3D6YA

Crystal structure of r275e mutant of bmrr bound to dna and berberine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 80
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6yA03
5GQQA 3Q1MA 3E0HA 3G9RA 3Q5RA 2BOWA 5KAUA 5I44A 1JYHA 1Q09A 2J5UA 1D5YA 1JBGA 5KATA 2ZHGA 2GOVA 5KAXA 4AYZA 3R8JA 1Q0AA 4R4MA 5KAWA 2HVAA 2JMLA 5I41B 3Q5SA 2OQQA 4R4LA 3LURA 5D8CA 3QAOA 4B0YA 3UCSA 1R8DA 4R22B 3GP4A 2DG6A 4WLWA 1R8EA 1EXIA 3D6YA 3D71A 1Q05A 4A1MA 5D90A 3Q5PA 5E01A 3Q3DA 1Q08A 4R24B 4AYZB 3D6ZA 3D70A 1Q06A 3GK6A 3Q2YA 3B49A 3IAOA 2ZHHA 2KCUA 4R4EA 4J2NA 3HH0A 3GPVA 1EXJA 1DIPA 5KAVA 4WLSA 2VZ4A 5KCBA 3R8KA 1Q07A 1BOWA 3T97B
chains in the Genus database with same CATH superfamily
3HE5B 4ZKPA 3FXEA 4LC1A 1YTZI 1T6AA 2GOVA 1HH0A 1NTMD 1UIIA 2WPSA 1GL2C 3V2PA 1RF0C 2O1JA 4H44D 1GW3A 1ZRTD 1SQVE 1FC2C 4M3LA 1LTJB 5KAXA 1N7SC 1M90Q 2FYUJ 1T2KC 2DG6A 1JY3O 2PFXA 3CXHH 1KFMA 1OX3A 3W67A 3L71J 1HVVA 1JMBA 2GUSA 1BCCG 3L75J 2IDBA 1LTTC 2I1KA 1NU1E 4PV1D 1H8AA 1N86A 3CWBD 3M0DA 1JCCA 1URQA 1SQQK 3QWOC 1N7LA 2WPQA 4YXWH 5AVQB 1LWUC 5CHXA 1KB9I 3H1IE 3CCLP 3CXHE 3TGUD 3ZDMA 1UIXA 1BCCJ 2G3AA 2QJYC 5BU5A 3LIEA 1SQBE 1PV3A 3GLMA 2ZVNB 2R32A 1OVRA 2IX7C 3AE4C 3G3ZA 3JCUE 3RK3C 3CCVP 4WLWA 1PIXA 2E75D 2AEFA 3ABVC 3LIDA 5KKZB 3AEBC 3GG2A 1URQC 5KAIE 4ASVA 2ZXEB 2QVAA 3L70J 5L8RJ 2XU6A 3CLQA 1KYOH 3QAOA 1S4XA 4EI2A 1NKNA 4L73A 4OGQD 1NKZB 2Q1KA 4N78E 3PJSK 4JPZB 3N4XA 4RESB 1FZCB 1LTBC 1HGVA 2GUVA 1EDIA 1XTCC 1FS0E 2AXCA 5AVRB 1L4AB 3S4RA 5KLIC 3SWYA 3OA7A 4C7RA 2H43A 2FBWC 2K9YA 2HODA 1S5LH 1AV1A 2R5DA 2E75B 2RKLA 4ZNCA 2A45H 4C7NB 2K9JB 3L36A 3B5ND 3HTKB 1NGMB 2P1JA 2AXTE 1RE3C 3H1JJ 1LX8A 1EDJA 1H89A 2LKMA 3CC7P 3K5BA 3MGNA 1VQ5P 5KAWA 1ZRTE 3CCQP 5BU8B 3EZ6A 2RN0A 1Q08A 1IFMA 1NTKD 5APSA 4BXLA 2FYZA 2GM4A 1EXJA 1JO5A 1IFIA 1Q09A 2Y0EA 1HJBA 5APXA 1VF5D 2HVAA 1BE3D 3WU2E 3L73J 4A1MA 3H1JE 2P67A 1MV8A 2E74C 4L75A 4IFDK 2OYIA 1HWTC 1S9KE 1J1EC 2W8ZA 1Q81Q 1YJWP 3RK3D 3S9OA 3E1RA 4RJTA 2PRRA 2P2UA 2IYOA 3H1HD 1L4AA 3H1HJ 1WRGA 1PGQA 3VMAA 2KLVA 2KZJA 1KILC 2ZJSE 2ZT9B 4KJMA 3CCJP 1LT1A 2B87A 1EZVE 2ZFCA 2OYHB 2WPRA 3HRNA 1SQPD 1X9VA 1NAFA 4R4EA 2XV5A 4Z1MH 4OH8B 3RK2B 1L0LE 2JJLA 2RH0A 2ZYGA 1EZVG 3SFDC 5GTIH 2K3RA 1Z56A 3B5NA 3L70G 1LTJC 2FYUE 1PP9E 1Q06A 1NTMK 3FX0A 1K73Q 2N1TB 3WUTA 2HYNA 1YQ4C 4I7ZC 5H2FH 2M0BA 1LP1B 2O01H 2I1JA 3S1KA 3U1AA 1DEEG 1RE4C 1GDTA 2BASA 3M06A 4D6TE 3IF4A 3EQ2A 1KQSO 3TYYA 5TJHA 3AE8C 1M1JA 2C0XA 3GHGB 2XNDH 1PZQA 1M1JC 4U3FG 1OZHA 2A06G 3CCEP 4R24B 1N8RQ 2ZHHA 1NTKJ 3CWBG 4GKGA 3CPWO 1VL2A 2V7QH 4H0LC 2FXPA 2M3BA 3KHUA 4H0LD 2AEMA 1T8ZA 2R5BA 1H88A 3A0HH 2NPSB 1S9KD 1KV4A 1YJ9P 3B4SA 5APQA 1Q90D 1IZNB 5H2FE 2KSJA 1T3UA 2WT7B 4C46A 5KLVD 1CW5A 2KZIA 3AEDC 2LXCB 5AW4B 2YNYA 4WY4C 1KTMA 1L0LD 2D2CD 5AW2B 5KLIB 1MZ9A 4JYCA 2YMKA 4DOJA 3VP9A 1X22A 5AW0B 1HBWA 3R8JA 4BRYA 2J58A 4HH2A 1BSNA 4WVZA 2WVRA 2OYOA 3CXHD 4NPEA 4GOFA 4IFMA 1NU1D 3GK6A 2E75C 1MKMA 4KHXA 1QVFO 3JCUH 2WWWA 3A2AA 2BEZF 2Q3EA 5CCGA 5AVSB 2UWJE 4HB1A 5GTHH 2JWAA 1BGYD 1GTWA 1D7MA 3V6IA 5KJ7C 1A02F 2QM7A 2Q7CA 2OGUA 4WLSA 1KFNA 3BASA 4AUWA 1E79H 1SQQD 2JDIH 1SVFA 1GU5A 3A0BE 1NU1J 3HE5A 5APUA 3CI9A 2FFDB 3BCCE 4PD4D 1NTZK 1LT9A 1P84I 2WZ7A 3HH0A 3H1IJ 3L75G 4YTPC 4D6TG 1IK7A 3CL3D 1NTKK 2NRGA 2YIUB 1QL1A 3PTZA 3H6PA 4A7PA 1VQNP 3UIAA 2BEQD 1J1DC 4UB8H 1VF5C 3AECC 1FOSE 2K88A 2E76C 1KC8Q 3MZWB 2CPBA 1HTLC 1U7MA 5CMZA 