3D70A

Crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYALIIPIHYSPKKQEEYRVEMKIRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d70A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d70A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d70A03
4R4LA 4WLSA 1Q0AA 2JMLA 5KAVA 3D71A 4R24B 3Q1MA 3Q5RA 3IAOA 2DG6A 3Q2YA 2J5UA 3T97B 3GK6A 4R4MA 5KATA 3D6ZA 1EXIA 3G9RA 2BOWA 5KAUA 1Q07A 2GOVA 1D5YA 2HVAA 4AYZB 5I44A 2KCUA 3QAOA 3GPVA 3Q5PA 1EXJA 3D70A 3R8KA 1Q08A 4WLWA 1R8DA 3UCSA 2ZHHA 1BOWA 4R22B 3B49A 2OQQA 1R8EA 5D90A 1DIPA 1JYHA 4A1MA 3HH0A 5D8CA 2ZHGA 4B0YA 5GQQA 4AYZA 1Q06A 5KAWA 5KAXA 1Q05A 1Q09A 5I41B 3LURA 2VZ4A 3D6YA 4J2NA 4R4EA 5KCBA 3Q5SA 1JBGA 3R8JA 3GP4A 3E0HA 3Q3DA 5E01A
chains in the Genus database with same CATH superfamily
2JMLA 2FFDA 3HE4B 2LXCB 2XU6A 3HD7C 2DW3A 2N1TB 3P8CE 3L72J 3H6PA 1GL2B 2LR2A 5AVYB 2WQYC 3R8JA 4UB6H 5BVZA 3CMEP 1FZCA 3BATA 2E74B 1SLQA 2E76D 2HODA 5APUA 1ZRTD 1JTHA 1URQC 4DZOA 1YBKA 2XNXA 4H44D 2QVAA 1NTZK 2WITA 4I7ZC 4GDOA 3LURA 1HJ0A 2WPRA 1HBWA 4UB8E 1SFCA 3II6A 4WY4A 2M3EA 5CCGA 3G9RA 3B5NA 3O8ZA 3H1JG 1JO5A 1EXJA 2YO3A 5KLIB 1PPJE 5AW7B 1YJ9P 4OVNF 4XA4A 1L4AC 3V4WA 1OX3A 2WMMA 3EZ6A 1ZRTE 1RHZB 3M0DA 1G1IA 3L71G 1E5WA 1MUUA 2AXTE 1KQSO 2HPCA 4Z1MH 4L74A 5KTBA 4EI2A 3GG2A 1JY3O 3PP5A 5KCBA 2A06G 2AEJA 2D2CB 1NJIQ 3IAOA 3JSVC 3IR9A 4PD4D 2JEEA 4L75A 3PRJA 1EDLA 2P10A 1U7JA 1VF5B 1MZ9A 4NPFX 1KYOI 3A0HE 3VMXA 3GHGC 2RN0A 2OTKE 3HTKA 4BRYB 1W5CE 4GIFA 1RQUA 1FOSE 2A45H 2FXMA 4B86A 1VDFA 1CSBA 4YTPC 4OH8B 1GK6A 2IX7C 2ZHGA 2ZXEB 1FZAA 3BRTB 2Q3EA 3KHUA 4PD4E 1P84I 1L0NK 2OARA 3H1JJ 3CXHE 3H1ID 3RK3B 3I56P 3CCQP 3G6EP 1X0TA 3H1HD 2JDIH 2WSCJ 2Q1KA 1NGMB 4RESB 1RY3A 2ZAEB 4AQRD 3L71J 1HWTC 2FXPA 4J2NA 5GTHE 1IO4A 1PM6A 1M56D 5BU8B 2QM8A 5K5GB 1BSHA 3H1IE 1AQTA 3S4RA 5KKZB 1Y47A 1Q09A 2IYPA 3H1HE 4KJMA 2QJYB 5KAVA 4KT0J 2JKVA 3H25A 2FYUK 1U7MA 5E79H 2PP6A 1PGQA 4L76A 1N73C 3M91A 2OYHC 2QIWA 4JF7A 3V5BA 1Q06A 2QEXP 3CLQA 3FXDA 2KSEA 4IFMA 2ZVOB 1SQPK 1N8RQ 2WTYA 3VN0A 5I44A 3O6QA 3RK2D 1BDCA 5D90A 1AVYA 2OYIC 1IFMA 5GQQA 2C9LY 1ZR4A 1ZXGA 2B87A 1JY3N 1JB0J 2C0XA 1FZGA 3CWBD 3L75G 1RF1A 3MZWB 3KXDA 1YQ3C 2B89A 3H1KD 3A2AA 1KC8Q 3S9OA 1LP1A 4ASWA 3QH9A 2E5TA 1QX8A 5KLIC 3MUDC 1UIIA 2J5UA 1LTBC 1L0LG 1M7LA 1BGYD 1YTZI 2OG0A 1JCCA 1SQQD 2IPPA 3L74D 1VQ7P 2W8ZA 3VP9A 1T6AA 3OAKA 2XDJA 1YIJP 2K1AA 2NPSB 3LIEA 3H1KE 1RH6A 1MKMA 1K73Q 3P8MC 2C9NY 1R5SA 4C46A 2VRSA 1BGYE 2YIUC 1M8OB 1SQQE 3D71A 3D6ZA 3N4XA 1D7MA 5KLVD 4YPCA 3V2PA 3ABVC 4W7YA 3WUUA 3PJSK 4IL6H 4H13C 4M3LA 1HUCA 3KZIE 1OVUA 2N1TD 5TISE 2QJPB 1GL2D 5KJ7C 2FFDB 3CCMP 3CCJP 2E74D 1A02J 2H88C 5H2FE 1LNQA 1EDIA 1HH0A 1DX7A 1LTJA 2YXQB 3WUTA 1HF9A 1FZCB 1SQVK 3KQGA 3GMAA 2H43A 4WBAA 5TISH 1OW6A 1M1KQ 2GM4A 2HODB 1PZQA 3AE2C 1GW3A 4LHFA 1JTHB 2ZT9C 1NTZG 1SQBK 3H1HJ 1N2DC 3T97A 3CXHI 3CWBG 3WMM0 3BCCG 3L70G 4DCZA 2OTJP 5KKZC 1SFCB 4WY4B 3CCRP 3B5NB 2QJYC 5AW6B 5AW1B 3AE6C 3AE7C 1VQ5P 4WB4A 1RE4C 2QA4P 1KYOH 4XFJA 2E76C 3KDPB 3L74G 4WLWA 2D2CD 1GK4A 2Y0DA 1OVRA 2HPCB 5D8CA 3A0BH 2WVRA 4YXWH 3TSIA 1KILA 2MJZA 4H44C 2HR3A 5AW5B 1SQXK 4KHXA 3TK1A 1VF5D 1P84H 1YHQP 3L71D 2KCUA 1EZVD 2P1JA 3HH0A 3PTZA 1OZHA 4NPEA 3FWLA 2WSFJ 3E0HA 5AW0B 2OTLP 3TNUB 1Q86Q 5KAFE 1HGVA 2K3RA 4U7JA 5KLVG 3HTKB 1D5YA 1LTSC 2K88A 3IN6A 1N7SA 3CWBJ 3RK3D 2QJKC 4RO0A 3HUSA 4RJTA 3L71E 1L0NG 3FWNA 3Q3DA 1EZVE 3H1KJ 3CCUP 4XE5B 1H8AA 3D70A 