3D6YA

Crystal structure of r275e mutant of bmrr bound to dna and berberine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 80
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6yA03
2ZHGA 3R8KA 4R4MA 3Q5PA 3D6YA 5KAUA 5KATA 4A1MA 2ZHHA 3Q5RA 3G9RA 5I41B 5KAWA 1Q08A 4R22B 5D8CA 2J5UA 4AYZA 1Q0AA 1EXJA 2KCUA 2DG6A 4J2NA 4WLSA 3GK6A 5KAVA 4AYZB 5D90A 1R8DA 1JYHA 3GP4A 3HH0A 1Q06A 5KAXA 1D5YA 2BOWA 2VZ4A 1Q07A 1DIPA 2GOVA 5GQQA 4R4LA 3R8JA 3D71A 3E0HA 3T97B 3QAOA 4R24B 3D70A 4B0YA 1JBGA 2JMLA 4WLWA 1BOWA 3GPVA 2HVAA 3UCSA 5E01A 3Q5SA 4R4EA 3Q2YA 3Q3DA 3D6ZA 5I44A 2OQQA 5KCBA 1EXIA 3LURA 1Q05A 1R8EA 1Q09A 3Q1MA 3B49A 3IAOA
chains in the Genus database with same CATH superfamily
1SS1A 1GL2B 3D6YA 2BEZF 4U3FG 5APVA 4EYYQ 3EFFK 1IFNA 3AE9C 4C7RA 2K3RA 5AVTB 1LNQA 2JJLA 2FYNC 3TGUE 1Q08A 2QJYB 1IFJA 1Q82Q 2R32A 1S1CX 5KJ7D 5KAXA 1DEBA 1A02J 1ZP0C 1SQXE 1HGZA 3AEEC 1AVYA 1SP4A 1L0NG 1H0TA 1YTZT 3B5NC 3I5CA 2K37A 3H1IG 1YTZI 2FYUG 1NTZK 1M7LA 4MN4C 2HLOA 3FGAD 1KILC 2CPSA 1MFTA 1LTJC 1DX7A 1KV4A 1QVGO 1IJDB 1PL5A 5CHXA 3AE5C 2QM7A 4WY4C 1OVVA 3VP8A 2YMKA 3H1LG 3P32A 3GHGC 2KS1A 2HYNA 1SQBE 1L4AB 3L71G 2WSSH 1FDMA 5AVYB 2BEQD 2WT7A 1KFNA 2YO2A 3TGUJ 1OX3A 1PPJD 2BCCD 2FYUE 1EZVI 2WMMA 2WPSA 1RE4C 1PPJE 1AJYA 1D5YA 1QGKB 1L0ND 3B4SA 1CSBA 3HD7C 3NTNA 2KOGA 1LT1A 3BRVB 1S9KE 3FWNA 2SPZA 2Y0CA 2NPSD 1EXJA 3PH0A 4HB1A 3USSA 3RGUA 1MZ9A 1YI2P 5CCHC 2YIUB 3CX5D 3TK1A 1K04A 3SWYA 2K88A 1VQ6P 1NTKE 2CK3H 1PFIA 4I1LA 1NU1G 1OIPA 2MKVA 3L74G 3HE4B 5H2FH 2OYHB 4JPZB 1VQKP 2A45G 1IFMA 3H1JE 1JMBA 3RBXA 2WTYA 1BCCE 1TU3F 4PD4D 3TSIA 3BASA 3RBZA 1GMJA 1SQVE 1K05A 4N78E 2O01J 5APXA 5KLVE 2IYOA 1SQBK 1NTZG 2J58A 2QJKC 1SQQJ 4JQ0D 2FXPA 1HGVA 2H43A 4EIJA 1NTMJ 2E75D 1EC5A 2ITAA 1HUCA 3VMAA 3V2PA 2L5GB 1NJIQ 3OJAB 3KZIH 1JY2O 2WWWA 3MUDA 2PGDA 1SQPG 1AQ5A 1SQVJ 2KIKA 1BE3E 1VQ9P 3TDKA 1Y8AA 1M90Q 2Z4EA 2JWAA 1Q07A 2NRGA 4B0YA 3VYIA 3CXHE 1VPCA 2YNYA 3MUDC 3Q5SA 2E74B 2JR8A 4H44B 1EXIA 2QSIA 1NHLA 3V2RA 3VMXA 1M1JB 4ASVA 1NKZB 2GUSA 3UIAA 2I1JA 2IEFA 4DCZA 1NU1J 1W2BO 3HUSA 1S5LH 2AEMA 2B87A 1S2EA 1YITP 2P67A 1NVOA 4ASWA 3PP5A 1VQ5P 3H32A 1X8YA 2IYPA 2QJKB 2V7QJ 1GZLA 5CBNA 2KSJA 1SQBG 3GF7A 1ZRTE 2O01H 2QIWA 5E01A 2E76D 2QEXP 2OQQA 1SQVD 2G8YA 1BGYJ 1NTZJ 1RF0C 4C46A 3AECC 4PJ0E 2OYHC 4EDFA 4IL6H 3E1IA 1JY3O 1LT9B 1VQOP 2A06E 3L75E 2ZYAA 2WSFH 1KORA 2PRRA 2YKPA 3CCVP 5AW6B 1KILB 4WBAA 1E5WA 3AE2C 2QJYC 4L74A 3M06A 2XZRA 3R8JA 3EZ7A 2JMLA 1J1EC 1G2CB 2N1TC 3BCCD 2Z5HA 3B5NB 4GDOA 2NPSA 3OA7A 5AW2B 3H1JD 3MTUE 1FZEA 1VDFA 3GW6A 1L0NE 1SFCD 1Q06A 1BDCA 3PJSK 2JP3A 4U3FD 1K73Q 4N6JA 2D2CD 3D6ZA 4HYTB 4Z1MH 1BSHA 1L2PA 2QE7H 1M56D 1PP9J 5KAFE 1VQ7P 3C1LA 1GDTA 3GP4A 4DJGA 5APUA 1BSNA 4YTPC 1LTJB 2WITA 1Q81Q 4AQRD 4PD4I 3LIEA 3Q5RA 3VP9A 1KYOH 2D2CC 3PHLA 1NTKG 5B5EE 1KN7A 2BCCJ 2IZ1A 4GKGA 3EZ9A 3H1IJ 2WPVB 4YXDC 1EQ7A 5KKZB 1PGPA 2FYUD 1KB9I 3HTKB 1CI6A 1H88A 2QJPB 1KC8Q 2A45H 2NPSB 2KZIA 3JCUH 2A45I 4NPEA 3PRJA 1PGQA 1OVUA 5KJ7A 5KLIC 1VQ4P 1PGOA 4PJ0H 4UB8E 2XNDH 1NAYA 1X9VA 3EFGA 4H13B 1NTMG 4GT1A 5AW3B 1RE3A 3N7NA 2WSCJ 1JCDA 4KHXA 3V6IA 2W83C 5KAIH 1M57D 1IZNB 1SQQG 1VQMP 2HVAA 3WUTA 3W67A 2KLUA 1T3JA 1NWQA 2AEJA 1FZFA 2H7HA 3H1JJ 4H0LD 1NTZD 2RH0A 1ZOYC 5KAVA 1JY2N 3HUSB 5K5GB 1CW5A 5TISE 1GW3A 1YIJP 2QM8A 1KD1Q 1SQPJ 3P8CE 3SFEC 1Q05A 3L70J 4CPGA 3V2NA 1NTKK 4GODA 4U7JA 1SQQD 1AVOA 3A3YB 1IFDA 1NOHA 4TLFA 3PTZA 