1RY3A 2W27A 3MTUE 4D6TJ 3L72D 2JMLA 1PPJG 4EIJA 3D71A 1L0LG 2IFMA 2BCCD 1W5CE 3B49A 1QVGO 3H1KD 2O1KA 2V4HA 5CBNA 1SP4A 2JKVA 4H44B 3TF5A 5GQQA 2IBZG 1S1CX 1IO4A 1QL2A 2IEFA 4XFJA 3VMXA 1KQGB 3TNUB 4AYZB 2ZYDA 2QJPC 3VOPA 1BE3G 4IL6E 2DW3A 2OTLP 3PHLA 1P84H 1IK9A 1VDFA 1N2DC 3CXHI 5E79E 3A7OA 1GK6A 2IFNA 5KLVE 2BCCG 1BSHA 2P10A 1AA0A 1VQ6P 1CZQA 4EDFA 1RE4A 3G4SP 3L71D 3O6QB 2KOGA 2FFDA 1BGYG 2QRXA 1USDA 3G6EP 5KAIH 2XDJA 3L74D 4OVNF 5AVYB 3CX5I 2W6AA 1SQBK 1NTME 1GU4A 2Y9ZA 1LTGC 1W2EA 4H13D 2HLOA 2BCCJ 2MJZA 4L74A 1Q2NA 1FZCA 2JR8A 3HD7D 2M3EA 2I8DA 3T97B 1YITP 3R2PA 2FKWB 2YKPA 1N73B 3I55P 2E74D 4PD4E 3EWKA 3ITKA 1FZGA 2HODB 1WMKA 2KNCA 4OGQB 1PL5A 1DIPA 2QSIA 1BDDA 4YPCA 4PV1B 2NPSC 4EYYQ 3P7KA 2OYIC 2K9JA 2C9LY 5AVZB 1Y9BA 2M5AB 3E7KA 2YXRB 1AVOA 4U3FD 3BRVB 3AEFC 1FJKA 2P58A 2IZ1A 4AQRD 3RBZA 3CCUP 1X79B 1KILE 4IL6X 5KJ7A 3EZFA 4BWNA 3A0HE 2K1AA 2R3SA 1KQLA 1NWQA 1OW6A 1AQTA 1PFIA 3M0DC 2WSFH 1SFCA 2B9BA 2JWDA 5DJTB 2POHA 1EZVD 3KZIE 1M1KQ 3VN0A 3L35A 1ZR4A 3WUVA 1N7SA 1K9MQ 2NPSD 3L75D 5AW9B 1J2JB 1KMIZ 2AXTH 2PP6A 2FYNC 3BATA 1ZP0C 5I44A 3HUSC 2WSCH 1OFCX 2Z4EA 5AVVB 1JMMA 2H88C 2QIWA 3I5CA 2KK7A 3Q3DA 2IZ0A 1R5LA 1NVOA 1SQBJ 1QLED 4MN4C 2HG5D 4J2NA 4ZMDA 3GPVA 1L0NJ 3NXSA 3EFFK 1SQQJ 2FFDC 1LT9B 3AE5C 1FDIA 3LW5J 1G2CA 1FJPA 1SQQE 2YIUC 3AE7C 5APWA 1NU1G 2CK3H 1RF1A 1S2EA 1BCCE 3H1LD 1NU1K 3M91A 4JBZA 1JM0A 3L70D 1H0TA 5CCHA 1KYOE 1A02J 4DCZA 1NTMJ 2B87B 2QA4P 2P7JA 1PGJA 1SQVG 2OYHA 4PJ0H 1DX7A 3CCRP 1ZW0A 2H8PD 1BGYE 3IFMA 3CWBJ 5KLVK 3L74J 3FWLA 1VQ8P 1JYHA 1PGPA 2PGDA 1RF0A 1NH4A 5KLVG 1RQUA 5KAFE 1YI2P 1S3JA 1SQXJ 1LWUB 3F89A 1JOCA 3VP8A 1FU1A 1YQ3C 5B66H 1SS1A 3GW6A 1AFOA 1EDLA 3Q5RA 1NTZD 1Y6UA 2NZ2A 1SQXE 3RK3B 1NYHA 3EZ7A 3QH9A 1EXIA 1LTAC 4HKZH 2VRSA 3D70A 1VQLP 2IBZE 3M9HA 2QJKB 2ZXXA 1DEBA 2KLUA 2IPPA 2WSFJ 5CCGD 2W6BA 4UB6E 1W2BO 2A06D 3TSIA 2Q6QA 2NPSA 4Y28J 1PPJE 1VQ9P 3A5TA 2KXPB 4N3YB 1IFNA 3A0BH 4WWIA 3VYIA 1T2KD 2ZT9D 3L37A 3MD0A 3I56P 4IFFA 2IBZD 4JF7A 1SQQG 4GT1A 2KSEA 5TISE 4XE5B 2HPCA 1L4AC 4WY4D 3WU2H 5AW6B 1SQXD 1NTZE 3KXDA 1K04A 4ASWA 1LJ2A 3FGAD 3TGUE 5KAUA 4IL6H 4OGQC 3AE2C 3EZ9A 1JY2N 5I41B 2WT7A 5CJ4A 3L73D 1FZFA 3RGUA 2ZVOB 1VPCA 2M5AA 4W7YA 3NTNA 1KYOD 3H1LJ 2N9BA 2WQYC 3HE4A 1OMIA 4TLFA 3AEGC 4H13C 3UCSA 1N7SB 3B8EB 2N1TA 1URQD 2QM8A 3L73E 2E5TA 1KB9E 1SFCC 1OVUA 3WMM0 3IR9A 2KI7B 3AE3C 1SLQA 1GL2D 2GA1A 3H32A 3JC22 5AW3B 1M56D 2OQQA 4I1LA 2E74B 2W90A 1Q05A 2PAJA 1G1JA 4I6MC 1SQPE 3IAOA 2YKOA 1RH6A 3H1KE 3H1HE 1JNMA 2QJYB 3JSVC 3CX5H 1N7SD 4TT3H 2OTJP 2Q9IA 4EOTA 3M0AA 1YJNP 3L74E 1LGHB 2FYUK 1ZV8A 1JTHA 1H0TB 3G9RA 3AEEC 1VQMP 5KTBA 3C1LA 3L72G 1VQOP 1L0LK 4R4LA 1R8DA 1DH3A 3C9IA 1LT9C 2H89C 3RL0D 3VTPC 3U1CA 1G2CB 2KCUA 1KILD 4YXDC 3BCCJ 3BCCD 4I2LC 1DD3A 2WMMA 1NTKE 4DZOA 1FOSF 3CWBE 2ITAA 2BOWA 5KATA 1FZCC 3TNUA 4AYZA 1OVVA 4U3FE 3CD6P 1RE3A 4R22B 2O3JA 2W83C 5TISH 1SQPJ 1BDCA 3PRJA 1K8AQ 4BRYB 1Y8AA 2BCCE 3O8ZA 1YIJP 1S72P 1L0NK 1YTZT 3VMZA 1NO4A 3Q2YA 2M8RA 4GOEA 2WPVB 1JUNA 5CCGC 1HJ0A 3GHGC 1OXZA 1NHLA 2FYUG 4WBAA 1M1JB 3L70E 5KLVJ 1WT6A 3H1LE 1JEKA 3RL0C 1VQKP 1IFDA 1GMJA 1X8YA 4RKUJ 4N78D 1KQFB 1YHQP 5B66E 1KZUB 1FE6A 5M1BA 5AW8B 3USSA 1EDKA 1NOHA 5APYA 3R4YA 3H1LG 3GMAA 1KILA 2WTYA 2IBZI 3CCSP 1QX8A 1NAYA 2E5YA 3SSUA 1FZBA 1GL2A 2N9YB 1JY2P 3AE1C 2JP3A 3CC4P 2WSCJ 2R44A 2WSSH 3L72J 5K5GB 3V4WA 5KJ7D 3B71A 1JTHB 2WSEJ 4DJGA 4WY4B 3KQGA 1FZEA 2LR2A 