3D70A

Crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYALIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d70A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d70A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d70A03
5KAVA 4AYZB 2HVAA 2KCUA 5GQQA 5D8CA 2ZHGA 4A1MA 3R8KA 5I44A 1JYHA 3B49A 3D71A 1JBGA 3GK6A 1BOWA 3Q2YA 3GPVA 4J2NA 3LURA 3GP4A 4R22B 2J5UA 4R4EA 2GOVA 3D70A 5KAUA 3T97B 3R8JA 5I41B 3G9RA 3IAOA 4WLSA 4WLWA 1Q07A 3Q5RA 5KATA 4R24B 5D90A 1R8DA 3D6YA 3E0HA 4R4LA 5KAWA 4R4MA 1Q05A 3D6ZA 4B0YA 5E01A 1EXIA 3HH0A 1DIPA 4AYZA 2JMLA 3QAOA 1Q08A 2OQQA 5KAXA 2BOWA 2DG6A 1D5YA 1EXJA 1Q0AA 3Q5PA 3Q1MA 2ZHHA 2VZ4A 3Q3DA 3Q5SA 1Q09A 1R8EA 3UCSA 1Q06A 5KCBA
chains in the Genus database with same CATH superfamily
1NTMG 3CWBE 4RESB 1H0TB 1OW8A 2FY8A 2P1JA 1SFCA 1AVYA 3U59A 4OVNF 1FZCA 3LW5J 1JMMA 3L71E 2D2CD 1X8YA 1XTGB 2PRRA 1OVUA 3GF7A 2B88A 1GW4A 1WRGA 2E76B 1KYOI 3CC4P 2P2UA 1H8AA 4K35A 4R22B 3LURA 2XKMA 1PP9E 1LP1B 5B66H 3U1AA 3L36A 3RK3C 3AEEC 2K1AA 2FFDC 2C9LY 1L0LK 1KILE 5GTHE 2FKWB 3CX5H 5GTIE 5CBOA 3JSVC 2B9BA 3VOPA 2HFED 4HYTB 1GD2E 3RK3B 2FBWC 1IFPA 4JQ0D 5KLIC 4D6TG 3AE8C 1T6AA 4CPGA 2Q1KA 1FC2C 5AVWB 4IFMA 1ZP0C 1N8RQ 1RHZB 2IYPA 3S1KA 1Q05A 1NTMK 4DZOA 5AVXB 1VQ9P 4D6TD 1N86A 1L0NK 1BE3J 2M5AA 4JPZB 1K04A 4OGQB 3AECC 3GLMA 3L75E 3U1CA 1VQOP 4N6JA 2Q9IA 1MZ9A 5KATA 1FZBA 3C9IA 5AVQB 3FWLA 1VDFA 1A02J 1LTIC 1D5YA 1RF0C 5B66E 4WY4A 2YXQB 1M57D 3PTZA 1QL1A 3M0AA 4QMAA 1JBGA 4DCKA 5AW5B 2Q5UA 3EWKA 3CX5E 3L74J 2PAJA 4I1LA 5BVZA 1JY3O 2NPSA 2QEXP 2B87B 1DEBA 3M9BA 3OAKA 4ZKUA 3UCSA 5AW8B 1SS1A 2R3CA 2LKMA 1L4AC 3B49A 3HUSB 4PV1D 3CCVP 1YQ4C 1YBKA 3NTNA 1N73C 5CCGA 1OVVA 4HKZH 1IJDB 1Q0AA 3Q5SA 1L4AB 1BE3G 2IBZG 2NRGA 2ZHGA 3RK3E 3G3ZA 3CCEP 3W67A 3H1JE 1N73B 1DX7A 2WT7A 3O8ZA 3EFGA 3W68A 4NPDA 3CWBJ 4ASWA 1OMIA 1SQXG 5KAWA 2OGUA 1VL2A 1Y47A 1QLED 1BE3D 2IBZD 1PFIA 3SFEC 4AYZB 1EZVI 2Z5HA 3N7NA 5APXA 3L71J 2KLUA 3OJAB 2QIWA 1VPCA 2W8ZA 1ZN5A 4HJGH 4WLWA 1SQXD 1Q86Q 4L74A 2Q3EA 1JY2O 4W7YA 3H1LE 4IL6H 2K9JA 3AE2C 1SQBK 3CCUP 4H13C 1PP9J 3RGUA 1WT6A 1ZRTD 2E75C 3MIWA 1SQVE 4AYCA 1P84D 5AW4B 4H44D 5AW3B 1SLQA 1Q07A 3V4WA 2LXCB 4U3FG 2J59M 2GM4A 4GOFA 3A3YB 4Y99C 2JR8A 1CI6A 1Z56A 2E75B 3CXHD 2C0XA 1NVOA 3FX0A 4ZNCA 5KCBA 2FYZA 2IBZI 5GQQA 3RBXA 1PM6A 1IK9A 3IR9A 3A5TA 3CD6P 3AEGC 3AEAC 4Y99B 4U3FD 2JMLA 2KZJA 2Z5IA 2QM8A 1PGOA 3RBZA 1OIPA 1M90Q 1L0NE 1LTJC 1QGKB 2E5YA 3HE5A 3L71G 3H32B 3M06A 1P84I 2OYHA 4JYCA 2OYIC 1RE4A 2XNXA 4B0YA 2WSEH 1LTJB 3L75J 1Q08A 1JY3N 3GF3A 3VTPC 1MKMA 4DCZA 1PP9G 4IL6E 2HVAA 3L71D 2M0BA 2AXCA 3PJSK 3M91A 2AEMA 1RQVA 4AUWA 3HE4A 2WPQA 2I1KA 4C7RA 2O01N 1TU3F 1PP9D 5KAVA 3IN6A 4DJGA 1J1DC 5APSA 1FDMA 1SQQK 3ITKA 5B5EH 1Y9BA 2ZYGA 2KI7B 1KILD 3B5NC 4AQRD 5KKZB 1BGYE 3NXSA 4EIJA 2DG6A 1J1DB 1KV4A 5AVSB 1S4XA 4H0LC 3MHVA 2IPPA 3H1IE 1K73Q 2HLOA 2PGDA 1S72P 3L75G 3MUDA 1PV3A 3H1JJ 2KNCA 4H0LB 3CI9A 1GDTA 1LT9A 1JY2N 1LWUC 2QVAA 2PFXA 1N2DC 3B4SA 2WWWA 4GODA 3L75D 1JUNA 5D90A 1LWUB 4C7NB 1GU4A 3MD0A 1GU5A 3SSUA 2UWJE 1FZFA 3HD7C 3FGAD 1GTWA 1SQBE 4EDFA 1KB9H 3H1LJ 5B5EE 3G4SP 3HTKA 1NKNA 1NTZE 1SQVJ 1SFCC 3MP7B 2JDIH 3KZIH 3CX5D 4A7PA 2E76D 1KFMA 1NTKG 5M1BA 2MJZA 4RJTA 1FZCC 2W27A 1YHQP 1SFCB 1IC2A 3H1JG 2HYNA 1T2KD 1EXJA 1NTKD 4GIFA 3Q1MA 2W6JH 1HJBA 1FZCB 1Q90D 2H43A 4BRYA 3II6A 3V4QA 1ZR4A 3I55P 2N9BA 2WQYC 1L0NJ 2WSFH 2KUBA 3KXDA 3H1JD 2K9YA 1FDIA 1NH4A 