1FAVA 4R22B 2R3CA 2NPSC 4D6TG 2A06E 4HYTB 5AVQB 4JYBA 3HD7A 1S5LH 3VTPC 1VPCA 1BGYJ 1OIPA 2YKPA 2WSCH 3CL3D 3JCUE 2GUVA 5M1BA 1PGJA 1SQQJ 3L74J 2MKVA 1S9KD 2G8YA 3RK3E 4PJ0E 1J1EC 1RE3A 1JMBA 3CC4P 2WSSH 2KP8A 2OQQA 1URQA 1NVOA 5KAXA 1IFNA 1T2KD 4AYCA 4Y28J 3B4SA 3CPWO 2FYUG 1M1JA 3VOPA 4U3FG 1NKNA 2L5GB 1KTMA 4PJ0H 1S9KE 4I1LA 5KLVJ 1L4AA 3I55P 2FFDC 4I6MC 4JPZB 2Q3IA 1SQPG 4R4MA 2XNDH 1LT9C 2PGDA 3GLMA 1NU1K 4W7ZA 3ITKA 3O6QB 1FZCC 5CJ4A 1KORA 1JM0A 4LLHA 5AW9B 4BWNA 1KFMA 2B87B 4D6TJ 4UB8H 2FBWC 1EZVG 4N3YB 1R8DA 4PV1B 1RF1B 1N86A 3F89A 1NTMK 3G71P 2QM7A 5AVVB 3SSUA 4WY4C 1Q05A 1LP1B 2M3BA 5CCGC 1KN7A 3IF4A 5GTIE 5AW8B 4AUWA 3GHGA 1HVVA 4Y99B 1K04A 1VQNP 3L75D 1YJWP 2HYNA 2NPSD 2AXTH 1NHLA 2R3SA 2B9BA 1JY3P 3RK2C 2FYUJ 4B0YA 3M0DC 3H32A 4C7RA 1M90Q 1JBGA 3M06A 1FC2C 5E01A 2KS1A 1JEKA 1QEXA 1T8ZA 1L0LD 3FXEA 4JYCA 4A7PA 1DEEG 2Y0CA 2HLOA 1H0TA 1LTAC 1PP9D 3RBZA 1J1DC 2E43A 1SQPJ 2O01J 5EFWB 3I5CA 1EC5A 2PRRA 3L75E 1NTKD 3MD0A 4H0LD 3A0HH 1FE6A 1RH5B 2NRGA 4ZNCA 4O9BA 2BCCG 3R4YA 1L0LE 1N7LA 1NAYA 3MGNA 4PD4H 1PP9E 3CXHH 3AECC 2N9YB 1N73A 4IOIH 2OYHA 4EIJA 1LTGC 3N7NA 3C9IA 2Y0EA 3D6YA 3WU2E 2IZ0A 5DJTB 3CC7P 1FDMA 3C8VA 1SQVG 5KATA 5GTHH 2I8DA 4ZMDA 2J58A 1LTJB 4HJGH 2Y9ZA 5L8RJ 2FYNB 3A3YB 5CCHA 1IFDA 1ZMEC 1KB9D 1SFCD 4WY4D 1FJPA 1Q81Q 5CCGD 1MFZA 1SQBG 3H1LG 3VP8A 3B5ND 2OYIA 5APYA 1Z56A 2RMZA 1ZW0A 3T97B 2N1TC 2AEMA 3USSA 3CD6P 1K9MQ 2GOVA 1GL2C 2A45G 1FZFA 4IFFA 5AVXB 1OMIA 3EZ7A 1S3JA 2O1KA 1GU4A 4LC1A 2E74C 4HB1A 1S2EA 1NTZD 1GTWA 4GKGA 5BU5A 3M9BA 3AE9C 2KB7P 2RKLA 1KFNA 3BCCD 1FDOA 1IFIA 3L70D 1KB9E 3MUDA 3R2PA 2HFED 5CBNA 2Q7CA 3E7KA 1AFOA 1PGPA 3TGUG 1M57D 4I2LC 3SWKA 1LT1A 3OJAB 4R4EA 2W90A 1SQXG 1L2PA 2J59M 1KILB 3Q5RA 2JWAA 2WSEJ 1GZLA 3MP7B 1NTZE 2AEFA 1PP9G 1NO4A 1NTMD 3CWBE 3BCCE 3L70E 4EYYQ 1QVFO 3GF3A 4OGQB 1Q90D 1NTKG 3TDKA 5AVRB 2O3JA 1QLED 5B66E 2WT7A 1H89A 1NYHA 1MFTA 1SQBJ 5TJHA 1GW4A 2V7QJ 5APQA 3AEAC 2D2CC 1YTZT 2Z5HA 1N7SB 2IBZG 1ZN5A 1IK7A 3OA7A 1QL2A 1WRGA 1H88A 2KVVA 3HUSB 2P58A 1GDTA 2B88A 3L74E 1VF5C 3CCSP 4DOJA 2M5AA 1SP4A 5KJ7A 1VQMP 3MTUE 2KNCA 4IFDK 4H0LB 1KQFB 2R5BA 3HD7B 3L75J 1L0ND 3AE5C 3U1AA 1NH4A 1LTIC 4GT1A 3LW5J 4JQ0D 3HRNA 1CZQA 1LWUA 1FU1A 3CX5D 1PL5A 1BOWA 3B49A 4D6TD 2WPQA 3OW2O 1S1CX 3RK3C 1L0LJ 1W2EA 1URQB 5KLVE 3RBXA 2DG6A 1PP9J 2WZ7A 3GK6A 2I1JA 4I7ZB 5APVA 3AEEC 1M1JB 1JY2O 3KZIH 3AEBC 4IL6X 2QE7H 3L73G 1L0NE 2KZJA 1NTKJ 1SS1A 3EWKA 4N6JA 5CMZA 1OXZA 4PD4I 1L4AB 5H2FH 1Y6UA 3CX5E 2L91A 2POHA 1LJ2A 2FYUD 1RE4A 4D6TE 1FOSF 4U3FD 1NU1G 4ASVA 2OGUA 3IFMA 1IFJA 4PV1D 1KZUB 1T2KC 4C7NA 1SQPD 2P2UA 2Q5UA 3KYQA 2KYVA 2XKMA 3BASA 1NTMG 3AE1C 2FYUE 3HE5A 3E1IA 1VQ8P 4U3FE 3VMYA 1QL1A 1PFIA 1DH3A 1RF0C 3GHGB 2KLVA 1BCCD 3UCSA 2M8RA 3RL0B 1CI6A 4AYZA 3F5HA 2SPZA 1SQPE 3SFDC 2ZJSE 5APTA 1EDKA 3CI9A 3WUVA 3H32B 3L72G 2BASA 1XTCC 2KS1B 2Q6QA 3L37A 1NTZJ 3JC22 1KILC 1JCDA 2IDBA 3BCCJ 3AEGC 3L70J 3SWFA 1H0TB 3A7OA 5I41B 1X9VA 1OW8A 2IZ1A 1NU1J 4ZKPA 2O01H 2FY8A 5KAUA 2IFMA 1KB9I 2HVAA 2PFXA 4OGQC 5KAFH 2YXRB 2JWDA 1HJBA 4HKZH 1IJDB 1CW5A 1WMKA 2YKQA 2WPVB 1NTMJ 3EQ2A 2I1KA 1YYCA 1ZLLA 3V4QA 3PHLA 1JY2N 1JOCA 4OWFA 3NFQA 1EDJA 3NXSA 1AVOA 4UB6E 5CHXA 2K9JA 2WWWA 1N73B 2OYHB 2BCCD 3CCVP 1G1JA 4RKUJ 2HG5D 1X8YA 3Q2YA 1S5LX 3JCUH 3L4FA 1T3UA 4H0LC 1FZEA 1LT9A 1HTLC 1BE3G 1R8EA 2IYOA 5AVWB 2WPSA 2QJPC 2GUSA 3K5BA 1PPJD 1Q82Q 1OW7A 1VQKP 1RE3C 2OYIB 3P32A 3A5TA 1SQVD 1KMIZ 