3L75E 1TU3F 1GZLA 3H1ID 1S5LE 4IOIH 3BCCG 3VMYA 2Y9YA 5EFWB 3HE4B 5KAFH 1PGOA 1GW4A 3H1JG 4Y99C 1JCDA 1SFCD 1BE3J 4K35A 1GK4A 4JQ0D 2D2CB 2OYHC 2R3CA 3NMDA 3M9QA 4NPDA 1KB9D 1QGKB 2H7HA 1NTKG 2B88A 3RK2D 2SPZA 3L71G 1GD2E 3RK2C 3II6A 4GDOA 1XTGB 2KYVA 3MUDC 1ZXGA 3D6YA 3B5NC 3L72E 1PM6A 1SQVD 4H13B 3MUDA 2N1TC 4I7ZB 4PD4I 2IYPA 3L74G 3BVHA 2KP8A 1Q7YQ 2YMYA 3KZIH 5BVZA 2ZHGA 1SFCB 5AVUB 4L76A 3FWNA 2WSEH 3O6QA 3GF3A 5AVXB 1IFPA 1KYOI 1LNQA 1AJYA 5GTHE 4W7ZA 3AEAC 1HF9A 3H1KG 5AW7B 4QMAA 1SQPG 3V2QA 3HUSA 2YKQA 1YBKA 1J1DB 1DD4A 1VF5B 2E76B 2MKVA 3CX5D 4AYCA 1Q82Q 5C39A 3SFEC 3WUUA 2KVVA 3T97A 2QE7H 2LXBA 1N73A 4KT0J 4H0LB 1Q0AA 3L4FA 4R4MA 1FDOA 3AE9C 4GIFA 5B5EH 2KNCB 3L71E 1FAVA 1KN7A 2A45G 1M57D 1RF1B 2K37A 3H1JD 2FXMA 4WB4A 2A06E 4ZKUA 4WY4A 1OW8A 1LWUA 4PD4H 1LTSC 1FDMA 1IFJA 3EZ2A 3HD7B 2ZYAA 1HGZA 2JEEA 1CSBA 5B5EE 1CI6B 1BOWA 3FXDA 1NTZG 4JYBA 3IN6A 2Q5UA 1KORA 4LLHA 1S5LX 3P32A 1M7LA 2C9NY 2B89A 2FXOA 2KS1A 5KAVA 2Y0CA 2XZRA 2CPSA 1PP9G 4RO0A 1ZMEC 4PJ0E 5CBOA 1ZN5A 5APVA 1ZLLA 1BGYJ 3CMEP 3CX5E 1R8EA 1L4AD 3OAKA 2J59M 3D6ZA 1SQVJ 3H1KJ 2HFED 1X0TA 3RL0B 2HPCB 1L0ND 3CMAP 1MUUA 4DT0A 1P84D 1NJIQ 1N73C 1PP9J 3U59A 2ZAEB 1IJDB 2HR3A 5CCHC 3W68A 3MIWA 4B86A 2KUBA 3OW2O 3M9BA 1SQXG 3BRTB 3P8CD 3GF7A 1U57A 2OYIB 4W80A 1GL2B 2J5UA 2L5GB 4D6TD 1MFTA 1PPJD 3PH0A 1EZVI 1P84E 1L0NE 1R5SA 2FYUD 2YXQB 3Q5PA 1Y47A 3SWKA 3RBXA 3MHVA 1OIPA 4UB8E 3E0HA 1PP9D 2C0WA 1USEA 1HUCA 2OARA 1JY2O 1L2PA 3NFQA 5D90A 5DJUB 4Y99B 4GODA 3V2RA 1EQ7A 3TDKA 2L91A 2YO3A 3TGUJ 1EC5A 2OTKE 2D2CC 4H44C 4K3AA 2KIKA 1NTZJ 1JBGA 1IC2A 3PP5A 2QEXP 1AQ5A 3GP4A 1CI6A 3P8MC 4NPFX 2Z5HA 2Y0DA 4O9BA 3B5NB 2Q3IA 3E1IA 3R8KA 2QJPB 5GTIE 1LTIC 3HUSB 3GHGA 2XNXA 1D5YA 4XA4A 1JY3N 5KKZC 1KD1Q 1URQB 4B0YA 1RHZB 1LP1A 3H32B 5E01A 2XKMA 3H25A 2W6JH 3H1HG 3MP7B 3N7NA 3RK3E 2O01N 4DCKA 3C8VA 1JY3P 1E5WA 4LGDE 1SQVK 1RQVA 1SQXK 2YO2A 4HYTB 3LURA 3AE6C 3CC2P 3TK1A 1K05A 4HJGH 1ZOYC 3P8CE 1L0LJ 3SWFA 1AVYA 2Z5IA 3L73G 3V4QA 5CJ0A 4UB6H 2WITA 3KDPB 3HD7A 1LTJA 1M8OB 3LW5H 1JB0J 3CCMP 1Q07A 1T3JA 2OG0A 4PV1C 1KB9H 4CPGA 2QG4A 1RF1C 2O01J 3KYQA 3HTKA 5CCHD 3V5BA 1SQBG 5E79H 2KS1B 4OWFA 5AW5B 3TGUG 3H1IG 3PLNA 2RMZA 2G8YA 1BCCD 1FBMA 3HD7C 3Q1MA 5AW1B 3RL0g 1G1IA 4LHFA 1SQPK 3Q5SA 5D8CA 1VQ7P 1U7JA 1VQPP 1VQ4P 2QJKC 2E42A 4C7NA 2FY8A 5AVTB 5KCBA 1FZAA 5AVWB 1OW7A 3F5HA 1RH5B 2E76D 1ZR2A 1NTMG 3G71P 1J1EB 4U7JA 2N1TD 1Q86Q 1YYCA 5APTA 2V7QJ 2FYNB 3V2NA 3EFGA 4N6JA 1L0NG 1QEXA 2JO1A 1KILB 2ZT9C 1SQBD 3KPEA 4U3FJ 1MFZA 1OWAA 3OJAB 2AEJA 2E43A 2VZ4A 1BE3E 2KB7P 3A3YB 2A45I
chains in the Genus database with same CATH topology
2WQYC 2OG0A 2YMKA 2D2CC 2JP3A 1ZP0C 4H44C 3Q5RA 1OMIA 1ZMEC 2BOWA 1Y6UA 5I44A 2NZ2A 1Q09A 4PV1C 1JBGA 2WSCJ 5KATA 5L8RJ 2GOVA 4AYZA 3AEGC 2O01J 3R8JA 1VF5D 1NYHA 4H13C 2HVAA 2JMLA 2H88C 3EZ7A 3QAOA 3UCSA 2E74D 3GP4A 4R22B 1EXIA 1R8EA 1DD4A 2QIWA 3B71A 1VF5B 3D71A 4A1MA 2WSEJ 3Q3DA 2E76B 3EWKA 2MKVA 1TU3F 3D6ZA 3D70A 3GK6A 2E74C 2E75C 1MKMA 1WMKA 3B49A 4OGQD 4OGQB 3SFEC 4J2NA 1PL5A 2KVVA 3GPVA 1DIPA 3R8KA 3AE8C 2QSIA 4H44B 4H44D 2G8YA 2WSFJ 3AE3C 5GQQA 4PV1B 3Q1MA 1S1CX 2BEZF 3RL0g 1D5YA 4LHFA 4KT0J 3AE5C 4H0LB 1FDIA 3S9OA 5KAXA 2IEFA 5KKZC 1Q0AA 4R4MA 4Y28J 3LW5J 3Q5SA 2OQQA 1FDOA 1Y9BA 4B0YA 5D8CA 4XFJA 3AE9C 2DG6A 5KLIC 2E74B 1Q05A 1KQGB 2YIUC 5E01A 4AYZB 4R24B 3RK3E 3AE7C 3H25A 2D2CB 2QJKC 3Q2YA 3IAOA 2ZHHA 2FBWC 3C8VA 2K9YA 