Z51A 1W5SA 5JS7A 5GJCA 1OKKD 1Q1QA 3SJCA 4DLYA 2ZETA 4N0EA 4CEIA 5CLQA 2FX3A 3ADBA 4G5GA 4JBXA 1U9IA 1S96A 1XEWX 2RKOA 2BVNA 4IOJA 4XTRA 5BQ5A 4HUTA 5JJKA 2ZS9A 2ONKA 1NKSA 1HT1E 4MKFA 2NO1A 4QHTA 3A1SA 1V5WA 1KI7A 4LYFA 4X8HA 1E32A 2YKGA 2ZSDA 3T61A 1YR9A 1KZ7B 4M1SA 4EPYA 1KI9A 4PPNA 5KDLA 1R5NA 3ZVMA 1XZQA 4W5JA 2ZI4A 1ODFA 4JSYA 3WMFA 2G1JA 3GQBA 4ABYA 4DLZA 1KK2A 1YZKA 2ZANA 4M2LA 4XSGA 2GBLA 5FI0B 5EE5B 721PA 2FA9A 3QBTA 4WBSA 2O5VA 4GP7A 4ESVA 1G5RA 3ZD6A 4ZV4A 1JR3D 1OT3A 3KB1A 3HYTA 4TTRA 2AWNA 2MSEB 3VFDA 2WMOB 4G0NA 1F2TA 2MSDB 3PV0A 2GBLC 1GP2A 3F5FA 1S3GA 5DN6D 1KI4A 2BC9A 2YINC 3IO5A 4NCIA 2WZQA 2FGKA 2WKPA 2J0UB 2F43B 2YC4C 4QRHA 1T3LA 4CYMA 5HE8A 2NPFA 1VYTA 1Z0FA 3O8BA 3U7EB 2VL7A 1LV7A 3B85A 3QPVA 1KI1A 4D0NA 4QXAA 1OXSC 1TADA 1GL9B 4G3XA 5EE0A 2XNDD 2ZU0C 1KSFX 2JEOA 4L5BA 2FSGA 2TMKA 5C2JB 4AG6A 4XSHA 3Q7PA 3B6EA 4KLZA 4Q00A 3W5JA 2JIZD 1XRJA 2V6JA 4F93B 4MDEA 2E87A 4TYYA 1CJVC 4R2HA 1RRGA 1LNZA 5AK0A 3W9YA 3OIVA 2VHTA 1YZUA 1IAQA 4CW7A 4TZ6A 4M1MA 1DVRA 1ZD9A 2IA5A 4UNPA 4D2IA 2VYFA 3A4NA 2NMVA 1ZM9A 3TW8B 1PLLA 1CIPA 4JBWA 1E9RA 3JZAA 3OFNA 5EE9A 4URVR 2H5EA 3AB3A 2HLDA 4Y0AA 5FBLB 3LO5A 3QPWA 1BO6A 5AR1A 2AN9A 5FOTA 4HLUC 3GEEA 4NKRA 3ZGXA 4LBWA 3I62A 1JNYA 2FEMA 1AM4D 4V0ME 4A1FA 1DARA 1JAHA 3VNUA 4QNRA 1EX6A 1BMFD 4ACAA 3THYB 1FP7A 1F6BA 1FQKA 1NBMA 2HLDD 2A5JA 4CGZA 1G6HA 2C77A 2IUSA 3AV0B 3SYNA 1CR1A 5B64A 2Z5FA 2JLSA 4O25A 1QHGA 1OYWA 3LBNA 1XCPA 4PPGA 4HLUA 4LWZA 4Q5IA 4TYNA 2KBFA 2G83A 1CR2A 2RGNC 3AQ4A 2IYLD 3GJ7A 821PA 2ZITA 4I1OA 4BPBA 3A1VA 4HB3A 4LSGA 4H1VA 1CJMA 2D4HA 3CRRA 1OF1A 3LVQE 5DISB 3TKLA 1G20E 4A4DA 3T15A 3WY9A 2XB2A 4DLTA 2R6DA 4JYBA 1VYUA 2YYZA 1XFAA 1D2EA 1KKMA 1UFQA 3KJIA 3KKNA 3GLIB 1Z07A 4BECA 2HT6A 3EG5A 1F5NA 4NYIR 3AF4A 5EZ6B 4UNNA 2IYXA 2GRJA 2OFXA 2J7PA 1ONBA 1SVKA 4HZIA 2IUUA 4DKXA 5LD2C 3AVPA 1OXUA 4ZCIA 2NO7A 2A5DA 2F1IA 4DDUA 1F3OA 3FE2A 1WA5A 2GF9A 4DJTA 3BK7A 3S1AB 2VP4A 2DFKB 2QUZA 1WCV1 2A5YB 4MYCA 2ZJZA 3X1XA 1FP6A 3QG1A 1KTVA 1QHXA 1YHNA 3AH8A 1ZCBA 1A7JA 3TVTA 4JZKA 3CPJB 3DEFA 3KL4A 4QHYA 4LBVA 1KO7A 2GJ9A 2W2VA 3C41J 1LS6A 4CEJB 5DHFA 1Z0KA 2F3TA 3NIBA 1YKSA 3VR1A 5KYKA 3QNUA 1P75A 2FPKA 2RGCA 2V1UA 3AKYA 4DXAA 3QKRB 5G53C 2NZJA 3VQTA 3O8CA 4LJ9A 1UKVY 2ZI5A 4Q7MB 3BE4A 3WRXC 1P9NA 3VAAA 5CITA 2ZQ5A 3U44B 1L4YA 4KV9A 3W8NA 1RPZA 1EXMA 2RB4A 4EJSC 3HU2A 1G8YA 5L3QA 4EKDA 3ZVNA 3MLEA 4TL7A 1R0XA 3RS4A 2R65A 1SXJB 1SZPA 2C9OA 2A5FA 1SVLA 3RAPR 3NEJA 1N6NA 4HB4A 1QBKC 2OAQ1 2JATA 3TK1A 3QG5A 4O2LA 3VKHA 2O8BB 5DNYB 3SEAA 1AGRA 1AQYA 1Q12A 1U98A 4Q9KA 3VKWA 2PBRA 4EFMA 1YZNA 1J90A 3EWAA 3FKQA 1M74A 1G41A 4L15A 1U8YA 1Z8FA 4OQMA 5C4GB 1EFCA 3F8TA 1G8PA 4LYAA 4C0HA 1E2IA 4DHEA 2VF7A 1SQ5A 4US0R 5FPKA 1F2UB 5FOXA 1ZD1A 3FB4A 1GITA 2J59A 1TEXA 1XTRA 2ZI3A 5DYIA 3AF3A 3TSOA 4P4SA 1DAEA 2ZRKA 4A0RA 3UIEA 3R7WB 4L4UA 