3D70A

Crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYALIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d70A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d70A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d70A03
3D71A 3IAOA 1R8DA 1EXJA 2GOVA 3GK6A 3QAOA 3R8JA 1Q06A 1Q09A 5I41B 3D6YA 5KCBA 3GP4A 5E01A 5I44A 2JMLA 1BOWA 1EXIA 5KAWA 3Q5RA 5KAVA 1Q0AA 4R4MA 5GQQA 1D5YA 3Q2YA 3UCSA 1Q07A 5D8CA 3G9RA 1JYHA 5KATA 3D70A 2ZHGA 2DG6A 5D90A 2OQQA 1DIPA 3B49A 4R24B 3R8KA 5KAXA 5KAUA 3T97B 4AYZA 3Q5PA 3GPVA 4R22B 1JBGA 2J5UA 2KCUA 2VZ4A 1Q05A 3LURA 3D6ZA 3Q5SA 4B0YA 1R8EA 4J2NA 4WLSA 3Q1MA 4R4LA 2HVAA 2ZHHA 4A1MA 1Q08A 4AYZB 4R4EA 4WLWA 3Q3DA 3E0HA 2BOWA 3HH0A
chains in the Genus database with same CATH superfamily
3ITKA 1IFDA 1OZHA 3FWNA 1QGKB 4IFDK 2KIKA 3L70D 1WRGA 1Q90D 2Z5HA 1XTCC 3H1JG 1Y47A 2IBZE 4GOEA 3P7KA 3Q5PA 1FJPA 3BCCD 4R4EA 2N1TC 2Z5IA 2PAJA 3L4FA 2JR8A 3MZWB 1YBKA 1BDCA 3P8CD 2G8YA 5DJUB 1VDFA 1OW7A 2KSEA 3SWKA 1PIXA 2K9JB 3L71D 2CK3H 2OTJP 3GHGB 1SQQE 3CCUP 3PLNA 2YXQB 1USEA 3EZFA 1SQPK 2HVAA 1HWTC 2FYUD 3CXHD 3G6EP 2N1TD 1NTZK 4R4MA 2KS1A 3BCCG 1ZR4A 2WPVB 1AJYA 2XU6A 1OWAA 1IFNA 1KORA 1PPJE 3L74E 1OW8A 1OW6A 2ZYAA 2B87B 2RKLA 1S1CX 1IJDB 1M57D 3F89A 1SQBD 1G2CB 3JC22 1AQ5A 3H1IG 2FYUG 1AQTA 4TLFA 3TGUG 4HJGH 1MZ9A 3CXHI 1HTLC 5AVVB 3H1HG 1LTGC 1EDJA 1URQD 4H0LC 4YXWH 5KJ7C 2K9YA 2HODB 1LT1A 1RE3A 1OFCX 4I1LA 4EOTA 1ZXGA 2AEMA 3C8VA 3BASA 2IBZI 2KZIA 2Y0EA 1JY3P 3O6QA 2KB7P 5AW9B 4ZKUA 2IX7C 5KLVK 3LIEA 1GW3A 2YKOA 5CMZA 4L73A 2LXBA 2KNCA 3HD7D 3H1HD 5KJ7A 2I8DA 5CJ4A 3CX5H 5TISE 2M8RA 3L73G 2FFDA 1KILE 3RK2B 4W80A 1L0NG 2YIUB 1KYOE 1PGOA 3AE4C 5CCGD 4DOJA 1NJIQ 2JMLA 3CCSP 3RK3D 1HGZA 5KLVD 1NHLA 3VMYA 5KLVJ 2QJKC 3CCQP 3CWBG 3V2PA 1Y6UA 1KC8Q 3VP8A 2ITAA 3T97B 3B5NC 3HD7B 2Q3EA 5KLIC 1AV1A 3O6QB 4BWNA 4D6TE 3AECC 3SFDC 3VMZA 1BCCG 5CHXA 1SQVK 1QVFO 5KAFE 1SQBK 1OVRA 4DCZA 1ZW0A 3GPVA 5BU5A 4K35A 3HRNA 5CCHD 2HPCB 4AQRD 4DJGA 2FFDB 4C7NB 1R8DA 1KYOI 4KHXA 1BOWA 1N8RQ 1CI6B 5KAIH 3JCUH 4PJ0H 5KLIB 3H1KG 2QJKB 3OJAB 5CCHC 4B0YA 2QRXA 4XFJA 3PHLA 1NTMG 2A06E 3GK6A 3TK1A 2QJPC 4PV1B 2B89A 3U1AA 1VQKP 1SQVE 2QVAA 4U3FG 3A0BE 3B5NB 3KQGA 3HD7A 1LTAC 3K5BA 1DEEG 1DEBA 5AVSB 4N6JA 1HJBA 1LT9A 1FS0E 3MUDA 3H1ID 1SQVD 3CMAP 5D90A 2WWWA 2BCCD 2LR2A 4YPCA 1S72P 5AW5B 1N2DC 2J58A 5AW8B 3KXDA 1N73C 3PJSK 1PP9E 3H1KD 2BOWA 3LW5H 2H43A 2NPSB 4U3FD 2N9BA 2BEZF 1RF1A 4LC1A 2PFXA 1NKNA 3EFFK 2WSEJ 3CC2P 4UB8E 1FOSF 2IDBA 2AEJA 5GTIH 3FXEA 1JNMA 4RO0A 3RK3B 2KLVA 