2QJPC 2WPVB 2IDBA 1RH6A 3GF7A 3AEFC 2ZT9D 4WLSA 1VL2A 5KCBA 1U57A 4PV1D 1HJ0A 2ZT9B 4H0LC 1RQVA 4GDOA 2J5UA 4DCZA 1OW7A 1OW8A 1KILE 2FXPA 2E75B 4H0LD 4IL6X 3EZFA 2E76D 3LURA 3D6YA 3AE6C 3EZ2A 2P10A 3Q5PA 1K05A 1PM6A 4TT3H 4U7JA 1GMJA 1ZOYC 3T97B 4RKUJ 1NGMB 1KQFB 1K04A 1OW6A 4H13B 4R4EA 4Z1MH 3HH0A 3FGAD 1Q90D 5M1BA 1BOWA 1UIXA 4YTPC 1IK7A 2G3AA 2V7QJ 4I7ZB 3E0HA 1LX8A 2QJYC 3G9RA 3AEEC 5KAUA 1JYHA 4OGQC 1PV3A 3IN6A 3R4YA 3GLMA 2ZHGA 3AE2C 3EZ9A 5KAWA 1KORA 3SFDC 1ZRTE 1S5LX 5I41B 1RQUA 3AE4C 3GMAA 4R4LA 1R8DA 2JO1A 4WLWA 1PIXA 3EZ6A 3AEDC 2BEQD 5D90A 2E75D 2H89C 3O6QA 1Q08A 3GF3A 2ZT9C 3ABVC 1VF5C 1Q06A 3AECC 4H13D 1AJYA 2E76C 1YQ3C 3AEBC 1KTMA 2KCUA 4YXDC 1JB0J 2D2CD 1EXJA 3AEAC 1YQ4C 1DD3A 4I7ZC 5KAVA 2VZ4A 1HF9A 1KMIZ 1Q07A 2FYNC 3AE1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQQ A;  3Q1M A;  3E0H A;  3G9R A;  3Q5R A;  2BOW A;  5KAU A;  5I44 A;  1JYH A;  1Q09 A;  2J5U A;  1D5Y A;  1JBG A;  5KAT A;  2ZHG A;  2GOV A;  5KAX A;  4AYZ A;  3R8J A;  1Q0A A;  4R4M A;  5KAW A;  2HVA A;  2JML A;  5I41 B;  3Q5S A;  2OQQ A;  4R4L A;  3LUR A;  5D8C A;  3QAO A;  4B0Y A;  3UCS A;  1R8D A;  4R22 B;  3GP4 A;  2DG6 A;  4WLW A;  1R8E A;  1EXI A;  3D6Y A;  3D71 A;  1Q05 A;  4A1M A;  5D90 A;  3Q5P A;  5E01 A;  3Q3D A;  1Q08 A;  4R24 B;  4AYZ B;  3D6Z A;  3D70 A;  1Q06 A;  3GK6 A;  3Q2Y A;  3B49 A;  3IAO A;  2ZHH A;  2KCU A;  4R4E A;  4J2N A;  3HH0 A;  3GPV A;  1EXJ A;  1DIP A;  5KAV A;  4WLS A;  2VZ4 A;  5KCB A;  3R8K A;  1Q07 A;  1BOW A;  3T97 B; 
#chains in the Genus database with same CATH topology
 3HE5 B;  4ZKP A;  3FXE A;  4LC1 A;  1YTZ I;  1T6A A;  2GOV A;  1HH0 A;  1NTM D;  1UII A;  2WPS A;  1GL2 C;  3V2P A;  1RF0 C;  2O1J A;  4H44 D;  1GW3 A;  1ZRT D;  1SQV E;  1FC2 C;  4M3L A;  1LTJ B;  5KAX A;  1N7S C;  1M90 Q;  2FYU J;  1T2K C;  2DG6 A;  1JY3 O;  2PFX A;  3CXH H;  1KFM A;  1OX3 A;  3W67 A;  3L71 J;  1HVV A;  1JMB A;  2GUS A;  1BCC G;  3L75 J;  2IDB A;  1LTT C;  2I1K A;  1NU1 E;  4PV1 D;  1H8A A;  1N86 A;  3CWB D;  3M0D A;  1JCC A;  1URQ A;  1SQQ K;  3QWO C;  1N7L A;  2WPQ A;  4YXW H;  5AVQ B;  1LWU C;  5CHX A;  1KB9 I;  3H1I E;  3CCL P;  3CXH E;  3TGU D;  3ZDM A;  1UIX A;  1BCC J;  2G3A A;  2QJY C;  5BU5 A;  3LIE A;  1SQB E;  1PV3 A;  3GLM A;  2ZVN B;  2R32 A;  1OVR A;  2IX7 C;  3AE4 C;  3G3Z A;  3JCU E;  3RK3 C;  3CCV P;  4WLW A;  1PIX A;  2E75 D;  2AEF A;  3ABV C;  3LID A;  5KKZ B;  3AEB C;  3GG2 A;  1URQ C;  5KAI E;  4ASV A;  2ZXE B;  2QVA A;  3L70 J;  5L8R J;  2XU6 A;  3CLQ A;  1KYO H;  3QAO A;  1S4X A;  4EI2 A;  1NKN A;  4L73 A;  4OGQ D;  1NKZ B;  2Q1K A;  4N78 E;  3PJS K;  4JPZ B;  3N4X A;  4RES B;  1FZC B;  1LTB C;  1HGV A;  2GUV A;  1EDI A;  1XTC C;  1FS0 E;  2AXC A;  5AVR B;  1L4A B;  3S4R A;  5KLI C;  3SWY A;  3OA7 A;  4C7R A;  2H43 A;  2FBW C;  2K9Y A;  2HOD A;  1S5L H;  1AV1 A;  2R5D A;  2E75 B;  2RKL A;  4ZNC A;  2A45 H;  4C7N B;  2K9J B;  3L36 A;  3B5N D;  3HTK B;  1NGM B;  2P1J A;  2AXT E;  1RE3 C;  3H1J J;  1LX8 A;  1EDJ A;  1H89 A;  2LKM A;  3CC7 P;  3K5B A;  3MGN A;  1VQ5 P;  5KAW A;  1ZRT E;  3CCQ P;  5BU8 B;  3EZ6 A;  2RN0 A;  1Q08 A;  1IFM A;  1NTK D;  5APS A;  4BXL A;  2FYZ A;  2GM4 A;  1EXJ A;  1JO5 A;  1IFI A;  1Q09 A;  2Y0E A;  1HJB A;  5APX A;  1VF5 D;  2HVA A;  1BE3 D;  3WU2 E;  3L73 J;  4A1M A;  3H1J E;  2P67 A;  1MV8 A;  2E74 C;  4L75 A;  4IFD K;  2OYI A;  1HWT C;  