5TY0A 1N5IA 2H92A 4PC3A 4YDSA 1Q0UA 4ASUD 1BKDR 4Q9IA 2XNSA 2G6BA 4L8GA 1E1RD 3PUVA 3TUZC 2FSFA 1ELOA 1WBBA 1KYIA 3HU3A 3OZXA 4PO8A 2ZE5A 2GZDA 1P2SA 2IL1A 5TVKA 1W36C 1G7RA 3T34A 1HV8A 3I92A 4G5QA 2O8FA 3KXLA 4LY6A 2NO6A 3C5HA 1VG9B 3Q8XB 2GAOA 5FTLA 3KTAA 3VR4A 2J0SA 1KJZA 2G1KA 1VG8A 1LTQA 4BLPA 1Z0AA 1T3HA 4LJ8A 3QXCA 2RGEA 2QQ0A 1UJ2A 5IK2D 1P2VA 3LD9A 4KBFA 5EUQB 4GPTA 4JBYA 3SBEA 2RGNA 1NY5A 2W6IA 1QVRA 2YWHA 3B78A 3OIWA 4K81B 2R62A 4PFSA 4TLCA 3D31A 4RD6A 4TMWA 1DG1G 4Q7LA 1P6XA 1GWNA 5CYOA 3VU9A 1COWD 2ZVQX 4CT4B 3EX7C 1SXJC 2JAQA 1ZNYA 5JHHB 4WW0A 3ZIAD 4PAMA 2FSHA 2QE7A 4ZPXA 1TTTA 3AVWA 4B2IA 4RCYA 2QNRA 2H18A 1IY0A 1A5TA 2QI9C 3T5DA 1UPTA 2VTKA 1HQYE 3AUYA 4HAWA 1FNMA 2Q0HA 4B3BA 3FMOB 5E95A 3QOFA 5GVSA 4G01B 3SI7A 3NBXX 1EFHA 3QQ5A 4JJKA 1WF3A 3OIUA 3DMDA 2FGJA 1CLUA 3TAUA 3D3QA 3W5IA 4A82A 1O3YA 3FKSD 4A92A 4BLOA 3RABA 1Q3HA 2VSFA 2GK7A 3K53A 4TLEA 4XWOA 1MT0A 1E9AA 2EW1A 4A15A 4ZCLA 2HV8A 4GT1A 4YQFA 1P7CA 2VP5A 1EWQA 4KVAA 4A8JA 4NCJA 1D2NA 1VCIA 2FZLA 2IYUA 2ZJ8A 3OAAD 3QF7A 4HAZA 2NQ2C 4TSFA 1DO2A 3U3RA 2KWIA 4RD3A 4Q9LA 3RRYA 4QBFA 4IKEA 3P32A 3U7FB 1U0HC 2VLIA 2GEDA 2GNOA 1BS1A 2HDNB 1TU4A 1WMSA 1QZXA 3BOSA 4AY2A 4BE7B 5DLQC 3KQLA 4Z1MA 2IYQA 2KBEA 4LV6A 4PTLA 5FR2A 1E1QA 1KMQA 3FPAA 3PUZA 2ZSEA 4LCBA 4DCUA 5J4HA 1HUQA 3VR3A 1G16A 3TAHA 3L0OA 1YVDA 3A4LA 1FTNA 1R8QA 3B1WA 3VHLB 3WBKA 4HAVA 4B75A 3A8TA 2IXFA 2CLDX 3FMFA 3MD0A 4WZ6A 3SYKA 1E1QD 1P60A 4CRWB 3IEVA 3E2IA 4KHZA 3PR1A 1H8ED 3AKCA 4GSYA 4UJ5A 4O0MA 2WIAA 1Z2CA 1WQ1R 5EXPA 1G4AE 1ZM2A 1T91A 5JRJA 1GM5A 1FZQA 2UKDA 3W6NA 2L0XA 2H7VA 2ZIAA 4RZXA 4BWYA 4MYUA 3THOA 2D7DA 1H8EA 4Q7KA 3X1DA 4WAUA 1DS6A 3BRWD 1MO5A 2ZRIA 2IF0A 1ZUNB 4QBIA 3I73A 3L0IB 5JI2E 1KOFA 2IEZA 4D4MA 4C7OA 1J8MF 4B32A 1K5DA 3TUIC 3LV8A 1HTWA 5D3MB 2ASEA 1G4UR 3E70C 3IUYA 2I4IA 2PMDA 2PT7A 3O8DA 4PHFA 1Z6YA 1EFUA 3OE7A 1A2KC 1X6VA 3PG5A 1DELA 4RFSB 1LS1A 3IIMA 3IIKA 1KO1A 3B82A 5GADl 2QSYA 3K0SA 3QBVA 4LPSA 3CRVA 1F48A 4ZKDA 5DN6A 4NCHA 4A36A 2WVJA 1WB9A 3C4JA 3C14C 4IVQA 4P4SB 1VMAA 1NY6A 1K8RA 3T1TA 4DCVA 3M4YA 3DOEA 4B6FA 4M1YA 1AQUA 1S9DA 4IOKA 3EWSA 4GI7A 2R8RA 1T0HB 5FUWA 3KQHA 1E2GA 3NKVA 1R0WA 1YZGA 3D7MA 5M04A 4C0SA 4PHTA 5JSZA 1RKBA
chains in the Genus database with same CATH superfamily
3EDCA 2CEKA 2WRMA 1HDYA 4LZAA 2PAAA 1M8JA 2FPIB 1F3FA 2WHQA 3Q8LA 4F3OA 2PX5A 4OQXA 2Y1OA 1M1NB 3WGJA 4PLCA 3FNBA 1OY8A 4MPJA 1P1BA 3KJQA 1QIGA 2IYTA 3NR2A 1BCRB 4AECA 2EV9A 1IR0A 4NG4A 4R8UB 2ZCVA 4IOBA 4EJSA 2A84A 5KX5B 2KL8A 4EH1A 3PHHA 5A5EA 4DQXA 1Q1ZA 2E4YA 4DBZA 3KK3B 2XVAA 1Z2OX 5AHWA 3D6TB 3PS9A 2B69A 1U7OA 2B8JA 1YOBA 3KUEA 3CCZA 3PHTA 2XW6A 3ZUGA 2ZM6J 2A5LA 1CZKA 4ZQCB 3ZO7A 2YV1A 3R3HA 1YRAA 1CZOA 1UPFA 3LF1A 3GA5A 1GNKA 2JHAA 4MUGA 4U9UA 3H2ZA 1Z5GA 3K16A 1KTQA 5TB5A 4WE1B 3AI7A 1Z4OA 1LPSA 4QRIA 1Z88A 1Q16B 2IVZA 2OC4A 5EQDA 