4NPEA 1S5LX 3TF5A 1OX3A 2JEEA 4N78E 1AA0A 2ITAA 1YTZT 3CX5I 1YYCA 3TYYA 2HR3A 2WVRA 1NGMB 1ZXGA 3P32A 3LIEA 3H1LG 1IK7A 3F5HA 2OTLP 2FYUK 1VQPP 1FE6A 1KB9E 3RL0g 1VQ4P 1EDLA 5AVVB 3IF4A 4OGQD 2ZT9D 3KZIE 3RL0C 4I6MC 2C9NY 3FXEA 3H6PA 1KYOD 2WSSH 1VQNP 1RQUA 3H1LD 3NFQA 3AE9C 1SQQE 5KAIH 1RH6A 2OTKE 2JKVA 4Y28J 1USEA 2WSCH 1NU1K 3RL0B 3H1HG 1L0LD 3TGUE 3ABVC 3EZFA 2KIKA 1FU1A 2BOWA 2KS1B 4GOEA 1YQ3C 1FJKA 2WPSA 1BGYJ 1A02F 1L0NG 2AEFA 3R2PA 3G6EP 2GUSA 4WY4C 3WUVA 1HVVA 2RMZA 3H1HD 4ZMDA 1JY3P 2FXPA 2KLVA 3H1IJ 2N1TD 2A45H 4M3LA 1NTMD 3O6QA 2YMYA 1IFIA 3SWYA 1FZGA 1EDJA 1G1IA 2ZVOB 4WY4B 1EDIA 2WSEJ 1VF5D 5AW2B 1L0ND 2NPSC 5AW0B 1UIIA 3BCCE 3L70E 1NOHA 3FWNA 3B8EB 3BATA 2QSIA 2BCCE 1Q82Q 3CCJP 2OG0A 2NPSB 1VQLP 3P7KA 4I7ZC 4JBZA 4IFDK 1T3JA 2XNDH 1LNQA 1SQVK 4EI2A 5KAIE 3BRTB 1SQBJ 2Y0CA 1KILA 2YXRB 2KK7A 1CZQA 3GG2A 3AEFC 1AJYA 2WZ7A 1PPJE 3OW2O 2FFDB 1Q81Q 1BGYG 1JEKA 4U7JA 4BWNA 1PIXA 1NTZJ 3H1KE 3CC7P 4GKGA 3AE6C 2R5DA 4NPFX 3CCQP 1RF1A 5KLIB 2WT7B 1GL2A 3H1IG 1JY2P 2ZXEB 2WPRA 3V2RA 4WB4A 2JWDA 5K5GB 1BGYD 3R4YA 1LT1A 5I44A 1JYHA 1J1EC 4GDOA 2IZ1A 4WLSA 3PH0A 4YXDC 1U57A 3H1ID 3FXDA 4YXWH 3RK2C 1H0TA 1GW3A 1J1EB 1EZVG 1ZMEC 2K9JB 1SQBG 2FYUE 3RK2B 1AVOA 1GK4A 4R24B 3CCMP 3A2AA 2OQQA 5KLVE 1OW7A 2QJPC 3VP9A 3AE4C 1YIJP 1EZVD 4A1MA 4L76A 2A06G 3GMAA 2LXBA 1SQBD 2D2CC 1JTHB 2ZJSE 5TJHA 2W6AA 1NU1E 2QJPB 2QG4A 4BXLA 1DD4A 2POHA 1SQQJ 2D2CB 1M56D 3GHGA 2OYHC 3TGUJ 5BU8B 2A06D 2Z4EA 3SFDC 1RE4C 1JOCA 3GK6A 3N4XA 2JO1A 5APWA 5APUA 3PP5A 1IO4A 2IEFA 1MFTA 2R44A 3E7KA 1MFZA 1SQPE 2OYHB 3NMDA 1S1CX 4LHFA 2WSFJ 2WMMA 3TK1A 3V2PA 1S5LH 2K3RA 1L2PA 5CBNA 2E74D 3L74G 4I2LC 5CCHD 1GZLA 2YO3A 5E01A 3L37A 5KJ7D 3BCCJ 3L70J 4N78D 2MKVA 3GP4A 3CC2P 1JM0A 1GK6A 2BCCJ 1QVGO 2I8DA 2AXTH 3L74D 2KXPB 1SQQG 3A7OA 1KB9D 2RN0A 1NTZK 4H13B 1NJIQ 5AW7B 1FOSE 1VQ7P 2WSCJ 2R5BA 3TGUG 2JWAA 1URQD 1RF0A 3MUDC 1DD3A 3AEBC 2J5UA 2B89A 2B87A 1LT9C 3CWBG 3EZ6A 2YNYA 1SQQD 4ZKPA 2N1TA 3H1KJ 3HUSA 3TGUD 2XZRA 2KNCB 2QM7A 1FZEA 2L5GB 1LT9B 1SP4A 4XA4A 1S5LE 2J58A 2KZIA 4PD4H 1M1JA 3CWBD 3IAOA 3A0HH 1L4AA 3A0BH 1M1KQ 3M9QA 3EQ2A 4HB1A 4PV1C 1N7SD 1KB9I 1N73A 3BCCG 2RH0A 3T97A 1HBWA 1OZHA 2BCCG 2CPSA 1H89A 2OYIB 4PV1B 2AXTE 1RH5B 2QJYC 5KAXA 3CCSP 2FYUJ 2GUVA 4JYBA 2FYNC 5TISH 3VMAA 1W2EA 1SVFA 2BCCD 5CJ4A 1IFDA 5KLVJ 2Y9YA 2C0WA 1EQ7A 2FYNB 3H1KG 4OWFA 5EFWB 1YJNP 1AV1A 1NU1J 1M7LA 3B5NB 4XE5B 4PD4E 4D6TE 1HJ0A 3PRJA 3MTUE 3A0HE 3H1KD 3A0BE 1GL2D 3TDKA 1Q09A 1S3JA 4H44C 3L72E 2G3AA 2XV5A 1JO5A 1SQPJ 1YITP 3GPVA 2KP8A 2Q3IA 2RKLA 2WITA 4H44B 3L73E 2FYUG 4YPCA 3Q3DA 1FJPA 3H32A 5TISE 1IFMA 3SWFA 3EZ9A 5C39A 1BOWA 3AE3C 2HODA 3WMM0 3HD7B 2FYUD 3TNUB 1QVFO 1FAVA 2WTYA 2PP6A 1NU1G 1NAFA 2HPCB 1MUUA 2KSJA 2Y9ZA 1JMBA 2P7JA 2L91A 1PGJA 3PHLA 3IFMA 3Q2YA 2A45I 1VQ5P 3M9HA 3HH0A 3C8VA 4WVZA 2CPBA 3AE1C 2JP3A 1EC5A 1NU1D 3MGNA 1X79B 3RK3D 1S9KE 1G2CA 2W83C 5CCHA 1K8AQ 1KORA 2O1KA 3EZ2A 5KJ7A 1DEEG 4KT0J 2AEJA 1KILC 1RE3A 1OW6A 1SQXE 3TSIA 3LIDA 5KAUA 4R4EA 3CCRP 1VQ8P 2SPZA 4R4MA 1SQVG 4LLHA 5KLVK 3ZDMA 2M8RA 1HH0A 4HH2A 3OA7A 1URQA 4B86A 1RF1C 1AQ5A 3KYQA 3CLQA 1LWUA 2P10A 1BSNA 4YTPC 1YI2P 1R8DA 1SQVD 2O1JA 3H25A 1IZNB 2H89C 1LTAC 1Q7YQ 2H7HA 1Y8AA 4U3FE 2M5AB 3L35A 3JC22 3D6YA 2IX7C 1SQPK 1KN7A 1N7SA 5AW6B 1T8ZA 4D6TJ 4EOTA 1J2JB 2JJLA 5E79H 2YMKA 2M3EA 2E76C 1HGZA 1JB0J 3L72J 3BVHA 1L4AD 3HRNA 1LX8A 2OYOA 4PJ0H 2W6BA 1NKZB 3MZWB 2M3BA 1U7JA 