5AVVB 1NYHA 2W6JH 1GU4A 1NTMD 4U3FE 3CX5E 1SQVK 3GLMA 3KQGA 1HH0A 1YJNP 1LTSC 2W90A 3GHGA 2DG6A 1LTTC 1DD4A 1SFCC 4WY4A 2P58A 1X22A 1EDJA 3D71A 1SVFA 3M0AA 4AUWA 5E79E 2HPCA 4W80A 1LT9C 1Q2NA 3AE8C 1HVVA 2M5AB 1RQVA 3ZDMA 3L35A 3H1KE 4PD4E 1Z56A 1EDIA 1U7JA 3Q2YA 2FY8A 4OGQC 2ZT9B 3H1LJ 3A5TA 1SQBD 2R5DA 1SQPE 3HH0A 3FWLA 1NH4A 5B66E 2OYHA 2M0BA 3BCCE 1P84I 2XDJA 5TISH 1H89A 1FC2C 1WMKA 1KB9E 3CCRP 3Q5PA 2WSCH 1SQQK 1R5SA 2KNCB 2FXOA 2A06D 4Y28J 3JCUE 2Y9ZA 3GHGB 2K9JB 2OYIC 3WMM0 3L71J 3TNUB 3KHUA 5APYA 1NAFA 1HWTC 5D90A 2HFED 2I1KA 1UIIA 2LKMA 4DCKA 3OW2O 1URQD 1KB9D 3R8KA 4AYCA 4H13D 2J5UA 3VN0A 3CWBJ 2B9BA 3CCSP 5KLVJ 3IN6A 3L36A 5AVZB 5APTA 2ZXXA 2K9YA 1NGMB 1Y47A 3RL0g 2BCCG 1USEA 2ZFCA 2BCCE 1A02F 3CC2P 3A0HE 2BOWA 3AE1C 3D70A 3KXDA 1SQXK 2M8RA 5CCHA 2YKOA 1NU1K 1JY3N 4WVZA 1AFOA 3TGUD 3IR9A 3AE6C 4L73A 1L0LK 2Y9YA 3WUVA 1FZAA 1BCCD 1PGJA 4DT0A 5GTHE 1ZW0A 4LHFA 1KQFB 5BVZA 3HTKA 3LW5H 3B49A 2R44A 3H1LE 1Q0AA 2O1KA 1ZMEC 1FZCB 2NPSC 1ZLLA 1GK6A 1U57A 1SLQA 1RH6A 5AW0B 2UWJE 1SQXD 1E79H 2GUVA 5AW7B 5L8RJ 5AVUB 3S1KA 1LWUC 3G3ZA 1N7SB 3U1CA 1IK9A 1GK4A 1HF9A 5CCGD 3A0BH 1DD3A 3KYQA 2JDIH 1Y6UA 1YQ4C 1M1KQ 1NTZE 1L4AC 2PAJA 2C9LY 2PFXA 4WWIA 5BU8B 1S3JA 1GL2C 1RE3C 1K9MQ 3HD7B 3PLNA 3AEFC 3NMDA 1L4AD 2G3AA 2QRXA 1OXZA 4KT0J 1NKNA 3H1HG 5B66H 2I8DA 2GM4A 5KATA 1GU5A 5KTBA 3CCUP 1VF5C 3EWKA 4OGQD 4WLSA 1KFMA 1NU1E 1LGHB 1SQXJ 3L70D 2FFDC 1IFPA 3BATA 2N9YB 3H1HE 1L0LE 2M3BA 3A7OA 4WB4A 1EZVD 3EZ2A 1USDA 1J1DB 3LW5J 5GTHH 2IBZG 2O1JA 5AW4B 3B8EB 2WSEH 1T6AA 3KZIE 2E5YA 1N86A 1T8ZA 3OAKA 4OWFA 2Q3EA 1LTIC 3LIDA 2M5AA 2ZVNB 2BASA 1P84H 1ZN5A 1RF0A 4LC1A 4WY4B 1J1EB 3CC7P 1GTWA 3VOPA 1JY2P 1JB0J 2WPRA 2E5TA 2H89C 1LP1B 2RMZA 1P84E 2QA4P 4LGDE 3H1IE 4HJGH 5I44A 3EQ2A 4I7ZC 3AEDC 2Q5UA 3S4RA 4IL6X 4DZOA 3G9RA 4IFMA 2Q1KA 1OZHA 2ZT9D 1LTGC 4AYZB 1RE4A 1U7MA 2KUBA 3L74J 2E75C 1PM6A 3L72D 3H1LD 4JBZA 4GIFA 2O01N 3MD0A 5H2FE 1WRGA 3BRTB 1G1JA 3MP7B 3F89A 1L4AA 5CCGA 5CJ0A 3G4SP 1M1JA 3MHVA 1HJ0A 4TT3H 1IO4A 3BCCJ 3SWKA 2KSEA 3AEAC 1N8RQ 3QWOC 2K1AA 5TJHA 3CCEP 5KLIB 1DIPA 1T2KC 1YJWP 4BXLA 2P2UA 4H0LC 1BE3J 5KAIE 1CI6B 5KCBA 2WVRA 1FJKA 2OGUA 3CXHI 1BGYE 1PP9D 2XU6A 1QVFO 3CLQA 2IBZD 3W68A 2FYNB 4L76A 5APQA 1FE6A 3G6EP 1L0LG 4OVNF 1N7LA 1URQB 2VRSA 4ZMDA 1ZRTD 3V2QA 1FZCC 4L75A 2JO1A 1CZQA 1LJ2A 3CWBD 2LXBA 1JO5A 3HD7A 2N9BA 3RK3C 4W7YA 1KYOE 1LWUB 1FJPA 4EOTA 1AV1A 3HD7D 4O9BA 5KLVG 1N7SC 2FBWC 2ZYGA 1HBWA 2E76C 1GL2A 4RJTA 1Q90D 2FYZA 1PIXA 4UB6H 3CX5H 1N7SA 4BWNA 1JBGA 5AVWB 5DJTB 3M9BA 2KK7A 5E79H 4A7PA 4R4MA 2ZAEB 1Q86Q 3CWBG 4JYCA 3AE3C 3TF5A 1G2CA 3CCLP 1D7MA 3L72J 1JYHA 1LWUA 2H88C 1URQC 1ZV8A 3NXSA 1KILA 1RHZB 4KJMA 3L75J 1YHQP 4WLWA 1M1JC 2KVVA 1GW4A 3FXEA 2ZVOB 1PP9G 2AXCA 4H44C 1KILD 2FYUJ 2CPBA 3P7KA 3B5NA 3SSUA 4PV1B 2P10A 2P7JA 1BGYG 2A06G 4R24B 1W5CE 1KMIZ 5KLVK 5GTIE 3B5ND 1T3UA 1JM0A 1OFCX 3O6QA 3S9OA 5DJUB 1NTMK 1HTLC 1P84D 1PPJG 4UB8H 1NTKJ 3L72G 3IFMA 2OTJP 1BDDA 4QMAA 3H32B 5CCGC 1LTAC 1M8OB 4YXWH 5AW5B 1S9KD 1ZXGA 3M9HA 1IK7A 3HRNA 1XTCC 2OTKE 4NPFX 1FZBA 2W8ZA 1OMIA 1QEXA 1Y9BA 1RY3A 1FU1A 3BVHA 4AYZA 1QL1A 3CC4P 1SQQE 2Q9IA 2XV5A 3N4XA 3TYYA 3MGNA 2PP6A 2J59M 3RL0C 3L73E 2IPPA 1NU1D 2E75B 2MJZA 4PV1C 2B87B 1N2DC 3JSVC 3TNUA 4I7ZB 4RESB 1LP1A 1L0LJ 5KAWA 2HODB 2K9JA 3V4QA 2YIUC 2YKQA 3M9QA 1RH5B 1MFZA 3L75D 2KNCA 3CXHH 1FOSE 3EZFA 1EDLA 1X79B 1PP9E 3V4WA 3L70G 2V7QH 4JF7A 2WPQA 5GTIH 