3BH6A 4K9OA 3OXFA 3GILA 1MSWD 2H1SA 2PCLA 3X43A 3P9ZA 3SJZA 1XEZA 1R0BG 4HDKB 2XCUA 5CD4A 2DGQA 1XBTA 1D8TA 3PW0A 1PKXA 1DIRA 3NC1C 3UAVA 1BCRA 5IWAF 2A94A 4U7GA 1EQ0A 1VL8A 3C14A 2C2RA 1Y00A 4C7OB 3DZFA 4YUAA 1IZ8A 3DYBA 1BOOA 1O95C 4QX6A 3NAIA 4RH1A 3A9TA 3IV6A 4PRYA 3A9SA 5TJHA 3KX2A 3IJRA 2YJZA 2V2ZA 2YX4A 1M76A 5CH3A 1W5EA 1RYNA 4EHHA 2J6CA 3SCIE 4ZAFA 4D74A 1OB2A 5JIBA 1W1WA 5HS4A 1IAVA 4EARA 1RE0A 1J4AA 4EB6A 4YUZA 4MULA 1E0SA 4YH1A 4U02A 1R0YA 3QATA 3JSXA 3PUWA 4HDNA 5PGMA 4JT2A 1T6ZA 4MUBA 1DO0A 4RADA 5KNDH 1S2DA 3AFIA 4AT1B 3S29A 1QAQA 3O6VA 3HKCA 4BBZA 1RTIB 3K0CC 2JLXA 5ALLA 3ED5A 2AI2A 4WOPA 2W2TA 4XFJA 3D8SA 2WBMA 2AP6A 3KZXA 2M9KA 3OLZA 4KO1S 2HK7A 2ZIZA 1JDBB 1VJWA 1Y6QA 4DR6B 4PCLA 3UXYA 1ZGAA 4XVUA 5E2AA 2OFOA 2R8OA 3UMCA 3SHTA 4P2XA 3X3UA 3PZBA 4EPVA 3M8WA 2QUAA 3KJEA 4KQXA 1I1NA 3KOOA 1ADJA 1HA3A 3Q24A 3VGSA 4HGPA 5DLFA 4LNUB 1LLQA 3VAGA 4K5RA 3KQWA 4RLQA 3UHAA 4OLFA 3V6HA 1ONNA 5B12A 2DHRA 1K75A 1UTAA 2WSCC 5FI3A 4WCDA 2ID4A 5DYGA 2QSUA 4JJ6A 1RSZA 4HI0E 4D80A 2AG0A 1ZAKA 3LC7O 2Q1YA 1YSCA 2VRCD 2VQSA 1EM8B 2X1VA 1SXJA 5CXQA 2FZWA 1HL7A 2VSXA 3BWVA 1W581 3MQ2A 4NYJR 1TMKA 3PSAA 3RNOA 3B1VA 1BH6A 5KOYA 3C85A 1GYQA 2BFCA 3R3ZA 1DRZA 1KOOA 2CV2A 1D0IA 1Q8IA 2ZR9A 4Q1FA 5DZSA 2FCAA 3GCWA 3RHSA 1A5AB 2H51A 2WOMA 1LVUA 3BFKA 5DK6A 3OUZA 1WACA 3O8OA 2EJUA 2H7CA 2OMLA 5KSYA 4OQNA 3RSOA 4CKYA 1TKXB 3N5CA 3OR2A 3ANXA 2DETA 1V25A 2P78A 1C80A 4DCOB 3BRSA 1RKQA 1ZA2A 1J21A 6LDHA 3QXGA 5EP2A 2O3TA 2LZ0A 1TDJA 5IC4B 3H0CA 5C8YA 4O3FA 4RDXA 1F1BB 1GQFA 4HPWA 3FNNA 4JQYA 3N87A 1ESMA 3QTTA 3CCJS 3FYUB 5IMBA 2I8AA 2IIQA 3ZY3A 3B9BA 2Z09A 1Q84A 3EE3A 3K2YA 4FGZA 4GKJF 2BYTA 3I61A 3NP7A 4RQUA 2GEBA 3HO6A 4IV0A 3QLUC 4WY8A 4HTFB 2XNDA 1QG0A 1VE3A 4QICA 1SU8A 3RC3A 4WA7A 1SJQA 2GT1A 3DFUA 1KDTA 4D5GA 3MR7A 4M8NE 1X0FA 3NEYA 2LQ8A 2B1JA 1ZN2A 1BTOA 1VL1A 1T8SA 1P0MA 2RQMA 2NREA 4DLKA 1SIWA 2XA1A 4CLOA 3I39X 3A4MA 4AKGA 4UC0A 3QSYB 1V6CA 4QGSA 1ABEA 3BF7A 1NXPA 3R2CJ 4OQEA 4YY3F 3IWNC 2QL5B 4M9UA 4Y6LA 2C2KA 5HZHA 3UN1A 3IIEA 2PVCA 1TAGA 2QVLA 4D0RA 1G3IA 1TUBA 5BQOA 3EYAA 1IKXA 1SVWA 4X93A 3GJRA 2G1DA 2X13A 5LQDA 2GPTA 5KYWB 3QEMB 4W98A 2WE8A 5AM4A 3LPEA 3GEHA 1DJNA 1PEDA 4GI3A 2XIJA 4LRQA 3ZNOA 2XB8A 3PEVA 4X65B 1HNWB 1NR5A 1V5IA 3BILA 2LPMA 3JWIA 1E2PA 3MHYA 1PT7A 1ZIYA 1KNXA 2OZVA 1S1WB 3WLEA 2OUGA 1FLAA 3AHCA 5A6PA 5C5JA 3KWJA 1DC6A 2O06A 3BL6A 4OCZA 1YZFA 1K8QA 1ZCAA 3ZCPA 2GEKA 3QM1A 3EBOA 3LPLA 1KONA 1YACA 5FXMA 2ZDHA 2OQRA 1VECA 2IWRA 4D8UA 2OH2A 3VZIA 2QPAA 1ZI8A 3CDUA 2R4FA 2EBUA 2YIVX 5FBWB 1OWNA 1DFGA 4ND8A 4YP0A 5KPJA 1IBLJ 3G8DA 5P8WA 1A4UA 4K4YA 1HW8A 1S5ZA 3OZFA 5JD3A 3VBCA 4HZUB 4R1MA 1N5MA 5JT1A 1TO2E 5J43A 2KG1A 3QPCA 1FDSA 3HA7A 2OV8A 3DMJA 2HSZA 3KEMA 1RT4B 4IXTA 4DQQA 2PYZA 4LOKA 4ID5B 4G1QA 4FKBA 3LX6A 3IVMA 5F21A 1W44A 4TS1A 1N36B 2DXEA 2PRZA 1GG2A 2ZW9A 1RHKB 