3L73J 5CCGC 1T2KC 1FBMA 2CK3H 3GHGC 3CL3D 3EFFK 5KAFH 4I7ZB 2BEZF 3GHGB 3R8JA 1NYHA 4Z1MH 1LTGC 2OTJP 3BASA 5CHXA 3CMEP 1JCDA 5E79E 3AE5C 3L72G 4OGQC 2ZT9C 2KS1A 4H13D 1KMIZ 2WPVB 2E75D 1HGVA 5KTBA 4WBAA 1DH3A 4PD4D 3CMAP 3I56P 3M0DA 1R5LA 1NWQA 1PGPA 1H88A 1MV8A 3L73G 2ZT9B 4PJ0E 1NO4A 2FXOA 3L72D 2YIUC 3S9OA 1X9VA 5AVTB 2Y0DA 1Y6UA 2BASA 1D7MA 1SQXJ 1OWAA 4XFJA 3E1RA 5KAFE 3L73D 2YIUB 1OVRA 5APTA 3VMYA 3F89A 1NAYA 1NTZG 1CI6B 2V7QH 4MN4C 2N1TC 2H8PD 1LP1A 3HUSC 1XTCC 1PGQA 3KPEA 1KYOH 2QE7H 5CJ0A 4RKUJ 2VRSA 1VF5C 4N3YB 1BCCE 2YKQA 1M1JC 4PD4I 1KTMA 2N1TB 1NTZD 1M8OB 3HE5B 4IOIH 5APYA 3E1IA 1NTKE 1VF5B 5CMZA 2E5TA 1M1JB 2FFDA 5APQA 1EXIA 4U3FJ 1ZR2A 1S2EA 4RO0A 1T3UA 2ZVNB 3KHUA 3T97B 3V6IA 1KC8Q 1HUCA 4GT1A 2ZYAA 3JCUH 5AVZB 5AVYB 3VYIA 1KQSO 1W2BO 3UIAA 1QL2A 1S9KD 3VP8A 3HE4B 1IFNA 5AW1B 3B5ND 4JF7A 2G8YA 1GMJA 2K88A 4TLFA 5DJTB 4ASVA 3WUTA 4H0LD 1KYOE 1G1JA 2O01H 3P8CE 1OXZA 1LTTC 4KJMA 5H2FH 1L0LE 3L4FA 2E43A 1KZUB 1KD1Q 2I1JA 2P58A 4K3AA 2Q7CA 1PL5A 1ZLLA 2W90A 1JTHA 5D8CA 3H1HE 1EDKA 2O3JA 2N9YB 4WWIA 1USDA 3HD7D 5DJUB 1NTME 3JCUE 2KOGA 2H88C 2ZHHA 1RY3A 1YTZI 3LW5H 1W5CE 3L70G 3I5CA 1SFCD 1SQXK 1YJWP 3AE7C 4LC1A 2QA4P 2HODB 4UB8H 4AYZA 2ZXXA 1K05A 3V5BA 1FOSF 3HTKB 3BCCD 3L70D 3CXHI 1AQTA 2HG5D 4IFFA 5H2FE 1PPJG 4UB6H 2QJYB 4W80A 2ZAEB 4EYYQ 3K5BA 2DW3A 1KFNA 2IYOA 3CPWO 5KKZC 1FZAA 3KQGA 3QWOC 2E74C 3PLNA 3QH9A 2YKPA 5CCHC 2P67A 3V2QA 2IFMA 1PPJD 1BCCJ 2A45G 5KJ7C 4BRYB 2E74B 1RE3C 1G2CB 2QRXA 1NTKJ 1BSHA 1LTSC 1AFOA 1LGHB 1ZW0A 3RL0D 3EZ7A 3G9RA 2V4HA 1VQKP 2ZFCA 1VQ6P 2IFNA 1URQC 3KDPB 4OH8B 3USSA 3P8MC 4UB8E 3B71A 5AVUB 1CSBA 2KVVA 1U7MA 1Q2NA 1VQMP 1YJ9P 2XU6A 5KLVG 1X22A 1ZV8A 4W7ZA 1LTJA 1OFCX 1URQB 4UB6E 2QJKC 4KHXA 3Q5RA 2YO2A 1EZVE 3S4RA 2R3SA 1JCCA 5BU5A 2BEQD 2V7QJ 1R8EA 1P84H 4WY4D 1KQGB 2OYIA 1QX8A 3R8KA 2QJKB 3D71A 5KLVD 1BCCG 4J2NA 5AVRB 5APVA 1N7SC 3CXHH 1QEXA 1X0TA 1FDOA 4L73A 1L0LJ 2NPSD 1JNMA 2A06E 2YKOA 2Q6QA 1CW5A 2VZ4A 1BDCA 1E5WA 2KYVA 3SWKA 2ZYDA 1N7SB 1SQPG 1BCCD 4DT0A 1IFJA 3O6QB 2FXMA 4TT3H 3D70A 5I41B 1BE3E 2IBZE 3WU2H 1BDDA 2NZ2A 3H1HJ 5CCGD 3QAOA 3Q5PA 1Q06A 1NHLA 1N7LA 3B5NA 1NTMJ 1SQPD 3CCLP 1PZQA 1HWTC 2IZ0A 3C1LA 3VN0A 1HF9A 3D6ZA 5L8RJ 1DIPA 5AW9B 3VMXA 2OARA 1ZRTE 2IDBA 1KILB 2GA1A 3G71P 1P84E 2KCUA 2LR2A 3L74E 2KSEA 1R5SA 4C46A 2KB7P 1GL2C 2O01J 4IL6X 2GOVA 3VMZA 4C7NA 1ZOYC 1LTBC 3CXHE 1L0LG 3E0HA 1KQFB 1FS0E 1HTLC 2R32A 1RF1B 2Y0EA 1GL2B 4O9BA 2E42A 1WMKA 2XDJA 3RK2D 3P8CD 1UIXA 1KQLA 5GTHH 3GW6A 5GTIH 1E79H 4L75A 3WUUA 3HD7A 3TNUA 3M0DC 4LGDE 1NTKK 3BRVB 3AEDC 1K9MQ 2K37A 4R4LA 3WU2E 2HPCA 3V2NA 1LJ2A 4DOJA
chains in the Genus database with same CATH topology
4H44C 3SFEC 2D2CB 2E74C 4AYZB 2HVAA 2G3AA 4KT0J 1K04A 1OW8A 4U7JA 1RQUA 4OGQB 1OW6A 3SFDC 1PIXA 3AECC 3GLMA 3AE9C 3GK6A 2JO1A 3GPVA 4TT3H 1RH6A 5KAUA 4R4EA 3D70A 2QIWA 4Y28J 5I41B 3AE6C 3IAOA 4WLWA 5KATA 1RQVA 2NZ2A 3LW5J 2IEFA 4R4MA 4H44B 4RKUJ 3ABVC 3EZFA 2E74B 3QAOA 2D2CD 4PV1C 1D5YA 2BOWA 2E76D 1TU3F 1VF5C 3Q5PA 3Q3DA 1YQ3C 1PL5A 4I7ZB 1S1CX 1Q06A 5M1BA 3AE2C 3GF7A 1KTMA 5KAVA 4LHFA 3IN6A 3R4YA 4H13C 2WSFJ 3EZ9A 5D8CA 2E76B 5I44A 1JYHA 2E75C 2BEZF 1JBGA 1BOWA 4GDOA 3LURA 3AE3C 4R22B 3R8JA 3EZ7A 1NYHA 2P10A 4H44D 3G9RA 2E74D 3EWKA 1Y9BA 4PV1B 4WLSA 1Q07A 1VF5B 4YXDC 1U57A 4YTPC 4Z1MH 1R8DA 2FXPA 2QJYC 1HF9A 3D6ZA 5E01A 5L8RJ 1EXIA 1DIPA 5KAXA 2H88C 2DG6A 3H25A 1EXJA 3Q1MA 2ZHHA 1ZRTE 2IDBA 2E75B 