3D70A

Crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYALIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d70A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d70A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d70A03
4R22B 1Q05A 5D8CA 3D70A 5KAUA 5KCBA 3Q5RA 5KAXA 2GOVA 5E01A 2OQQA 3E0HA 1BOWA 1D5YA 3G9RA 4R24B 1JYHA 2ZHGA 3LURA 1Q07A 3D6YA 3QAOA 1R8DA 5KAWA 3R8JA 4J2NA 3R8KA 1Q08A 5D90A 3UCSA 3Q3DA 3GP4A 4R4MA 5GQQA 1Q0AA 5I41B 2BOWA 2ZHHA 3GK6A 2KCUA 1EXJA 4R4LA 1JBGA 4AYZB 3D6ZA 4A1MA 1Q06A 5I44A 1R8EA 1EXIA 2HVAA 5KAVA 3GPVA 3Q2YA 3Q5PA 4WLSA 3B49A 2JMLA 3Q1MA 1Q09A 2VZ4A 2J5UA 1DIPA 5KATA 4AYZA 3D71A 4R4EA 2DG6A 3Q5SA 3IAOA 3HH0A 3T97B 4B0YA 4WLWA
chains in the Genus database with same CATH superfamily
4HKZH 2P10A 1PP9J 1N7SD 2JDIH 1IFIA 2CPBA 2AEFA 3H1HJ 2WMMA 4BXLA 4Y28J 2QIWA 2G8YA 3AE7C 3G71P 1KILE 1RY3A 1SQBE 4IL6H 1T2KD 3HD7D 5KLVE 3CCEP 1MFZA 2A45I 4ZMDA 5AVRB 5TISE 3CCMP 1L0LG 1Q08A 3AEBC 1NTMD 2O1JA 1PP9G 2GM4A 1OMIA 1HJBA 1DEEG 4H0LC 3D71A 3L75D 2M5AA 3AE2C 2IX7C 3IR9A 3H1LE 1KD1Q 1X0TA 1USDA 5APVA 1IK7A 1Q90D 1BE3G 2LKMA 3CX5I 2WPSA 1RE3C 2E76B 4N78D 3KYQA 1J1DC 2SPZA 1T2KC 2ZYDA 3HD7C 2ITAA 1GW3A 2ZHGA 4TLFA 5GTHH 4J2NA 4L75A 5CHXA 2V7QH 1M57D 3GHGB 1FAVA 1NTKK 1JBGA 3V4QA 5B5EH 3HE5B 4AYZA 5KLVK 1VF5D 1SVFA 4IOIH 1AVOA 1Q05A 3LIDA 1NH4A 3L72J 1LWUB 3QH9A 1L0NE 4RJTA 2Q3EA 1JCCA 5AVQB 4PJ0E 2FYUD 2D2CB 2LXCB 2K37A 2O3JA 1RF1A 1LTBC 1IFPA 4DJGA 4L76A 4XFJA 1ZN5A 3VP8A 3AECC 4HB1A 1LT9B 1FDIA 4WB4A 1GL2D 2FFDC 1SQPK 5APWA 3L72G 4ZNCA 1NVOA 3RBXA 3L74G 3A0BE 1VF5C 4EI2A 3BCCJ 3B5NA 3L71G 3P8CD 2R5DA 3EFFK 3R8KA 4YXDC 1AVYA 1NTMK 2HPCA 4IFMA 4GDOA 1W2BO 1OIPA 1MV8A 1L2PA 3E0HA 5BU8B 5H2FE 1SQQE 2KUBA 2A06D 4OVNF 3EWKA 5KJ7D 3BCCG 1GL2C 1DIPA 1JOCA 5AVYB 1IC2A 4H0LB 1PL5A 3MTUE 2WZ7A 5AVWB 4Z1MH 2R5BA 1K8AQ 1OWAA 1EZVD 3UCSA 3H32B 3MUDA 5AW0B 2IBZD 2ZHHA 3SFEC 4GODA 2BEQD 2WVRA 1FZCC 1USEA 1A02F 3VP9A 3VMZA 2O01H 1NTKJ 1J1DB 1AJYA 5KAUA 2GA1A 2RN0A 2GOVA 3W67A 3HD7B 1SQBJ 5KLVJ 1HH0A 1E79H 3EQ2A 4IL6E 1G1IA 3H1ID 2K9JA 1XTGB 1OW7A 2O1KA 1S9KE 2FYUK 3RK3E 5KJ7C 1DD3A 2OG0A 1URQD 4JF7A 1NWQA 1FC2C 4JBZA 3IF4A 3MD0A 3Q3DA 1L0LD 1NTKG 1HJ0A 2QVAA 1PP9D 1PPJE 1FJPA 3Q2YA 2Y0EA 3ITKA 5KLVG 1PGJA 3H1HD 2HFED 3K5BA 3RL0D 1M1JA 1SQPJ 2WPVB 1VQPP 4EOTA 2ZT9D 2P7JA 1HTLC 1GK6A 1ZRTE 3H1JE 1BE3D 1RF0A 5CJ4A 2FFDB 1L4AA 3FWNA 5BVZA 1OVRA 2VZ4A 1R5LA 3CCSP 1YJNP 4WWIA 2IFMA 5BU5A 1G1JA 5GTHE 1P84I 3MHVA 3GF7A 2L5GB 4U3FE 2H7HA 5AVUB 2W90A 3G9RA 1JYHA 1VF5B 5B5EE 2KS1B 1SQPG 1A02J 3USSA 1NTZE 2M3BA 2B87A 1KN7A 3CXHH 2MJZA 1L0NJ 3OA7A 1VQ5P 2C9NY 3L37A 2KNCA 1W5CE 1VQ8P 3RL0C 4C7NB 4PD4D 2ZT9C 4DCZA 3T97A 2WSFJ 1NTMG 3HTKA 4L74A 5KAVA 5CCHC 2Y9ZA 1FDOA 2Q9IA 1IJDB 3M9BA 1GL2B 3L75G 2OYIA 1VQ7P 2HLOA 3H1KE 3HE4A 1HBWA 2ZVNB 2YO3A 2QRXA 2W6JH 4RESB 3L72D 1HGZA 1LTIC 1SLQA 1JY3O 1P84D 3L35A 3FWLA 1FZCB 2M8RA 3V2QA 1OVUA 4DT0A 4WY4A 3HRNA 1KZUB 2E76D 1HUCA 2WQYC 4A1MA 4C46A 1SQQJ 3WMM0 3WU2H 4BRYB 3V2PA 1NOHA 5AW4B 1NO4A 4WVZA 4JYCA 2Y9YA 2AEJA 5D8CA 4R24B 3AE6C 2BEZF 2WT7B 1EC5A 1KMIZ 1FU1A 1H8AA 2J58A 3BCCD 1NU1E 1GMJA 2IZ1A 1EDKA 1U7MA 3TYYA 3M91A 1KYOD 2XV5A 1JCDA 1Y47A 4NPFX 4W80A 3AE3C 4I7ZC 2FBWC 1SQVK 2M0BA 3HE5A 5KCBA 3U1CA 1K9MQ 4O9BA 2N1TA 1Z56A 2P1JA 3AEDC 3W68A 1LWUA 4IFFA 1VQ6P 1PM6A 1LTJA 3PH0A 2QEXP 3CCUP 1M7LA 2QSIA 3TK1A 1JB0J 4K35A 2ZXXA 3CCQP 3AE1C 3VMXA 1NHLA 1G2CB 