1VQNP 3E1RA 3RL0D 5AVUB 3IF4A 1VF5D 5E01A 4H13D 5B66H 1EXIA 2FXMA 2KOGA 4HKZH 3WU2H 2A45H 2C0XA 3IFMA 1KILC 3GF7A 5BVZA 3RGUA 2IZ0A 3CL3D 4HYTB 2L91A 4U3FE 1KQSO 4LHFA 1SFCA 3CI9A 3AEDC 3BRVB 2A06D 3AE8C 1QL1A 3M9BA 2PRRA 3FGAD 1BE3J 1KILD 2JDIH 1RQVA 3H1KE 2QJYC 4PD4I 2NPSC 1J2JB 3VMAA 1J1DB 3TDKA 4BRYB 1NTMJ 3S1KA 2OYIB 1KB9I 2O3JA 1IO4A 1YTZT 3QH9A 3RBXA 5KLVE 2WSSH 3OW2O 3MD0A 1SQPE 2P58A 3II6A 3LW5J 1UIXA 2NPSA 3L70G 1PP9G 2WTYA 4GODA 3M0DA 4R22B 1JBGA 4B86A 2N1TA 1FJKA 1FZCC 2FXPA 3T97A 4LLHA 3IN6A 1L4AD 1K8AQ 3GF3A 1KQGB 1XTGB 4JF7A 1VF5B 1URQC 3H1LD 4H44C 3VOPA 1KB9D 3H1JD 2P7JA 4HB1A 4ZKPA 1YTZI 2N9YB 2KLUA 2DW3A 1SQPD 2JWAA 4PD4D 2K9JA 3CMEP 1FZGA 1ZOYC 1OX3A 2E74D 3M9HA 3CWBJ 2BCCE 3KPEA 2FYUE 1FZCB 1CI6A 2QG4A 1SP4A 4L75A 1PGPA 3L73E 1U7MA 3Q3DA 1KTMA 1Q86Q 1QX8A 1RQUA 5APTA 2ZT9B 3GMAA 4KT0J 2ZXEB 3KYQA 3HD7C 1Q07A 2W27A 3CC7P 1KV4A 3RK3E 2B87A 1OIPA 2FYNB 4WWIA 4OGQB 3G4SP 1GK4A 4UB6E 4AYCA 3E0HA 2J59M 2BASA 3FWLA 1VQ8P 4OVNF 1Q09A 3M91A 1URQB 4IFFA 1M1JB 1S5LE 5CJ0A 4WY4A 2I1JA 1GTWA 2HLOA 2R3CA 3UIAA 2JKVA 1NAFA 3BATA 2HYNA 4RJTA 4JQ0D 3QWOC 3E7KA 5AVWB 2I1KA 2JO1A 4BXLA 1M56D 3OAKA 1D5YA 3L37A 2E74C 1NTKD 2P1JA 2OARA 1YI2P 2FFDC 1LJ2A 1JTHB 3H1JE 4Z1MH 3NTNA 4GOFA 1FZAA 4PV1C 2WT7A 3CD6P 3R4YA 1J1DC 3IAOA 1IFMA 3RL0B 1J1EB 3NXSA 1Q2NA 3A0BH 2NRGA 4R24B 1ZMEC 1SFCC 3S4RA 1ZP0C 1W5CE 3WMM0 2R5BA 1A02J 1L0LD 2QJPB 2E75D 2R3SA 2OYHA 3R8JA 2ZYDA 4W7ZA 3HUSA 4OH8B 1Q82Q 1FDIA 2E75B 1NAYA 3RK2D 5KATA 2Q3IA 1EZVI 1VQLP 1MUUA 3O8ZA 3AE5C 1NKZB 4YXDC 1YQ4C 2ZJSE 1FU1A 3L71G 1YYCA 1W2EA 2HFED 5E79H 3A0HE 1T8ZA 1LTJB 3A5TA 3TGUE 2FXOA 4PD4E 3H1JJ 1YJNP 2O01J 1VQ4P 1J1EC 1CZQA 1IZNB 1FOSE 1L0LJ 1M90Q 1D7MA 2IBZG 2V7QJ 3L71E 1SQPJ 3M06A 2SPZA 4Y28J 3MP7B 1KD1Q 2KUBA 2GM4A 3N4XA 5B66E 1JTHA 1JO5A 2W6JH 1SQVJ 1G2CA 1NU1K 1EDIA 2WPSA 1GZLA 1U7JA 3L75E 1PM6A 3H1LE 3HUSB 5GTIE 2YKQA 1JMBA 4EDFA 1BE3E 1L0NE 2FYNC 2ZVNB 1E5WA 2FKWB 1FBMA 5AVXB 3VP9A 5AVRB 1IK7A 4ASWA 2WZ7A 1FDMA 3HH0A 1KYOH 1VQMP 2Z4EA 1RHZB 2MKVA 4IL6X 5AW7B 2OYHB 5AW0B 2IZ1A 2E5TA 3LIDA 3ZDMA 1LT9B 4N78E 1JCDA 2PP6A 3AE3C 5GTHE 2W6BA 2W8ZA 2NPSD 4PD4H 1HUCA 1P84H 1MV8A 1NU1E 1Q0AA 3IR9A 4GDOA 1L0LE 2OTLP 1FDOA 2XKMA 4RESB 5L8RJ 3SSUA 2H88C 3G71P 1LTJA 3CX5E 5TISH 2LKMA 1K05A 1G1JA 2YO3A 1QLED 2OYHC 3Q5RA 3MHVA 4RKUJ 1MKMA 1L4AB 3GHGA 3HE5B 1M1KQ 3G3ZA 1SFCB 2WSCJ 1NTKE 3VN0A 3FX0A 2E5YA 1SS1A 2K3RA 5CCGC 3CWBE 1S9KE 3C9IA 1H0TA 2Q7CA 3L72E 1KILB 2OQQA 2M3BA 5AW3B 5EFWB 3HE4B 1S5LH 1YJ9P 3VYIA 1L0NK 2LXCB 4BRYA 2KVVA 