3B71A 3UCSA 2FYNC 2H89C 5KCBA 3O6QA 1Q90D 2KCUA 2KVVA 1ZMEC 5GQQA 3AEEC 4H0LC 3B49A 4PV1D 2WSEJ 1PM6A 1VF5D 2MKVA 3Q2YA 1KILE 3GP4A 2O01J 2WQYC 3AE5C 4IL6X 2GOVA 4OGQC 3T97B 3AE7C 2ZT9C 1AJYA 1YQ4C 3AEGC 2QJKC 1ZOYC 3AEAC 4H13D 3Q5RA 1KMIZ 4R24B 2WPVB 2K9YA 3D6YA 2E75D 1FDIA 3E0HA 1S5LX 1KQFB 3HH0A 3C8VA 4AYZA 2JMLA 1PV3A 2BEQD 2OQQA 2FBWC 2V7QJ 3AE1C 4H13B 2JP3A 1Q0AA 4H0LB 3Q5SA 1R8EA 1K05A 1OW7A 2QJPC 2QSIA 5KLIC 3AE4C 2OG0A 2WSCJ 1KQGB 3AE8C 1NGMB 1WMKA 2ZHGA 2ZT9B 3RK3E 4A1MA 4I7ZC 3R8KA 1UIXA 3D71A 2YMKA 3GMAA 1IK7A 2D2CC 1DD3A 4J2NA 3AEBC 2J5UA 2YIUC 2E76C 3S9OA 1JB0J 2G8YA 1GMJA 3RL0g 1ZP0C 3EZ6A 3AEDC 1HJ0A 1Y6UA 5D90A 1OMIA 4H0LD 4B0YA 1DD4A 4R4LA 1FDOA 1Q05A 1KORA 5KAWA 1VL2A 1LX8A 1Q08A 3GF3A 4OGQD 2VZ4A 1MKMA 3EZ2A 2ZT9D 1Q09A 3AEFC 4XFJA 5KKZC 4DCZA 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAV A;  4AYZ B;  2HVA A;  2KCU A;  5GQQ A;  5D8C A;  2ZHG A;  4A1M A;  3R8K A;  5I44 A;  1JYH A;  3B49 A;  3D71 A;  1JBG A;  3GK6 A;  1BOW A;  3Q2Y A;  3GPV A;  4J2N A;  3LUR A;  3GP4 A;  4R22 B;  2J5U A;  4R4E A;  2GOV A;  3D70 A;  5KAU A;  3T97 B;  3R8J A;  5I41 B;  3G9R A;  3IAO A;  4WLS A;  4WLW A;  1Q07 A;  3Q5R A;  5KAT A;  4R24 B;  5D90 A;  1R8D A;  3D6Y A;  3E0H A;  4R4L A;  5KAW A;  4R4M A;  1Q05 A;  3D6Z A;  4B0Y A;  5E01 A;  1EXI A;  3HH0 A;  1DIP A;  4AYZ A;  2JML A;  3QAO A;  1Q08 A;  2OQQ A;  5KAX A;  2BOW A;  2DG6 A;  1D5Y A;  1EXJ A;  1Q0A A;  3Q5P A;  3Q1M A;  2ZHH A;  2VZ4 A;  3Q3D A;  3Q5S A;  1Q09 A;  1R8E A;  3UCS A;  1Q06 A;  5KCB A; 
#chains in the Genus database with same CATH topology
 1NTM G;  3CWB E;  4RES B;  1H0T B;  1OW8 A;  2FY8 A;  2P1J A;  1SFC A;  1AVY A;  3U59 A;  4OVN F;  1FZC A;  3LW5 J;  1JMM A;  3L71 E;  2D2C D;  1X8Y A;  1XTG B;  2PRR A;  1OVU A;  3GF7 A;  2B88 A;  1GW4 A;  1WRG A;  2E76 B;  1KYO I;  3CC4 P;  2P2U A;  1H8A A;  4K35 A;  4R22 B;  3LUR A;  2XKM A;  1PP9 E;  1LP1 B;  5B66 H;  3U1A A;  3L36 A;  3RK3 C;  3AEE C;  2K1A A;  2FFD C;  2C9L Y;  1L0L K;  1KIL E;  5GTH E;  2FKW B;  3CX5 H;  5GTI E;  5CBO A;  3JSV C;  2B9B A;  3VOP A;  2HFE D;  4HYT B;  1GD2 E;  3RK3 B;  2FBW C;  1IFP A;  4JQ0 D;  5KLI C;  4D6T G;  3AE8 C;  1T6A A;  4CPG A;  2Q1K A;  1FC2 C;  5AVW B;  4IFM A;  1ZP0 C;  1N8R Q;  1RHZ B;  2IYP A;  3S1K A;  1Q05 A;  1NTM K;  4DZO A;  5AVX B;  1VQ9 P;  4D6T D;  1N86 A;  1L0N K;  1BE3 J;  2M5A A;  4JPZ B;  1K04 A;  4OGQ B;  3AEC C;  3GLM A;  3L75 E;  3U1C A;  1VQO P;  4N6J A;  2Q9I A;  1MZ9 A;  5KAT A;  1FZB A;  3C9I A;  5AVQ B;  3FWL A;  1VDF A;  1A02 J;  1LTI C;  1D5Y A;  1RF0 C;  5B66 E;  4WY4 A;  2YXQ B;  1M57 D;  3PTZ A;  1QL1 A;  3M0A A;  4QMA A;  1JBG A;  4DCK A;  5AW5 B;  2Q5U A;  3EWK A;  3CX5 E;  3L74 J;  2PAJ A;  4I1L A;  5BVZ A;  1JY3 O;  2NPS A;  2QEX P;  2B87 B;  1DEB A;  3M9B A;  3OAK A;  4ZKU A;  3UCS A;  5AW8 B;  1SS1 A;  2R3C A;  2LKM A;  1L4A C;  3B49 A;  3HUS B;  4PV1 D;  3CCV P;  1YQ4 C;  1YBK A;  3NTN A;  1N73 C;  5CCG A;  1OVV A;  4HKZ H;  1IJD B;  1Q0A A;  3Q5S A;  1L4A B;  1BE3 G;  2IBZ G;  2NRG A;  2ZHG A;  3RK3 E;  3G3Z A;  3CCE P;  3W67 A;  3H1J E;  1N73 B;  1DX7 A;  2WT7 A;  3O8Z A;  3EFG A;  3W68 A;  4NPD A;  3CWB J;  4ASW A;  1OMI A;  1SQX G;  5KAW A;  2OGU A;  1VL2 A;  1Y47 A;  1QLE D;  1BE3 D;  2IBZ D;  1PFI A;  3SFE C;  4AYZ B;  1EZV I;  2Z5H A;  3N7N A;  5APX A;  3L71 J;  2KLU A;  3OJA B;  2QIW A;  