5KKZC 3N4XA 3RL0B 1SP4A 2ZT9B 1NTKD 2A45H 1Q2NA 1Y6UA 1KILD 3CPWO 3L70E 1SQBD 4YTPC 3M0DA 5AW7B 1PZQA 5KLVD 3H1JJ 1FJKA 5CCGA 2FKWB 1RE4C 1BDDA 2E43A 1KQGB 5APYA 1GDTA 3I5CA 3C9IA 5I41B 5CMZA 4R4LA 4U3FJ 1LX8A 4H0LD 5GTIH 1CW5A 3CX5H 1UIXA 4UB8H 1ZW0A 3A2AA 5B66H 3L73J 1NTZJ 3EZ9A 5E01A 3M0AA 2QJKC 4OWFA 2W6AA 3CXHE 1J1EC 3EFGA 1SQPD 3H1IG 2YO2A 1SQXE 2V4HA 1KILC 1JMBA 1QVGO 4D6TE 1FZEA 3EZ7A 3B4SA 1WRGA 1Q07A 3TGUE 1MZ9A 3HUSC 1KFNA 3QWOC 2POHA 2YKOA 3L73G 4M3LA 4ZKPA 3D6ZA 3CC7P 2P58A 1JUNA 3H32A 2IEFA 1N7SA 1JMMA 1RQUA 3H1HG 1ZV8A 1GU5A 3VMAA 1RE3A 2WSCH 1L0ND 3M9HA 3SWKA 1SQVJ 1GZLA 2W8ZA 2OYHC 1NGMB 3HD7A 3PHLA 4I2LC 1FE6A 1FZAA 1WT6A 1X9VA 4I7ZB 3C1LA 4NPEA 1BOWA 3SFDC 3V2NA 3CCJP 1BCCJ 3IFMA 5KTBA 3WU2E 2UWJE 1WMKA 1X8YA 1PGPA 5DJTB 2IFNA 5KAFH 4I6MC 1SQVG 1Q09A 3OAKA 1SQBK 1Y8AA 1H88A 1PGQA 1QLED 1D5YA 2KXPB 1S5LH 3V6IA 1NU1J 2BCCJ 5KKZB 2C0XA 3BVHA 3EZFA 5AVZB 3VN0A 5KLIC 4UB6H 3P7KA 2O01N 1BCCG 4WLWA 2FFDA 2WSSH 2Q6QA 1EQ7A 2O01J 3PJSK 1VQOP 1SQQD 2Z5HA 2W27A 1DX7A 1T6AA 1LTAC 1EZVI 1JNMA 2FYNC 3B5ND 1ZLLA 2IBZI 1CI6B 3CLQA 3U59A 1H89A 1MUUA 1NU1G 1IFDA 2BCCG 3A3YB 3G4SP 1KC8Q 2OTKE 4GOEA 2QJKB 1LP1B 2K3RA 1FBMA 2NZ2A 4R4MA 1M56D 1J1EB 3KHUA 1BDCA 3B49A 4B0YA 1KILB 2WTYA 2H88C 1YI2P 3FX0A 5APXA 3D70A 1YBKA 1GL2A 1QVFO 4RO0A 1DEBA 3L70J 1L0NK 2XU6A 1FOSE 2WITA 3HUSB 1M1KQ 4PD4H 4AYCA 1EXIA 2KOGA 3B5NC 3V5BA 1KORA 1SFCA 3G6EP 1YIJP 3RK3D 4R4EA 2YXRB 1N7LA 2E5TA 3M9QA 1JTHA 3QAOA 5GTIE 3VYIA 3CX5E 1JY2N 2FYZA 4UB8E 2OYHB 3CCVP 5B66E 2HYNA 2QE7H 3RL0g 2WWWA 1ZXGA 5CBNA 4BRYA 1NKZB 3P8CE 1SQXJ 1P84H 2Z5IA 2PRRA 3CL3D 3H1JD 1U7JA 1NYHA 2M5AB 4HJGH 2H89C 3AEEC 3V4WA 4LLHA 4H44D 2AXTH 3RK3C 4U3FD 1HGVA 1T8ZA 3AEAC 1SQQK 4XA4A 2A06E 4PD4I 1RH5B 2GUSA 3L73D 1NTZD 3H1LJ 5KLIB 1SQBG 2IYOA 5APUA 2KP8A 3S1KA 1EDIA 1EZVE 3PTZA 1Q81Q 4TT3H 1KB9D 1N8RQ 2G3AA 2N9YB 4C7RA 5CCHD 2FYNB 1URQA 1DH3A 2B9BA 3TNUB 4DOJA 4AQRD 4H44C 1N73A 3H1LG 2FXMA 5D90A 2E5YA 1M1JC 5KAFE 2XNDH 1EXJA 1G2CA 2JR8A 1S5LE 1SQVD 4LC1A 4PV1D 2I1JA 1L0LE 1R5SA 1S2EA 1NJIQ 1PP9E 3RGUA 2HVAA 2LXBA 4QMAA 1H0TA 3B5NB 1BCCD 2P2UA 4IL6X 3LURA 1KYOI 2HPCB 1L0NG 4WY4D 2N9BA 1BE3E 3OJAB 1LTSC 1LGHB 2QM7A 1OFCX 1NU1D 1QEXA 5APQA 2BCCD 3L4FA 3PLNA 5APTA 1TU3F 4JQ0D 1ZOYC 5KAIH 1PGOA 2ZYAA 4PV1C 1BGYE 5APSA 2B89A 1NKNA 2C0WA 4WBAA 1NTZK 4GOFA 1FZGA 4B86A 1OW8A 3RK3B 2OGUA 4PD4E 1QX8A 2R32A 2ZVOB 3LW5J 4WY4C 4N6JA 4YPCA 1IFNA 2JEEA 2Q5UA 2JWAA 5TJHA 2I1KA 3AE4C 1AFOA 3KZIH 2Y0CA 1W2EA 1JY3P 3R4YA 2K9JB 1SQQG 1N2DC 1IZNB 5E79H 4GT1A 2E75D 3L72E 3L70D 2YKPA 2NRGA 3GHGA 1P84E 3GF3A 3L74E 4XE5B 3S4RA 2XNXA 3JSVC 2PFXA 4H44B 2KZIA 3L71E 3CCRP 4CPGA 1LTGC 1EDJA 2JWDA 2AXTE 2YXQB 1M1JB 3B8EB 2B88A 2OYOA 3VMYA 1NAYA 1X79B 3GMAA 2WSCJ 5GQQA 1RE4A 2E74D 2NPSD 1Q06A 3A7OA 3I56P 3BCCE 1AQTA 1SQXD 2N1TC 1LT9A 2E75C 2DG6A 1NU1K 1CI6A 2AEMA 3U1AA 4ASVA 3E1IA 5KAXA 2AXCA 1LTJC 3BATA 3NFQA 3ABVC 2QM8A 1MFTA 2XZRA 3GW6A 2R3SA 3P8MC 1VL2A 2KNCB 3MP7B 1PPJG 2V7QJ 1KQFB 3T97B 3R2PA 1IO4A 3HTKB 3H1LD 5L8RJ 1JY2P 2K1AA 3M0DC 3H1JG 4PV1B 5CCGC 1GTWA 2KCUA 3CWBE 1OW6A 4H13D 1Y9BA 3Q5PA 4N3YB 2LR2A 2E74C 2NPSC 3HE4B 2IYPA 3Q5SA 4MN4C 2RH0A 4U3FG 2J59M 2W6BA 5KAWA 1KTMA 3L36A 1NTKE 3RK2C 3GLMA 3KDPB 1NTZG 3CC2P 4WY4B 3H1KJ 2YNYA 2OARA 2RKLA 2OYHA 1BE3J 3B71A 4JYBA 3A0HH 5AW9B 4LGDE 2CPSA 2QA4P 2DW3A 5AW1B 1U57A 1QL1A 1BGYJ 2WSEH 5KAIE 2KLUA 3MZWB 4H13C 4Y99C 2QJPC 3IAOA 2C9LY 5AVXB 