1NOHA 2BCCE 1L0NJ 4JBZA 1G2CA 1Q2NA 2KK7A 1USDA 5AVTB 2CK3H 4TLFA 1M1JC 1SQBD 3H1LD 2K37A 2LKMA 1T3JA 1U57A 2KUBA 1ZP0C 1BCCG 1ZV8A 1KILD 1AJYA 1X79B 3V6IA 2O1JA 1SFCC 1SQVE 2O01N 3NMDA 3B5NC 2IFNA 3M9QA 4HH2A 2BOWA 4OGQD 1SQQK 1SQBE 3VMZA 2IEFA 3H1LE 2FKWB 2WSEH 1NAFA 3AE8C 1E79H 3GW6A 3TF5A 3L36A 3TGUD 4U3FJ 3Q5SA 1OVVA 2RH0A 1SQXD 1KILE 4R24B 3NTNA 1BE3J 3CX5I 1N7SD 5AVUB 3CXHD 2E75B 2YIUB 2YMKA 5GTIH 1DD4A 5APSA 3Q5PA 2QRXA 3R8KA 2W27A 2WT7B 3VMAA 2QG4A 2YO2A 3TNUA 2W6BA 2H89C 2PAJA 2QSIA 1AA0A 2NZ2A 2V7QH 3RL0C 1BSNA 4DJGA 4DT0A 5KLVK 3EFGA 3HD7D 3TGUE 4H13B 2E5YA 3AEDC 1JMMA 3CCLP 1SQXE 1KV4A 2M5AB 2IBZD 2KNCB 1BCCJ 1Q7YQ 2KZIA 1URQD 3QWOC 3CC2P 3EZFA 3LW5H 1LWUB 2R32A 5APWA 1NTKE 1PPJG 5E79E 4WWIA 4NPDA 1QGKB 3HE4A 3BRVB 2JO1A 2ZT9B 5C39A 1KQGB 2P67A 2ZYDA 3LIDA 4WVZA 3C1LA 3QAOA 2N1TA 1Y8AA 1L4AD 2IBZE 3TYYA 1GL2A 1PIXA 2LXBA 4GODA 5AW2B 2BEZF 2KI7B 2E42A 3Q1MA 3S1KA 1EZVI 2ZVNB 3B71A 3WU2H 3RL0g 1VQ9P 1EQ7A 3MHVA 1S4XA 2W6AA 3L73D 2C0WA 1VL2A 1RQVA 3FX0A 2E76B 2R5DA 1GD2E 5CCHC 5AVSB 2BCCJ 4H44B 4YXDC 1HGZA 4C7NB 1JUNA 4DCKA 1NU1D 2KLUA 1JYHA 3CCEP 1ZR2A 3PLNA 3AE3C 2ZXXA 3RL0D 3HE5B 3L73E 3UIAA 2W83C 2H7HA 1KB9H 3E1RA 3EZ9A 4LGDE 1SQVJ 3FGAD 2VZ4A 1CI6B 1OWAA 3GF7A 4AYZB 3SWYA 4PV1C 1NU1E 2QJKB 1RF1C 1ZOYC 1JNMA 2WSFH 3H1LJ 1AQ5A 2P7JA 4A1MA 1QVGO 4Y99C 2H8PD 3H1IG 1OFCX 1FZBA 2ZYAA 2Y9YA 4BRYA 1UIXA 3L72D 1XTGB 3H1HG 1EXIA 1NTME 2OYOA 1Q08A 5B66H 1AV1A 3G3ZA 3W68A 4IL6E 2XZRA 2KOGA 5KAWA 1J1EB 2E75C 3ZDMA 5KAIE 1K05A 2FXOA 5CBOA 1NKZB 1YQ4C 3P7KA 3AEFC 2G3AA 3TGUJ 4GOFA 3GPVA 1Y9BA 1VQ6P 2V4HA 4BXLA 5B5EE 1SQXJ 1FS0E 2YMYA 2Z4EA 4CPGA 1YI2P 3L72E 2K9JB 2YNYA 1BDDA 2UWJE 2ZYGA 1USEA 5CCHD 2A45I 1KYOD 5KAIH 2GA1A 2Q9IA 2YKOA 3V2QA 1X22A 1IC2A 3BVHA 4W80A 1J2JB 3AE4C 1LT9B 4N78D 5B5EH 1W2BO 1VQOP 3GP4A 1DEBA 1Q0AA 3V2NA 1JY2P 1LWUC 1P84D 1VQLP 3KPEA 3H1IJ 1MV8A 1BE3D 2ITAA 1KYOE 4TT3H 2KXPB 1G2CB 1LTJC 1KD1Q 3M9HA 2FYNC 3EZ2A 4QMAA 4GOEA 1YITP 4MN4C 4K3AA 1KQLA 2BEQD 4N78E 1R5LA 3A0BE 2Z5IA 3CX5H 1FJKA 3H1KG 1RF0A 1S72P 1PV3A 2JP3A 1A02F 4EOTA 1P84E 4K35A 2XV5A 4WLSA 3RK2B 1BGYG 2KSJA 2N9BA 3EFFK 1BE3E 4ZKUA 1Q07A 1FDIA 1SQQG 3H1JD 1VQ4P 3U59A 1LGHB 2IBZI 5CJ0A 1DD3A 1TU3F 2E75D 2K9YA 2W6JH 4R4LA 3L73J 1J1DB 1WT6A 1L0LK 1IZNB 5AVZB 2R44A 3V2RA 1IK9A 1GU5A 4EDFA 3B8EB 3PH0A 3RGUA 4H13D 2JJLA 2NPSA 1NWQA 2A06D 3H1JE 3L35A 1NTKK 1BCCE 2FYZA 1LTTC 5KJ7D 3VYIA 3M0AA 1S5LE 3SFEC 2CPSA 4L73A 1IFPA 2AXCA 3G4SP 2JR8A 1GMJA 3CMAP 5DJUB 3W67A 3MIWA 1VQPP 5AW3B 5APXA 3P8CD 2ZFCA 1YJNP 5AW4B 1LX8A 1N7SC 3U1CA 2KIKA 2ZHHA 1K8AQ 3HUSC 1SVFA 2ZT9D 1DIPA 1PGOA 2M0BA 1FBMA 2CPBA
chains in the Genus database with same CATH topology
4WLSA 5KAVA 2JMLA 1OW7A 3Q5RA 2D2CB 4KT0J 3IAOA 2DG6A 4DCZA 3H25A 1YQ4C 2WSEJ 3GK6A 5KKZC 4I7ZB 3AEFC 1KMIZ 4H44B 2G3AA 1Q07A 1FDIA 3AEEC 3AECC 4YXDC 3AEBC 1RH6A 1MKMA 2FBWC 4IL6X 2QIWA 4H13B 3GPVA 3AEDC 3D70A 2QJYC 1R8DA 4PV1B 1Y9BA 4R22B 2P10A 2IDBA 1DD3A 1JYHA 1VF5B 1TU3F 3AEGC 3EWKA 3AE6C 2E75D 1Q06A 3AE3C 1Q05A 5I41B 1OW8A 3AE7C 3D6YA 2WQYC 2YIUC 3R8JA 3GF3A 4OGQB 1Q90D 5M1BA 2K9YA 4R4LA 1Y6UA 3D71A 2MKVA 3C8VA 2E74B 4XFJA 1U57A 5KATA 1K04A 2E76D 2G8YA 3RK3E 3D6ZA 5KAUA 1ZP0C 5L8RJ 2E76C 2HVAA 1NYHA 1RQUA 5I44A 3O6QA 4OGQC 4WLWA 3EZFA 2D2CD 1AJYA 2OQQA 2V7QJ 5D90A 4YTPC 3ABVC 3AEAC 1ZMEC 2D2CC 3EZ9A 3AE4C 5D8CA 2ZHGA 4B0YA 4H44D 5GQQA 5KAXA 4I7ZC 1IK7A 4GDOA 4H13D 4H44C 3FGAD 2VZ4A 3LURA 1HJ0A 1WMKA 4PV1D 1JBGA 3GF7A 2KVVA 3GP4A 1JB0J 4AYZB 4H13C 5E01A 4Y28J 1Q0AA 4PV1C 2WPVB 1VF5D 2JO1A 2ZT9B 1KQGB 1ZOYC 3T97B 1VF5C 3G9RA 2BOWA 2GOVA 4OGQD 2KCUA 3QAOA 2WSCJ 1EXJA 3SFEC 1YQ3C 1OMIA 3Q3DA 1NGMB 1KTMA 2IEFA 3EZ7A 3AE8C 2E74D 1PIXA 3S9OA 4A1MA 3HH0A 2H88C 2E74C 4H0LB 1GMJA 2O01J 4TT3H 3AE1C 1KQFB 4RKUJ 3EZ6A 2FXPA 4J2NA 3Q5SA 2WSFJ 2FYNC 3EZ2A 2BEZF 1ZRTE 3E0HA 3AE9C 3AE5C 5KLIC 1PM6A 1KILE 4R24B 3Q1MA 3Q2YA 2J5UA 1UIXA 4H0LD 1HF9A 1FDOA 1S5LX 3GMAA 4R4MA 4U7JA 3LW5J 2BEQD 1EXIA 3B71A 3GLMA 4H0LC 1LX8A 2E75B 3RL0g 1D5YA 2YMKA 1DD4A 2OG0A 1OW6A 3Q5PA 4Z1MH 3R8KA 1Q08A 3IN6A 3UCSA 3AE2C 2ZHHA 1PL5A 1BOWA 4LHFA 2ZT9D 1R8EA 3B49A 1PV3A 1VL2A 2JP3A 1RQVA 3R4YA 1DIPA 2ZT9C 2QJKC 4AYZA 5KAWA 1KORA 1S1CX 2QJPC 2E76B 2E75C 1Q09A 3SFDC 2H89C 5KCBA 4R4EA 2QSIA 2NZ2A 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4L A;  4WLS A;  1Q0A A;  2JML A;  5KAV A;  3D71 A;  4R24 B;  3Q1M A;  3Q5R A;  3IAO A;  2DG6 A;  3Q2Y A;  2J5U A;  3T97 B;  3GK6 A;  4R4M A;  5KAT A;  3D6Z A;  1EXI A;  3G9R A;  2BOW A;  5KAU A;  1Q07 A;  2GOV A;  1D5Y A;  2HVA A;  4AYZ B;  5I44 A;  2KCU A;  3QAO A;  3GPV A;  3Q5P A;  1EXJ A;  3D70 A;  3R8K A;  1Q08 A;  4WLW A;  1R8D A;  3UCS A;  2ZHH A;  1BOW A;  4R22 B;  3B49 A;  2OQQ A;  1R8E A;  5D90 A;  1DIP A;  1JYH A;  4A1M A;  3HH0 A;  5D8C A;  2ZHG A;  4B0Y A;  5GQQ A;  4AYZ A;  1Q06 A;  5KAW A;  5KAX A;  1Q05 A;  1Q09 A;  5I41 B;  3LUR A;  2VZ4 A;  3D6Y A;  4J2N A;  4R4E A;  5KCB A;  3Q5S A;  1JBG A;  3R8J A;  3GP4 A;  3E0H A;  3Q3D A;  5E01 A; 
#chains in the Genus database with same CATH topology
 2JML A;  2FFD A;  3HE4 B;  2LXC B;  2XU6 A;  3HD7 C;  2DW3 A;  2N1T B;  3P8C E;  3L72 J;  3H6P A;  1GL2 B;  2LR2 A;  5AVY B;  2WQY C;  3R8J A;  4UB6 H;  5BVZ A;  3CME P;  1FZC A;  3BAT A;  2E74 B;  1SLQ A;  2E76 D;  2HOD A;  5APU A;  1ZRT D;  1JTH A;  1URQ C;  4DZO A;  1YBK A;  2XNX A;  4H44 D;  2QVA A;  1NTZ K;  2WIT A;  4I7Z C;  4GDO A;  3LUR A;  1HJ0 A;  2WPR A;  1HBW A;  4UB8 E;  1SFC A;  3II6 A;  4WY4 A;  2M3E A;  5CCG A;  3G9R A;  3B5N A;  3O8Z A;  3H1J G;  1JO5 A;  1EXJ A;  2YO3 A;  5KLI B;  1PPJ E;  5AW7 B;  1YJ9 P;  4OVN F;  4XA4 A;  1L4A C;  3V4W A;  1OX3 A;  2WMM A;  3EZ6 A;  1ZRT E;  1RHZ B;  3M0D A;  1G1I A;  3L71 G;  1E5W A;  1MUU A;  2AXT E;  1KQS O;  2HPC A;  4Z1M H;  4L74 A;  5KTB A;  4EI2 A;  3GG2 A;  1JY3 O;  3PP5 A;  5KCB A;  2A06 G;  2AEJ A;  2D2C B;  1NJI Q;  3IAO A;  3JSV C;  3IR9 A;  4PD4 D;  2JEE A;  4L75 A;  3PRJ A;  1EDL A;  2P10 A;  1U7J A;  1VF5 B;  1MZ9 A;  4NPF X;  1KYO I;  3A0H E;  3VMX A;  3GHG C;  2RN0 A;  2OTK E;  3HTK A;  4BRY B;  1W5C E;  4GIF A;  1RQU A;  1FOS E;  2A45 H;  2FXM A;  4B86 A;  1VDF A;  1CSB A;  4YTP C;  4OH8 B;  1GK6 A;  2IX7 C;  2ZHG A;  2ZXE B;  1FZA A;  3BRT B;  2Q3E A;  3KHU A;  4PD4 E;  1P84 I;  1L0N K;  2OAR A;  3H1J J;  3CXH E;  3H1I D;  3RK3 B;  3I56 P;  3CCQ P;  3G6E P;  1X0T A;  3H1H D;  2JDI H;  2WSC J;  2Q1K A;  1NGM B;  4RES B;  1RY3 A;  2ZAE B;  4AQR D;  3L71 J;  1HWT C;  2FXP A;  4J2N A;  5GTH E;  1IO4 A;  1PM6 A;  1M56 D;  5BU8 B;  2QM8 A;  5K5G B;  1BSH A;  3H1I E;  1AQT A;  3S4R A;  5KKZ B;  1Y47 A;  1Q09 A;  2IYP A;  3H1H E;  4KJM A;  2QJY B;  5KAV A;  4KT0 J;  2JKV A;  3H25 A;  2FYU K;  1U7M A;  5E79 H;  2PP6 A;  1PGQ A;  4L76 A;  1N73 C;  3M91 A;  2OYH C;  2QIW A;  4JF7 A;  3V5B A;  1Q06 A;  2QEX P;  