1VPC A;  2W8Z A;  1ZN5 A;  4HJG H;  4WLW A;  1SQX D;  1Q86 Q;  4L74 A;  2Q3E A;  1JY2 O;  4W7Y A;  3H1L E;  4IL6 H;  2K9J A;  3AE2 C;  1SQB K;  3CCU P;  4H13 C;  1PP9 J;  3RGU A;  1WT6 A;  1ZRT D;  2E75 C;  3MIW A;  1SQV E;  4AYC A;  1P84 D;  5AW4 B;  4H44 D;  5AW3 B;  1SLQ A;  1Q07 A;  3V4W A;  2LXC B;  4U3F G;  2J59 M;  2GM4 A;  4GOF A;  3A3Y B;  4Y99 C;  2JR8 A;  1CI6 A;  1Z56 A;  2E75 B;  3CXH D;  2C0X A;  1NVO A;  3FX0 A;  4ZNC A;  5KCB A;  2FYZ A;  2IBZ I;  5GQQ A;  3RBX A;  1PM6 A;  1IK9 A;  3IR9 A;  3A5T A;  3CD6 P;  3AEG C;  3AEA C;  4Y99 B;  4U3F D;  2JML A;  2KZJ A;  2Z5I A;  2QM8 A;  1PGO A;  3RBZ A;  1OIP A;  1M90 Q;  1L0N E;  1LTJ C;  1QGK B;  2E5Y A;  3HE5 A;  3L71 G;  3H32 B;  3M06 A;  1P84 I;  2OYH A;  4JYC A;  2OYI C;  1RE4 A;  2XNX A;  4B0Y A;  2WSE H;  1LTJ B;  3L75 J;  1Q08 A;  1JY3 N;  3GF3 A;  3VTP C;  1MKM A;  4DCZ A;  1PP9 G;  4IL6 E;  2HVA A;  3L71 D;  2M0B A;  2AXC A;  3PJS K;  3M91 A;  2AEM A;  1RQV A;  4AUW A;  3HE4 A;  2WPQ A;  2I1K A;  4C7R A;  2O01 N;  1TU3 F;  1PP9 D;  5KAV A;  3IN6 A;  4DJG A;  1J1D C;  5APS A;  1FDM A;  1SQQ K;  3ITK A;  5B5E H;  1Y9B A;  2ZYG A;  2KI7 B;  1KIL D;  3B5N C;  4AQR D;  5KKZ B;  1BGY E;  3NXS A;  4EIJ A;  2DG6 A;  1J1D B;  1KV4 A;  5AVS B;  1S4X A;  4H0L C;  3MHV A;  2IPP A;  3H1I E;  1K73 Q;  2HLO A;  2PGD A;  1S72 P;  3L75 G;  3MUD A;  1PV3 A;  3H1J J;  2KNC A;  4H0L B;  3CI9 A;  1GDT A;  1LT9 A;  1JY2 N;  1LWU C;  2QVA A;  2PFX A;  1N2D C;  3B4S A;  2WWW A;  4GOD A;  3L75 D;  1JUN A;  5D90 A;  1LWU B;  4C7N B;  1GU4 A;  3MD0 A;  1GU5 A;  3SSU A;  2UWJ E;  1FZF A;  3HD7 C;  3FGA D;  1GTW A;  1SQB E;  4EDF A;  1KB9 H;  3H1L J;  5B5E E;  3G4S P;  3HTK A;  1NKN A;  1NTZ E;  1SQV J;  1SFC C;  3MP7 B;  2JDI H;  3KZI H;  3CX5 D;  4A7P A;  2E76 D;  1KFM A;  1NTK G;  5M1B A;  2MJZ A;  4RJT A;  1FZC C;  2W27 A;  1YHQ P;  1SFC B;  1IC2 A;  3H1J G;  2HYN A;  1T2K D;  1EXJ A;  1NTK D;  4GIF A;  3Q1M A;  2W6J H;  1HJB A;  1FZC B;  1Q90 D;  2H43 A;  4BRY A;  3II6 A;  3V4Q A;  1ZR4 A;  3I55 P;  2N9B A;  2WQY C;  1L0N J;  2WSF H;  2KUB A;  3KXD A;  3H1J D;  2K9Y A;  1FDI A;  1NH4 A;  4NPE A;  1S5L X;  3TF5 A;  1OX3 A;  2JEE A;  4N78 E;  1AA0 A;  2ITA A;  1YTZ T;  3CX5 I;  1YYC A;  3TYY A;  2HR3 A;  2WVR A;  1NGM B;  1ZXG A;  3P32 A;  3LIE A;  3H1L G;  1IK7 A;  3F5H A;  2OTL P;  2FYU K;  1VQP P;  1FE6 A;  1KB9 E;  3RL0 g;  1VQ4 P;  1EDL A;  5AVV B;  3IF4 A;  4OGQ D;  2ZT9 D;  3KZI E;  3RL0 C;  4I6M C;  2C9N Y;  3FXE A;  3H6P A;  1KYO D;  2WSS H;  1VQN P;  1RQU A;  3H1L D;  3NFQ A;  3AE9 C;  1SQQ E;  5KAI H;  1RH6 A;  2OTK E;  2JKV A;  4Y28 J;  1USE A;  2WSC H;  1NU1 K;  3RL0 B;  3H1H G;  1L0L D;  3TGU E;  3ABV C;  3EZF A;  2KIK A;  1FU1 A;  2BOW A;  2KS1 B;  4GOE A;  1YQ3 C;  1FJK A;  2WPS A;  1BGY J;  1A02 F;  1L0N G;  2AEF A;  3R2P A;  3G6E P;  2GUS A;  4WY4 C;  3WUV A;  1HVV A;  2RMZ A;  3H1H D;  4ZMD A;  1JY3 P;  2FXP A;  2KLV A;  3H1I J;  2N1T D;  2A45 H;  4M3L A;  1NTM D;  3O6Q A;  2YMY A;  1IFI A;  3SWY A;  1FZG A;  1EDJ A;  1G1I A;  2ZVO B;  4WY4 B;  1EDI A;  2WSE J;  1VF5 D;  5AW2 B;  1L0N D;  2NPS C;  5AW0 B;  1UII A;  3BCC E;  3L70 E;  1NOH A;  3FWN A;  3B8E B;  3BAT A;  2QSI A;  2BCC E;  1Q82 Q;  3CCJ P;  2OG0 A;  2NPS B;  1VQL P;  3P7K A;  4I7Z C;  4JBZ A;  4IFD K;  1T3J A;  2XND H;  1LNQ A;  1SQV K;  4EI2 A;  5KAI E;  3BRT B;  1SQB J;  2Y0C