1S9K E;  1J1E C;  2W8Z A;  1Q81 Q;  1YJW P;  3RK3 D;  3S9O A;  3E1R A;  4RJT A;  2PRR A;  2P2U A;  2IYO A;  3H1H D;  1L4A A;  3H1H J;  1WRG A;  1PGQ A;  3VMA A;  2KLV A;  2KZJ A;  1KIL C;  2ZJS E;  2ZT9 B;  4KJM A;  3CCJ P;  1LT1 A;  2B87 A;  1EZV E;  2ZFC A;  2OYH B;  2WPR A;  3HRN A;  1SQP D;  1X9V A;  1NAF A;  4R4E A;  2XV5 A;  4Z1M H;  4OH8 B;  3RK2 B;  1L0L E;  2JJL A;  2RH0 A;  2ZYG A;  1EZV G;  3SFD C;  5GTI H;  2K3R A;  1Z56 A;  3B5N A;  3L70 G;  1LTJ C;  2FYU E;  1PP9 E;  1Q06 A;  1NTM K;  3FX0 A;  1K73 Q;  2N1T B;  3WUT A;  2HYN A;  1YQ4 C;  4I7Z C;  5H2F H;  2M0B A;  1LP1 B;  2O01 H;  2I1J A;  3S1K A;  3U1A A;  1DEE G;  1RE4 C;  1GDT A;  2BAS A;  3M06 A;  4D6T E;  3IF4 A;  3EQ2 A;  1KQS O;  3TYY A;  5TJH A;  3AE8 C;  1M1J A;  2C0X A;  3GHG B;  2XND H;  1PZQ A;  1M1J C;  4U3F G;  1OZH A;  2A06 G;  3CCE P;  4R24 B;  1N8R Q;  2ZHH A;  1NTK J;  3CWB G;  4GKG A;  3CPW O;  1VL2 A;  2V7Q H;  4H0L C;  2FXP A;  2M3B A;  3KHU A;  4H0L D;  2AEM A;  1T8Z A;  2R5B A;  1H88 A;  3A0H H;  2NPS B;  1S9K D;  1KV4 A;  1YJ9 P;  3B4S A;  5APQ A;  1Q90 D;  1IZN B;  5H2F E;  2KSJ A;  1T3U A;  2WT7 B;  4C46 A;  5KLV D;  1CW5 A;  2KZI A;  3AED C;  2LXC B;  5AW4 B;  2YNY A;  4WY4 C;  1KTM A;  1L0L D;  2D2C D;  5AW2 B;  5KLI B;  1MZ9 A;  4JYC A;  2YMK A;  4DOJ A;  3VP9 A;  1X22 A;  5AW0 B;  1HBW A;  3R8J A;  4BRY A;  2J58 A;  4HH2 A;  1BSN A;  4WVZ A;  2WVR A;  2OYO A;  3CXH D;  4NPE A;  4GOF A;  4IFM A;  1NU1 D;  3GK6 A;  2E75 C;  1MKM A;  4KHX A;  1QVF O;  3JCU H;  2WWW A;  3A2A A;  2BEZ F;  2Q3E A;  5CCG A;  5AVS B;  2UWJ E;  4HB1 A;  5GTH H;  2JWA A;  1BGY D;  1GTW A;  1D7M A;  3V6I A;  5KJ7 C;  1A02 F;  2QM7 A;  2Q7C A;  2OGU A;  4WLS A;  1KFN A;  3BAS A;  4AUW A;  1E79 H;  1SQQ D;  2JDI H;  1SVF A;  1GU5 A;  3A0B E;  1NU1 J;  3HE5 A;  5APU A;  3CI9 A;  2FFD B;  3BCC E;  4PD4 D;  1NTZ K;  1LT9 A;  1P84 I;  2WZ7 A;  3HH0 A;  3H1I J;  3L75 G;  4YTP C;  4D6T G;  1IK7 A;  3CL3 D;  1NTK K;  2NRG A;  2YIU B;  1QL1 A;  3PTZ A;  3H6P A;  4A7P A;  1VQN P;  3UIA A;  2BEQ D;  1J1D C;  4UB8 H;  1VF5 C;  3AEC C;  1FOS E;  2K88 A;  2E76 C;  1KC8 Q;  3MZW B;  2CPB A;  1HTL C;  1U7M A;  5CMZ A;  1RY3 A;  2W27 A;  3MTU E;  4D6T J;  3L72 D;  2JML A;  1PPJ G;  4EIJ A;  3D71 A;  1L0L G;  2IFM A;  2BCC D;  1W5C E;  3B49 A;  1QVG O;  3H1K D;  2O1K A;  2V4H A;  5CBN A;  1SP4 A;  2JKV A;  4H44 B;  3TF5 A;  5GQQ A;  2IBZ G;  1S1C X;  1IO4 A;  1QL2 A;  2IEF A;  4XFJ A;  3VMX A;  1KQG B;  3TNU B;  4AYZ B;  2ZYD A;  2QJP C;  3VOP A;  1BE3 G;  4IL6 E;  2DW3 A;  2OTL P;  3PHL A;  1P84 H;  1IK9 A;  1VDF A;  1N2D C;  3CXH I;  5E79 E;  3A7O A;  1GK6 A;  2IFN A;  5KLV E;  2BCC G;  1BSH A;  2P10 A;  1AA0 A;  1VQ6 P;  1CZQ A;  4EDF A;  1RE4 A;  3G4S P;  3L71 D;  3O6Q B;  2KOG A;  2FFD A;  1BGY G;  2QRX A;  1USD A;  3G6E P;  5KAI H;  2XDJ A;  3L74 D;  4OVN F;  5AVY B;  3CX5 I;  2W6A A;  1SQB K;  1NTM E;  1GU4 A;  2Y9Z A;  1LTG C;  1W2E A;  4H13 D;  2HLO A;  2BCC J;  2MJZ A;  4L74 A;  1Q2N A;  1FZC A;  2JR8 A;  3HD7 D;  2M3E A;  2I8D A;  3T97 B;  1YIT P;  3R2P A;  2FKW B;  2YKP A;  1N73 B;  3I55 P;  2E74 D;  4PD4 E;  3EWK A;  3ITK A;  1FZG A;  2HOD B;  1WMK A;  2KNC A;  4OGQ B;  1PL5 A;  1DIP A;  2QSI A;  1BDD A;  4YPC A;  4PV1 B;  2NPS C;  4EYY Q;  3P7K A;  2OYI C;  2K9J A;  2C9L Y;  5AVZ B;  1Y9B A;  2M5A B;  3E7K A;  2YXR B;  1AVO A;  4U3F