5AW3B 3RBZA 2YMKA 1VQLP 3H1KG 1N7SC 2Q1KA 2BOWA 2Y0DA 1SQPE 3GG2A 1IK9A 1ZR4A 2RMZA 1EDLA 3JCUH 3N7NA 3E1RA 1SQXK 2YIUC 4L73A 1ZR2A 1BGYG 1JY3N 2JO1A 1DD4A 1NTME 3KZIE 2ZYGA 5AVVB 4GIFA 3L75E 2N1TB 3FXEA 2E75B 4KJMA 2Q7CA 3WUVA 5E79E 1VDFA 2HODB 3KXDA 3TNUA 2QG4A 1LTJB 3L74J 3O6QB 1FS0E 3VOPA 5AW2B 1S3JA 3UIAA 3GPVA 3L71J 1KB9H 4N78E 4YXWH 2KS1A 3BASA 1HF9A 1J2JB 3HH0A 1ZMEC 3AEGC 4HH2A 3NTNA 2KSJA 3CX5D 1RF1C 4C7NA 2ZFCA 2I8DA 3MIWA 3LIEA 1R8EA 1VQ4P 1YQ3C 1AV1A 1S4XA 1Q82Q 4EIJA 1VQNP 2E74B 2P67A 2NPSB 1SFCD 1K05A 3Q5RA 1YYCA 1LT1A 1Q7YQ 2FY8A 1HVVA 1NAFA 3RK2B 1FDMA 2FYUE 1PV3A 3CCLP 1S9KD 1OXZA 4R22B 3TSIA 3BRTB 1FZCA 3R8JA 4OH8B 1AA0A 1KB9I 2Z4EA 1PPJD 3II6A 1RH6A 3L70G 1E5WA 4KT0J 3Q1MA 3EZ6A 2FXOA 3CWBJ 3AE5C 4H13B 2K9YA 4Y99B 4A7PA 2QJPB 4DZOA 1OX3A 5EFWB 1SFCC 2PAJA 3WUTA 5KJ7A 1ZRTD 2Q3IA 3BRVB 4KHXA 1N7SB 3H6PA 1GW4A 4D6TJ 1T3JA 2R44A 4OGQD 2WT7A 1M8OB 4BWNA 1N86A 3SSUA 3TGUJ 3MUDC 2YIUB 1JEKA 1IFMA 4NPDA 1D7MA 2YKQA 1YITP 3JC22 3CWBG 4EDFA 3A0HE 3NMDA 1SQXG 3EZ2A 4GKGA 2KB7P 1UIIA 2KLVA 3CD6P 1KQSO 4D6TG 2GUVA 1L4AD 1PFIA 2ZAEB 2M3EA 1SS1A 3TGUG 5CJ0A 2IBZE 1KYOH 4AYZB 3TDKA 3ZDMA 4OGQC 3KPEA 1MKMA 2J5UA 3TF5A 2CK3H 2OQQA 1VPCA 3H1KD 1YJ9P 3D6YA 1QL2A 3JCUE 1FOSF 3GP4A 1T3UA 1JO5A 3H1IE 1RF1B 2IDBA 1CSBA 4I1LA 1IFJA 1NTMJ 1RF0C 1URQC 4W7YA 1CZQA 1L4AC 5CCHA 2MKVA 1R8DA 1BGYD 3PP5A 5AVTB 3L75J 4UB6E 2OTLP 1Q0AA 1BSNA 1YTZT 3L73E 5C39A 2IPPA 1N73C 2HR3A 3H1HE 3VTPC 1VQMP 2KYVA 1Q86Q 4HYTB 2QJYC 1RHZB 3V2RA 4IFDK 1KB9E 4RKUJ 1M90Q 3P32A 2ZXEB 5TISH 4U7JA 1FZFA 1K04A 2R3CA 1YQ4C 1GK4A 3AE8C 3AE9C 2XKMA 2WPRA 1YHQP 5AW6B 2WPQA 3C8VA 1SFCB 2OYIC 2KK7A 1KQLA 3FGAD 1SQVE 2IZ0A 1JTHB 3L74D 2FXPA 1YJWP 2VRSA 3SWFA 1S1CX 2KSEA 2FYUJ 3L71D 1LTTC 4AUWA 1L0LK 5AVSB 3GK6A 3CXHI 2E42A 1BCCE 2JKVA 3M06A 2L91A 1BSHA 2KZJA 2A45G 2PGDA 1GU4A 2OTJP 2K88A 5AW8B 1YTZI 4DCKA 2XDJA 1S5LX 2N1TD 5I44A 3WUUA 1OVVA 1LNQA 2FYUG 1HWTC 3I55P 2BCCE 1LJ2A 1PIXA 4OGQB 4PJ0H 1VQKP 2BASA 2WSFH 2JP3A 2H43A 2D2CD 3CC4P 2E76C 4K3AA 3CMAP 2YMYA 2HG5D 2JJLA 1XTCC 3FXDA 1URQB 4ZKUA 5CCGD 3A0BH 3GHGC 1L4AB 3OW2O 3CXHD 1VQ9P 2HODA 1GD2E 1ZP0C 3CWBD 2KI7B 4W7ZA 3H25A 1N73B 3O6QA 3F89A 1JM0A 1JY2O 2WSEJ 4D6TD 1LWUC 3G3ZA 3NXSA 5M1BA 1KV4A 2KVVA 1KYOE 1X22A 3AEFC 1RQVA 5DJUB 3O8ZA 2QJYB 3RK2D 2B87B 3S9OA 3TGUD 2A06G 2ZJSE 1KFMA 3KQGA 4EYYQ 5AW5B 3CMEP 2W83C 5H2FH 3CI9A 2D2CC 4WLSA 3MGNA 1LP1A 5KATA 1OZHA 1K73Q 3H1IJ 3PRJA 5CBOA 1FZBA 1LT9C 1EZVG 2NPSA 4LHFA 1KILA 3LW5H 2IBZG 3A5TA 1S72P 1H0TB 3SWYA 4ASWA 2KIKA 2OYIB 2JMLA 3IN6A 2PP6A 1QGKB 4JPZB 1L0LJ 3HUSA 5K5GB 3F5HA 1AQ5A 2H8PD 3E7KA
chains in the Genus database with same CATH topology
3GF7A 1Q05A 5D8CA 3D70A 1TU3F 1ZOYC 2P10A 1ZMEC 2QJYC 3AEGC 1BOWA 3G9RA 4R24B 1JYHA 4Z1MH 1KQGB 3SFDC 1VF5B 3AE6C 2BEZF 4PV1C 3GMAA 2WSCJ 3UCSA 4TT3H 4RKUJ 2JP3A 1U57A 2D2CD 5GQQA 5I41B 2E76C 2ZHHA 1KMIZ 4Y28J 4R4LA 2G3AA 3SFEC 2QIWA 1WMKA 2E74D 2G8YA 3AE7C 1Q06A 1R8EA 1LX8A 1EXIA 1KILE 2BEQD 4H0LD 1YQ3C 4U7JA 1K04A 1KORA 2D2CB 3EZ2A 1Q09A 2E75C 1UIXA 4H13C 4R4EA 1GMJA 2DG6A 2QJPC 3IAOA 2E74B 1YQ4C 1AJYA 4XFJA 1OW8A 4H44C 5KAUA 2YMKA 3AE8C 1K05A 3Q5RA 5KAXA 2GOVA 3EZ9A 5E01A 1D5YA 3AE9C 2QJKC 3ABVC 3AECC 3QAOA 2ZT9C 4DCZA 1Q08A 5D90A 3C8VA 1FDIA 2BOWA 3EZFA 3AEBC 1ZP0C 2WSFJ 1EXJA 4AYZB 3LW5J 1VL2A 1OW7A 5KLIC 1OMIA 3H25A 2V7QJ 5KAVA 4OGQC 1FDOA 1PV3A 3AE3C 3FGAD 3O6QA 1MKMA 4H0LC 2J5UA 4I7ZC 3RK3E 