A;  1KIL A;  2YXR B;  2KK7 A;  1CZQ A;  3GG2 A;  3AEF C;  1AJY A;  2WZ7 A;  1PPJ E;  3OW2 O;  2FFD B;  1Q81 Q;  1BGY G;  1JEK A;  4U7J A;  4BWN A;  1PIX A;  1NTZ J;  3H1K E;  3CC7 P;  4GKG A;  3AE6 C;  2R5D A;  4NPF X;  3CCQ P;  1RF1 A;  5KLI B;  2WT7 B;  1GL2 A;  3H1I G;  1JY2 P;  2ZXE B;  2WPR A;  3V2R A;  4WB4 A;  2JWD A;  5K5G B;  1BGY D;  3R4Y A;  1LT1 A;  5I44 A;  1JYH A;  1J1E C;  4GDO A;  2IZ1 A;  4WLS A;  3PH0 A;  4YXD C;  1U57 A;  3H1I D;  3FXD A;  4YXW H;  3RK2 C;  1H0T A;  1GW3 A;  1J1E B;  1EZV G;  1ZME C;  2K9J B;  1SQB G;  2FYU E;  3RK2 B;  1AVO A;  1GK4 A;  4R24 B;  3CCM P;  3A2A A;  2OQQ A;  5KLV E;  1OW7 A;  2QJP C;  3VP9 A;  3AE4 C;  1YIJ P;  1EZV D;  4A1M A;  4L76 A;  2A06 G;  3GMA A;  2LXB A;  1SQB D;  2D2C C;  1JTH B;  2ZJS E;  5TJH A;  2W6A A;  1NU1 E;  2QJP B;  2QG4 A;  4BXL A;  1DD4 A;  2POH A;  1SQQ J;  2D2C B;  1M56 D;  3GHG A;  2OYH C;  3TGU J;  5BU8 B;  2A06 D;  2Z4E A;  3SFD C;  1RE4 C;  1JOC A;  3GK6 A;  3N4X A;  2JO1 A;  5APW A;  5APU A;  3PP5 A;  1IO4 A;  2IEF A;  1MFT A;  2R44 A;  3E7K A;  1MFZ A;  1SQP E;  2OYH B;  3NMD A;  1S1C X;  4LHF A;  2WSF J;  2WMM A;  3TK1 A;  3V2P A;  1S5L H;  2K3R A;  1L2P A;  5CBN A;  2E74 D;  3L74 G;  4I2L C;  5CCH D;  1GZL A;  2YO3 A;  5E01 A;  3L37 A;  5KJ7 D;  3BCC J;  3L70 J;  4N78 D;  2MKV A;  3GP4 A;  3CC2 P;  1JM0 A;  1GK6 A;  2BCC J;  1QVG O;  2I8D A;  2AXT H;  3L74 D;  2KXP B;  1SQQ G;  3A7O A;  1KB9 D;  2RN0 A;  1NTZ K;  4H13 B;  1NJI Q;  5AW7 B;  1FOS E;  1VQ7 P;  2WSC J;  2R5B A;  3TGU G;  2JWA A;  1URQ D;  1RF0 A;  3MUD C;  1DD3 A;  3AEB C;  2J5U A;  2B89 A;  2B87 A;  1LT9 C;  3CWB G;  3EZ6 A;  2YNY A;  1SQQ D;  4ZKP A;  2N1T A;  3H1K J;  3HUS A;  3TGU D;  2XZR A;  2KNC B;  2QM7 A;  1FZE A;  2L5G B;  1LT9 B;  1SP4 A;  4XA4 A;  1S5L E;  2J58 A;  2KZI A;  4PD4 H;  1M1J A;  3CWB D;  3IAO A;  3A0H H;  1L4A A;  3A0B H;  1M1K Q;  3M9Q A;  3EQ2 A;  4HB1 A;  4PV1 C;  1N7S D;  1KB9 I;  1N73 A;  3BCC G;  2RH0 A;  3T97 A;  1HBW A;  1OZH A;  2BCC G;  2CPS A;  1H89 A;  2OYI B;  4PV1 B;  2AXT E;  1RH5 B;  2QJY C;  5KAX A;  3CCS P;  2FYU J;  2GUV A;  4JYB A;  2FYN C;  5TIS H;  3VMA A;  1W2E A;  1SVF A;  2BCC D;  5CJ4 A;  1IFD A;  5KLV J;  2Y9Y A;  2C0W A;  1EQ7 A;  2FYN B;  3H1K G;  4OWF A;  5EFW B;  1YJN P;  1AV1 A;  1NU1 J;  1M7L A;  3B5N B;  4XE5 B;  4PD4 E;  4D6T E;  1HJ0 A;  3PRJ A;  3MTU E;  3A0H E;  3H1K D;  3A0B E;  1GL2 D;  3TDK A;  1Q09 A;  1S3J A;  4H44 C;  3L72 E;  2G3A A;  2XV5 A;  1JO5 A;  1SQP J;  1YIT P;  3GPV A;  2KP8 A;  2Q3I A;  2RKL A;  2WIT A;  4H44 B;  3L73 E;  2FYU G;  4YPC A;  3Q3D A;  1FJP A;  3H32 A;  5TIS E;  1IFM A;  3SWF A;  3EZ9 A;  5C39 A;  1BOW A;  3AE3 C;  2HOD A;  3WMM 0;  3HD7 B;  2FYU D;  3TNU B;  1QVF O;  1FAV A;  2WTY A;  2PP6 A;  1NU1 G;  1NAF A;  2HPC B;  1MUU A;  2KSJ A;  2Y9Z A;  1JMB A;  2P7J A;  2L91 A;  1PGJ A;  3PHL A;  3IFM A;  3Q2Y A;  2A45 I;  1VQ5 P;  3M9H A;  3HH0 A;  3C8V A;  4WVZ A;  2CPB A;  3AE1 C;  2JP3 A;  1EC5 A;  1NU1 D;  3MGN A;  1X79 B;  3RK3 D;  1S9K E;  1G2C A;  2W83 C;  5CCH A;  1K8A Q;  1KOR A;  2O1K A;  3EZ2 A;  5KJ7 A;  1DEE G;  4KT0 J;  2AEJ A;  1KIL C;  1RE3 A;  1OW6 A;  1SQX E;  3TSI A;  3LID A;  5KAU A;  4R4E A;  3CCR P;  1VQ8 P;  2SPZ A;  4R4M A;  1SQV G;  4LLH A;  5KLV K;  3ZDM A;  2M8R A;  1HH0 A;  4HH2 A;  3OA7 A;  1URQ A;  4B86 A;  1RF1 C;  1AQ5 A;  3KYQ A;  3CLQ A;  1LWU A;  2P10 A;  1BSN A;  4YTP C;  1YI2 P;  1R8D A;  1SQV D;  2O1J A;  3H25 A;  1IZN B;  2H89 C;  1LTA C;  1Q7Y Q;  2H7H A;  1Y8A A;  4U3F E;  2M5A B;  3L35 A;  3JC2 2;  3D6Y A;  2IX7 C;  1SQP K;  1KN7 A;  1N7S A;  5AW6 B;  1T8Z A;  4D6T J;  4EOT A;  1J2J B;  2JJL A;  5E79 H;  2YMK A;  2M3E A;  2E76 C;  1HGZ A;  1JB0 J;  3L72 J;  3BVH A;  1L4A D;  3HRN A;  1LX8 A;  2OYO A;  4PJ0 H;  2W6B A;  1NKZ B;  3MZW B;  2M3B A;  1U7J A;  3L73 J;  5CCG C;  1T2K C;  1FBM A;  2CK3 H;  3GHG C;  3CL3 D;  3EFF K;  5KAF H;  4I7Z B;  2BEZ F;  3GHG B;  3R8J A;  1NYH A;  4Z1M H;  1LTG C;  2OTJ P;  3BAS A;  5CHX A;  3CME P;  1JCD A;  5E79 E;  3AE5 C;  3L72 G;  4OGQ C;  2ZT9 C;  2KS1 A;  4H13 D;  1KMI Z;  2WPV B;  2E75 D;  1HGV A;  5KTB A;  4WBA A;  1DH3 A;  4PD4 D;  3CMA P;  3I56 P;  3M0D A;  1R5L A;  1NWQ A;  1PGP A;  1H88 A;  1MV8 A;  3L73 G;  2ZT9 B;  4PJ0 E;  1NO4 A;  2FXO A;  3L72 D;  2YIU C;  3S9O A;  1X9V A;  5AVT B;  2Y0D A;  1Y6U A;  2BAS A;  1D7M A;  1SQX J;  1OWA A;  4XFJ A;  3E1R A;  5KAF E;  3L73 D;  2YIU B;  1OVR A;  5APT A;  3VMY A;  3F89 A;  1NAY A;  1NTZ G;  1CI6 B;  2V7Q H;  4MN4 C;  2N1T C;  2H8P D;  1LP1 A;  3HUS C;  1XTC C;  1PGQ A;  3KPE A;  1KYO H;  2QE7 H;  5CJ0 A;  4RKU J;  2VRS A;  1VF5 C;  4N3Y B;  1BCC E;  2YKQ A;  1M1J C;  4PD4 I;  1KTM A;  2N1T B;  1NTZ D;  1M8O B;  3HE5 B;  4IOI H;  5APY A;  3E1I A;  1NTK E;  1VF5 B;  5CMZ A;  2E5T A;  1M1J B;  2FFD A;  5APQ A;  1EXI A;  4U3F J;  1ZR2 A;  1S2E A;  4RO0 A;  1T3U A;  2ZVN B;  3KHU A;  3T97 B;  3V6I A;  1KC8 Q;  1HUC A;  4GT1 A;  2ZYA A;  3JCU H;  5AVZ B;  5AVY B;  3VYI A;  1KQS O;  1W2B O;  3UIA A;  1QL2 A;  1S9K D;  3VP8 A;  3HE4 B;  1IFN A;  5AW1 B;  3B5N D;  4JF7 A;  2G8Y A;  1GMJ A;  2K88 A;  4TLF A;  5DJT B;  4ASV A;  3WUT A;  4H0L D;  1KYO E;  1G1J A;  2O01 H;  3P8C E;  1OXZ A;  1LTT C;  4KJM A;  5H2F H;  1L0L E;  3L4F A;  2E43 A;  1KZU B;  1KD1 Q;  2I1J A;  2P58 A;  4K3A A;  2Q7C A;  1PL5 A;  1ZLL A;  2W90 A;  1JTH A;  5D8C A;  3H1H E;  1EDK A;  2O3J A;  2N9Y B;  4WWI A;  1USD A;  3HD7 D;  5DJU B;  1NTM E;  3JCU E;  2KOG A;  2H88 C;  2ZHH A;  1RY3 A;  1YTZ I;  3LW5 H;  1W5C E;  3L70 G;  3I5C A;  1SFC D;  1SQX K;  1YJW P;  3AE7 C;  4LC1 A;  2QA4 P;  2HOD B;  4UB8 H;  4AYZ A;  2ZXX A;  1K05 A;  3V5B A;  1FOS F;  3HTK B;  3BCC D;  3L70 D;  3CXH I;  1AQT A;  2HG5 D;  4IFF A;  5H2F E;  1PPJ G;  4UB6 H;  2QJY B;  4W80 A;  2ZAE B;  4EYY Q;  3K5B A;  2DW3 A;  1KFN A;  2IYO A;  3CPW O;  5KKZ C;  1FZA A;  3KQG A;  3QWO C;  2E74 C;  3PLN A;  3QH9 A;  2YKP A;  5CCH C;  2P67 A;  3V2Q A;  2IFM A;  1PPJ D;  1BCC J;  2A45 G;  5KJ7 C;  4BRY B;  2E74 B;  1RE3 C;  1G2C B;  2QRX A;  1NTK J;  1BSH A;  1LTS C;  1AFO A;  1LGH B;  1ZW0 A;  3RL0 D;  3EZ7 A;  3G9R A;  2V4H A;  1VQK P;  2ZFC A;  1VQ6 P;  2IFN A;  1URQ C;  3KDP B;  4OH8 B;  3USS A;  3P8M C;  4UB8 E;  3B71 A;  5AVU B;  1CSB A;  2KVV A;  1U7M A;  1Q2N A;  1VQM P;  1YJ9 P;  2XU6 A;  5KLV G;  1X22 A;  1ZV8 A;  4W7Z A;  1LTJ A;  1OFC X;  1URQ B;  4UB6 E;  2QJK C;  4KHX A;  3Q5R A;  2YO2 A;  1EZV E;  3S4R A;  2R3S A;  1JCC A;  5BU5 A;  2BEQ D;  2V7Q J;  1R8E A;  1P84 H;  4WY4 D;  1KQG B;  2OYI A;  1QX8 A;  3R8K A;  2QJK B;  3D71 A;  5KLV D;  1BCC G;  4J2N A;  5AVR B;  5APV A;  1N7S C;  3CXH H;  1QEX A;  1X0T A;  1FDO A;  4L73 A;  1L0L J;  2NPS D;  1JNM A;  2A06 E;  2YKO A;  2Q6Q A;  1CW5 A;  2VZ4 A;  