D;  3BRV B;  3AEF C;  1FJK A;  2P58 A;  2IZ1 A;  4AQR D;  3RBZ A;  3CCU P;  1X79 B;  1KIL E;  4IL6 X;  5KJ7 A;  3EZF A;  4BWN A;  3A0H E;  2K1A A;  2R3S A;  1KQL A;  1NWQ A;  1OW6 A;  1AQT A;  1PFI A;  3M0D C;  2WSF H;  1SFC A;  2B9B A;  2JWD A;  5DJT B;  2POH A;  1EZV D;  3KZI E;  1M1K Q;  3VN0 A;  3L35 A;  1ZR4 A;  3WUV A;  1N7S A;  1K9M Q;  2NPS D;  3L75 D;  5AW9 B;  1J2J B;  1KMI Z;  2AXT H;  2PP6 A;  2FYN C;  3BAT A;  1ZP0 C;  5I44 A;  3HUS C;  2WSC H;  1OFC X;  2Z4E A;  5AVV B;  1JMM A;  2H88 C;  2QIW A;  3I5C A;  2KK7 A;  3Q3D A;  2IZ0 A;  1R5L A;  1NVO A;  1SQB J;  1QLE D;  4MN4 C;  2HG5 D;  4J2N A;  4ZMD A;  3GPV A;  1L0N J;  3NXS A;  3EFF K;  1SQQ J;  2FFD C;  1LT9 B;  3AE5 C;  1FDI A;  3LW5 J;  1G2C A;  1FJP A;  1SQQ E;  2YIU C;  3AE7 C;  5APW A;  1NU1 G;  2CK3 H;  1RF1 A;  1S2E A;  1BCC E;  3H1L D;  1NU1 K;  3M91 A;  4JBZ A;  1JM0 A;  3L70 D;  1H0T A;  5CCH A;  1KYO E;  1A02 J;  4DCZ A;  1NTM J;  2B87 B;  2QA4 P;  2P7J A;  1PGJ A;  1SQV G;  2OYH A;  4PJ0 H;  1DX7 A;  3CCR P;  1ZW0 A;  2H8P D;  1BGY E;  3IFM A;  3CWB J;  5KLV K;  3L74 J;  3FWL A;  1VQ8 P;  1JYH A;  1PGP A;  2PGD A;  1RF0 A;  1NH4 A;  5KLV G;  1RQU A;  5KAF E;  1YI2 P;  1S3J A;  1SQX J;  1LWU B;  3F89 A;  1JOC A;  3VP8 A;  1FU1 A;  1YQ3 C;  5B66 H;  1SS1 A;  3GW6 A;  1AFO A;  1EDL A;  3Q5R A;  1NTZ D;  1Y6U A;  2NZ2 A;  1SQX E;  3RK3 B;  1NYH A;  3EZ7 A;  3QH9 A;  1EXI A;  1LTA C;  4HKZ H;  2VRS A;  3D70 A;  1VQL P;  2IBZ E;  3M9H A;  2QJK B;  2ZXX A;  1DEB A;  2KLU A;  2IPP A;  2WSF J;  5CCG D;  2W6B A;  4UB6 E;  1W2B O;  2A06 D;  3TSI A;  2Q6Q A;  2NPS A;  4Y28 J;  1PPJ E;  1VQ9 P;  3A5T A;  2KXP B;  4N3Y B;  1IFN A;  3A0B H;  4WWI A;  3VYI A;  1T2K D;  2ZT9 D;  3L37 A;  3MD0 A;  3I56 P;  4IFF A;  2IBZ D;  4JF7 A;  1SQQ G;  4GT1 A;  2KSE A;  5TIS E;  4XE5 B;  2HPC A;  1L4A C;  4WY4 D;  3WU2 H;  5AW6 B;  1SQX D;  1NTZ E;  3KXD A;  1K04 A;  4ASW A;  1LJ2 A;  3FGA D;  3TGU E;  5KAU A;  4IL6 H;  4OGQ C;  3AE2 C;  3EZ9 A;  1JY2 N;  5I41 B;  2WT7 A;  5CJ4 A;  3L73 D;  1FZF A;  3RGU A;  2ZVO B;  1VPC A;  2M5A A;  4W7Y A;  3NTN A;  1KYO D;  3H1L J;  2N9B A;  2WQY C;  3HE4 A;  1OMI A;  4TLF A;  3AEG C;  4H13 C;  3UCS A;  1N7S B;  3B8E B;  2N1T A;  1URQ D;  2QM8 A;  3L73 E;  2E5T A;  1KB9 E;  1SFC C;  1OVU A;  3WMM 0;  3IR9 A;  2KI7 B;  3AE3 C;  1SLQ A;  1GL2 D;  2GA1 A;  3H32 A;  3JC2 2;  5AW3 B;  1M56 D;  2OQQ A;  4I1L A;  2E74 B;  2W90 A;  1Q05 A;  2PAJ A;  1G1J A;  4I6M C;  1SQP E;  3IAO A;  2YKO A;  1RH6 A;  3H1K E;  3H1H E;  1JNM A;  2QJY B;  3JSV C;  3CX5 H;  1N7S D;  4TT3 H;  2OTJ P;  2Q9I A;  4EOT A;  3M0A A;  1YJN P;  3L74 E;  1LGH B;  2FYU K;  1ZV8 A;  1JTH A;  1H0T B;  3G9R A;  3AEE C;  1VQM P;  5KTB A;  3C1L A;  3L72 G;  1VQO P;  1L0L K;  4R4L A;  1R8D A;  1DH3 A;  3C9I A;  1LT9 C;  2H89 C;  3RL0 D;  3VTP C;  3U1C A;  1G2C B;  2KCU A;  1KIL D;  4YXD C;  3BCC J;  3BCC D;  4I2L C;  1DD3 A;  2WMM A;  1NTK E;  4DZO A;  1FOS F;  3CWB E;  2ITA A;  2BOW A;  5KAT A;  1FZC C;  3TNU A;  4AYZ A;  1OVV A;  4U3F E;  3CD6 P;  1RE3 A;  4R22 B;  2O3J A;  2W83 C;  5TIS H;  1SQP J;  1BDC A;  3PRJ A;  1K8A Q;  4BRY B;  1Y8A A;  2BCC E;  3O8Z A;  1YIJ P;  1S72 P;  1L0N K;  1YTZ T;  3VMZ A;  1NO4 A;  3Q2Y A;  2M8R A;  4GOE A;  2WPV B;  1JUN A;  5CCG C;  1HJ0 A;  3GHG C;  1OXZ A;  1NHL A;  2FYU G;  4WBA A;  1M1J B;  3L70 E;  5KLV J;  1WT6 