3CLQ A;  3FXD A;  2KSE A;  4IFM A;  2ZVO B;  1SQP K;  1N8R Q;  2WTY A;  3VN0 A;  5I44 A;  3O6Q A;  3RK2 D;  1BDC A;  5D90 A;  1AVY A;  2OYI C;  1IFM A;  5GQQ A;  2C9L Y;  1ZR4 A;  1ZXG A;  2B87 A;  1JY3 N;  1JB0 J;  2C0X A;  1FZG A;  3CWB D;  3L75 G;  1RF1 A;  3MZW B;  3KXD A;  1YQ3 C;  2B89 A;  3H1K D;  3A2A A;  1KC8 Q;  3S9O A;  1LP1 A;  4ASW A;  3QH9 A;  2E5T A;  1QX8 A;  5KLI C;  3MUD C;  1UII A;  2J5U A;  1LTB C;  1L0L G;  1M7L A;  1BGY D;  1YTZ I;  2OG0 A;  1JCC A;  1SQQ D;  2IPP A;  3L74 D;  1VQ7 P;  2W8Z A;  3VP9 A;  1T6A A;  3OAK A;  2XDJ A;  1YIJ P;  2K1A A;  2NPS B;  3LIE A;  3H1K E;  1RH6 A;  1MKM A;  1K73 Q;  3P8M C;  2C9N Y;  1R5S A;  4C46 A;  2VRS A;  1BGY E;  2YIU C;  1M8O B;  1SQQ E;  3D71 A;  3D6Z A;  3N4X A;  1D7M A;  5KLV D;  4YPC A;  3V2P A;  3ABV C;  4W7Y A;  3WUU A;  3PJS K;  4IL6 H;  4H13 C;  4M3L A;  1HUC A;  3KZI E;  1OVU A;  2N1T D;  5TIS E;  2QJP B;  1GL2 D;  5KJ7 C;  2FFD B;  3CCM P;  3CCJ P;  2E74 D;  1A02 J;  2H88 C;  5H2F E;  1LNQ A;  1EDI A;  1HH0 A;  1DX7 A;  1LTJ A;  2YXQ B;  3WUT A;  1HF9 A;  1FZC B;  1SQV K;  3KQG A;  3GMA A;  2H43 A;  4WBA A;  5TIS H;  1OW6 A;  1M1K Q;  2GM4 A;  2HOD B;  1PZQ A;  3AE2 C;  1GW3 A;  4LHF A;  1JTH B;  2ZT9 C;  1NTZ G;  1SQB K;  3H1H J;  1N2D C;  3T97 A;  3CXH I;  3CWB G;  3WMM 0;  3BCC G;  3L70 G;  4DCZ A;  2OTJ P;  5KKZ C;  1SFC B;  4WY4 B;  3CCR P;  3B5N B;  2QJY C;  5AW6 B;  5AW1 B;  3AE6 C;  3AE7 C;  1VQ5 P;  4WB4 A;  1RE4 C;  2QA4 P;  1KYO H;  4XFJ A;  2E76 C;  3KDP B;  3L74 G;  4WLW A;  2D2C D;  1GK4 A;  2Y0D A;  1OVR A;  2HPC B;  5D8C A;  3A0B H;  2WVR A;  4YXW H;  3TSI A;  1KIL A;  2MJZ A;  4H44 C;  2HR3 A;  5AW5 B;  1SQX K;  4KHX A;  3TK1 A;  1VF5 D;  1P84 H;  1YHQ P;  3L71 D;  2KCU A;  1EZV D;  2P1J A;  3HH0 A;  3PTZ A;  1OZH A;  4NPE A;  3FWL A;  2WSF J;  3E0H A;  5AW0 B;  2OTL P;  3TNU B;  1Q86 Q;  5KAF E;  1HGV A;  2K3R A;  4U7J A;  5KLV G;  3HTK B;  1D5Y A;  1LTS C;  2K88 A;  3IN6 A;  1N7S A;  3CWB J;  3RK3 D;  2QJK C;  4RO0 A;  3HUS A;  4RJT A;  3L71 E;  1L0N G;  3FWN A;  3Q3D A;  1EZV E;  3H1K J;  3CCU P;  4XE5 B;  1H8A A;  3D70 A;  1FAV A;  4R22 B;  2R3C A;  2NPS C;  4D6T G;  2A06 E;  4HYT B;  5AVQ B;  4JYB A;  3HD7 A;  1S5L H;  3VTP C;  1VPC A;  1BGY J;  1OIP A;  2YKP A;  2WSC H;  3CL3 D;  3JCU E;  2GUV A;  5M1B A;  1PGJ A;  1SQQ J;  3L74 J;  2MKV A;  1S9K D;  2G8Y A;  3RK3 E;  4PJ0 E;  1J1E C;  1RE3 A;  1JMB A;  3CC4 P;  2WSS H;  2KP8 A;  2OQQ A;  1URQ A;  1NVO A;  5KAX A;  1IFN A;  1T2K D;  4AYC A;  4Y28 J;  3B4S A;  3CPW O;  2FYU G;  1M1J A;  3VOP A;  4U3F G;  1NKN A;  2L5G B;  1KTM A;  4PJ0 H;  1S9K E;  4I1L A;  5KLV J;  1L4A A;  3I55 P;  2FFD C;  4I6M C;  4JPZ B;  2Q3I A;  1SQP G;  4R4M A;  2XND H;  1LT9 C;  2PGD A;  3GLM A;  1NU1 K;  4W7Z A;  3ITK A;  3O6Q B;  1FZC C;  5CJ4 A;  1KOR A;  1JM0 A;  4LLH A;  5AW9 B;  4BWN A;  1KFM A;  2B87 B;  4D6T J;  4UB8 H;  2FBW C;  1EZV G;  4N3Y B;  1R8D A;  4PV1 B;  1RF1 B;  1N86 A;  3F89 A;  1NTM K;  3G71 P;  2QM7 A;  5AVV B;  3SSU A;  4WY4 C;  1Q05 A;  1LP1 B;  2M3B A;  5CCG C;  1KN7 A;  3IF4 A;  5GTI E;  5AW8 B;  4AUW A;  3GHG A;  1HVV A;  4Y99 B;  1K04 A;  1VQN P;  3L75 D;  1YJW P;  2HYN A;  2NPS D;  2AXT H;  1NHL A;  2R3S A;  2B9B A;  1JY3 P;  3RK2 C;  2FYU J;  4B0Y A;  3M0D C;  3H32 A;  4C7R A;  1M90 Q;  1JBG A;  3M06 A;  1FC2 C;  5E01 A;  2KS1 A;  1JEK A;  1QEX A;  1T8Z