3RL0g 2FBWC 3D71A 2YIUC 1DD3A 2WSEJ 3AE4C 1KQFB 3T97B 4WLWA 2OG0A 2FXPA 3AE2C 4R22B 2O01J 5M1BA 1VF5C 4H0LB 4PV1D 5KCBA 1S1CX 2KVVA 2OQQA 3AEFC 3EZ7A 3R4YA 1RQVA 5L8RJ 1Q07A 3D6YA 3S9OA 3R8JA 2JO1A 1IK7A 3R8KA 3Q3DA 3GP4A 1DD4A 1Q90D 3GK6A 4PV1B 3AEDC 2FYNC 2KCUA 1HJ0A 1NYHA 4YXDC 3D6ZA 2D2CC 1OW6A 2E75D 2E76B 4H13D 4I7ZB 2HVAA 1PM6A 1Y9BA 3Q2YA 4GDOA 1RH6A 3Q5PA 4WLSA 2H89C 3AEEC 2IEFA 3Q1MA 2E74C 2IDBA 3EZ6A 4KT0J 1RQUA 5KATA 4H44D 3Q5SA 3GF3A 2QSIA 2E75B 4H13B 3AE5C 1JB0J 2K9YA 2WPVB 2ZT9D 3AE1C 3E0HA 2ZHGA 4IL6X 5KKZC 4H44B 3LURA 3AEAC 2MKVA 1R8DA 4LHFA 2E76D 5KAWA 1ZRTE 4J2NA 1KTMA 4R4MA 2NZ2A 1Q0AA 2ZT9B 2WQYC 1NGMB 3EWKA 1JBGA 4OGQD 3GLMA 4A1MA 1S5LX 1Y6UA 5I44A 3GPVA 3B49A 2JMLA 3IN6A 4YTPC 2VZ4A 1DIPA 4AYZA 1HF9A 1PIXA 1VF5D 4OGQB 3HH0A 4B0YA 3B71A 1PL5A 2H88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R22 B;  1Q05 A;  5D8C A;  3D70 A;  5KAU A;  5KCB A;  3Q5R A;  5KAX A;  2GOV A;  5E01 A;  2OQQ A;  3E0H A;  1BOW A;  1D5Y A;  3G9R A;  4R24 B;  1JYH A;  2ZHG A;  3LUR A;  1Q07 A;  3D6Y A;  3QAO A;  1R8D A;  5KAW A;  3R8J A;  4J2N A;  3R8K A;  1Q08 A;  5D90 A;  3UCS A;  3Q3D A;  3GP4 A;  4R4M A;  5GQQ A;  1Q0A A;  5I41 B;  2BOW A;  2ZHH A;  3GK6 A;  2KCU A;  1EXJ A;  4R4L A;  1JBG A;  4AYZ B;  3D6Z A;  4A1M A;  1Q06 A;  5I44 A;  1R8E A;  1EXI A;  2HVA A;  5KAV A;  3GPV A;  3Q2Y A;  3Q5P A;  4WLS A;  3B49 A;  2JML A;  3Q1M A;  1Q09 A;  2VZ4 A;  2J5U A;  1DIP A;  5KAT A;  4AYZ A;  3D71 A;  4R4E A;  2DG6 A;  3Q5S A;  3IAO A;  3HH0 A;  3T97 B;  4B0Y A;  4WLW A; 
#chains in the Genus database with same CATH topology
 4HKZ H;  2P10 A;  1PP9 J;  1N7S D;  2JDI H;  1IFI A;  2CPB A;  2AEF A;  3H1H J;  2WMM A;  4BXL A;  4Y28 J;  2QIW A;  2G8Y A;  3AE7 C;  3G71 P;  1KIL E;  1RY3 A;  1SQB E;  4IL6 H;  1T2K D;  3HD7 D;  5KLV E;  3CCE P;  1MFZ A;  2A45 I;  4ZMD A;  5AVR B;  5TIS E;  3CCM P;  1L0L G;  1Q08 A;  3AEB C;  1NTM D;  2O1J A;  1PP9 G;  2GM4 A;  1OMI A;  1HJB A;  1DEE G;  4H0L C;  3D71 A;  3L75 D;  2M5A A;  3AE2 C;  2IX7 C;  3IR9 A;  3H1L E;  1KD1 Q;  1X0T A;  1USD A;  5APV A;  1IK7 A;  1Q90 D;  1BE3 G;  2LKM A;  3CX5 I;  2WPS A;  1RE3 C;  2E76 B;  4N78 D;  3KYQ A;  1J1D C;  2SPZ A;  1T2K C;  2ZYD A;  3HD7 C;  2ITA A;  1GW3 A;  2ZHG A;  4TLF A;  5GTH H;  4J2N A;  4L75 A;  5CHX A;  2V7Q H;  1M57 D;  3GHG B;  1FAV A;  1NTK K;  1JBG A;  3V4Q A;  5B5E H;  3HE5 B;  4AYZ A;  5KLV K;  1VF5 D;  1SVF A;  4IOI H;  1AVO A;  1Q05 A;  3LID A;  1NH4 A;  3L72 J;  1LWU B;  3QH9 A;  1L0N E;  4RJT A;  2Q3E A;  1JCC A;  5AVQ B;  4PJ0 E;  2FYU D;  2D2C B;  2LXC B;  2K37 A;  2O3J A;  1RF1 A;  1LTB C;  1IFP A;  4DJG A;  4L76 A;  4XFJ A;  1ZN5 A;  3VP8 A;  3AEC C;  4HB1 A;  1LT9 B;  1FDI A;  4WB4 A;  1GL2 D;  2FFD C;  1SQP K;  5APW A;  3L72 G;  4ZNC A;  1NVO A;  3RBX A;  3L74 G;  3A0B E;  1VF5 C;  4EI2 A;  3BCC J;  3B5N A;  3L71 G;  3P8C D;  2R5D A;  3EFF K;  3R8K A;  4YXD C;  1AVY A;  1NTM K;  2HPC A;  4IFM A;  4GDO A;  1W2B O;  1OIP A;  1MV8 A;  1L2P A;  3E0H A;  5BU8 B;  5H2F E;  1SQQ E;  2KUB A;  2A06 D;  4OVN F;  3EWK A;  5KJ7 D;  3BCC G;  1GL2 C;  1DIP A;  1JOC A;  5AVY B;  1IC2 A;  4H0L B;  1PL5 A;  3MTU E;  2WZ7 A;  5AVW B;  4Z1M H;  2R5B A;  1K8A Q;  1OWA A;  1EZV D;  3UCS A;  3H32 B;  3MUD A;  5AW0 B;  2IBZ D;  2ZHH A;  3SFE C;  4GOD A;  2BEQ D;  2WVR A;  1FZC C;  1USE A;  1A02 F;  3VP9 A;  3VMZ A;  2O01 H;  1NTK