4I7ZC 3M0AA 2QM8A 3NMDA 2WPRA 1KYOD 2YXRB 2CPBA 5APXA 2XV5A 1GW4A 1NOHA 3AE2C 3FXDA 1AVYA 3Q1MA 1YITP 1JY3N 3H1IJ 5DJTB 3L75J 5B5EH 1OVVA 3L73D 4ASVA 2N1TB 3JSVC 4NPDA 5B5EE 2H7HA 1LNQA 3D6ZA 1NU1G 3BVHA 4R4LA 2ZYGA 5KLVG 1EQ7A 3P32A 1ZV8A 1ZRTE 1M1JC 4D6TD 1PZQA 4H44D 1W2BO 3H1LG 2OG0A 4I6MC 2FY8A 5AW6B 1Z56A 2V4HA 1NU1J 2UWJE 3L72J 4I7ZB 1T2KD 1ZRTD 1VF5C 3CCLP 3BRTB 2ZFCA 3L73J 3WUTA 2IFMA 3L75D 3B71A 2WITA 3EZ6A 1SQXK 1L2PA 1R5SA 2YMYA 2R5DA 2KZJA 4M3LA 1K04A 3L70E 1GU4A 3G9RA 1HJ0A 1NH4A 2O1KA 1YJWP 1BE3G 2KI7B 1FZBA 1YHQP 1KMIZ 5CBOA 3B5ND 1GU5A 2R32A 2E75C 4PV1D 3H1KJ 1SQXJ 4IFMA 2PGDA 2W90A 1T3JA 2XNDH 2HG5D 1E79H 2WQYC 3GLMA 4OGQD 4DCKA 1PV3A 4A7PA 3Q5SA 3CCJP 1KFMA 1Q81Q 3V5BA 2FBWC 1LTJC 1KN7A 3H1HJ 2HPCA 2YNYA 1SVFA 3TF5A 1T2KC 1SFCD 3USSA 1N73A 3VTPC 4C7RA 2XDJA 2OYIA 3P8MC 2YKPA 2WSFH 1WT6A 3B5NA 3RK2C 3B4SA 1HF9A 1WMKA 3PRJA 1S2EA 3RL0C 1KQLA 1N86A 1SQBJ 3GW6A 3HUSC 1EZVG 5I41B 3D6YA 1YQ3C 4CPGA 1Y9BA 1BSNA 2WPQA 1SQBE 2E43A 1PL5A 4XE5B 5APSA 4A1MA 2E42A 1KQFB 1RF1B 2C0WA 1GMJA 2L5GB 1S5LX 3MGNA 4H0LD 2FYUJ 3V4WA 2IYPA 1EZVE 4WBAA 3AE7C 3L71J 3EZ7A 1BGYE 1IC2A 1ZN5A 5APYA 2D2CD 1SQXD 3CXHH 1SQPG 2Y9ZA 4D6TG 3L72G 1VPCA 1RE4C 3P8CE 1EZVD 2IPPA 4WVZA 1QEXA 2IBZD 3BCCJ 4TT3H 5KAIE 3I5CA 2QIWA 3CX5D 3H6PA 1EDKA 2O01N 2QA4P 4ZMDA 2ZAEB 2K88A 1L4AC 1NTZE 2D2CB 2IYOA 2JEEA 5APUA 1SQXG 1LWUB 1K73Q 1BCCE 3TSIA 1GL2C 4EI2A 1DD4A 2V7QH 5GTHH 1LTIC 2P2UA 1Q7YQ 1RF1C 1FAVA 4EIJA 2AXCA 1MFZA 1VQOP 4EYYQ 3CCEP 5KAWA 3I56P 2R44A 3D70A 2GUVA 1JCCA 1BGYG 4I2LC 3JCUE 3L72D 5APWA 1OXZA 1RH5B 5AW1B 1NYHA 4DT0A 1KB9E 1JB0J 1IFJA 2E76C 3L74D 3V4QA 3SWYA 2M5AB 1QVGO 4AUWA 1Q08A 1LTTC 3D71A 5H2FE 4C7NA 1M7LA 5AVQB 4Y99B 3RBZA 1N7SC 3RK3C 4D6TJ 1LGHB 1JYHA 5D8CA 1LWUC 3W68A 1LT9C 3A7OA 1NTKG 1KFNA 1X0TA 1HBWA 5AVYB 2POHA 4NPEA 4UB6H 3V2RA 1BGYD 3WU2E 1S3JA 3OA7A 3M9QA 1KB9H 3TGUD 3TNUB 1K9MQ 2DG6A 1AA0A 1JUNA 2O1JA 4L76A 2KCUA 1LWUA 1BCCD 2GA1A 1VQPP 3CCRP 2RH0A 1LTBC 3HE5A 2M3EA 2RN0A 4GIFA 3QAOA 3L74G 2Q6QA 2AXTE 2QJYB 3PH0A 2ZXXA 4WB4A 3PP5A 2OYOA 4WY4C 1NVOA 1GDTA 2E76B 2OYIC 2WVRA 3BCCE 3N7NA 2KNCB 4H0LB 1RY3A 1KILA 4Y99C 2GOVA 1N7SB 4IL6E 5CBNA 2OTKE 2Y0CA 2K1AA 4N3YB 1N7SD 3H32B 1X22A 1FZCA 2Y0DA 2E76D 2Q9IA 1GK6A 5AW4B 3L70J 2A45I 3CWBD 1URQA 3CPWO 3CXHE 2KP8A 2M5AA 2JJLA 1X8YA 3WUUA 3R2PA 4U7JA 2GUSA 2YIUC 3MIWA 3CLQA 4O9BA 1TU3F 1NTMK 1NTZJ 1LP1B 4KJMA 1S9KD 1PFIA 1EXJA 1SQVG 5KTBA 1JY2N 4H13B 3W67A 1M1JA 4W7YA 4WY4B 4MN4C 2JWDA 3S9OA 1IK9A 4AYZA 1NU1D 3RL0g 2WT7B 4K3AA 2KS1B 