4D6TD 4H0LB 2E74D 1EZVG 3CXHD 3MIWA 1KZUB 3WU2H 4WY4D 3CMAP 1SFCB 3L73D 5AW1B 3H25A 3ABVC 3Q3DA 1X0TA 2D2CB 2KI7B 4H44D 2DW3A 1ZR2A 3V5BA 3E1RA 3P8MC 1RF1A 3L4FA 3IF4A 2KCUA 2KP8A 3H6PA 2IBZE 2B89A 1SQVG 2W6BA 2YMYA 1K8AQ 1BOWA 1N73C 2WZ7A 4GOEA 2AXTE 2ZT9C 1Q09A 2OARA 1FAVA 2R3CA 4A1MA 5KAUA 2OYIA 1IFIA 4UB6E 1YQ3C 1OW7A 2HPCB 4K35A 5APWA 3AEGC 3E0HA 1JMMA 2KYVA 4PV1D 2HR3A 2IX7C 3A2AA 4I2LC 1SFCA 3HE4A 2WQYC 1BE3D 2IDBA 4RKUJ 2LXCB 5AVSB 1PZQA 2Y0EA 3GG2A 1VL2A 4C7NB 3E7KA 1OW8A 3SFDC 1NTKD 2OTLP 3L75G 4Y99C 2KXPB 2Q3IA 1N73A 1S5LE 4Y99B 4IOIH 5CCHD 1FZCA 2W27A 3HUSC 1FDIA 1EZVE 2FFDA 2HODA 4J2NA 4NPDA 1MKMA 3HE5B 2GOVA 4EI2A 3VTPC 3L70E 2FXMA 2YO3A 1AA0A 2JKVA 2XKMA 5AW9B 5KLVD 4XFJA 5D8CA 5C39A 3L73J 2V4HA 4ZKPA 2RKLA 2WT7B 3NFQA 1OW6A 1KYOD 2IZ0A 2KS1B 4XA4A 4ZNCA 1JEKA 3B71A 5AVQB 1FS0E 5EFWB 1L0LD 2NZ2A 3P8CD 4HH2A 5AW8B 1LX8A 2LR2A 5B5EH 5KJ7C 2N1TA 1UIXA 2KLVA 2AEFA 2C9NY 2C0WA 3O6QB 4B86A 2ZJSE 1H0TB 2OYOA 3WU2E 4I6MC 1N73B 2QJPC 1BE3G 2Q6QA 1BGYD 3M91A 3RL0B 2ZXEB 2JWDA 3AEBC 3RK2B 3LURA 1R8EA 3Q1MA 1VQLP 3CD6P 2IFMA 3IAOA 2P1JA 1VF5B 2N1TD 2Z5IA 5KAFH 1S4XA 2W6AA 3FX0A 2KZJA 1R5LA 2B88A 1JUNA 3VMZA 1JCCA 3QAOA 3CWBE 3L71D 2L91A 4W7ZA 2OG0A 2RN0A 2Y0DA 1RQUA 3G71P 3K5BA 2OYIB 4D6TE 1WT6A 3ITKA 1Q7YQ 3VMYA 4R4LA 1KQLA 4LLHA 5APSA 3GPVA 1JOCA 1KTMA 4R4EA 3T97A 3AE4C 3FXDA 1YJ9P 1JNMA 3CPWO 1PV3A 1KQGB 3AE7C 3H1ID 1KB9H 1RF1B 1J1DC 1R8DA 4U3FJ 1OWAA 3KPEA 1DEEG 3L73G 5GQQA 4IL6E 1XTGB 3BCCG 1GL2D 3II6A 3RK2C 3M0DC 3RK2D 1JTHB 2H8PD 1KQSO 5AVRB 4D6TG 4ZKUA 1H8AA 1VQNP 2N1TB 1T2KD 2ZHHA 1LT9A 5I41B 3R2PA 1URQA 3EZ6A 2POHA 1SQPK 2IBZI 1SQBJ 5AVXB 2ZYDA 1MV8A 4BRYB 1FDOA 1FZGA 3H1KJ 4IFDK 1VQPP 3L74E 2WSEJ 4OH8B 2WSFJ 5CJ4A 1GD2E 3H1HD 2E42A 1BCCJ 1KILE 1L0NK 1J2JB 1W2EA 4XE5B 3I55P 3CCJP 4PD4H 2JEEA 1RF1C 2QG4A 3M0DA 4N78D 3C8VA 3L71E 1IC2A 1G1IA 4YPCA 3CCMP 4RO0A 3RK3D 3HE5A 2AXTH 3U59A 4M3LA 2YXRB 2FFDB 1AQTA 5CMZA 3L74D 3L72E 4OGQB 3CCQP 4GOFA 3CI9A 4BRYA 3R4YA 3GMAA 2R3SA 4C7NA 1YBKA 4N3YB 1OVRA 2HG5D 3RK3E 3CX5I 3QH9A 3CL3D 3H1KD 4D6TJ 2Q7CA 1QX8A 2IFNA 1HJBA 2GA1A 3L37A 3H1HJ 4JYBA 2ZHGA 2E74C 1NO4A 1EDKA 1SQXG 1FBMA 3WUUA 1MUUA 1FOSF 3A0HH 2KB7P 3JC22 1LTBC 1SQPD 1YYCA 5CBOA 2YXQB 4IFFA 2M3EA 4H13C 3TGUG 3UCSA 3KDPB 3RL0D 3I56P 5KKZC 1KYOI 1S5LX 2FKWB 1VF5D 5BU5A 1BCCG 3CMEP 1NTME 2E43A 2XNXA 1N7SD 3RK3B 1S72P 2VZ4A 1JTHA 1DH3A 3H1KG 3F5HA 1QL2A 3MZWB 3C9IA 2C0XA 3SWFA 4DOJA 4R22B 1QLED 3GK6A 1ZR4A 3O8ZA 3GF3A 5M1BA 3A0BE 4HKZH 2E76B 4K3AA 1VQ8P 3T97B 2O3JA 1LTJA 1JY3P 1L0NJ 3U1AA 2R5BA 2QVAA 3H1JG 2FYUK
chains in the Genus database with same CATH topology
3B71A 4R4MA 3Q5PA 3D6YA 1Y9BA 2BEZF 3AECC 5KAUA 5KATA 3Q5RA 4A1MA 1PV3A 4AYZA 4U7JA 3AE3C 1KQGB 3AE7C 3AEAC 1VF5C 1OW7A 1YQ3C 3R4YA 3GMAA 3EWKA 4OGQD 4WLSA 2D2CC 1R8DA 2NZ2A 2H88C 1JYHA 3AEGC 2E75D 1AJYA 3AE9C 3RK3E 1D5YA 3AE6C 4Y28J 1DIPA 5GQQA 3EZ9A 3E0HA 1NYHA 4WLWA 2WPVB 4YXDC 2KVVA 2E75B 4PV1C 4H0LC 1LX8A 4PV1D 4LHFA 1KQFB 3EZ2A 5KCBA 4I7ZB 3LW5J 4H44C 3B49A 1UIXA 2ZHGA 2E74C 2FYNC 3GLMA 2ZHHA 5I41B 5KAWA 1Q08A 2WQYC 1Q0AA 1KORA 1EXJA 1ZMEC 3EZ6A 2DG6A 2YIUC 2IDBA 4RKUJ 5D90A 1DD4A 1S1CX 3AE2C 2QJYC 5KAXA 4PV1B 1U57A 1Q07A 2P10A 2QJPC 1VL2A 3EZ7A 3D71A 3R8JA 1RH6A 1ZP0C 4R24B 4B0YA 2JMLA 3EZFA 1KMIZ 1OW8A 3UCSA 4H13C 3SFDC 5KLIC 3Q5SA 2E74B 3AEEC 5L8RJ 1FDOA 3AEBC 5KKZC 4H44B 1EXIA 2QSIA 3LURA 1R8EA 3Q1MA 3AE8C 3IAOA 1S5LX 