A;  3H1L E;  1JEK A;  3RL0 C;  1VQK P;  1IFD A;  1GMJ A;  1X8Y A;  4RKU J;  4N78 D;  1KQF B;  1YHQ P;  5B66 E;  1KZU B;  1FE6 A;  5M1B A;  5AW8 B;  3USS A;  1EDK A;  1NOH A;  5APY A;  3R4Y A;  3H1L G;  3GMA A;  1KIL A;  2WTY A;  2IBZ I;  3CCS P;  1QX8 A;  1NAY A;  2E5Y A;  3SSU A;  1FZB A;  1GL2 A;  2N9Y B;  1JY2 P;  3AE1 C;  2JP3 A;  3CC4 P;  2WSC J;  2R44 A;  2WSS H;  3L72 J;  5K5G B;  3V4W A;  5KJ7 D;  3B71 A;  1JTH B;  2WSE J;  4DJG A;  4WY4 B;  3KQG A;  1FZE A;  2LR2 A;  3L75 E;  1TU3 F;  1GZL A;  3H1I D;  1S5L E;  4IOI H;  3BCC G;  3VMY A;  2Y9Y A;  5EFW B;  3HE4 B;  5KAF H;  1PGO A;  1GW4 A;  3H1J G;  4Y99 C;  1JCD A;  1SFC D;  1BE3 J;  4K35 A;  1GK4 A;  4JQ0 D;  2D2C B;  2OYH C;  2R3C A;  3NMD A;  3M9Q A;  4NPD A;  1KB9 D;  1QGK B;  2H7H A;  1NTK G;  2B88 A;  3RK2 D;  2SPZ A;  3L71 G;  1GD2 E;  3RK2 C;  3II6 A;  4GDO A;  1XTG B;  2KYV A;  3MUD C;  1ZXG A;  3D6Y A;  3B5N C;  3L72 E;  1PM6 A;  1SQV D;  4H13 B;  3MUD A;  2N1T C;  4I7Z B;  4PD4 I;  2IYP A;  3L74 G;  3BVH A;  2KP8 A;  1Q7Y Q;  2YMY A;  3KZI H;  5BVZ A;  2ZHG A;  1SFC B;  5AVU B;  4L76 A;  3FWN A;  2WSE H;  3O6Q A;  3GF3 A;  5AVX B;  1IFP A;  1KYO I;  1LNQ A;  1AJY A;  5GTH E;  4W7Z A;  3AEA C;  1HF9 A;  3H1K G;  5AW7 B;  4QMA A;  1SQP G;  3V2Q A;  3HUS A;  2YKQ A;  1YBK A;  1J1D B;  1DD4 A;  1VF5 B;  2E76 B;  2MKV A;  3CX5 D;  4AYC A;  1Q82 Q;  5C39 A;  3SFE C;  3WUU A;  2KVV A;  3T97 A;  2QE7 H;  2LXB A;  1N73 A;  4KT0 J;  4H0L B;  1Q0A A;  3L4F A;  4R4M A;  1FDO A;  3AE9 C;  4GIF A;  5B5E H;  2KNC B;  3L71 E;  1FAV A;  1KN7 A;  2A45 G;  1M57 D;  1RF1 B;  2K37 A;  3H1J D;  2FXM A;  4WB4 A;  2A06 E;  4ZKU A;  4WY4 A;  1OW8 A;  1LWU A;  4PD4 H;  1LTS C;  1FDM A;  1IFJ A;  3EZ2 A;  3HD7 B;  2ZYA A;  1HGZ A;  2JEE A;  1CSB A;  5B5E E;  1CI6 B;  1BOW A;  3FXD A;  1NTZ G;  4JYB A;  3IN6 A;  2Q5U A;  1KOR A;  4LLH A;  1S5L X;  3P32 A;  1M7L A;  2C9N Y;  2B89 A;  2FXO A;  2KS1 A;  5KAV A;  2Y0C A;  2XZR A;  2CPS A;  1PP9 G;  4RO0 A;  1ZME C;  4PJ0 E;  5CBO A;  1ZN5 A;  5APV A;  1ZLL A;  1BGY J;  3CME P;  3CX5 E;  1R8E A;  1L4A D;  3OAK A;  2J59 M;  3D6Z A;  1SQV J;  3H1K J;  2HFE D;  1X0T A;  3RL0 B;  2HPC B;  1L0N D;  3CMA P;  1MUU A;  4DT0 A;  1P84 D;  1NJI Q;  1N73 C;  1PP9 J;  3U59 A;  2ZAE B;  1IJD B;  2HR3 A;  5CCH C;  3W68 A;  3MIW A;  4B86 A;  2KUB A;  3OW2 O;  3M9B A;  1SQX G;  3BRT B;  3P8C D;  3GF7 A;  1U57 A;  2OYI B;  4W80 A;  1GL2 B;  2J5U A;  2L5G B;  4D6T D;  1MFT A;  1PPJ D;  3PH0 A;  1EZV I;  1P84 E;  1L0N E;  1R5S A;  2FYU D;  2YXQ B;  3Q5P A;  1Y47 A;  3SWK A;  3RBX A;  3MHV A;  1OIP A;  4UB8 E;  3E0H A;  1PP9 D;  2C0W A;  1USE A;  1HUC A;  2OAR A;  1JY2 O;  1L2P A;  3NFQ A;  5D90 A;  5DJU B;  4Y99 B;  4GOD A;  3V2R A;  1EQ7 A;  3TDK A;  2L91 A;  2YO3 A;  3TGU J;  1EC5 A;  2OTK E;  2D2C C;  4H44 C;  4K3A A;  2KIK A;  1NTZ J;  1JBG A;  1IC2 A;  3PP5 A;  2QEX P;  1AQ5 A;  3GP4 A;  1CI6 A;  3P8M C;  4NPF X;  2Z5H A;  2Y0D A;  4O9B A;  3B5N B;  2Q3I A;  3E1I A;  3R8K A;  2QJP B;  5GTI E;  1LTI C;  3HUS B;  3GHG A;  2XNX A;  1D5Y A;  4XA4 A;  1JY3 N;  5KKZ C;  1KD1 Q;  1URQ B;  4B0Y A;  1RHZ B;  1LP1 A;  3H32 B;  5E01 A;  2XKM A;  3H25 A;  2W6J H;  3H1H G;  3MP7 B;  3N7N A;  3RK3 E;  2O01 N;  4DCK A;  3C8V A;  1JY3 P;  1E5W A;  4LGD E;  1SQV K;  1RQV A;  1SQX K;  2YO2 A;  4HYT B;  3LUR A;  3AE6 C;  3CC2 P;  3TK1 A;  