3AEAC 1IFIA 1OMIA 4WY4D 3M0DC 1PGJA 1RF0A 1MFTA 1JM0A 4H44B 1N7SA 3GP4A 2KSJA 3KHUA 1CW5A 2NZ2A 3UCSA 1SQBG 1DIPA 1EC5A 3AEEC 4JYCA 2JP3A 3EFGA 2WSFJ 1NTKJ 1NTMD 1OVUA 1FZFA 3C1LA 4ZNCA 3L75G 5AW2B 1RF0C 3WUVA 1M8OB 1GL2A 4IL6H 2HR3A 1JY2P 1BE3D 3H32A 2VZ4A 2WSCH 3LURA 2B88A 1X9VA 3CC4P 1LP1A 2ZHHA 3MUDC 2MJZA 1ZR2A 2ZT9C 1BSHA 1G1IA 1T6AA 5KKZC 5KAFH 1FZEA 5GQQA 3Q2YA 1SQQD 1DH3A 1NTKK 2OGUA 1HVVA 3U59A 2A45G 4OWFA 1L0LK 3I55P 1PPJD 3ABVC 5TJHA 3GHGC 1JEKA 3A2AA 2Q5UA 1L0ND 2ZT9D 3E1IA 3KZIE 3HE4A 5C39A 1BDDA 1DD3A 3SWFA 1S4XA 3SFEC 2D2CC 3TYYA 3V2QA 1FC2C 4UB8H 1ZLLA 4U3FJ 3EZ2A 5AVZB 3L35A 3HTKA 1PP9J 5E79E 4GT1A 1L0NJ 1PPJG 1NWQA 2Q1KA 1VQ6P 3GG2A 1N73B 3V6IA 2XNXA 2BCCJ 2QSIA 2XZRA 2P67A 2AEFA 1P84E 4XA4A 1VQ7P 1U57A 2WMMA 1NTME 2A06G 1SLQA 5KAVA 2M0BA 3H1HE 1GL2B 2B9BA 4N78D 1R8EA 1YIJP 2G3AA 2WSEH 2W83C 1P84I 2IEFA 3H1IE 2Y9YA 2C9LY 2AXTH 4JBZA 2QM7A 2IFNA 2P10A 3NFQA 4C46A 1VL2A 1JOCA 4WLSA 4JYBA 1IFPA 1CSBA 5KJ7D 2BEQD 3A3YB 3KZIH 1LX8A 1NTZD 1RE4A 5APVA 4GKGA 1SQXE 3EZ9A 2FYUK 2C9NY 4J2NA 4QMAA 5CCHA 1DX7A 2W6AA 1PP9D 1KZUB 1Q06A 5KCBA 3V2NA 1GD2E 1NO4A 1L4AA 1NGMB 1JY3O 3HTKB 3R8KA 3A0HH 2KYVA 1R5LA 1Q05A 5APQA 5K5GB 4AYZB 5H2FH 5KKZB 1NTZG 1PGQA 2HODA 3F5HA 1P84D 2O01H 4L74A 2VRSA 1H0TB 4IOIH 1HH0A 3VMXA 4NPFX 3AEGC 2BCCG 4DZOA 4JPZB 5KAUA 2KXPB 3U1CA 2J5UA 2KK7A 1SQQJ 1Y8AA 3KDPB 1A02F 5KAXA 3H1LJ 1H88A 1VQ5P 1RH6A 3AE1C 1SQQG 5M1BA 3B8EB 1X79B 2YMKA 3AE9C 2RMZA 1BCCJ 4LGDE 1UIIA 2H8PD 5CCGA 3CCVP 2QEXP 1H8AA 4PJ0E 3TGUJ 3AEFC 2YO2A 1H89A 3H25A 3CCMP 2ZVOB 2ZHGA 1SQQK 3AE6C 1HGVA 2QE7H 4HH2A 1JMMA 2K37A 3L36A 3TNUA 1JY2O 1AVOA 4WLWA 4H13C 2E74B 3EQ2A 1BGYJ 5I44A 1VQ9P 1FE6A 1N7LA 4OGQC 1RE3C 1USDA 4YTPC 3B49A 5BU8B 2H89C 2CPSA 3EWKA 1LTSC 3PTZA 1QL2A 3AEBC 2FYZA 3L74J 1GL2D 1AFOA 1T3UA 1EDLA 1L0LG 3MTUE 5AVTB 3CX5I
chains in the Genus database with same CATH topology
3D71A 3SFDC 2E75C 4PV1D 1Q09A 5KKZC 1GMJA 1RH6A 2BOWA 4H0LC 1S5LX 2BEZF 3LW5J 3AE1C 4H0LD 1Q0AA 1UIXA 4GDOA 4U7JA 5M1BA 5GQQA 3Q2YA 2K9YA 5D8CA 1Q90D 1JYHA 2WSEJ 2YMKA 3AE9C 2YIUC 2IDBA 4DCZA 2P10A 2WQYC 3C8VA 3GLMA 3Q5PA 3GPVA 4R22B 4OGQD 1JBGA 1FDOA 1VL2A 1PV3A 3ABVC 3AE7C 5L8RJ 2H88C 3D6ZA 3Q5SA 1TU3F 3EZ7A 3O6QA 4WLSA 4R4LA 2D2CD 2FXPA 4R4EA 1K05A 3IN6A 2ZT9D 1EXJA 3AEFC 1R8DA 1ZRTE 3GF3A 2O01J 1KQGB 1VF5D 3H25A 5E01A 4H13D 1BOWA 2JO1A 2FBWC 1EXIA 4H13B 4H44D 1VF5B 3Q5RA 2G8YA 4H44C 4RKUJ 1D5YA 1MKMA 1DD3A 2BEQD 1OW7A 1LX8A 2E74C 2ZHGA 2DG6A 2V7QJ 2OG0A 3AE6C 4Y28J 1PIXA 2WSCJ 4TT3H 3S9OA 4AYZA 3EZ9A 