4H0LB 3R8KA 1VF5B 1K04A 4H13B 2E74D 1VF5D 4GDOA 4H13D 1RQVA 2J5UA 2WSEJ 3O6QA 2WSFJ 1FDIA 3S9OA 2MKVA 4J2NA 1JB0J 2WSCJ 2IEFA 2H89C 3H25A 4DCZA 1HF9A 1Q06A 1MKMA 1KILE 2VZ4A 3IN6A 2GOVA 1DD3A 2JO1A 3QAOA 1Y6UA 2JP3A 2HVAA 3ABVC 1YQ4C 3FGAD 4TT3H 3Q2YA 2D2CD 3Q3DA 3D6ZA 5I44A 4OGQC 2D2CB 1TU3F 4Z1MH 2K9YA 4I7ZC 2OG0A 4H44D 2ZT9B 3AEDC 1NGMB 2V7QJ 1RQUA 4H0LD 4IL6X 3C8VA 3G9RA 4XFJA 1GMJA 4R22B 5D8CA 1PL5A 3RL0g 1ZOYC 3AE5C 1K05A 2ZT9D 3AEFC 2KCUA 2FBWC 3GK6A 2E76C 5KAVA 4AYZB 2YMKA 3GP4A 3GF3A 3HH0A 1IK7A 2G3AA 3GF7A 5M1BA 2E75C 1PM6A 2E76B 1ZRTE 2O01J 2BOWA 1Q90D 1PIXA 2QIWA 3AE1C 4R4LA 3T97B 3D70A 1JBGA 1BOWA 3GPVA 4KT0J 4YTPC 1OW6A 5E01A 2QJKC 4R4EA 2E76D 1KTMA 1WMKA 2OQQA 3AE4C 2ZT9C 3SFEC 1HJ0A 2G8YA 1Q05A 2BEQD 1Q09A 2FXPA 4OGQB 1OMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZHG A;  3R8K A;  4R4M A;  3Q5P A;  3D6Y A;  5KAU A;  5KAT A;  4A1M A;  2ZHH A;  3Q5R A;  3G9R A;  5I41 B;  5KAW A;  1Q08 A;  4R22 B;  5D8C A;  2J5U A;  4AYZ A;  1Q0A A;  1EXJ A;  2KCU A;  2DG6 A;  4J2N A;  4WLS A;  3GK6 A;  5KAV A;  4AYZ B;  5D90 A;  1R8D A;  1JYH A;  3GP4 A;  3HH0 A;  1Q06 A;  5KAX A;  1D5Y A;  2BOW A;  2VZ4 A;  1Q07 A;  1DIP A;  2GOV A;  5GQQ A;  4R4L A;  3R8J A;  3D71 A;  3E0H A;  3T97 B;  3QAO A;  4R24 B;  3D70 A;  4B0Y A;  1JBG A;  2JML A;  4WLW A;  1BOW A;  3GPV A;  2HVA A;  3UCS A;  5E01 A;  3Q5S A;  4R4E A;  3Q2Y A;  3Q3D A;  3D6Z A;  5I44 A;  2OQQ A;  5KCB A;  1EXI A;  3LUR A;  1Q05 A;  1R8E A;  1Q09 A;  3Q1M A;  3B49 A;  3IAO A; 
#chains in the Genus database with same CATH topology
 1SS1 A;  1GL2 B;  3D6Y A;  2BEZ F;  4U3F G;  5APV A;  4EYY Q;  3EFF K;  1IFN A;  3AE9 C;  4C7R A;  2K3R A;  5AVT B;  1LNQ A;  2JJL A;  2FYN C;  3TGU E;  1Q08 A;  2QJY B;  1IFJ A;  1Q82 Q;  2R32 A;  1S1C X;  5KJ7 D;  5KAX A;  1DEB A;  1A02 J;  1ZP0 C;  1SQX E;  1HGZ A;  3AEE C;  1AVY A;  1SP4 A;  1L0N G;  1H0T A;  1YTZ T;  3B5N C;  3I5C A;  2K37 A;  3H1I G;  1YTZ I;  2FYU G;  1NTZ K;  1M7L A;  4MN4 C;  2HLO A;  3FGA D;  1KIL C;  2CPS A;  1MFT A;  1LTJ C;  1DX7 A;  1KV4 A;  1QVG O;  1IJD B;  1PL5 A;  5CHX A;  3AE5 C;  2QM7 A;  4WY4 C;  1OVV A;  3VP8 A;  2YMK A;  3H1L G;  3P32 A;  3GHG C;  2KS1 A;  2HYN A;  1SQB E;  1L4A B;  3L71 G;  2WSS H;  1FDM A;  5AVY B;  2BEQ D;  2WT7 A;  1KFN A;  2YO2 A;  3TGU J;  1OX3 A;  1PPJ D;  2BCC D;  2FYU E;  1EZV I;  2WMM A;  2WPS A;  1RE4 C;  1PPJ E;  1AJY A;  1D5Y A;  1QGK B;  1L0N D;  3B4S A;  1CSB A;  3HD7 C;  3NTN A;  2KOG A;  1LT1 A;  3BRV B;  1S9K E;  3FWN A;  2SPZ A;  2Y0C A;  2NPS D;  1EXJ A;  3PH0 A;  4HB1 A;  3USS A;  3RGU A;  1MZ9 A;  1YI2 P;  5CCH C;  2YIU B;  3CX5 D;  3TK1 A;  1K04 A;  3SWY A;  2K88 A;  1VQ6 P;  1NTK E;  2CK3 H;  1PFI A;  4I1L A;  1NU1 G;  1OIP A;  2MKV A;  3L74 G;  3HE4 B;  5H2F H;  2OYH B;  4JPZ B;  1VQK P;  2A45 G;  1IFM A;  3H1J E;  1JMB A;  3RBX A;  2WTY A;  1BCC E;  1TU3 F;  4PD4 D;  3TSI A;  3BAS A;  3RBZ A;  1GMJ A;  1SQV E;  1K05 A;  4N78 E;  2O01 J;  5APX A;  5KLV E;  2IYO A;  1SQB K;  1NTZ G;  2J58 A;  2QJK C;  1SQQ J;  4JQ0 D;  2FXP A;  1HGV A;  2H43 A;  4EIJ A;  1NTM J;  2E75 D;  1EC5 A;  2ITA A;  1HUC A;  3VMA A;  3V2P A;  2L5G B;  1NJI Q;  3OJA B;  3KZI H;  1JY2 O;  2WWW A;  3MUD A;  2PGD A;  1SQP G;  1AQ5 A;  1SQV J;  2KIK A;  1BE3 E;  1VQ9 P;  3TDK A;  1Y8A A;  1M90 Q;  2Z4E A;  2JWA A;  1Q07 A;  2NRG A;  4B0Y A;  3VYI A;  3CXH E;  