1WX1A 3R5BA 2HGMA 1K1EA 1H1DA 1W1UA 5F4ZA 3B5EA 3H6KA 2CZVC 3KQMA 5DO9A 5HMWA 3ACBA 3VX3A 1ZM7A 2DD8S 1JJ7A 2X4IA 3UY4A 1K1SA 2KW5A 5THKA 1UJ4A 3USES 4TWIA 3EIQA 1OT5A 4Q3KA 5EHHA 4OXQA 3KJXA 2E3JA 2C1XA 4GX0A 5CH7B 4OLOA 3O4JA 4CG2A 1PZHA 3KJNB 3KHTA 1T6XA 1IB0A 1LPPA 1JJVA 1GSHA 3WMGA 3BIXA 3GIRA 1S57A 3I0RB 3M6IA 3IHKA 5TGDA 2PZFA 4CBVA 3OF2A 2JFZA 3TOSA 3AFHA 4ZT5A 1NX6A 5EZYA 4MXDA 1PYOA 4JI1J 1CRQA 3GJXC 4DZRA 4FN5A 4GQBA 1FLVA 2BJEA 3DO6A 3HHEA 1THMA 1XMJA 3NG1A 1PG2A 3ZDRA 4AF7A 4RVGA 4EUKA 1RAEA 2F3UA 1IU9A 1ZWKA 2I1WA 2COEA 1R6DA 3D54D 4O33A 1NW7A 4WY2A 2PZJA 5JYDA 2Y05A 3L4BA 3NDJA 4ZYUA 1PSDA 1U26A 4I14A 2JZ5A 1KNZA 2VQFF 4JP3A 3LFUA 1Y5NB 3UN2A 1SFRA 3G2KA 1XZCA 2KTQA 3D4PA 3N8NA 5LDDC 1RHUA 3FG9A 2DHEA 2A1IA 4OLAA 1L2TA 4QIFA 1P5ZB 3ZWPA 1RT7B 2HWWA 3CBQA 1GSOA 3CLUC 2DRAA 3OZDA 3PFIA 1T05A 1O6BA 4Y2VA 2QI9F 3DG9A 2DSNA 1UC8A 1ADCA 2C4UA 3PQDA 1U9CA 2DH6A 4WFNQ 4D56A 5CFRA 4PV7A 1ZIXA 2M98A 3LTEA 5CM8B 4MVJM 2H08A 1QF7A 3I37X 5AYVA 1A50B 4OZ2A 1Q91A 1SHUX 1AMUA 1FMTA 3ND5A 4HCJA 1G21B 5HANA 3A8KA 1XMQF 2CFIA 5DEOA 4ID3A 3CZAA 3PIIA 2DVIA 2JKYA 4ETXA 3K92A 4TKUA 3AR9A 4MI3A 121PA 1H2FA 3CD5A 2NGRA 3IP9A 3ICPA 4BP1A 5HATA 2YV5A 3U37A 4JXKA 2H54B 3VOSA 4JLPA 1U48A 2PL1A 5FO0A 2GN8A 1JMVA 3IIJA 2MJLA 3SM3A 3ELHA 3VNQA 2ZI6A 4RJ2A 3B12A 3REQA 2F43A 5CA0F 3REOA 1HWYA 4A48A 1Y1RA 1M54A 3M7VA 3TUPA 4N01A 4P7JA 3T5BA 1R66A 3JYTB 3FNEA 3OX1A 4LK3A 1Y1TA 3ROQA 3TMKA 1ZD5A 1RQ2A 1DC4A 2E7ZA 4NJEB 4ZT6A 3G2OA 2GZSA 3PEEA 5EFZA 5KCMA 3V8BA 1XR7A 3KU1A 1BE4A 4LDAA 2JFQA 3RAXA 3EVAA 3COZA 4J9OA 1NJGA 5F2OA 3WGOA 4LHSA 4COKA 2VBZA 3D2BA 3JQBA 1TTPB 2SCUA 3TQFA 3GD5A 3AP2A 5IM0A 2EX0A 5A5GA 4FJ2A 3I8SA 4LV5B 4XM2A 1XXHE 4B81A 4OREX 3T6BA 3M49A 4YEAA 2OD4A 3IAEA 4F04A 4H3SA 3EFOA 1UXGA 2Z30B 4EUVA 4EDHA 3T38A 1QFJA 3HCOA 3EVFA 3EQ7A 1ZH6A 1XMOF 3BZUA 4LHWA 3I3OA 4L9WA 3NH9A 2BACA 3BULA 3K9NA 4L5JA 4JK3A 3RYTC 4YI5A 3RLFA 2APJA 3S01A 2I76A 4AS2A 5AJYA 4FNIA 1FP1D 5MGBA 1XF1A 4DCMA 5DASA 4MEJA 1FUEA 2OGSA 3JS9A 3N76A 4HLQB 2GN4A 4GG1A 2VIHA 1K06A 1NLMA 4H9GA 4KPUB 3ITHA 3IAM9 1Q7CA 4TSRA 1TA0A 1YQTA 2YKAA 3WHKA 3MMPA 1ZUD1 4KRXA 4MMXB 5KT6A 1TLLA 5ALEA 5E3HA 2CVZA 2ZAOA 2VG5B 5F3TA 2Z08A 2J9YB 4IO0A 5EJ8A 1X3LA 2D3TA 3PNKA 1ZM3A 3JQCA 1HBOB 1UZAA 2UYGA 3R8CA 1D1UA 2IYYA 1Q22A 1ORIA 1XEWY 1CP2A 4O2BF 4WXYB 2X3YA 2C20A 1GUAA 2QX9A 3CSUA 3FFIA 3R7NA 4BWVA 4HYQA 2JLZA 1M6VB 3VV2A 4EYKA 3ILOA 3ETHA 4AD6A 1S6PB 3Q7TA 2W2MP 2LW7A 3D4OA 4U63A 1HKAA 2FP3A 1NM2A 4XB2A 3DWEX 5G0SA 4MRVA 1HYEA 1RJJA 3G02A 2AUTA 2DECA 4FHEA 2DRIA 3OQOA 5CFMA 2RNEA 1W93A 1BE0A 4UHCA 3V8EA 5A06A 4MVJF 5CT4A 1G3UA 2CWXA 4PY2A 2ZZMA 4R2IA 4A23A 2A18A 2BGUA 3F4LA 2V54A 4ARVA 2PHZA 3OZRA 3WHLA 5IU6A 5C8DA 5C42A 4IIYA 3WRXA 1BQ4A 3GV7B 1KIMA 3DE5X 5LLSA 1T2AA 4NAHA 2XCSB 1BY9A 3U7GA 1RR6A 4P52A 2R8PA 4OI3A 3A31A 3DZDA 