3RL0g 2QIWA 2KCUA 4I7ZB 3GF7A 4Z1MH 3AEAC 1KILE 1OMIA 3SFEC 4B0YA 3EZFA 4J2NA 4XFJA 2HVAA 4PV1C 1VF5C 2D2CC 3AE4C 4WLWA 4LHFA 3R4YA 4H13C 3IAOA 4H44B 3GK6A 3EZ2A 3QAOA 1Q06A 1ZOYC 3GP4A 5I44A 2E74D 2JMLA 5KCBA 1PM6A 3AEDC 2QJPC 4PV1B 3B71A 4R4MA 1NGMB 2NZ2A 3UCSA 2D2CB 2WPVB 3AE8C 4OGQC 1AJYA 2OQQA 4YTPC 1DIPA 3B49A 4R24B 2FYNC 3R8KA 3AEEC 2H89C 1ZMEC 3FGAD 1HF9A 3EZ6A 2E76B 2QSIA 1ZP0C 1Q05A 1WMKA 1KORA 2KVVA 2QJKC 3AE3C 2JP3A 4I7ZC 2WSFJ 4H0LB 3EWKA 1DD4A 1IK7A 1RQVA 1OW8A 1U57A 4AYZB 1OW6A 3Q3DA 2QJYC 3HH0A 1KTMA 2GOVA 2E75D 1S1CX 1RQUA 3R8JA 5I41B 3D6YA 1YQ3C 2ZT9B 3GMAA 4KT0J 2MKVA 5KAWA 1Y9BA 3AE2C 1K04A 4IL6X 1FDIA 5KAVA 2E75B 3G9RA 1Q07A 1HJ0A 5KATA 3D70A 3AEGC 3AEBC 1Y6UA 5D90A 5KAUA 3RK3E 3T97B 3AE5C 2J5UA 2VZ4A 1KMIZ 4YXDC 2E76D 1NYHA 2E76C 1JB0J 3LURA 4OGQB 1PL5A 1R8EA 1YQ4C 3Q1MA 2G3AA 5KLIC 2ZHHA 4A1MA 1Q08A 5KAXA 2IEFA 3E0HA 2ZT9C 3AECC 1KQFB 2E74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D71 A;  3IAO A;  1R8D A;  1EXJ A;  2GOV A;  3GK6 A;  3QAO A;  3R8J A;  1Q06 A;  1Q09 A;  5I41 B;  3D6Y A;  5KCB A;  3GP4 A;  5E01 A;  5I44 A;  2JML A;  1BOW A;  1EXI A;  5KAW A;  3Q5R A;  5KAV A;  1Q0A A;  4R4M A;  5GQQ A;  1D5Y A;  3Q2Y A;  3UCS A;  1Q07 A;  5D8C A;  3G9R A;  1JYH A;  5KAT A;  3D70 A;  2ZHG A;  2DG6 A;  5D90 A;  2OQQ A;  1DIP A;  3B49 A;  4R24 B;  3R8K A;  5KAX A;  5KAU A;  3T97 B;  4AYZ A;  3Q5P A;  3GPV A;  4R22 B;  1JBG A;  2J5U A;  2KCU A;  2VZ4 A;  1Q05 A;  3LUR A;  3D6Z A;  3Q5S A;  4B0Y A;  1R8E A;  4J2N A;  4WLS A;  3Q1M A;  4R4L A;  2HVA A;  2ZHH A;  4A1M A;  1Q08 A;  4AYZ B;  4R4E A;  4WLW A;  3Q3D A;  3E0H A;  2BOW A;  3HH0 A; 
#chains in the Genus database with same CATH topology
 3ITK A;  1IFD A;  1OZH A;  3FWN A;  1QGK B;  4IFD K;  2KIK A;  3L70 D;  1WRG A;  1Q90 D;  2Z5H A;  1XTC C;  3H1J G;  1Y47 A;  2IBZ E;  4GOE A;  3P7K A;  3Q5P A;  1FJP A;  3BCC D;  4R4E A;  2N1T C;  2Z5I A;  2PAJ A;  3L4F A;  2JR8 A;  3MZW B;  1YBK A;  1BDC A;  3P8C D;  2G8Y A;  5DJU B;  1VDF A;  1OW7 A;  2KSE A;  3SWK A;  1PIX A;  2K9J B;  3L71 D;  2CK3 H;  2OTJ P;  3GHG B;  1SQQ E;  3CCU P;  3PLN A;  2YXQ B;  1USE A;  3EZF A;  1SQP K;  2HVA A;  1HWT C;  2FYU D;  3CXH D;  3G6E P;  2N1T D;  1NTZ K;  4R4M A;  2KS1 A;  3BCC G;  1ZR4 A;  2WPV B;  1AJY A;  2XU6 A;  1OWA A;  1IFN A;  1KOR A;  1PPJ E;  3L74 E;  1OW8 A;  1OW6 A;  2ZYA A;  2B87 B;  2RKL A;  1S1C X;  1IJD B;  1M57 D;  3F89 A;  1SQB D;  1G2C B;  3JC2 2;  1AQ5 A;  3H1I G;  2FYU G;  1AQT A;  4TLF A;  3TGU G;  