1VPC A;  2YNY A;  3MUD C;  3Q5S A;  2E74 B;  2JR8 A;  4H44 B;  1EXI A;  2QSI A;  1NHL A;  3V2R A;  3VMX A;  1M1J B;  4ASV A;  1NKZ B;  2GUS A;  3UIA A;  2I1J A;  2IEF A;  4DCZ A;  1NU1 J;  1W2B O;  3HUS A;  1S5L H;  2AEM A;  2B87 A;  1S2E A;  1YIT P;  2P67 A;  1NVO A;  4ASW A;  3PP5 A;  1VQ5 P;  3H32 A;  1X8Y A;  2IYP A;  2QJK B;  2V7Q J;  1GZL A;  5CBN A;  2KSJ A;  1SQB G;  3GF7 A;  1ZRT E;  2O01 H;  2QIW A;  5E01 A;  2E76 D;  2QEX P;  2OQQ A;  1SQV D;  2G8Y A;  1BGY J;  1NTZ J;  1RF0 C;  4C46 A;  3AEC C;  4PJ0 E;  2OYH C;  4EDF A;  4IL6 H;  3E1I A;  1JY3 O;  1LT9 B;  1VQO P;  2A06 E;  3L75 E;  2ZYA A;  2WSF H;  1KOR A;  2PRR A;  2YKP A;  3CCV P;  5AW6 B;  1KIL B;  4WBA A;  1E5W A;  3AE2 C;  2QJY C;  4L74 A;  3M06 A;  2XZR A;  3R8J A;  3EZ7 A;  2JML A;  1J1E C;  1G2C B;  2N1T C;  3BCC D;  2Z5H A;  3B5N B;  4GDO A;  2NPS A;  3OA7 A;  5AW2 B;  3H1J D;  3MTU E;  1FZE A;  1VDF A;  3GW6 A;  1L0N E;  1SFC D;  1Q06 A;  1BDC A;  3PJS K;  2JP3 A;  4U3F D;  1K73 Q;  4N6J A;  2D2C D;  3D6Z A;  4HYT B;  4Z1M H;  1BSH A;  1L2P A;  2QE7 H;  1M56 D;  1PP9 J;  5KAF E;  1VQ7 P;  3C1L A;  1GDT A;  3GP4 A;  4DJG A;  5APU A;  1BSN A;  4YTP C;  1LTJ B;  2WIT A;  1Q81 Q;  4AQR D;  4PD4 I;  3LIE A;  3Q5R A;  3VP9 A;  1KYO H;  2D2C C;  3PHL A;  1NTK G;  5B5E E;  1KN7 A;  2BCC J;  2IZ1 A;  4GKG A;  3EZ9 A;  3H1I J;  2WPV B;  4YXD C;  1EQ7 A;  5KKZ B;  1PGP A;  2FYU D;  1KB9 I;  3HTK B;  1CI6 A;  1H88 A;  2QJP B;  1KC8 Q;  2A45 H;  2NPS B;  2KZI A;  3JCU H;  2A45 I;  4NPE A;  3PRJ A;  1PGQ A;  1OVU A;  5KJ7 A;  5KLI C;  1VQ4 P;  1PGO A;  4PJ0 H;  4UB8 E;  2XND H;  1NAY A;  1X9V A;  3EFG A;  4H13 B;  1NTM G;  4GT1 A;  5AW3 B;  1RE3 A;  3N7N A;  2WSC J;  1JCD A;  4KHX A;  3V6I A;  2W83 C;  5KAI H;  1M57 D;  1IZN B;  1SQQ G;  1VQM P;  2HVA A;  3WUT A;  3W67 A;  2KLU A;  1T3J A;  1NWQ A;  2AEJ A;  1FZF A;  2H7H A;  3H1J J;  4H0L D;  1NTZ D;  2RH0 A;  1ZOY C;  5KAV A;  1JY2 N;  3HUS B;  5K5G B;  1CW5 A;  5TIS E;  1GW3 A;  1YIJ P;  2QM8 A;  1KD1 Q;  1SQP J;  3P8C E;  3SFE C;  1Q05 A;  3L70 J;  4CPG A;  3V2N A;  1NTK K;  4GOD A;  4U7J A;  1SQQ D;  1AVO A;  3A3Y B;  1IFD A;  1NOH A;  4TLF A;  3PTZ A;  5AVV B;  1NYH A;  2W6J H;  1GU4 A;  1NTM D;  4U3F E;  3CX5 E;  1SQV K;  3GLM A;  3KQG A;  1HH0 A;  1YJN P;  1LTS C;  2W90 A;  3GHG A;  2DG6 A;  1LTT C;  1DD4 A;  1SFC C;  4WY4 A;  2P58 A;  1X22 A;  1EDJ A;  3D71 A;  1SVF A;  3M0A A;  4AUW A;  5E79 E;  2HPC A;  4W80 A;  1LT9 C;  1Q2N A;  3AE8 C;  1HVV A;  2M5A B;  1RQV A;  3ZDM A;  3L35 A;  3H1K E;  4PD4 E;  1Z56 A;  1EDI A;  1U7J A;  3Q2Y A;  2FY8 A;  4OGQ C;  2ZT9 B;  3H1L J;  3A5T A;  1SQB D;  2R5D A;  1SQP E;  3HH0 A;  3FWL A;  1NH4 A;  5B66 E;  2OYH A;  2M0B A;  3BCC E;  1P84 I;  2XDJ A;  5TIS H;  1H89 A;  1FC2 C;  1WMK A;  1KB9 E;  3CCR P;  3Q5P A;  2WSC H;  1SQQ K;  1R5S A;  2KNC B;  2FXO A;  2A06 D;  4Y28 J;  3JCU E;  2Y9Z A;  3GHG B;  2K9J B;  2OYI C;  3WMM 0;  3L71 J;  3TNU B;  3KHU A;  5APY A;  1NAF A;  1HWT C;  5D90 A;  2HFE D;  2I1K A;  1UII A;  2LKM A;  4DCK A;  3OW2 O;  1URQ D;  1KB9 D;  3R8K A;  4AYC A;  4H13 D;  2J5U A;  3VN0 A;  3CWB J;  2B9B A;  3CCS P;  5KLV J;  3IN6 A;  3L36 A;  5AVZ B;  5APT A;  2ZXX A;  2K9Y A;  1NGM B;  1Y47 A;  3RL0 g;  2BCC G;  1USE A;  2ZFC A;  2BCC E;  1A02 F;  3CC2 P;  3A0H E;  2BOW A;  3AE1 C;  3D70 A;  3KXD A;  1SQX K;  2M8R A;  5CCH