2N47A 4JI8J 5CW2A 5T3YA 2XOKA 2ZXUA 4F2RA 5FBKA 2LXUA 2O59A 2OKCA 4UUPA 1TMJA 2VZ0A 3AZPA 3O44A 4YV7A 4GKJB 5IYZA 5GV7A 3IT1A 4AP5A 4HC4A 1WU8A 1YJ7A 3MM9B 4X62J 2XAAA 4MRMA 3IC1A 1H3EA 4WK1A 4G8CA 3OESA 3C7DB 3STYA 1V3QE 3KZKA 1UEXC 1Q7YT 4RD1A 1VHWA 1GNRA 2RBGA 2HWIA 4CTJA 4QG3A 4BFWA 3NTXA 2WILA 1C1CB 3K70D 1JH9A 2RGBA 2WPDD 3S8EA 3RVKA 4JKOA 1S8NA 5IDYA 1DKNA 3KUHA 2FJXA 3BHIA 5BQXA 1XPRA 2QRHA 5HYVA 3ZWBA 2WAOA 3A4VA 1U3DA 3W9HA 1VA4A 3NT2A 1WUHS 4RR5A 5J2UF 1E1DA 2AOXA 3PVCA 3IA0A 4F5ZA 4BO2A 5K3EA 5A4MS 1LPMA 3QYFA 1YTLA 3R7BA 5JVDF 3DB1A 2FPPA 5IP5A 2N3OA 1L7AA 3ORSA 3RSQA 2A14A 1W25A 3NGUA 3H18A 4HQ6A 4MS3A 1C9KA 1ZI9A 3LQFA 1SKYE 3KB2A 4KV8B 3GEMA 2CDRA 4M7RA 3ZJVA 3PPXA 1M6VA 4PX3A 4A6XA 3N6LA 1LBEA 1LLDA 1FTCA 2JIDA 2ZREA 1XTPA 2RKIA 2PSFA 1ZUHA 1WO8A 4C5CA 3C6MA 3NTLA 1EIYB 1C14A 3QYYA 2VT2A 3MC1A 5G4KB 4O08A 3SR0A 3SEOA 5EHQA 1VYAA 1RT9A 2D5CA 3UB3A 3MFHA 3M8QA 1O0PA 3SU8A 3C43A 3FSRA 2DT5A 1UZLA 4PPFA 3PTAA 3B1FA 1XKQA 3DO8A 3U27A 5D84A 3WKBA 3I1YA 3M6VA 3IP7A 3O7WA 4FBGA 4WL0A 5M5BA 3SKXA 3PX4A 2VCYA 3V80A 2JLFA 3LGMA 4GX5A 2YN0A 3JD4A 3MGGA 1QAOA 4LQCA 4HLDA 4BDTA 4CEIA 2K7ZA 4V1CA 3QY9A 1CUGA 3BVPA 1RYRA 4EB3A 3N8KA 4X8HA 1CX9B 3BKFA 1O95D 1UQRA 2XHEA 1KWMA 3KAJA 1Y8ZA 1O77A 4CLOB 1YDEA 4K50A 3GYNA 1Z56C 5IH7A 1ACMA 2TECE 1SQSA 2RJNA 1Z8HA 1NA5A 1G8SA 2ZTLA 2XWSA 2Z9DA 5AW4A 4XTTA 3N2NA 3EGDB 3N6RA 3S7RA 2CUZA 1NHUA 4YTEA 1IEXA 1KYQA 5BSRA 2CPYA 4RPFA 3G9QA 1KSFX 6AT1B 3LA8A 3RSFA 3BE5A 3NU1A 5EX3A 4KO0B 1SV5A 4D45A 1WW2A 3LXUX 1QM5A 1KZ6A 3R76A 4Q3NA 2WJWA 3A4NA 3EF0A 4FFVA 5DDQC 3EQZA 5EE9A 4W9RA 3Q7RA 4I1YA 1SCJA 4R3WA 2BRKA 2WVEA 5KJFA 5AVOA 3PJDA 2HSJA 3GBVA 1MXHA 3IAHA 2P77A 3K3PA 1DIBA 2JEZA 4LWZA 4O4HF 5JFTA 1CJUB 7REQB 2YJ4A 4N5IX 1CJMA 3DNCA 3HXTA 2GJFA 2AEEA 1AKUA 3KJIA 4X85A 4A8HA 3AF4A 5LXRA 5EZ6B 1T7PA 5LD2C 3AVPA 1YI1A 4DDUA 2NV6A 2RSQA 3L40A 3DJFA 4I8IA 3FXAA 4I55B 5KQLA 3AEQA 4KMOA 2HG4A 4QHYA 4LBVA 3J80Y 3L1KA 4KO0A 2ZBVA 3ETOA 1P75A 1I36A 4K26A 1C0EA 4D98A 4DXAA 1H6KX 4PYLA 4ZTZB 3U44B 4U4AA 1HDZA 3F8WA 1FWPA 1OROA 2IH5A 2CMGA 5L3QA 3DCNA 1TM3E 2DPLA 2EDAA 1JSXA 2XB9A 2IY7A 1IN0A 3Q2KA 2FTKE 2JKVA 1BFDA 2V8PA 3L93A 1RWKA 1M74A 5F7ZA 2ZBDA 3QWPA 1XC9A 1XYYA 4UD2A 1P7VA 1BRTA 4Q2LA 2DNRA 1TEXA 1IM6A 2YXDA 4IIFA 1KZ4A 4EO6A 1E5VA 4LNAA 2Q2OA 1ILEA 4JSRA 1EJ6A 1K7YA 3SMVA 4PKDB 3G0OA 1ZHFA 1WI6A 3TN7A 2FZEA 3LWZA 3T0GA 3LQYA 4DRYA 2HPUA 1Z0AA 4ZC8A 2II6A 4C8YA 1UA0A 3MRVA 4GPTA 3M8PB 2YWHA 5D5PA 4HEA9 3U4GA 2NVUA 2C2EA 3MCOA 5JVDA 1NK6A 2IEIA 3DCYA 4GR4A 3KAQA 1C1BA 1ZRMA 4B0OA 3TOZA 1JEQB 3DFFA 1LW2A 1MROB 3OIUA 1YR1A 4FE7A 4NBLA 2BKXA 4TVSA 2EW1A 1JFLA 4A15A 1ID1A 4B9UA 1IBMF 2Q6BA 4Q5VA 4TSFA 1IEQA 2KWIA 3OO0A 4BNYA 3IAM1 4U5QA 2OP0A 1H6BA 3PWZA 4G36A 3U7FB 3LQKA 1I7DA 1VRQC 3IDAA 2GR9A 5E41A 5ETMA 1E1QA 3VR3A 3FCYA 1REQA 3B1WA 3A8TA 1A8PA 