A;  1L0L D;  3FXE A;  4JYC A;  4A7P A;  1DEE G;  2Y0C A;  2HLO A;  1H0T A;  1LTA C;  1PP9 D;  3RBZ A;  1J1D C;  2E43 A;  1SQP J;  2O01 J;  5EFW B;  3I5C A;  1EC5 A;  2PRR A;  3L75 E;  1NTK D;  3MD0 A;  4H0L D;  3A0H H;  1FE6 A;  1RH5 B;  2NRG A;  4ZNC A;  4O9B A;  2BCC G;  3R4Y A;  1L0L E;  1N7L A;  1NAY A;  3MGN A;  4PD4 H;  1PP9 E;  3CXH H;  3AEC C;  2N9Y B;  1N73 A;  4IOI H;  2OYH A;  4EIJ A;  1LTG C;  3N7N A;  3C9I A;  2Y0E A;  3D6Y A;  3WU2 E;  2IZ0 A;  5DJT B;  3CC7 P;  1FDM A;  3C8V A;  1SQV G;  5KAT A;  5GTH H;  2I8D A;  4ZMD A;  2J58 A;  1LTJ B;  4HJG H;  2Y9Z A;  5L8R J;  2FYN B;  3A3Y B;  5CCH A;  1IFD A;  1ZME C;  1KB9 D;  1SFC D;  4WY4 D;  1FJP A;  1Q81 Q;  5CCG D;  1MFZ A;  1SQB G;  3H1L G;  3VP8 A;  3B5N D;  2OYI A;  5APY A;  1Z56 A;  2RMZ A;  1ZW0 A;  3T97 B;  2N1T C;  2AEM A;  3USS A;  3CD6 P;  1K9M Q;  2GOV A;  1GL2 C;  2A45 G;  1FZF A;  4IFF A;  5AVX B;  1OMI A;  3EZ7 A;  1S3J A;  2O1K A;  1GU4 A;  4LC1 A;  2E74 C;  4HB1 A;  1S2E A;  1NTZ D;  1GTW A;  4GKG A;  5BU5 A;  3M9B A;  3AE9 C;  2KB7 P;  2RKL A;  1KFN A;  3BCC D;  1FDO A;  1IFI A;  3L70 D;  1KB9 E;  3MUD A;  3R2P A;  2HFE D;  5CBN A;  2Q7C A;  3E7K A;  1AFO A;  1PGP A;  3TGU G;  1M57 D;  4I2L C;  3SWK A;  1LT1 A;  3OJA B;  4R4E A;  2W90 A;  1SQX G;  1L2P A;  2J59 M;  1KIL B;  3Q5R A;  2JWA A;  2WSE J;  1GZL A;  3MP7 B;  1NTZ E;  2AEF A;  1PP9 G;  1NO4 A;  1NTM D;  3CWB E;  3BCC E;  3L70 E;  4EYY Q;  1QVF O;  3GF3 A;  4OGQ B;  1Q90 D;  1NTK G;  3TDK A;  5AVR B;  2O3J A;  1QLE D;  5B66 E;  2WT7 A;  1H89 A;  1NYH A;  1MFT A;  1SQB J;  5TJH A;  1GW4 A;  2V7Q J;  5APQ A;  3AEA C;  2D2C C;  1YTZ T;  2Z5H A;  1N7S B;  2IBZ G;  1ZN5 A;  1IK7 A;  3OA7 A;  1QL2 A;  1WRG A;  1H88 A;  2KVV A;  3HUS B;  2P58 A;  1GDT A;  2B88 A;  3L74 E;  1VF5 C;  3CCS P;  4DOJ A;  2M5A A;  1SP4 A;  5KJ7 A;  1VQM P;  3MTU E;  2KNC A;  4IFD K;  4H0L B;  1KQF B;  2R5B A;  3HD7 B;  3L75 J;  1L0N D;  3AE5 C;  3U1A A;  1NH4 A;  1LTI C;  4GT1 A;  3LW5 J;  4JQ0 D;  3HRN A;  1CZQ A;  1LWU A;  1FU1 A;  3CX5 D;  1PL5 A;  1BOW A;  3B49 A;  4D6T D;  2WPQ A;  3OW2 O;  1S1C X;  3RK3 C;  1L0L J;  1W2E A;  1URQ B;  5KLV E;  3RBX A;  2DG6 A;  1PP9 J;  2WZ7 A;  3GK6 A;  2I1J A;  4I7Z B;  5APV A;  3AEE C;  1M1J B;  1JY2 O;  3KZI H;  3AEB C;  4IL6 X;  2QE7 H;  3L73 G;  1L0N E;  2KZJ A;  1NTK J;  1SS1 A;  3EWK A;  4N6J A;  5CMZ A;  1OXZ A;  4PD4 I;  1L4A B;  5H2F H;  1Y6U A;  3CX5 E;  2L91 A;  2POH A;  1LJ2 A;  2FYU D;  1RE4 A;  4D6T E;  1FOS F;  4U3F D;  1NU1 G;  4ASV A;  2OGU A;  3IFM A;  1IFJ A;  4PV1 D;  1KZU B;  1T2K C;  4C7N A;  1SQP D;  2P2U A;  2Q5U A;  3KYQ A;  2KYV A;  2XKM A;  3BAS A;  1NTM G;  3AE1 C;  2FYU E;  3HE5 A;  3E1I A;  1VQ8 P;  4U3F E;  3VMY A;  1QL1 A;  1PFI A;  1DH3 A;  1RF0 C;  3GHG B;  2KLV A;  1BCC D;  3UCS A;  2M8R A;  3RL0 B;  1CI6 A;  4AYZ A;  3F5H A;  2SPZ A;  1SQP E;  3SFD C;  2ZJS E;  5APT A;  1EDK A;  3CI9 A;  3WUV A;  3H32 B;  3L72 G;  2BAS A;  1XTC C;  2KS1 B;  2Q6Q A;  3L37 A;  1NTZ J;  3JC2 2;  1KIL C;  1JCD A;  2IDB A;  3BCC J;  3AEG C;  3L70 J;  3SWF A;  1H0T B;  3A7O A;  5I41 B;  1X9V A;  1OW8 A;  2IZ1 A;  1NU1 J;  4ZKP A;  2O01 H;  2FY8 A;  5KAU A;  2IFM A;  1KB9 I;  2HVA A;  2PFX A;  4OGQ C;  5KAF H;  2YXR B;  2JWD A;  1HJB A;  4HKZ H;  1IJD B;  1CW5 A;  1WMK A;  2YKQ A;  2WPV B;  1NTM J;  3EQ2 A;  2I1K A;  1YYC A;  1ZLL A;  3V4Q A;  