J;  1J1D B;  1AJY A;  5KAU A;  2GA1 A;  2RN0 A;  2GOV A;  3W67 A;  3HD7 B;  1SQB J;  5KLV J;  1HH0 A;  1E79 H;  3EQ2 A;  4IL6 E;  1G1I A;  3H1I D;  2K9J A;  1XTG B;  1OW7 A;  2O1K A;  1S9K E;  2FYU K;  3RK3 E;  5KJ7 C;  1DD3 A;  2OG0 A;  1URQ D;  4JF7 A;  1NWQ A;  1FC2 C;  4JBZ A;  3IF4 A;  3MD0 A;  3Q3D A;  1L0L D;  1NTK G;  1HJ0 A;  2QVA A;  1PP9 D;  1PPJ E;  1FJP A;  3Q2Y A;  2Y0E A;  3ITK A;  5KLV G;  1PGJ A;  3H1H D;  2HFE D;  3K5B A;  3RL0 D;  1M1J A;  1SQP J;  2WPV B;  1VQP P;  4EOT A;  2ZT9 D;  2P7J A;  1HTL C;  1GK6 A;  1ZRT E;  3H1J E;  1BE3 D;  1RF0 A;  5CJ4 A;  2FFD B;  1L4A A;  3FWN A;  5BVZ A;  1OVR A;  2VZ4 A;  1R5L A;  3CCS P;  1YJN P;  4WWI A;  2IFM A;  5BU5 A;  1G1J A;  5GTH E;  1P84 I;  3MHV A;  3GF7 A;  2L5G B;  4U3F E;  2H7H A;  5AVU B;  2W90 A;  3G9R A;  1JYH A;  1VF5 B;  5B5E E;  2KS1 B;  1SQP G;  1A02 J;  3USS A;  1NTZ E;  2M3B A;  2B87 A;  1KN7 A;  3CXH H;  2MJZ A;  1L0N J;  3OA7 A;  1VQ5 P;  2C9N Y;  3L37 A;  2KNC A;  1W5C E;  1VQ8 P;  3RL0 C;  4C7N B;  4PD4 D;  2ZT9 C;  4DCZ A;  3T97 A;  2WSF J;  1NTM G;  3HTK A;  4L74 A;  5KAV A;  5CCH C;  2Y9Z A;  1FDO A;  2Q9I A;  1IJD B;  3M9B A;  1GL2 B;  3L75 G;  2OYI A;  1VQ7 P;  2HLO A;  3H1K E;  3HE4 A;  1HBW A;  2ZVN B;  2YO3 A;  2QRX A;  2W6J H;  4RES B;  3L72 D;  1HGZ A;  1LTI C;  1SLQ A;  1JY3 O;  1P84 D;  3L35 A;  3FWL A;  1FZC B;  2M8R A;  3V2Q A;  1OVU A;  4DT0 A;  4WY4 A;  3HRN A;  1KZU B;  2E76 D;  1HUC A;  2WQY C;  4A1M A;  4C46 A;  1SQQ J;  3WMM 0;  3WU2 H;  4BRY B;  3V2P A;  1NOH A;  5AW4 B;  1NO4 A;  4WVZ A;  4JYC A;  2Y9Y A;  2AEJ A;  5D8C A;  4R24 B;  3AE6 C;  2BEZ F;  2WT7 B;  1EC5 A;  1KMI Z;  1FU1 A;  1H8A A;  2J58 A;  3BCC D;  1NU1 E;  1GMJ A;  2IZ1 A;  1EDK A;  1U7M A;  3TYY A;  3M91 A;  1KYO D;  2XV5 A;  1JCD A;  1Y47 A;  4NPF X;  4W80 A;  3AE3 C;  4I7Z C;  2FBW C;  1SQV K;  2M0B A;  3HE5 A;  5KCB A;  3U1C A;  1K9M Q;  4O9B A;  2N1T A;  1Z56 A;  2P1J A;  3AED C;  3W68 A;  1LWU A;  4IFF A;  1VQ6 P;  1PM6 A;  1LTJ A;  3PH0 A;  2QEX P;  3CCU P;  1M7L A;  2QSI A;  3TK1 A;  1JB0 J;  4K35 A;  2ZXX A;  3CCQ P;  3AE1 C;  3VMX A;  1NHL A;  1G2C B;  5KKZ C;  3N4X A;  3RL0 B;  1SP4 A;  2ZT9 B;  1NTK D;  2A45 H;  1Q2N A;  1Y6U A;  1KIL D;  3CPW O;  3L70 E;  1SQB D;  4YTP C;  3M0D A;  5AW7 B;  1PZQ A;  5KLV D;  3H1J J;  1FJK A;  5CCG A;  2FKW B;  1RE4 C;  1BDD A;  2E43 A;  1KQG B;  5APY A;  1GDT A;  3I5C A;  3C9I A;  5I41 B;  5CMZ A;  4R4L A;  4U3F J;  1LX8 A;  4H0L D;  5GTI H;  1CW5 A;  3CX5 H;  1UIX A;  4UB8 H;  1ZW0 A;  3A2A A;  5B66 H;  3L73 J;  1NTZ J;  3EZ9 A;  5E01 A;  3M0A A;  2QJK C;  4OWF A;  2W6A A;  3CXH E;  1J1E C;  3EFG A;  1SQP D;  3H1I G;  2YO2 A;  1SQX E;  2V4H A;  1KIL C;  1JMB A;  1QVG O;  4D6T E;  1FZE A;  3EZ7 A;  3B4S A;  1WRG A;  1Q07 A;  3TGU E;  1MZ9 A;  3HUS C;  1KFN A;  3QWO C;  2POH A;  2YKO A;  3L73 G;  4M3L A;  4ZKP A;  3D6Z A;  3CC7 P;  2P58 A;  1JUN A;  3H32 A;  2IEF A;  1N7S A;  1JMM A;  1RQU A;  3H1H G;  1ZV8 A;  1GU5 A;  3VMA A;  1RE3 A;  2WSC H;  1L0N D;  3M9H A;  3SWK A;  1SQV J;  1GZL A;  2W8Z A;  2OYH C;  1NGM B;  3HD7 A;  3PHL A;  4I2L C;  1FE6 A;  1FZA A;  1WT6 A;  1X9V A;  4I7Z B;  3C1L A;  4NPE A;  1BOW A;  3SFD C;  3V2N A;  3CCJ P;  1BCC J;  3IFM A;  5KTB A;  3WU2 E;  2UWJ E;  1WMK A;  1X8Y A;  1PGP A;  5DJT B;  2IFN A;  5KAF H;  4I6M C;  1SQV G;  1Q09 A;  3OAK A;  1SQB K;  1Y8A