2IXFA 4RA6A 3UA3A 5H9EK 2JFKA 2GO7A 1RMTA 4KH1B 5F4BA 4RVDA 2NZWA 5ITWA 2F4VJ 1G4AE 1FZQA 1VE5A 4J7CA 2X0NA 4X4RA 4HTJA 1N57A 1VDHA 1IBCB 4NI5A 3A4IA 1HE5A 2X0JA 2ASEA 1G4UR 4E5KA 1NW4A 3BGUA 4AG3A 2I4IA 2PMDA 3D3WA 3TCXB 3KEQA 3VAHA 2FZVA 4F3TA 1SBNE 2PJDA 4PWZA 1HNIB 4ZPCA 2QLWA 2C4MA 1WB9A 3C4JA 3C14C 3FCSB 4B3OA 5I9TA 1PWEA 1NY6A 4ZVPB 1SCAA 1V5IB 5EWMA 4C0SA 1MROA 4Q39A 4PQYA 4J7AA 4DXLA 4WNAA 3VKVA 3QX7A 4MP6A 5H70A 1ZVJA 2DO4A 2GJKA 4BMVA 3EPRA 3BN4A 1WC0A 5K0EA 4ZCPA 1JHQA 1URNA 4JIMA 3VOAA 3V81B 4ZAXA 4MGIR 1FRXA 5L3QB 4E5VA 4CF3A 2L9NA 1E5DA 2BFDB 4KMRA 2BFWA 4YMGA 4IV8A 1SVOA 2WZBA 4BB6A 3T1HB 3Q0EA 1J8YF 2XEXA 3J7TA 3BGRB 3DFKA 2FHJD 4XEUA 2JA2A 4UZBA 1RAOA 4JV1A 4PZDA 3D68A 1AROP 2CRLA 3KG1A 1PEAA 4I50A 3KZMA 4K6MA 3VZCA 3BCUA 1UINA 2WFAA 3RGIA 1ST3A 5GONB 3ET5A 2RK3A 4R3UC 3K1AA 2QYTA 2NW6A 2OSRA 2Y9PB 4FYJA 5HL7Q 3KS9A 5FTJA 3PFWO 3PKMA 1O51A 1R0AA 1C7ZA 3R5GA 1A27A 4HQKA 2J5XA 1LBQA 3KQVA 3NGRA 4NH4A 4A9AA 1LNQA 4ATNA 4QPJC 3WV4A 3F56A 1K0UA 3KC2A 1Y63A 4G9BA 3PEHA 1DQAA 2HFUA 3LUCA 1H05A 4CDRA 3EMVA 4KCGA 3CSKA 1BAPA 1OXBB 4WKGA 1CLFA 13PKA 5C3MA 2WYWA 1JTFA 2G1HA 4O4IB 3HN2A 4ZA1A 4RANA 2L19A 4J0HA 4DYVA 1S10A 3V4PB 4ZMMA 4S04A 1M0SA 1J24A 1JDBC 4MA4A 4ED7A 2VJBA 4KXXA 4N7TA 4CUZA 4OYWA 1AG9A 2WINI 1DPFA 3GSIA 3ZDDA 4IKAA 4D6YA 1QMGA 1W8DA 3PUJA 2HCTA 3CONA 5JPIA 2AD9A 3UGJA 4FR5A 2FNAA 2MLZA 3UCUP 4CT9A 1V5FA 2OHDA 1TMMA 4US1R 4M6WA 1T5IA 1HT0A 5B08A 2DP4E 4AYBD 5J1NA 4YCBA 4ESHA 3DGPA 4IDEA 3DV9A 4CYUB 3Q8RB 2R3SA 3OA2A 1GXSB 5BMOA 1SXJE 2KT3A 3I4PA 1F7UA 1ZX1A 3Q6MA 5DHPA 3G9TA 3E7XA 3U3OA 1O4VA 3ESAA 3A3PA 2QLTA 3LPYA 4N5MA 5DBGA 2VNHA 1LPNA 1H65A 1JXMA 2FPWA 3I6PA 3ZFVA 3ZWQA 4M89A 2A57A 2OMOA 1MWZA 1NKVA 4LIWA 1W6RA 2GNAA 4AKTA 3NGKA 3C8ZA 3RYFA 2EFCB 5TX7A 3MJVA 4YFVA 5K3OA 3MM7B 1T9ZA 1JUDA 3QEBZ 3ORYA 1M34B 4DSFA 1RYFA 3QVXA 2JFXA 2RE8A 4PWUA 1UVJA 3IR6B 1C7FA 3H1FA 2VHVA 3AHDA 1QDLB 5KYNA 1TJNA 2N3LA 1PE0A 4L72A 5CURA 5TT1A 2C9DA 2IEBA 4RJKA 4V19X 2XUJA 4O02B 2IUYA 3Q3GE 2B99A 1FXSA 2NUHA 1O6CA 5HLFA 3SFGA 3GV0A 3CW2C 4R6WA 1I5OB 3GJ3A 1OLSB 4G8BA 4X41A 1IJEA 5DOVA 2XZTA 1YWXA 2NSCA 2XQJA 3SC3A 1L5WA 1MWQA 1J0EA 3PTWA 2PTGA 4BB0A 3M6UA 4M0MA 4OB7A 4LY3A 4J75A 4BU0A 2C9MA 3OT9A 1P1FA 1SRQA 3PYFA 2D7SA 2XYHB 5CVUA 4V3BA 2EEZA 3WLOA 3MR6A 3VH3A 2JIPA 1GNSA 4NEGA 3PD0A 5CDYA 1RKIA 4NMLA 3TIGA 3NNSA 1RRMA 2REOA 4YFYA 1U6FA 2A10A 5AW3A 4Q3DA 2HVHA 1OX5A 2YN2A 4F4XA 4RK0A 3M2VA 3TZBA 3P8BB 4CKEA 3PI6A 2HGNA 1WC1A 4EVSA 1WABA 2X1GA 3AL0C 3FFXA 4Q4HA 3TM5A 3HB0A 3K4PA 4WU3A 3PXXA 2ZPUA 4NZ7A 3HCNA 4FS8A 3CA8A 2W0SA 2GESA 2HNYB 1PDVA 2XCIA 4F9GA 3STWA 1E2KA 4GC9A 3HDYA 4WPGA 1SUEA 3SYZA 2AGQA 5KQPA 4OXIA 4D42A 2ZE7A 1VL6A 2DR7A 4BMXA 1ODTC 1BHNA 4IVPA 1KY2A 3G6YA 4OYAA 1L7NA 4RJIA 2I2FA 2WYUA 2GAFA 2Q3LA 1ONSA 2V6IA 2AGOA 4JEIA 1WTCA 4U7UK 1QGOA 3CMQA 4OJ3A 