A;  2YKO A;  1NU1 K;  1JY3 N;  4WVZ A;  1AFO A;  3TGU D;  3IR9 A;  3AE6 C;  4L73 A;  1L0L K;  2Y9Y A;  3WUV A;  1FZA A;  1BCC D;  1PGJ A;  4DT0 A;  5GTH E;  1ZW0 A;  4LHF A;  1KQF B;  5BVZ A;  3HTK A;  3LW5 H;  3B49 A;  2R44 A;  3H1L E;  1Q0A A;  2O1K A;  1ZME C;  1FZC B;  2NPS C;  1ZLL A;  1GK6 A;  1U57 A;  1SLQ A;  1RH6 A;  5AW0 B;  2UWJ E;  1SQX D;  1E79 H;  2GUV A;  5AW7 B;  5L8R J;  5AVU B;  3S1K A;  1LWU C;  3G3Z A;  1N7S B;  3U1C A;  1IK9 A;  1GK4 A;  1HF9 A;  5CCG D;  3A0B H;  1DD3 A;  3KYQ A;  2JDI H;  1Y6U A;  1YQ4 C;  1M1K Q;  1NTZ E;  1L4A C;  2PAJ A;  2C9L Y;  2PFX A;  4WWI A;  5BU8 B;  1S3J A;  1GL2 C;  1RE3 C;  1K9M Q;  3HD7 B;  3PLN A;  3AEF C;  3NMD A;  1L4A D;  2G3A A;  2QRX A;  1OXZ A;  4KT0 J;  1NKN A;  3H1H G;  5B66 H;  2I8D A;  2GM4 A;  5KAT A;  1GU5 A;  5KTB A;  3CCU P;  1VF5 C;  3EWK A;  4OGQ D;  4WLS A;  1KFM A;  1NU1 E;  1LGH B;  1SQX J;  3L70 D;  2FFD C;  1IFP A;  3BAT A;  2N9Y B;  3H1H E;  1L0L E;  2M3B A;  3A7O A;  4WB4 A;  1EZV D;  3EZ2 A;  1USD A;  1J1D B;  3LW5 J;  5GTH H;  2IBZ G;  2O1J A;  5AW4 B;  3B8E B;  2WSE H;  1T6A A;  3KZI E;  2E5Y A;  1N86 A;  1T8Z A;  3OAK A;  4OWF A;  2Q3E A;  1LTI C;  3LID A;  2M5A A;  2ZVN B;  2BAS A;  1P84 H;  1ZN5 A;  1RF0 A;  4LC1 A;  4WY4 B;  1J1E B;  3CC7 P;  1GTW A;  3VOP A;  1JY2 P;  1JB0 J;  2WPR A;  2E5T A;  2H89 C;  1LP1 B;  2RMZ A;  1P84 E;  2QA4 P;  4LGD E;  3H1I E;  4HJG H;  5I44 A;  3EQ2 A;  4I7Z C;  3AED C;  2Q5U A;  3S4R A;  4IL6 X;  4DZO A;  3G9R A;  4IFM A;  2Q1K A;  1OZH A;  2ZT9 D;  1LTG C;  4AYZ B;  1RE4 A;  1U7M A;  2KUB A;  3L74 J;  2E75 C;  1PM6 A;  3L72 D;  3H1L D;  4JBZ A;  4GIF A;  2O01 N;  3MD0 A;  5H2F E;  1WRG A;  3BRT B;  1G1J A;  3MP7 B;  3F89 A;  1L4A A;  5CCG A;  5CJ0 A;  3G4S P;  1M1J A;  3MHV A;  1HJ0 A;  4TT3 H;  1IO4 A;  3BCC J;  3SWK A;  2KSE A;  3AEA C;  1N8R Q;  3QWO C;  2K1A A;  5TJH A;  3CCE P;  5KLI B;  1DIP A;  1T2K C;  1YJW P;  4BXL A;  2P2U A;  4H0L C;  1BE3 J;  5KAI E;  1CI6 B;  5KCB A;  2WVR A;  1FJK A;  2OGU A;  3CXH I;  1BGY E;  1PP9 D;  2XU6 A;  1QVF O;  3CLQ A;  2IBZ D;  3W68 A;  2FYN B;  4L76 A;  5APQ A;  1FE6 A;  3G6E P;  1L0L G;  4OVN F;  1N7L A;  1URQ B;  2VRS A;  4ZMD A;  1ZRT D;  3V2Q A;  1FZC C;  4L75 A;  2JO1 A;  1CZQ A;  1LJ2 A;  3CWB D;  2LXB A;  1JO5 A;  3HD7 A;  2N9B A;  3RK3 C;  4W7Y A;  1KYO E;  1LWU B;  1FJP A;  4EOT A;  1AV1 A;  3HD7 D;  4O9B A;  5KLV G;  1N7S C;  2FBW C;  2ZYG A;  1HBW A;  2E76 C;  1GL2 A;  4RJT A;  1Q90 D;  2FYZ A;  1PIX A;  4UB6 H;  3CX5 H;  1N7S A;  4BWN A;  1JBG A;  5AVW B;  5DJT B;  3M9B A;  2KK7 A;  5E79 H;  4A7P A;  4R4M A;  2ZAE B;  1Q86 Q;  3CWB G;  4JYC A;  3AE3 C;  3TF5 A;  1G2C A;  3CCL P;  1D7M A;  3L72 J;  1JYH A;  1LWU A;  2H88 C;  1URQ C;  1ZV8 A;  3NXS A;  1KIL A;  1RHZ B;  4KJM A;  3L75 J;  1YHQ P;  4WLW A;  1M1J C;  2KVV A;  1GW4 A;  3FXE A;  2ZVO B;  1PP9 G;  2AXC A;  4H44 C;  1KIL D;  2FYU J;  2CPB A;  3P7K A;  3B5N A;  3SSU A;  4PV1 B;  2P10 A;  2P7J A;  1BGY G;  2A06 G;  4R24 B;  1W5C E;  1KMI Z;  5KLV K;  5GTI E;  3B5N D;  1T3U A;  1JM0 A;  1OFC X;  3O6Q A;  3S9O A;  5DJU B;  1NTM K;  1HTL C;  1P84 D;  1PPJ G;  4UB8 H;  1NTK J;  3L72 G;  3IFM A;  2OTJ P;  1BDD A;  4QMA A;  3H32 B;  5CCG C;  1LTA C;  1M8O B;  4YXW H;  5AW5 B;  1S9K D;  1ZXG A;  3M9H A;  1IK7 A;  3HRN A;  1XTC C;  2OTK E;  4NPF X;  1FZB A;  2W8Z A;  1OMI A;  1QEX