A;  1H88 A;  1PGQ A;  1QLE D;  1D5Y A;  2KXP B;  1S5L H;  3V6I A;  1NU1 J;  2BCC J;  5KKZ B;  2C0X A;  3BVH A;  3EZF A;  5AVZ B;  3VN0 A;  5KLI C;  4UB6 H;  3P7K A;  2O01 N;  1BCC G;  4WLW A;  2FFD A;  2WSS H;  2Q6Q A;  1EQ7 A;  2O01 J;  3PJS K;  1VQO P;  1SQQ D;  2Z5H A;  2W27 A;  1DX7 A;  1T6A A;  1LTA C;  1EZV I;  1JNM A;  2FYN C;  3B5N D;  1ZLL A;  2IBZ I;  1CI6 B;  3CLQ A;  3U59 A;  1H89 A;  1MUU A;  1NU1 G;  1IFD A;  2BCC G;  3A3Y B;  3G4S P;  1KC8 Q;  2OTK E;  4GOE A;  2QJK B;  1LP1 B;  2K3R A;  1FBM A;  2NZ2 A;  4R4M A;  1M56 D;  1J1E B;  3KHU A;  1BDC A;  3B49 A;  4B0Y A;  1KIL B;  2WTY A;  2H88 C;  1YI2 P;  3FX0 A;  5APX A;  3D70 A;  1YBK A;  1GL2 A;  1QVF O;  4RO0 A;  1DEB A;  3L70 J;  1L0N K;  2XU6 A;  1FOS E;  2WIT A;  3HUS B;  1M1K Q;  4PD4 H;  4AYC A;  1EXI A;  2KOG A;  3B5N C;  3V5B A;  1KOR A;  1SFC A;  3G6E P;  1YIJ P;  3RK3 D;  4R4E A;  2YXR B;  1N7L A;  2E5T A;  3M9Q A;  1JTH A;  3QAO A;  5GTI E;  3VYI A;  3CX5 E;  1JY2 N;  2FYZ A;  4UB8 E;  2OYH B;  3CCV P;  5B66 E;  2HYN A;  2QE7 H;  3RL0 g;  2WWW A;  1ZXG A;  5CBN A;  4BRY A;  1NKZ B;  3P8C E;  1SQX J;  1P84 H;  2Z5I A;  2PRR A;  3CL3 D;  3H1J D;  1U7J A;  1NYH A;  2M5A B;  4HJG H;  2H89 C;  3AEE C;  3V4W A;  4LLH A;  4H44 D;  2AXT H;  3RK3 C;  4U3F D;  1HGV A;  1T8Z A;  3AEA C;  1SQQ K;  4XA4 A;  2A06 E;  4PD4 I;  1RH5 B;  2GUS A;  3L73 D;  1NTZ D;  3H1L J;  5KLI B;  1SQB G;  2IYO A;  5APU A;  2KP8 A;  3S1K A;  1EDI A;  1EZV E;  3PTZ A;  1Q81 Q;  4TT3 H;  1KB9 D;  1N8R Q;  2G3A A;  2N9Y B;  4C7R A;  5CCH D;  2FYN B;  1URQ A;  1DH3 A;  2B9B A;  3TNU B;  4DOJ A;  4AQR D;  4H44 C;  1N73 A;  3H1L G;  2FXM A;  5D90 A;  2E5Y A;  1M1J C;  5KAF E;  2XND H;  1EXJ A;  1G2C A;  2JR8 A;  1S5L E;  1SQV D;  4LC1 A;  4PV1 D;  2I1J A;  1L0L E;  1R5S A;  1S2E A;  1NJI Q;  1PP9 E;  3RGU A;  2HVA A;  2LXB A;  4QMA A;  1H0T A;  3B5N B;  1BCC D;  2P2U A;  4IL6 X;  3LUR A;  1KYO I;  2HPC B;  1L0N G;  4WY4 D;  2N9B A;  1BE3 E;  3OJA B;  1LTS C;  1LGH B;  2QM7 A;  1OFC X;  1NU1 D;  1QEX A;  5APQ A;  2BCC D;  3L4F A;  3PLN A;  5APT A;  1TU3 F;  4JQ0 D;  1ZOY C;  5KAI H;  1PGO A;  2ZYA A;  4PV1 C;  1BGY E;  5APS A;  2B89 A;  1NKN A;  2C0W A;  4WBA A;  1NTZ K;  4GOF A;  1FZG A;  4B86 A;  1OW8 A;  3RK3 B;  2OGU A;  4PD4 E;  1QX8 A;  2R32 A;  2ZVO B;  3LW5 J;  4WY4 C;  4N6J A;  4YPC A;  1IFN A;  2JEE A;  2Q5U A;  2JWA A;  5TJH A;  2I1K A;  3AE4 C;  1AFO A;  3KZI H;  2Y0C A;  1W2E A;  1JY3 P;  3R4Y A;  2K9J B;  1SQQ G;  1N2D C;  1IZN B;  5E79 H;  4GT1 A;  2E75 D;  3L72 E;  3L70 D;  2YKP A;  2NRG A;  3GHG A;  1P84 E;  3GF3 A;  3L74 E;  4XE5 B;  3S4R A;  2XNX A;  3JSV C;  2PFX A;  4H44 B;  2KZI A;  3L71 E;  3CCR P;  4CPG A;  1LTG C;  1EDJ A;  2JWD A;  2AXT E;  2YXQ B;  1M1J B;  3B8E B;  2B88 A;  2OYO A;  3VMY A;  1NAY A;  1X79 B;  3GMA A;  2WSC J;  5GQQ A;  1RE4 A;  2E74 D;  2NPS D;  1Q06 A;  3A7O A;  3I56 P;  3BCC E;  1AQT A;  1SQX D;  2N1T C;  1LT9 A;  2E75 C;  2DG6 A;  1NU1 K;  1CI6 A;  2AEM A;  3U1A A;  4ASV A;  3E1I A;  5KAX A;  2AXC A;  1LTJ C;  3BAT A;  3NFQ A;  3ABV C;  2QM8 A;  1MFT A;  2XZR A;  3GW6 A;  2R3S A;  3P8M C;  1VL2 A;  2KNC B;  3MP7 B;  1PPJ G;  2V7Q J;  1KQF B;  3T97 B;  3R2P A;  1IO4 A;  3HTK B;  3H1L D;  5L8R J;  1JY2 P;  2K1A A;  3M0D C;  3H1J G;  4PV1 B;  5CCG C;  1GTW A;  2KCU A;  3CWB E;  1OW6 A;  4H13 D;  1Y9B A;  3Q5P A;  4N3Y B;  