1BDC A;  1E5W A;  2KYV A;  3SWK A;  2ZYD A;  1N7S B;  1SQP G;  1BCC D;  4DT0 A;  1IFJ A;  3O6Q B;  2FXM A;  4TT3 H;  3D70 A;  5I41 B;  1BE3 E;  2IBZ E;  3WU2 H;  1BDD A;  2NZ2 A;  3H1H J;  5CCG D;  3QAO A;  3Q5P A;  1Q06 A;  1NHL A;  1N7L A;  3B5N A;  1NTM J;  1SQP D;  3CCL P;  1PZQ A;  1HWT C;  2IZ0 A;  3C1L A;  3VN0 A;  1HF9 A;  3D6Z A;  5L8R J;  1DIP A;  5AW9 B;  3VMX A;  2OAR A;  1ZRT E;  2IDB A;  1KIL B;  2GA1 A;  3G71 P;  1P84 E;  2KCU A;  2LR2 A;  3L74 E;  2KSE A;  1R5S A;  4C46 A;  2KB7 P;  1GL2 C;  2O01 J;  4IL6 X;  2GOV A;  3VMZ A;  4C7N A;  1ZOY C;  1LTB C;  3CXH E;  1L0L G;  3E0H A;  1KQF B;  1FS0 E;  1HTL C;  2R32 A;  1RF1 B;  2Y0E A;  1GL2 B;  4O9B A;  2E42 A;  1WMK A;  2XDJ A;  3RK2 D;  3P8C D;  1UIX A;  1KQL A;  5GTH H;  3GW6 A;  5GTI H;  1E79 H;  4L75 A;  3WUU A;  3HD7 A;  3TNU A;  3M0D C;  4LGD E;  1NTK K;  3BRV B;  3AED C;  1K9M Q;  2K37 A;  4R4L A;  3WU2 E;  2HPC A;  3V2N A;  1LJ2 A;  4DOJ A; 
#chains in the Genus database with same CATH homology
 4H44 C;  3SFE C;  2D2C B;  2E74 C;  4AYZ B;  2HVA A;  2G3A A;  4KT0 J;  1K04 A;  1OW8 A;  4U7J A;  1RQU A;  4OGQ B;  1OW6 A;  3SFD C;  1PIX A;  3AEC C;  3GLM A;  3AE9 C;  3GK6 A;  2JO1 A;  3GPV A;  4TT3 H;  1RH6 A;  5KAU A;  4R4E A;  3D70 A;  2QIW A;  4Y28 J;  5I41 B;  3AE6 C;  3IAO A;  4WLW A;  5KAT A;  1RQV A;  2NZ2 A;  3LW5 J;  2IEF A;  4R4M A;  4H44 B;  4RKU J;  3ABV C;  3EZF A;  2E74 B;  3QAO A;  2D2C D;  4PV1 C;  1D5Y A;  2BOW A;  2E76 D;  1TU3 F;  1VF5 C;  3Q5P A;  3Q3D A;  1YQ3 C;  1PL5 A;  4I7Z B;  1S1C X;  1Q06 A;  5M1B A;  3AE2 C;  3GF7 A;  1KTM A;  5KAV A;  4LHF A;  3IN6 A;  3R4Y A;  4H13 C;  2WSF J;  3EZ9 A;  5D8C A;  2E76 B;  5I44 A;  1JYH A;  2E75 C;  2BEZ F;  1JBG A;  1BOW A;  4GDO A;  3LUR A;  3AE3 C;  4R22 B;  3R8J A;  3EZ7 A;  1NYH A;  2P10 A;  4H44 D;  3G9R A;  2E74 D;  3EWK A;  1Y9B A;  4PV1 B;  4WLS A;  1Q07 A;  1VF5 B;  4YXD C;  1U57 A;  4YTP C;  4Z1M H;  1R8D A;  2FXP A;  2QJY C;  1HF9 A;  3D6Z A;  5E01 A;  5L8R J;  1EXI A;  1DIP A;  5KAX A;  2H88 C;  2DG6 A;  3H25 A;  1EXJ A;  3Q1M A;  2ZHH A;  1ZRT E;  2IDB A;  2E75 B;  3B71 A;  3UCS A;  2FYN C;  2H89 C;  5KCB A;  3O6Q A;  1Q90 D;  2KCU A;  2KVV A;  1ZME C;  5GQQ A;  3AEE C;  4H0L C;  3B49 A;  4PV1 D;  2WSE J;  1PM6 A;  1VF5 D;  2MKV A;  3Q2Y A;  1KIL E;  3GP4 A;  2O01 J;  2WQY C;  3AE5 C;  4IL6 X;  2GOV A;  4OGQ C;  3T97 B;  3AE7 C;  2ZT9 C;  1AJY A;  1YQ4 C;  3AEG C;  2QJK C;  1ZOY C;  3AEA C;  4H13 D;  3Q5R A;  1KMI Z;  4R24 B;  2WPV B;  2K9Y A;  3D6Y A;  2E75 D;  1FDI A;  3E0H A;  1S5L X;  1KQF B;  3HH0 A;  3C8V A;  4AYZ A;  2JML A;  1PV3 A;  2BEQ D;  2OQQ A;  2FBW C;  2V7Q J;  3AE1 C;  4H13 B;  2JP3 A;  1Q0A A;  4H0L B;  3Q5S A;  1R8E A;  1K05 A;  1OW7 A;  2QJP C;  2QSI A;  5KLI C;  3AE4 C;  2OG0 A;  2WSC J;  1KQG B;  3AE8 C;  1NGM B;  1WMK A;  2ZHG A;  2ZT9 B;  3RK3 E;  4A1M A;  4I7Z C;  3R8K A;  1UIX A;  3D71 A;  2YMK A;  3GMA A;  1IK7 A;  2D2C C;  1DD3 A;  4J2N A;  3AEB C;  2J5U A;  2YIU C;  2E76 C;  3S9O A;  1JB0 J;  2G8Y A;  1GMJ A;  3RL0 g;  1ZP0 C;  3EZ6 A;  3AED C;  1HJ0 A;  1Y6U A;  5D90 A;  1OMI A;  4H0L D;  4B0Y A;  1DD4 A;  4R4L A;  1FDO A;  1Q05 A;  1KOR A;  5KAW A;  1VL2 A;  1LX8 A;  1Q08 A;  3GF3 A;  4OGQ D;  2VZ4 A;  1MKM A;  3EZ2 A;  2ZT9 D;  1Q09 A;  3AEF C;  4XFJ A;  5KKZ C;  4DCZ A;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...