4HJG H;  1MZ9 A;  3CXH I;  1HTL C;  5AVV B;  3H1H G;  1LTG C;  1EDJ A;  1URQ D;  4H0L C;  4YXW H;  5KJ7 C;  2K9Y A;  2HOD B;  1LT1 A;  1RE3 A;  1OFC X;  4I1L A;  4EOT A;  1ZXG A;  2AEM A;  3C8V A;  3BAS A;  2IBZ I;  2KZI A;  2Y0E A;  1JY3 P;  3O6Q A;  2KB7 P;  5AW9 B;  4ZKU A;  2IX7 C;  5KLV K;  3LIE A;  1GW3 A;  2YKO A;  5CMZ A;  4L73 A;  2LXB A;  2KNC A;  3HD7 D;  3H1H D;  5KJ7 A;  2I8D A;  5CJ4 A;  3CX5 H;  5TIS E;  2M8R A;  3L73 G;  2FFD A;  1KIL E;  3RK2 B;  4W80 A;  1L0N G;  2YIU B;  1KYO E;  1PGO A;  3AE4 C;  5CCG D;  4DOJ A;  1NJI Q;  2JML A;  3CCS P;  3RK3 D;  1HGZ A;  5KLV D;  1NHL A;  3VMY A;  5KLV J;  2QJK C;  3CCQ P;  3CWB G;  3V2P A;  1Y6U A;  1KC8 Q;  3VP8 A;  2ITA A;  3T97 B;  3B5N C;  3HD7 B;  2Q3E A;  5KLI C;  1AV1 A;  3O6Q B;  4BWN A;  4D6T E;  3AEC C;  3SFD C;  3VMZ A;  1BCC G;  5CHX A;  1SQV K;  1QVF O;  5KAF E;  1SQB K;  1OVR A;  4DCZ A;  1ZW0 A;  3GPV A;  5BU5 A;  4K35 A;  3HRN A;  5CCH D;  2HPC B;  4AQR D;  4DJG A;  2FFD B;  4C7N B;  1R8D A;  1KYO I;  4KHX A;  1BOW A;  1N8R Q;  1CI6 B;  5KAI H;  3JCU H;  4PJ0 H;  5KLI B;  3H1K G;  2QJK B;  3OJA B;  5CCH C;  4B0Y A;  2QRX A;  4XFJ A;  3PHL A;  1NTM G;  2A06 E;  3GK6 A;  3TK1 A;  2QJP C;  4PV1 B;  2B89 A;  3U1A A;  1VQK P;  1SQV E;  2QVA A;  4U3F G;  3A0B E;  3B5N B;  3KQG A;  3HD7 A;  1LTA C;  3K5B A;  1DEE G;  1DEB A;  5AVS B;  4N6J A;  1HJB A;  1LT9 A;  1FS0 E;  3MUD A;  3H1I D;  1SQV D;  3CMA P;  5D90 A;  2WWW A;  2BCC D;  2LR2 A;  4YPC A;  1S72 P;  5AW5 B;  1N2D C;  2J58 A;  5AW8 B;  3KXD A;  1N73 C;  3PJS K;  1PP9 E;  3H1K D;  2BOW A;  3LW5 H;  2H43 A;  2NPS B;  4U3F D;  2N9B A;  2BEZ F;  1RF1 A;  4LC1 A;  2PFX A;  1NKN A;  3EFF K;  2WSE J;  3CC2 P;  4UB8 E;  1FOS F;  2IDB A;  2AEJ A;  5GTI H;  3FXE A;  1JNM A;  4RO0 A;  3RK3 B;  2KLV A;  1VQN P;  3E1R A;  3RL0 D;  5AVU B;  3IF4 A;  1VF5 D;  5E01 A;  4H13 D;  5B66 H;  1EXI A;  2FXM A;  2KOG A;  4HKZ H;  3WU2 H;  2A45 H;  2C0X A;  3IFM A;  1KIL C;  3GF7 A;  5BVZ A;  3RGU A;  2IZ0 A;  3CL3 D;  4HYT B;  2L91 A;  4U3F E;  1KQS O;  4LHF A;  1SFC A;  3CI9 A;  3AED C;  3BRV B;  2A06 D;  3AE8 C;  1QL1 A;  3M9B A;  2PRR A;  3FGA D;  1BE3 J;  1KIL D;  2JDI H;  1RQV A;  3H1K E;  2QJY C;  4PD4 I;  2NPS C;  1J2J B;  3VMA A;  1J1D B;  3TDK A;  4BRY B;  1NTM J;  3S1K A;  2OYI B;  1KB9 I;  2O3J A;  1IO4 A;  1YTZ T;  3QH9 A;  3RBX A;  5KLV E;  2WSS H;  3OW2 O;  3MD0 A;  1SQP E;  2P58 A;  3II6 A;  3LW5 J;  1UIX A;  2NPS A;  3L70 G;  1PP9 G;  2WTY A;  4GOD A;  3M0D A;  4R22 