2LR2 A;  2E74 C;  2NPS C;  3HE4 B;  2IYP A;  3Q5S A;  4MN4 C;  2RH0 A;  4U3F G;  2J59 M;  2W6B A;  5KAW A;  1KTM A;  3L36 A;  1NTK E;  3RK2 C;  3GLM A;  3KDP B;  1NTZ G;  3CC2 P;  4WY4 B;  3H1K J;  2YNY A;  2OAR A;  2RKL A;  2OYH A;  1BE3 J;  3B71 A;  4JYB A;  3A0H H;  5AW9 B;  4LGD E;  2CPS A;  2QA4 P;  2DW3 A;  5AW1 B;  1U57 A;  1QL1 A;  1BGY J;  2WSE H;  5KAI E;  2KLU A;  3MZW B;  4H13 C;  4Y99 C;  2QJP C;  3IAO A;  2C9L Y;  5AVX B;  5AW3 B;  3RBZ A;  2YMK A;  1VQL P;  3H1K G;  1N7S C;  2Q1K A;  2BOW A;  2Y0D A;  1SQP E;  3GG2 A;  1IK9 A;  1ZR4 A;  2RMZ A;  1EDL A;  3JCU H;  3N7N A;  3E1R A;  1SQX K;  2YIU C;  4L73 A;  1ZR2 A;  1BGY G;  1JY3 N;  2JO1 A;  1DD4 A;  1NTM E;  3KZI E;  2ZYG A;  5AVV B;  4GIF A;  3L75 E;  2N1T B;  3FXE A;  2E75 B;  4KJM A;  2Q7C A;  3WUV A;  5E79 E;  1VDF A;  2HOD B;  3KXD A;  3TNU A;  2QG4 A;  1LTJ B;  3L74 J;  3O6Q B;  1FS0 E;  3VOP A;  5AW2 B;  1S3J A;  3UIA A;  3GPV A;  3L71 J;  1KB9 H;  4N78 E;  4YXW H;  2KS1 A;  3BAS A;  1HF9 A;  1J2J B;  3HH0 A;  1ZME C;  3AEG C;  4HH2 A;  3NTN A;  2KSJ A;  3CX5 D;  1RF1 C;  4C7N A;  2ZFC A;  2I8D A;  3MIW A;  3LIE A;  1R8E A;  1VQ4 P;  1YQ3 C;  1AV1 A;  1S4X A;  1Q82 Q;  4EIJ A;  1VQN P;  2E74 B;  2P67 A;  2NPS B;  1SFC D;  1K05 A;  3Q5R A;  1YYC A;  1LT1 A;  1Q7Y Q;  2FY8 A;  1HVV A;  1NAF A;  3RK2 B;  1FDM A;  2FYU E;  1PV3 A;  3CCL P;  1S9K D;  1OXZ A;  4R22 B;  3TSI A;  3BRT B;  1FZC A;  3R8J A;  4OH8 B;  1AA0 A;  1KB9 I;  2Z4E A;  1PPJ D;  3II6 A;  1RH6 A;  3L70 G;  1E5W A;  4KT0 J;  3Q1M A;  3EZ6 A;  2FXO A;  3CWB J;  3AE5 C;  4H13 B;  2K9Y A;  4Y99 B;  4A7P A;  2QJP B;  4DZO A;  1OX3 A;  5EFW B;  1SFC C;  2PAJ A;  3WUT A;  5KJ7 A;  1ZRT D;  2Q3I A;  3BRV B;  4KHX A;  1N7S B;  3H6P A;  1GW4 A;  4D6T J;  1T3J A;  2R44 A;  4OGQ D;  2WT7 A;  1M8O B;  4BWN A;  1N86 A;  3SSU A;  3TGU J;  3MUD C;  2YIU B;  1JEK A;  1IFM A;  4NPD A;  1D7M A;  2YKQ A;  1YIT P;  3JC2 2;  3CWB G;  4EDF A;  3A0H E;  3NMD A;  1SQX G;  3EZ2 A;  4GKG A;  2KB7 P;  1UII A;  2KLV A;  3CD6 P;  1KQS O;  4D6T G;  2GUV A;  1L4A D;  1PFI A;  2ZAE B;  2M3E A;  1SS1 A;  3TGU G;  5CJ0 A;  2IBZ E;  1KYO H;  4AYZ B;  3TDK A;  3ZDM A;  4OGQ C;  3KPE A;  1MKM A;  2J5U A;  3TF5 A;  2CK3 H;  2OQQ A;  1VPC A;  3H1K D;  1YJ9 P;  3D6Y A;  1QL2 A;  3JCU E;  1FOS F;  3GP4 A;  1T3U A;  1JO5 A;  3H1I E;  1RF1 B;  2IDB A;  1CSB A;  4I1L A;  1IFJ A;  1NTM J;  1RF0 C;  1URQ C;  4W7Y A;  1CZQ A;  1L4A C;  5CCH A;  2MKV A;  1R8D A;  1BGY D;  3PP5 A;  5AVT B;  3L75 J;  4UB6 E;  2OTL P;  1Q0A A;  1BSN A;  1YTZ T;  3L73 E;  5C39 A;  2IPP A;  1N73 C;  2HR3 A;  3H1H E;  3VTP C;  1VQM P;  2KYV A;  1Q86 Q;  4HYT B;  2QJY C;  1RHZ B;  3V2R A;  4IFD K;  1KB9 E;  4RKU J;  1M90 Q;  3P32 A;  2ZXE B;  5TIS H;  4U7J A;  1FZF A;  1K04 A;  2R3C A;  1YQ4 C;  1GK4 A;  3AE8 C;  3AE9 C;  2XKM A;  2WPR A;  1YHQ P;  5AW6 B;  2WPQ A;  3C8V A;  1SFC B;  2OYI C;  2KK7 A;  1KQL A;  3FGA D;  1SQV E;  2IZ0 A;  1JTH B;  3L74 D;  2FXP A;  1YJW P;  2VRS A;  3SWF A;  1S1C X;  2KSE A;  2FYU J;  3L71 D;  1LTT C;  4AUW A;  1L0L K;  5AVS B;  3GK6 A;  3CXH I;  2E42 A;  1BCC E;  2JKV A;  3M06 A;  2L91 A;  1BSH A;  2KZJ A;  2A45 G;  2PGD A;  1GU4 A;  2OTJ P;  2K88 A;  5AW8 B;  1YTZ I;  4DCK A;  2XDJ A;  1S5L X;  2N1T D;  5I44 A;  3WUU A;  1OVV A;  1LNQ A;  2FYU G;  1HWT C;  3I55 P;  2BCC E;  1LJ2 A;  1PIX A;  4OGQ B;  4PJ0 