A;  1Y9B A;  1RY3 A;  1FU1 A;  3BVH A;  4AYZ A;  1QL1 A;  3CC4 P;  1SQQ E;  2Q9I A;  2XV5 A;  3N4X A;  3TYY A;  3MGN A;  2PP6 A;  2J59 M;  3RL0 C;  3L73 E;  2IPP A;  1NU1 D;  2E75 B;  2MJZ A;  4PV1 C;  2B87 B;  1N2D C;  3JSV C;  3TNU A;  4I7Z B;  4RES B;  1LP1 A;  1L0L J;  5KAW A;  2HOD B;  2K9J A;  3V4Q A;  2YIU C;  2YKQ A;  3M9Q A;  1RH5 B;  1MFZ A;  3L75 D;  2KNC A;  3CXH H;  1FOS E;  3EZF A;  1EDL A;  1X79 B;  1PP9 E;  3V4W A;  3L70 G;  2V7Q H;  4JF7 A;  2WPQ A;  5GTI H;  4D6T D;  4H0L B;  2E74 D;  1EZV G;  3CXH D;  3MIW A;  1KZU B;  3WU2 H;  4WY4 D;  3CMA P;  1SFC B;  3L73 D;  5AW1 B;  3H25 A;  3ABV C;  3Q3D A;  1X0T A;  2D2C B;  2KI7 B;  4H44 D;  2DW3 A;  1ZR2 A;  3V5B A;  3E1R A;  3P8M C;  1RF1 A;  3L4F A;  3IF4 A;  2KCU A;  2KP8 A;  3H6P A;  2IBZ E;  2B89 A;  1SQV G;  2W6B A;  2YMY A;  1K8A Q;  1BOW A;  1N73 C;  2WZ7 A;  4GOE A;  2AXT E;  2ZT9 C;  1Q09 A;  2OAR A;  1FAV A;  2R3C A;  4A1M A;  5KAU A;  2OYI A;  1IFI A;  4UB6 E;  1YQ3 C;  1OW7 A;  2HPC B;  4K35 A;  5APW A;  3AEG C;  3E0H A;  1JMM A;  2KYV A;  4PV1 D;  2HR3 A;  2IX7 C;  3A2A A;  4I2L C;  1SFC A;  3HE4 A;  2WQY C;  1BE3 D;  2IDB A;  4RKU J;  2LXC B;  5AVS B;  1PZQ A;  2Y0E A;  3GG2 A;  1VL2 A;  4C7N B;  3E7K A;  1OW8 A;  3SFD C;  1NTK D;  2OTL P;  3L75 G;  4Y99 C;  2KXP B;  2Q3I A;  1N73 A;  1S5L E;  4Y99 B;  4IOI H;  5CCH D;  1FZC A;  2W27 A;  3HUS C;  1FDI A;  1EZV E;  2FFD A;  2HOD A;  4J2N A;  4NPD A;  1MKM A;  3HE5 B;  2GOV A;  4EI2 A;  3VTP C;  3L70 E;  2FXM A;  2YO3 A;  1AA0 A;  2JKV A;  2XKM A;  5AW9 B;  5KLV D;  4XFJ A;  5D8C A;  5C39 A;  3L73 J;  2V4H A;  4ZKP A;  2RKL A;  2WT7 B;  3NFQ A;  1OW6 A;  1KYO D;  2IZ0 A;  2KS1 B;  4XA4 A;  4ZNC A;  1JEK A;  3B71 A;  5AVQ B;  1FS0 E;  5EFW B;  1L0L D;  2NZ2 A;  3P8C D;  4HH2 A;  5AW8 B;  1LX8 A;  2LR2 A;  5B5E H;  5KJ7 C;  2N1T A;  1UIX A;  2KLV A;  2AEF A;  2C9N Y;  2C0W A;  3O6Q B;  4B86 A;  2ZJS E;  1H0T B;  2OYO A;  3WU2 E;  4I6M C;  1N73 B;  2QJP C;  1BE3 G;  2Q6Q A;  1BGY D;  3M91 A;  3RL0 B;  2ZXE B;  2JWD A;  3AEB C;  3RK2 B;  3LUR A;  1R8E A;  3Q1M A;  1VQL P;  3CD6 P;  2IFM A;  3IAO A;  2P1J A;  1VF5 B;  2N1T D;  2Z5I A;  5KAF H;  1S4X A;  2W6A A;  3FX0 A;  2KZJ A;  1R5L A;  2B88 A;  1JUN A;  3VMZ A;  1JCC A;  3QAO A;  3CWB E;  3L71 D;  2L91 A;  4W7Z A;  2OG0 A;  2RN0 A;  2Y0D A;  1RQU A;  3G71 P;  3K5B A;  2OYI B;  4D6T E;  1WT6 A;  3ITK A;  1Q7Y Q;  3VMY A;  4R4L A;  1KQL A;  4LLH A;  5APS A;  3GPV A;  1JOC A;  1KTM A;  4R4E A;  3T97 A;  3AE4 C;  3FXD A;  1YJ9 P;  1JNM A;  3CPW O;  1PV3 A;  1KQG B;  3AE7 C;  3H1I D;  1KB9 H;  1RF1 B;  1J1D C;  1R8D A;  4U3F J;  1OWA A;  3KPE A;  1DEE G;  3L73 G;  5GQQ A;  4IL6 E;  1XTG B;  3BCC G;  1GL2 D;  3II6 A;  3RK2 C;  3M0D C;  3RK2 D;  1JTH B;  2H8P D;  1KQS O;  5AVR B;  4D6T G;  4ZKU A;  1H8A A;  1VQN P;  2N1T B;  1T2K D;  2ZHH A;  1LT9 A;  5I41 B;  3R2P A;  1URQ A;  3EZ6 A;  2POH A;  1SQP K;  2IBZ I;  1SQB J;  5AVX B;  2ZYD A;  1MV8 A;  4BRY B;  1FDO A;  1FZG A;  3H1K J;  4IFD K;  1VQP P;  3L74 E;  2WSE J;  4OH8 B;  2WSF J;  5CJ4 A;  1GD2 E;  3H1H D;  2E42 A;  1BCC J;  1KIL E;  1L0N K;  1J2J B;  1W2E A;  4XE5 B;  3I55 P;  3CCJ P;  4PD4 H;  2JEE A;  1RF1 C;  2QG4 A;  3M0D A;  4N78 D;  3C8V A;  3L71 E;  1IC2 A;  1G1I A;  4YPC A;  3CCM P;  4RO0 A;  3RK3 D;  3HE5 A;  2AXT H;  3U59 A;  4M3L A;  2YXR B;  2FFD B;  1AQT A;  