3SFTA 2GWRA 3RRGA 4OB8A 1W88A 3QO9B 5B1SA 4M9XA 1W4CA 4XGIA 1NUQA 2QV6A 3D2LA 3W78A 2F1JA 1KC3A 4BN4A 2ZRCA 3K5IA 4KRFA 2FDRA 3OD5A 2JFNA 2XDWA 3MEGA 3FPBA 4CT8A 4IQGA 3UK1A 3HBMA 1ZOOA 4P71A 5CNMA 3HBLA 2WJYA 1MENA 5BNIA 1XX6A 1C8LA 3B1KA 2G4VA 5C8YB 1VQ8S 2GKOA 2OFWA 2V6MA 3F3KA 3IEPA 3GLIE 3BBPA 1H9AA 2OR3A 3QE2A 2MR5A 4LHZA 4TV9A 1TKTA 3HUDA 4JBGA 5JAUA 1PJ7A 4ZC1A 4BNDB 2LMIA 4PR3A 1AKYA 3R44A 5AVXA 3DPUA 3DE3X 3LHFA 2ODEA 1NUTA 2UZ0A 3HT3A 5HP4A 4X6LA 3OAAA 3IHTA 1ISRA 3TSWA 2FSUA 1T9GR 4PO9A 2BELA 3SYMA 5JS1A 4E2FA 4KGXB 1J2EA 2OZLB 3G6ES 1X5SA 4YO7A 3RSHA 1A8IA 3ZV6A 1JR2A 5ALRA 1JHXA 4GM0A 3D6VA 3IODA 4HV4A 3C1UA 3FJ1A 1T5DX 1T15A 2ADMA 2CDBA 5J1TB 4NV0A 3KYIB 3MF5A 2DNYA 4QVKA 1E2QA 4DREA 2FLKA 5F77A 2OECA 2EWHA 5B36A 3LMKA 5MGNA 3K17A 1EUQA 4KNVA 1FXDA 1G20A 2L08A 3UPFA 4B82A 3PJRA 4GMGA 2XA2A 1A2OA 1A5BB 1OV4A 2C97A 2GXSA 2YX1A 2WFMA 1DX9A 1UA1A 1E69A 4MUYA 3FETA 4BFUA 1JAYA 3UD3P 4YDQA 1HURA 4TYWA 1IN4A 1P81A 4MDYA 2GC8A 3VJLA 4I6YA 2FYTA 2Q8NA 3N2KA 3A6HA 4URQU 2LQJA 4X64B 3PW4A 3KBOA 1UEJA 1K5PA 1RI3A 4HAXA 5HOQA 1FZTA 3LK6A 4QULA 4Q37A 3WAJA 3SFVA 3DD5A 3N4WA 3BMCA 2CPIA 3QRPA 1QE3A 3J7YU 2Q1XA 1A6LA 1NHKL 1WPRA 3HVTB 1R8CA 2PUVA 3CHYA 2FN8A 5A6VA 1C1CA 3WQPA 4TQAA 1JHYA 5KFFA 2NUPA 3FI9A 4J37A 3ABZA 4OHKA 4X7PA 4CR6A 2CN1A 4DIFA 4KSEB 3WK7A 1GL3A 2LV8A 4D0LB 5BMVF 4MWEA 1M83A 2EI5A 3WB0A 1LJLA 5ICSA 5J1SB 2ISSD 5FWYA 2XTAA 3L4KA 3WXMA 2DWPA 2P9EA 2K2QB 1R50A 1U7TA 3ZIUA 3N7AA 3LP1A 1NXVA 2QN9A 2F8TA 1WUUA 4EEYA 2XQIA 4JX8A 5EJGA 2J9DA 5FOQA 4Y30A 4OD0A 5MN4A 5T41A 1FNNA 1EHYA 4HSGA 3JTMA 2VH5R 3U0VA 3TZ6A 4GLOA 5EP1A 3PQCA 2VO1A 3ANYB 1O1YA 1VQ1A 5TS3A 4DV4B 1YONA 5DIFA 5WRFA 2H1RA 3HY6A 5L9AA 2Y1CA 4BY9E 2F1RA 4IFIA 4A8OA 3BWXA 1QU3A 4OHUA 2ET6A 3BBLA 2OEPA 4DV5J 2P7IA 1D2RA 3BSAA 3LO3A 2I3BA 2Q4RA 4ARZB 2V58A 4FMDF 3UFXB 1U80A 2NUBA 4XUCA 1Z6GA 4NZ6A 1T03A 4M1WA 4ZO8A 2HM7A 2R7NA 1ZSYA 2RONA 4JIGA 2OT3B 1AGPA 2NNWB 1CFJA 1JBKA 3PVZA 1PR2A 3EVNA 4JV0A 1FVSA 3PHEA 2B4VA 2UUCB 3NKFA 3S70A 2B9EA 1RT3A 3EDOA 2UUCJ 3E01A 4YJ3B 1BQEA 3CE9A 5EPOA 2O48X 2W2LD 4EJSB 2IEDA 3IKVA 2M8DB 4FQ8A 4MUMA 3IV9A 1AQJA 4KVZA 3A1DA 2D69A 2QTHA 4NWBA 1QRAA 3EA0A 3PKJA 3M2RA 2BTEA 2X2OA 5AJWA 3HYSA 3HGMA 2PBFA 4PS0A 1FDRA 4C5AA 3L43A 1ULSA 3JQQA 3V6JA 1XK7A 4K5QA 3H9JA 4BMOB 3WXBA 3K5NA 3H1TA 3K6SB 4JJAA 2E1PA 3LPDA 4CMIA 3HDTA 1RHUB 2RG7A 2IEGA 2IPNA 1N56A 1DQSA 4UEQA 1FDAA 4V03A 4U8GA 3IYLW 1UMBA 3GLQA 5IZHA 4MYHA 2JLRA 3H19A 2LKZA 4HB0A 1V26A 1ZJ5A 4IH7A 2JI8A 1T6BY 1XKXA 4UPDA 1PFYA 4TS3A 5BXIA 3UBMA 3EGVA 3LWLA 2JD2A 5FQOA 3QIPB 1ORHA 5EE1A 4RZHA 4BMPB 3MAQA 3WWEA 2QLJB 5D78A 5F33A 2NADA 2VYVD 4X1IB 1EFVB 2K1RA 4BKQA 4BKMA 1UM8A 3TD2A 2POQX 1M33A 2GIQA 3GGSA 5KYWA 3EYZA 5CM9C 3TLCA 5JMTA 1BRMA 4DAOA 3PGKA 1TMYA 4W5HA 3C6TA 1O94D 1M6NA 1F4PA 3LBYA 2H2GA 3MIIA 3SLKA 2QC3A 1W7AA 1PR0A 