H;  1VQK P;  2BAS A;  2WSF H;  2JP3 A;  2H43 A;  2D2C D;  3CC4 P;  2E76 C;  4K3A A;  3CMA P;  2YMY A;  2HG5 D;  2JJL A;  1XTC C;  3FXD A;  1URQ B;  4ZKU A;  5CCG D;  3A0B H;  3GHG C;  1L4A B;  3OW2 O;  3CXH D;  1VQ9 P;  2HOD A;  1GD2 E;  1ZP0 C;  3CWB D;  2KI7 B;  4W7Z A;  3H25 A;  1N73 B;  3O6Q A;  3F89 A;  1JM0 A;  1JY2 O;  2WSE J;  4D6T D;  1LWU C;  3G3Z A;  3NXS A;  5M1B A;  1KV4 A;  2KVV A;  1KYO E;  1X22 A;  3AEF C;  1RQV A;  5DJU B;  3O8Z A;  2QJY B;  3RK2 D;  2B87 B;  3S9O A;  3TGU D;  2A06 G;  2ZJS E;  1KFM A;  3KQG A;  4EYY Q;  5AW5 B;  3CME P;  2W83 C;  5H2F H;  3CI9 A;  2D2C C;  4WLS A;  3MGN A;  1LP1 A;  5KAT A;  1OZH A;  1K73 Q;  3H1I J;  3PRJ A;  5CBO A;  1FZB A;  1LT9 C;  1EZV G;  2NPS A;  4LHF A;  1KIL A;  3LW5 H;  2IBZ G;  3A5T A;  1S72 P;  1H0T B;  3SWY A;  4ASW A;  2KIK A;  2OYI B;  2JML A;  3IN6 A;  2PP6 A;  1QGK B;  4JPZ B;  1L0L J;  3HUS A;  5K5G B;  3F5H A;  1AQ5 A;  2H8P D;  3E7K A; 
#chains in the Genus database with same CATH homology
 3GF7 A;  1Q05 A;  5D8C A;  3D70 A;  1TU3 F;  1ZOY C;  2P10 A;  1ZME C;  2QJY C;  3AEG C;  1BOW A;  3G9R A;  4R24 B;  1JYH A;  4Z1M H;  1KQG B;  3SFD C;  1VF5 B;  3AE6 C;  2BEZ F;  4PV1 C;  3GMA A;  2WSC J;  3UCS A;  4TT3 H;  4RKU J;  2JP3 A;  1U57 A;  2D2C D;  5GQQ A;  5I41 B;  2E76 C;  2ZHH A;  1KMI Z;  4Y28 J;  4R4L A;  2G3A A;  3SFE C;  2QIW A;  1WMK A;  2E74 D;  2G8Y A;  3AE7 C;  1Q06 A;  1R8E A;  1LX8 A;  1EXI A;  1KIL E;  2BEQ D;  4H0L D;  1YQ3 C;  4U7J A;  1K04 A;  1KOR A;  2D2C B;  3EZ2 A;  1Q09 A;  2E75 C;  1UIX A;  4H13 C;  4R4E A;  1GMJ A;  2DG6 A;  2QJP C;  3IAO A;  2E74 B;  1YQ4 C;  1AJY A;  4XFJ A;  1OW8 A;  4H44 C;  5KAU A;  2YMK A;  3AE8 C;  1K05 A;  3Q5R A;  5KAX A;  2GOV A;  3EZ9 A;  5E01 A;  1D5Y A;  3AE9 C;  2QJK C;  3ABV C;  3AEC C;  3QAO A;  2ZT9 C;  4DCZ A;  1Q08 A;  5D90 A;  3C8V A;  1FDI A;  2BOW A;  3EZF A;  3AEB C;  1ZP0 C;  2WSF J;  1EXJ A;  4AYZ B;  3LW5 J;  1VL2 A;  1OW7 A;  5KLI C;  1OMI A;  3H25 A;  2V7Q J;  5KAV A;  4OGQ C;  1FDO A;  1PV3 A;  3AE3 C;  3FGA D;  3O6Q A;  1MKM A;  4H0L C;  2J5U A;  4I7Z C;  3RK3 E;  3RL0 g;  2FBW C;  3D71 A;  2YIU C;  1DD3 A;  2WSE J;  3AE4 C;  1KQF B;  3T97 B;  4WLW A;  2OG0 A;  2FXP A;  3AE2 C;  4R22 B;  2O01 J;  5M1B A;  1VF5 C;  4H0L B;  4PV1 D;  5KCB A;  1S1C X;  2KVV A;  2OQQ A;  3AEF C;  3EZ7 A;  3R4Y A;  1RQV A;  5L8R J;  1Q07 A;  3D6Y A;  3S9O A;  3R8J A;  2JO1 A;  1IK7 A;  3R8K A;  3Q3D A;  3GP4 A;  1DD4 A;  1Q90 D;  3GK6 A;  4PV1 B;  3AED C;  2FYN C;  2KCU A;  1HJ0 A;  1NYH A;  4YXD C;  3D6Z A;  2D2C C;  1OW6 A;  2E75 D;  2E76 B;  4H13 D;  4I7Z B;  2HVA A;  1PM6 A;  1Y9B A;  3Q2Y A;  4GDO A;  1RH6 A;  3Q5P A;  4WLS A;  2H89 C;  3AEE C;  2IEF A;  3Q1M A;  2E74 C;  2IDB A;  3EZ6 A;  4KT0 J;  1RQU A;  5KAT A;  4H44 D;  3Q5S A;  3GF3 A;  2QSI A;  2E75 B;  4H13 B;  3AE5 C;  1JB0 J;  2K9Y A;  2WPV B;  2ZT9 D;  3AE1 C;  3E0H A;  2ZHG A;  4IL6 X;  5KKZ C;  4H44 B;  3LUR A;  3AEA C;  2MKV A;  1R8D A;  4LHF A;  2E76 D;  5KAW A;  1ZRT E;  4J2N A;  1KTM A;  4R4M A;  2NZ2 A;  1Q0A A;  2ZT9 B;  2WQY C;  1NGM B;  3EWK A;  1JBG A;  4OGQ D;  3GLM A;  4A1M A;  1S5L X;  1Y6U A;  5I44 A;  3GPV A;  3B49 A;  2JML A;  3IN6 A;  4YTP C;  2VZ4 A;  1DIP A;  4AYZ A;  1HF9 A;  1PIX A;  1VF5 D;  4OGQ B;  3HH0 A;  4B0Y A;  3B71 A;  1PL5 A;  2H88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...