5CMZ A;  3L74 D;  3L72 E;  4OGQ B;  3CCQ P;  4GOF A;  3CI9 A;  4BRY A;  3R4Y A;  3GMA A;  2R3S A;  4C7N A;  1YBK A;  4N3Y B;  1OVR A;  2HG5 D;  3RK3 E;  3CX5 I;  3QH9 A;  3CL3 D;  3H1K D;  4D6T J;  2Q7C A;  1QX8 A;  2IFN A;  1HJB A;  2GA1 A;  3L37 A;  3H1H J;  4JYB A;  2ZHG A;  2E74 C;  1NO4 A;  1EDK A;  1SQX G;  1FBM A;  3WUU A;  1MUU A;  1FOS F;  3A0H H;  2KB7 P;  3JC2 2;  1LTB C;  1SQP D;  1YYC A;  5CBO A;  2YXQ B;  4IFF A;  2M3E A;  4H13 C;  3TGU G;  3UCS A;  3KDP B;  3RL0 D;  3I56 P;  5KKZ C;  1KYO I;  1S5L X;  2FKW B;  1VF5 D;  5BU5 A;  1BCC G;  3CME P;  1NTM E;  2E43 A;  2XNX A;  1N7S D;  3RK3 B;  1S72 P;  2VZ4 A;  1JTH A;  1DH3 A;  3H1K G;  3F5H A;  1QL2 A;  3MZW B;  3C9I A;  2C0X A;  3SWF A;  4DOJ A;  4R22 B;  1QLE D;  3GK6 A;  1ZR4 A;  3O8Z A;  3GF3 A;  5M1B A;  3A0B E;  4HKZ H;  2E76 B;  4K3A A;  1VQ8 P;  3T97 B;  2O3J A;  1LTJ A;  1JY3 P;  1L0N J;  3U1A A;  2R5B A;  2QVA A;  3H1J G;  2FYU K; 
#chains in the Genus database with same CATH homology
 3B71 A;  4R4M A;  3Q5P A;  3D6Y A;  1Y9B A;  2BEZ F;  3AEC C;  5KAU A;  5KAT A;  3Q5R A;  4A1M A;  1PV3 A;  4AYZ A;  4U7J A;  3AE3 C;  1KQG B;  3AE7 C;  3AEA C;  1VF5 C;  1OW7 A;  1YQ3 C;  3R4Y A;  3GMA A;  3EWK A;  4OGQ D;  4WLS A;  2D2C C;  1R8D A;  2NZ2 A;  2H88 C;  1JYH A;  3AEG C;  2E75 D;  1AJY A;  3AE9 C;  3RK3 E;  1D5Y A;  3AE6 C;  4Y28 J;  1DIP A;  5GQQ A;  3EZ9 A;  3E0H A;  1NYH A;  4WLW A;  2WPV B;  4YXD C;  2KVV A;  2E75 B;  4PV1 C;  4H0L C;  1LX8 A;  4PV1 D;  4LHF A;  1KQF B;  3EZ2 A;  5KCB A;  4I7Z B;  3LW5 J;  4H44 C;  3B49 A;  1UIX A;  2ZHG A;  2E74 C;  2FYN C;  3GLM A;  2ZHH A;  5I41 B;  5KAW A;  1Q08 A;  2WQY C;  1Q0A A;  1KOR A;  1EXJ A;  1ZME C;  3EZ6 A;  2DG6 A;  2YIU C;  2IDB A;  4RKU J;  5D90 A;  1DD4 A;  1S1C X;  3AE2 C;  2QJY C;  5KAX A;  4PV1 B;  1U57 A;  1Q07 A;  2P10 A;  2QJP C;  1VL2 A;  3EZ7 A;  3D71 A;  3R8J A;  1RH6 A;  1ZP0 C;  4R24 B;  4B0Y A;  2JML A;  3EZF A;  1KMI Z;  1OW8 A;  3UCS A;  4H13 C;  3SFD C;  5KLI C;  3Q5S A;  2E74 B;  3AEE C;  5L8R J;  1FDO A;  3AEB C;  5KKZ C;  4H44 B;  1EXI A;  2QSI A;  3LUR A;  1R8E A;  3Q1M A;  3AE8 C;  3IAO A;  1S5L X;  4H0L B;  3R8K A;  1VF5 B;  1K04 A;  4H13 B;  2E74 D;  1VF5 D;  4GDO A;  4H13 D;  1RQV A;  2J5U A;  2WSE J;  3O6Q A;  2WSF J;  1FDI A;  3S9O A;  2MKV A;  4J2N A;  1JB0 J;  2WSC J;  2IEF A;  2H89 C;  3H25 A;  4DCZ A;  1HF9 A;  1Q06 A;  1MKM A;  1KIL E;  2VZ4 A;  3IN6 A;  2GOV A;  1DD3 A;  2JO1 A;  3QAO A;  1Y6U A;  2JP3 A;  2HVA A;  3ABV C;  1YQ4 C;  3FGA D;  4TT3 H;  3Q2Y A;  2D2C D;  3Q3D A;  3D6Z A;  5I44 A;  4OGQ C;  2D2C B;  1TU3 F;  4Z1M H;  2K9Y A;  4I7Z C;  2OG0 A;  4H44 D;  2ZT9 B;  3AED C;  1NGM B;  2V7Q J;  1RQU A;  4H0L D;  4IL6 X;  3C8V A;  3G9R A;  4XFJ A;  1GMJ A;  4R22 B;  5D8C A;  1PL5 A;  3RL0 g;  1ZOY C;  3AE5 C;  1K05 A;  2ZT9 D;  3AEF C;  2KCU A;  2FBW C;  3GK6 A;  2E76 C;  5KAV A;  4AYZ B;  2YMK A;  3GP4 A;  3GF3 A;  3HH0 A;  1IK7 A;  2G3A A;  3GF7 A;  5M1B A;  2E75 C;  1PM6 A;  2E76 B;  1ZRT E;  2O01 J;  2BOW A;  1Q90 D;  1PIX A;  2QIW A;  3AE1 C;  4R4L A;  3T97 B;  3D70 A;  1JBG A;  1BOW A;  3GPV A;  4KT0 J;  4YTP C;  1OW6 A;  5E01 A;  2QJK C;  4R4E A;  2E76 D;  1KTM A;  1WMK A;  2OQQ A;  3AE4 C;  2ZT9 C;  3SFE C;  1HJ0 A;  2G8Y A;  1Q05 A;  2BEQ D;  1Q09 A;  2FXP A;  4OGQ B;  1OMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...