B;  1JBG A;  4B86 A;  2N1T A;  1FJK A;  1FZC C;  2FXP A;  3T97 A;  4LLH A;  3IN6 A;  1L4A D;  1K8A Q;  3GF3 A;  1KQG B;  1XTG B;  4JF7 A;  1VF5 B;  1URQ C;  3H1L D;  4H44 C;  3VOP A;  1KB9 D;  3H1J D;  2P7J A;  4HB1 A;  4ZKP A;  1YTZ I;  2N9Y B;  2KLU A;  2DW3 A;  1SQP D;  2JWA A;  4PD4 D;  2K9J A;  3CME P;  1FZG A;  1ZOY C;  1OX3 A;  2E74 D;  3M9H A;  3CWB J;  2BCC E;  3KPE A;  2FYU E;  1FZC B;  1CI6 A;  2QG4 A;  1SP4 A;  4L75 A;  1PGP A;  3L73 E;  1U7M A;  3Q3D A;  1KTM A;  1Q86 Q;  1QX8 A;  1RQU A;  5APT A;  2ZT9 B;  3GMA A;  4KT0 J;  2ZXE B;  3KYQ A;  3HD7 C;  1Q07 A;  2W27 A;  3CC7 P;  1KV4 A;  3RK3 E;  2B87 A;  1OIP A;  2FYN B;  4WWI A;  4OGQ B;  3G4S P;  1GK4 A;  4UB6 E;  4AYC A;  3E0H A;  2J59 M;  2BAS A;  3FWL A;  1VQ8 P;  4OVN F;  1Q09 A;  3M91 A;  1URQ B;  4IFF A;  1M1J B;  1S5L E;  5CJ0 A;  4WY4 A;  2I1J A;  1GTW A;  2HLO A;  2R3C A;  3UIA A;  2JKV A;  1NAF A;  3BAT A;  2HYN A;  4RJT A;  4JQ0 D;  3QWO C;  3E7K A;  5AVW B;  2I1K A;  2JO1 A;  4BXL A;  1M56 D;  3OAK A;  1D5Y A;  3L37 A;  2E74 C;  1NTK D;  2P1J A;  2OAR A;  1YI2 P;  2FFD C;  1LJ2 A;  1JTH B;  3H1J E;  4Z1M H;  3NTN A;  4GOF A;  1FZA A;  4PV1 C;  2WT7 A;  3CD6 P;  3R4Y A;  1J1D C;  3IAO A;  1IFM A;  3RL0 B;  1J1E B;  3NXS A;  1Q2N A;  3A0B H;  2NRG A;  4R24 B;  1ZME C;  1SFC C;  3S4R A;  1ZP0 C;  1W5C E;  3WMM 0;  2R5B A;  1A02 J;  1L0L D;  2QJP B;  2E75 D;  2R3S A;  2OYH A;  3R8J A;  2ZYD A;  4W7Z A;  3HUS A;  4OH8 B;  1Q82 Q;  1FDI A;  2E75 B;  1NAY A;  3RK2 D;  5KAT A;  2Q3I A;  1EZV I;  1VQL P;  1MUU A;  3O8Z A;  3AE5 C;  1NKZ B;  4YXD C;  1YQ4 C;  2ZJS E;  1FU1 A;  3L71 G;  1YYC A;  1W2E A;  2HFE D;  5E79 H;  3A0H E;  1T8Z A;  1LTJ B;  3A5T A;  3TGU E;  2FXO A;  4PD4 E;  3H1J J;  1YJN P;  2O01 J;  1VQ4 P;  1J1E C;  1CZQ A;  1IZN B;  1FOS E;  1L0L J;  1M90 Q;  1D7M A;  2IBZ G;  2V7Q J;  3L71 E;  1SQP J;  3M06 A;  2SPZ A;  4Y28 J;  3MP7 B;  1KD1 Q;  2KUB A;  2GM4 A;  3N4X A;  5B66 E;  1JTH A;  1JO5 A;  2W6J H;  1SQV J;  1G2C A;  1NU1 K;  1EDI A;  2WPS A;  1GZL A;  1U7J A;  3L75 E;  1PM6 A;  3H1L E;  3HUS B;  5GTI E;  2YKQ A;  1JMB A;  4EDF A;  1BE3 E;  1L0N E;  2FYN C;  2ZVN B;  1E5W A;  2FKW B;  1FBM A;  5AVX B;  3VP9 A;  5AVR B;  1IK7 A;  4ASW A;  2WZ7 A;  1FDM A;  3HH0 A;  1KYO H;  1VQM P;  2Z4E A;  1RHZ B;  2MKV A;  4IL6 X;  5AW7 B;  2OYH B;  5AW0 B;  2IZ1 A;  2E5T A;  3LID A;  3ZDM A;  1LT9 B;  4N78 E;  1JCD A;  2PP6 A;  3AE3 C;  5GTH E;  2W6B A;  2W8Z A;  2NPS D;  4PD4 H;  1HUC A;  1P84 H;  1MV8 