1B2RA 1C4WA 4LGVA 1Q17A 2ZZTA 1ZNQO 4FMCF 1PT6A 2DFTA 5F51A 4PG6A 3H1GA 1AUDA 1D3AA 1EQAA 3TLGB 1ZCFA 2Z8ZA 3DO5A 2BKVA 3H5RA 3KSUA 4ES2A 4RTLA 5CDFE 1JHMA 4GO7X 1OJ4A 3B54A 2IS1A 2GZ2A 2RDDA 3UQZA 2XKKA 2Q3DA 2WTFA 3DAHA 3DRXA 4L4SA 5LJ3Y 2GCOB 3SIXA 1ZYQA 4NZZA 4ARSA 3NBFA 3T1YB 1J9ZA 4K9QA 1WHTB 4KO8A 2IZ6A 5JE8A 1UOQA 1W30A 3MSXA 1Y89A 2EZ9A 1I6KA 4HMQA 3ML1A 2P6SA 1IWBB 3RW9A 1GRRA 1C1XB 5DLGA 1N5YB 3GJTA 3BDVA 2A2ZA 4HDSA 3LCRA 1Z13A 1MEEA 1UQTA 4EKEA 4XCQA 1RI5A 1DAKA 3TO5A 2PZBA 2FFJA 2ZIWB 5KTQA 5DBIA 5GY7A 1Z82A 1PR3A 2JEGA 4QAJA 3DZBA 1SUIA 2QU8A 1U0TA 2CBGA 4DDTA 3O4VA 4NPCA 3WK4A 1CT9A 4ZPDA 2TS1A 3UHFA 1NGSA 1Y3HA 3FQLA 3UW1A 4BNIA 4IDFA 1W0JD 2IMOA 5EYPA 5BUZA 1J27A 3RCBA 3UDCA 3MM4A 1OZHA 5B7PA 2VHUA 1TKBA 5J1EB 1YB2A 1OC4A 1TL7C 3HKEA 4MITA 4DLXA 4W92B 3JAKA 1X4CA 2I6GA 2IRUA 3BM5A 4JODA 3R27A 3ZHYA 3ICVA 5HG0A 2QGZA 2HIQA 2UXBJ 3NP5A 1ZGHA 4D9JA 1MN7A 1T29A 1DMRA 4ZGGA 1GTEA 1GH8A 1WXDA 1N3BA 2O1PA 1AS0A 1A7GE 3TJZA 4MKYA 3FGZA 2B3TA 4O2BA 5EVJA 1U09A 1TF7A 2VRNA 1MXFA 3PIDA 1KFDA 4RSHA 4NS4A 2HAEA 3G1TA 1F9AA 2W7PA 3NIGB 3JSRA 3CXCR 1DPGA 3VPXA 1VHIA 1CY2A 2YJGA 3UUWA 2HUNA 1DEXA 5DGIA 4QODA 3CX8A 3OCUA 4HSEA 2JZCA 4YV2A 4TLQA 3UENA 4MIBA 2XBUA 5A9SA 3WLPA 1EK6A 4H59A 4QVIA 1TK0A 4AVYA 3E23A 4TL8A 2ZUGA 2CNWD 4B0PA 1Z83A 1YVFA 3QQCD 1XHLA 1RM5A 2MYPA 4NFYA 4QYMA 5IX8A 2O67A 4A8KA 4MR9A 3NGDA 4H7EA 4DSTA 5FAKA 1YBHA 2EW8A 3R3WA 4X6YA 2OVBA 5DVZA 3IP6A 3QBDA 3KNAA 1XNGA 4LXXA 3EZ9A 4WNAB 4JASB 1FKOB 3VR4D 2O8VA 3AF6A 4CNZA 2JHEA 4F92B 2R1TA 4QUAA 1LWFB 3ZZNA 3ESQA 4W90B 1EXNA 4U2DA 4IUFA 3L7JA 2V0NA 4PYNA 2RGDA 4OLJA 1KETA 3GRUA 1F0XA 1YE8A 4V0SA 3A3OB 4QWWA 3CM0A 4OMFG 1IG3A 2PWYA 3ZZRA 3WP0A 2B8TA 3WZ0A 3UJ8A 2B9WA 1Y3DE 2CJFA 4B87A 5KZMB 3H0KA 3E1SA 3CNQP 3PWTA 3SP1A 3ZHTA 5DG7A 2XGJA 1SIOA 5LXTB 3HO8A 3P49B 3LG2A 4HR2A 2WUVA 3R4VA 4CL0A 3D4JA 2WUGA 3CGIA 5CIYA 1TPZA 4ZVQB 1WL8A 1XQ9A 2L9WA 3GN2A 4ECZA 2XO6A 1I2DA 3GTYX 3BN3A 3NCPA 4DR2B 3WR5A 3OUYB 3C70A 1N25A 2ZUEA 1IN8A 3PU6A 2W4CA 1V8BA 2D0PB 5ALGA 3SJCA 2FZ5A 2HQFA 1WSWA 2XLBA 1SC9A 4QASA 3D8RA 4QDZA 4QTYA 1E32A 1JZTA 4M1SA 2ASJA 3LAMA 5BN4B 2RKBA 3U39A 4ABYA 3FNRA 5TC4A 4XSGA 4MICA 2EFJA 4CCAA 1E5LA 2XCPA 1Y8RA 4TTRA 1PBTA 3R3UA 3AQIA 3OL7A 3RC1A 1IBMJ 4G0NA 2QLBB 3IXQA 1HQKA 1SJRA 5DN6D 1QUVA 3P2OA 3SX4A 2DOKA 1M73E 3WWDA 3K94A 5L40A 2JJYA 2VL7A 1KI1A 3D1LA 1HOXA 1Q8KA 3HY4A 5KOHB 5LXTA 5C0OE 2AFRA 4F3CA 4DBLE 3HSGA 1QO0A 2C5HA 1EETA 1OWXA 4YT2A 4D2IA 1V1MA 3TW8B 3QOXA 3UB4A 3F2IA 5KJEA 1HMVB 2ZLBA 4IRKA 3SF0A 1AXEA 2JFPA 3NIFB 2YPYA 1BMFD 4ACAA 1XWFA 1WC3A 1LI5A 1NFRA 4RWEA 3LRXA 16PKA 3S0JA 1NF2A 1ZOIA 5C1PA 2RGNC 3LHSA 821PA 3HYLA 4BPBA 1R4ZA 2D4HA 3E7WA 1H2ZA 2YIDA 2FLPA 3AUSA 1XFAA 1P39A 1USWA 3I12A 1UAWA 1XAJA 2YRWA 2IYXA 1KVIA 1RADB 4DKXA 2A5DA 3ZWOA 3KWMA 3LDFA 4IJ6A 1WCV1 3IB3A 4ZU1X 1IIBA