3PHL A;  1JY2 N;  1JOC A;  4OWF A;  3NFQ A;  1EDJ A;  3NXS A;  1AVO A;  4UB6 E;  5CHX A;  2K9J A;  2WWW A;  1N73 B;  2OYH B;  2BCC D;  3CCV P;  1G1J A;  4RKU J;  2HG5 D;  1X8Y A;  3Q2Y A;  1S5L X;  3JCU H;  3L4F A;  1T3U A;  4H0L C;  1FZE A;  1LT9 A;  1HTL C;  1BE3 G;  1R8E A;  2IYO A;  5AVW B;  2WPS A;  2QJP C;  2GUS A;  3K5B A;  1PPJ D;  1Q82 Q;  1OW7 A;  1VQK P;  1RE3 C;  2OYI B;  3P32 A;  3A5T A;  1SQV D;  1KMI Z;  1NOH A;  2BCC E;  1L0N J;  4JBZ A;  1G2C A;  1Q2N A;  2KK7 A;  1USD A;  5AVT B;  2CK3 H;  4TLF A;  1M1J C;  1SQB D;  3H1L D;  2K37 A;  2LKM A;  1T3J A;  1U57 A;  2KUB A;  1ZP0 C;  1BCC G;  1ZV8 A;  1KIL D;  1AJY A;  1X79 B;  3V6I A;  2O1J A;  1SFC C;  1SQV E;  2O01 N;  3NMD A;  3B5N C;  2IFN A;  3M9Q A;  4HH2 A;  2BOW A;  4OGQ D;  1SQQ K;  1SQB E;  3VMZ A;  2IEF A;  3H1L E;  2FKW B;  2WSE H;  1NAF A;  3AE8 C;  1E79 H;  3GW6 A;  3TF5 A;  3L36 A;  3TGU D;  4U3F J;  3Q5S A;  1OVV A;  2RH0 A;  1SQX D;  1KIL E;  4R24 B;  3NTN A;  1BE3 J;  3CX5 I;  1N7S D;  5AVU B;  3CXH D;  2E75 B;  2YIU B;  2YMK A;  5GTI H;  1DD4 A;  5APS A;  3Q5P A;  2QRX A;  3R8K A;  2W27 A;  2WT7 B;  3VMA A;  2QG4 A;  2YO2 A;  3TNU A;  2W6B A;  2H89 C;  2PAJ A;  2QSI A;  1AA0 A;  2NZ2 A;  2V7Q H;  3RL0 C;  1BSN A;  4DJG A;  4DT0 A;  5KLV K;  3EFG A;  3HD7 D;  3TGU E;  4H13 B;  2E5Y A;  3AED C;  1JMM A;  3CCL P;  1SQX E;  1KV4 A;  2M5A B;  2IBZ D;  2KNC B;  1BCC J;  1Q7Y Q;  2KZI A;  1URQ D;  3QWO C;  3CC2 P;  3EZF A;  3LW5 H;  1LWU B;  2R32 A;  5APW A;  1NTK E;  1PPJ G;  5E79 E;  4WWI A;  4NPD A;  1QGK B;  3HE4 A;  3BRV B;  2JO1 A;  2ZT9 B;  5C39 A;  1KQG B;  2P67 A;  2ZYD A;  3LID A;  4WVZ A;  3C1L A;  3QAO A;  2N1T A;  1Y8A A;  1L4A D;  2IBZ E;  3TYY A;  1GL2 A;  1PIX A;  2LXB A;  4GOD A;  5AW2 B;  2BEZ F;  2KI7 B;  2E42 A;  3Q1M A;  3S1K A;  1EZV I;  2ZVN B;  3B71 A;  3WU2 H;  3RL0 g;  1VQ9 P;  1EQ7 A;  3MHV A;  1S4X A;  2W6A A;  3L73 D;  2C0W A;  1VL2 A;  1RQV A;  3FX0 A;  2E76 B;  2R5D A;  1GD2 E;  5CCH C;  5AVS B;  2BCC J;  4H44 B;  4YXD C;  1HGZ A;  4C7N B;  1JUN A;  4DCK A;  1NU1 D;  2KLU A;  1JYH A;  3CCE P;  1ZR2 A;  3PLN A;  3AE3 C;  2ZXX A;  3RL0 D;  3HE5 B;  3L73 E;  3UIA A;  2W83 C;  2H7H A;  1KB9 H;  3E1R A;  3EZ9 A;  4LGD E;  1SQV J;  3FGA D;  2VZ4 A;  1CI6 B;  1OWA A;  3GF7 A;  4AYZ B;  3SWY A;  4PV1 C;  1NU1 E;  2QJK B;  1RF1 C;  1ZOY C;  1JNM A;  2WSF H;  3H1L J;  1AQ5 A;  2P7J A;  4A1M A;  1QVG O;  4Y99 C;  2H8P D;  3H1I G;  1OFC X;  1FZB A;  2ZYA A;  2Y9Y A;  4BRY A;  1UIX A;  3L72 D;  1XTG B;  3H1H G;  1EXI A;  1NTM E;  2OYO A;  1Q08 A;  5B66 H;  1AV1 A;  3G3Z A;  3W68 A;  4IL6 E;  2XZR A;  2KOG A;  5KAW A;  1J1E B;  2E75 C;  3ZDM A;  5KAI E;  1K05 A;  2FXO A;  5CBO A;  1NKZ B;  1YQ4 C;  3P7K A;  3AEF C;  2G3A A;  3TGU J;  4GOF A;  3GPV A;  1Y9B A;  1VQ6 P;  2V4H A;  4BXL A;  5B5E E;  1SQX J;  1FS0 E;  2YMY A;  2Z4E A;  4CPG A;  1YI2 P;  3L72 E;  2K9J B;  2YNY A;  1BDD A;  2UWJ E;  2ZYG A;  1USE A;  5CCH D;  2A45 I;  1KYO D;  5KAI H;  2GA1 A;  2Q9I A;  2YKO A;  3V2Q A;  1X22 A;  1IC2 A;  3BVH A;  4W80 A;  1J2J B;  3AE4 C;  1LT9 B;  4N78 D;  5B5E H;  1W2B O;  1VQO P;  3GP4 A;  1DEB A;  1Q0A A;  3V2N A;  1JY2 P;  1LWU C;  1P84 D;  1VQL P;  3KPE A;  3H1I J;  1MV8 A;  1BE3 D;  2ITA A;  1KYO E;  4TT3 H;  2KXP B;  1G2C B;  1LTJ C;  1KD1 Q;  3M9H A;  2FYN C;  3EZ2 A;  4QMA A;  4GOE A;  1YIT P;  4MN4 C;  4K3A