1K05 A;  4HJG H;  1ZOY C;  3P8C E;  1L0L J;  3SWF A;  1AVY A;  2Z5I A;  3L73 G;  3V4Q A;  5CJ0 A;  4UB6 H;  2WIT A;  3KDP B;  3HD7 A;  1LTJ A;  1M8O B;  3LW5 H;  1JB0 J;  3CCM P;  1Q07 A;  1T3J A;  2OG0 A;  4PV1 C;  1KB9 H;  4CPG A;  2QG4 A;  1RF1 C;  2O01 J;  3KYQ A;  3HTK A;  5CCH D;  3V5B A;  1SQB G;  5E79 H;  2KS1 B;  4OWF A;  5AW5 B;  3TGU G;  3H1I G;  3PLN A;  2RMZ A;  2G8Y A;  1BCC D;  1FBM A;  3HD7 C;  3Q1M A;  5AW1 B;  3RL0 g;  1G1I A;  4LHF A;  1SQP K;  3Q5S A;  5D8C A;  1VQ7 P;  1U7J A;  1VQP P;  1VQ4 P;  2QJK C;  2E42 A;  4C7N A;  2FY8 A;  5AVT B;  5KCB A;  1FZA A;  5AVW B;  1OW7 A;  3F5H A;  1RH5 B;  2E76 D;  1ZR2 A;  1NTM G;  3G71 P;  1J1E B;  4U7J A;  2N1T D;  1Q86 Q;  1YYC A;  5APT A;  2V7Q J;  2FYN B;  3V2N A;  3EFG A;  4N6J A;  1L0N G;  1QEX A;  2JO1 A;  1KIL B;  2ZT9 C;  1SQB D;  3KPE A;  4U3F J;  1MFZ A;  1OWA A;  3OJA B;  2AEJ A;  2E43 A;  2VZ4 A;  1BE3 E;  2KB7 P;  3A3Y B;  2A45 I; 
#chains in the Genus database with same CATH homology
 2WQY C;  2OG0 A;  2YMK A;  2D2C C;  2JP3 A;  1ZP0 C;  4H44 C;  3Q5R A;  1OMI A;  1ZME C;  2BOW A;  1Y6U A;  5I44 A;  2NZ2 A;  1Q09 A;  4PV1 C;  1JBG A;  2WSC J;  5KAT A;  5L8R J;  2GOV A;  4AYZ A;  3AEG C;  2O01 J;  3R8J A;  1VF5 D;  1NYH A;  4H13 C;  2HVA A;  2JML A;  2H88 C;  3EZ7 A;  3QAO A;  3UCS A;  2E74 D;  3GP4 A;  4R22 B;  1EXI A;  1R8E A;  1DD4 A;  2QIW A;  3B71 A;  1VF5 B;  3D71 A;  4A1M A;  2WSE J;  3Q3D A;  2E76 B;  3EWK A;  2MKV A;  1TU3 F;  3D6Z A;  3D70 A;  3GK6 A;  2E74 C;  2E75 C;  1MKM A;  1WMK A;  3B49 A;  4OGQ D;  4OGQ B;  3SFE C;  4J2N A;  1PL5 A;  2KVV A;  3GPV A;  1DIP A;  3R8K A;  3AE8 C;  2QSI A;  4H44 B;  4H44 D;  2G8Y A;  2WSF J;  3AE3 C;  5GQQ A;  4PV1 B;  3Q1M A;  1S1C X;  2BEZ F;  3RL0 g;  1D5Y A;  4LHF A;  4KT0 J;  3AE5 C;  4H0L B;  1FDI A;  3S9O A;  5KAX A;  2IEF A;  5KKZ C;  1Q0A A;  4R4M A;  4Y28 J;  3LW5 J;  3Q5S A;  2OQQ A;  1FDO A;  1Y9B A;  4B0Y A;  5D8C A;  4XFJ A;  3AE9 C;  2DG6 A;  5KLI C;  2E74 B;  1Q05 A;  1KQG B;  2YIU C;  5E01 A;  4AYZ B;  4R24 B;  3RK3 E;  3AE7 C;  3H25 A;  2D2C B;  2QJK C;  3Q2Y A;  3IAO A;  2ZHH A;  2FBW C;  3C8V A;  2K9Y A;  2QJP C;  2WPV B;  2IDB A;  1RH6 A;  3GF7 A;  3AEF C;  2ZT9 D;  4WLS A;  1VL2 A;  5KCB A;  1U57 A;  4PV1 D;  1HJ0 A;  2ZT9 B;  4H0L C;  1RQV A;  4GDO A;  2J5U A;  4DCZ A;  1OW7 A;  1OW8 A;  1KIL E;  2FXP A;  2E75 B;  4H0L D;  4IL6 X;  3EZF A;  2E76 D;  3LUR A;  3D6Y A;  3AE6 C;  3EZ2 A;  2P10 A;  3Q5P A;  1K05 A;  1PM6 A;  4TT3 H;  4U7J A;  1GMJ A;  1ZOY C;  3T97 B;  4RKU J;  1NGM B;  1KQF B;  1K04 A;  1OW6 A;  4H13 B;  4R4E A;  4Z1M H;  3HH0 A;  3FGA D;  1Q90 D;  5M1B A;  1BOW A;  1UIX A;  4YTP C;  1IK7 A;  2G3A A;  2V7Q J;  4I7Z B;  3E0H A;  1LX8 A;  2QJY C;  3G9R A;  3AEE C;  5KAU A;  1JYH A;  4OGQ C;  1PV3 A;  3IN6 A;  3R4Y A;  3GLM A;  2ZHG A;  3AE2 C;  3EZ9 A;  5KAW A;  1KOR A;  3SFD C;  1ZRT E;  1S5L X;  5I41 B;  1RQU A;  3AE4 C;  3GMA A;  4R4L A;  1R8D A;  2JO1 A;  4WLW A;  1PIX A;  3EZ6 A;  3AED C;  2BEQ D;  5D90 A;  2E75 D;  2H89 C;  3O6Q A;  1Q08 A;  3GF3 A;  2ZT9 C;  3ABV C;  1VF5 C;  1Q06 A;  3AEC C;  4H13 D;  1AJY A;  2E76 C;  1YQ3 C;  3AEB C;  1KTM A;  2KCU A;  4YXD C;  1JB0 J;  2D2C D;  1EXJ A;  3AEA C;  1YQ4 C;  1DD3 A;  4I7Z C;  5KAV A;  2VZ4 A;  1HF9 A;  1KMI Z;  1Q07 A;  2FYN C;  3AE1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...