A;  1KQL A;  2BEQ D;  4N78 E;  1R5L A;  3A0B E;  2Z5I A;  3CX5 H;  1FJK A;  3H1K G;  1RF0 A;  1S72 P;  1PV3 A;  2JP3 A;  1A02 F;  4EOT A;  1P84 E;  4K35 A;  2XV5 A;  4WLS A;  3RK2 B;  1BGY G;  2KSJ A;  2N9B A;  3EFF K;  1BE3 E;  4ZKU A;  1Q07 A;  1FDI A;  1SQQ G;  3H1J D;  1VQ4 P;  3U59 A;  1LGH B;  2IBZ I;  5CJ0 A;  1DD3 A;  1TU3 F;  2E75 D;  2K9Y A;  2W6J H;  4R4L A;  3L73 J;  1J1D B;  1WT6 A;  1L0L K;  1IZN B;  5AVZ B;  2R44 A;  3V2R A;  1IK9 A;  1GU5 A;  4EDF A;  3B8E B;  3PH0 A;  3RGU A;  4H13 D;  2JJL A;  2NPS A;  1NWQ A;  2A06 D;  3H1J E;  3L35 A;  1NTK K;  1BCC E;  2FYZ A;  1LTT C;  5KJ7 D;  3VYI A;  3M0A A;  1S5L E;  3SFE C;  2CPS A;  4L73 A;  1IFP A;  2AXC A;  3G4S P;  2JR8 A;  1GMJ A;  3CMA P;  5DJU B;  3W67 A;  3MIW A;  1VQP P;  5AW3 B;  5APX A;  3P8C D;  2ZFC A;  1YJN P;  5AW4 B;  1LX8 A;  1N7S C;  3U1C A;  2KIK A;  2ZHH A;  1K8A Q;  3HUS C;  1SVF A;  2ZT9 D;  1DIP A;  1PGO A;  2M0B A;  1FBM A;  2CPB A; 
#chains in the Genus database with same CATH homology
 4WLS A;  5KAV A;  2JML A;  1OW7 A;  3Q5R A;  2D2C B;  4KT0 J;  3IAO A;  2DG6 A;  4DCZ A;  3H25 A;  1YQ4 C;  2WSE J;  3GK6 A;  5KKZ C;  4I7Z B;  3AEF C;  1KMI Z;  4H44 B;  2G3A A;  1Q07 A;  1FDI A;  3AEE C;  3AEC C;  4YXD C;  3AEB C;  1RH6 A;  1MKM A;  2FBW C;  4IL6 X;  2QIW A;  4H13 B;  3GPV A;  3AED C;  3D70 A;  2QJY C;  1R8D A;  4PV1 B;  1Y9B A;  4R22 B;  2P10 A;  2IDB A;  1DD3 A;  1JYH A;  1VF5 B;  1TU3 F;  3AEG C;  3EWK A;  3AE6 C;  2E75 D;  1Q06 A;  3AE3 C;  1Q05 A;  5I41 B;  1OW8 A;  3AE7 C;  3D6Y A;  2WQY C;  2YIU C;  3R8J A;  3GF3 A;  4OGQ B;  1Q90 D;  5M1B A;  2K9Y A;  4R4L A;  1Y6U A;  3D71 A;  2MKV A;  3C8V A;  2E74 B;  4XFJ A;  1U57 A;  5KAT A;  1K04 A;  2E76 D;  2G8Y A;  3RK3 E;  3D6Z A;  5KAU A;  1ZP0 C;  5L8R J;  2E76 C;  2HVA A;  1NYH A;  1RQU A;  5I44 A;  3O6Q A;  4OGQ C;  4WLW A;  3EZF A;  2D2C D;  1AJY A;  2OQQ A;  2V7Q J;  5D90 A;  4YTP C;  3ABV C;  3AEA C;  1ZME C;  2D2C C;  3EZ9 A;  3AE4 C;  5D8C A;  2ZHG A;  4B0Y A;  4H44 D;  5GQQ A;  5KAX A;  4I7Z C;  1IK7 A;  4GDO A;  4H13 D;  4H44 C;  3FGA D;  2VZ4 A;  3LUR A;  1HJ0 A;  1WMK A;  4PV1 D;  1JBG A;  3GF7 A;  2KVV A;  3GP4 A;  1JB0 J;  4AYZ B;  4H13 C;  5E01 A;  4Y28 J;  1Q0A A;  4PV1 C;  2WPV B;  1VF5 D;  2JO1 A;  2ZT9 B;  1KQG B;  1ZOY C;  3T97 B;  1VF5 C;  3G9R A;  2BOW A;  2GOV A;  4OGQ D;  2KCU A;  3QAO A;  2WSC J;  1EXJ A;  3SFE C;  1YQ3 C;  1OMI A;  3Q3D A;  1NGM B;  1KTM A;  2IEF A;  3EZ7 A;  3AE8 C;  2E74 D;  1PIX A;  3S9O A;  4A1M A;  3HH0 A;  2H88 C;  2E74 C;  4H0L B;  1GMJ A;  2O01 J;  4TT3 H;  3AE1 C;  1KQF B;  4RKU J;  3EZ6 A;  2FXP A;  4J2N A;  3Q5S A;  2WSF J;  2FYN C;  3EZ2 A;  2BEZ F;  1ZRT E;  3E0H A;  3AE9 C;  3AE5 C;  5KLI C;  1PM6 A;  1KIL E;  4R24 B;  3Q1M A;  3Q2Y A;  2J5U A;  1UIX A;  4H0L D;  1HF9 A;  1FDO A;  1S5L X;  3GMA A;  4R4M A;  4U7J A;  3LW5 J;  2BEQ D;  1EXI A;  3B71 A;  3GLM A;  4H0L C;  1LX8 A;  2E75 B;  3RL0 g;  1D5Y A;  2YMK A;  1DD4 A;  2OG0 A;  1OW6 A;  3Q5P A;  4Z1M H;  3R8K A;  1Q08 A;  3IN6 A;  3UCS A;  3AE2 C;  2ZHH A;  1PL5 A;  1BOW A;  4LHF A;  2ZT9 D;  1R8E A;  3B49 A;  1PV3 A;  1VL2 A;  2JP3 A;  1RQV A;  3R4Y A;  1DIP A;  2ZT9 C;  2QJK C;  4AYZ A;  5KAW A;  1KOR A;  1S1C X;  2QJP C;  2E76 B;  2E75 C;  1Q09 A;  3SFD C;  2H89 C;  5KCB A;  4R4E A;  2QSI A;  2NZ2 A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...