A;  1NU1 E;  1Q0A A;  3IR9 A;  4GDO A;  1L0L E;  2OTL P;  1FDO A;  2XKM A;  4RES B;  5L8R J;  3SSU A;  2H88 C;  3G71 P;  1LTJ A;  3CX5 E;  5TIS H;  2LKM A;  1K05 A;  1G1J A;  2YO3 A;  1QLE D;  2OYH C;  3Q5R A;  3MHV A;  4RKU J;  1MKM A;  1L4A B;  3GHG A;  3HE5 B;  1M1K Q;  3G3Z A;  1SFC B;  2WSC J;  1NTK E;  3VN0 A;  3FX0 A;  2E5Y A;  1SS1 A;  2K3R A;  5CCG C;  3CWB E;  1S9K E;  3C9I A;  1H0T A;  2Q7C A;  3L72 E;  1KIL B;  2OQQ A;  2M3B A;  5AW3 B;  5EFW B;  3HE4 B;  1S5L H;  1YJ9 P;  3VYI A;  1L0N K;  2LXC B;  4BRY A;  2KVV A;  4I7Z C;  3M0A A;  2QM8 A;  3NMD A;  2WPR A;  1KYO D;  2YXR B;  2CPB A;  5APX A;  2XV5 A;  1GW4 A;  1NOH A;  3AE2 C;  3FXD A;  1AVY A;  3Q1M A;  1YIT P;  1JY3 N;  3H1I J;  5DJT B;  3L75 J;  5B5E H;  1OVV A;  3L73 D;  4ASV A;  2N1T B;  3JSV C;  4NPD A;  5B5E E;  2H7H A;  1LNQ A;  3D6Z A;  1NU1 G;  3BVH A;  4R4L A;  2ZYG A;  5KLV G;  1EQ7 A;  3P32 A;  1ZV8 A;  1ZRT E;  1M1J C;  4D6T D;  1PZQ A;  4H44 D;  1W2B O;  3H1L G;  2OG0 A;  4I6M C;  2FY8 A;  5AW6 B;  1Z56 A;  2V4H A;  1NU1 J;  2UWJ E;  3L72 J;  4I7Z B;  1T2K D;  1ZRT D;  1VF5 C;  3CCL P;  3BRT B;  2ZFC A;  3L73 J;  3WUT A;  2IFM A;  3L75 D;  3B71 A;  2WIT A;  3EZ6 A;  1SQX K;  1L2P A;  1R5S A;  2YMY A;  2R5D A;  2KZJ A;  4M3L A;  1K04 A;  3L70 E;  1GU4 A;  3G9R A;  1HJ0 A;  1NH4 A;  2O1K A;  1YJW P;  1BE3 G;  2KI7 B;  1FZB A;  1YHQ P;  1KMI Z;  5CBO A;  3B5N D;  1GU5 A;  2R32 A;  2E75 C;  4PV1 D;  3H1K J;  1SQX J;  4IFM A;  2PGD A;  2W90 A;  1T3J A;  2XND H;  2HG5 D;  1E79 H;  2WQY C;  3GLM A;  4OGQ D;  4DCK A;  1PV3 A;  4A7P A;  3Q5S A;  3CCJ P;  1KFM A;  1Q81 Q;  3V5B A;  2FBW C;  1LTJ C;  1KN7 A;  3H1H J;  2HPC A;  2YNY A;  1SVF A;  3TF5 A;  1T2K C;  1SFC D;  3USS A;  1N73 A;  3VTP C;  4C7R A;  2XDJ A;  2OYI A;  3P8M C;  2YKP A;  2WSF H;  1WT6 A;  3B5N A;  3RK2 C;  3B4S A;  1HF9 A;  1WMK A;  3PRJ A;  1S2E A;  3RL0 C;  1KQL A;  1N86 A;  1SQB J;  3GW6 A;  3HUS C;  1EZV G;  5I41 B;  3D6Y A;  1YQ3 C;  4CPG A;  1Y9B A;  1BSN A;  2WPQ A;  1SQB E;  2E43 A;  1PL5 A;  4XE5 B;  5APS A;  4A1M A;  2E42 A;  1KQF B;  1RF1 B;  2C0W A;  1GMJ A;  2L5G B;  1S5L X;  3MGN A;  4H0L D;  2FYU J;  3V4W A;  2IYP A;  1EZV E;  4WBA A;  3AE7 C;  3L71 J;  3EZ7 A;  1BGY E;  1IC2 A;  1ZN5 A;  5APY A;  2D2C D;  1SQX D;  3CXH H;  1SQP G;  2Y9Z A;  4D6T G;  3L72 G;  1VPC A;  1RE4 C;  3P8C E;  1EZV D;  2IPP A;  4WVZ A;  1QEX A;  2IBZ D;  3BCC J;  4TT3 H;  5KAI E;  3I5C A;  2QIW A;  3CX5 D;  3H6P A;  1EDK A;  2O01 N;  2QA4 P;  4ZMD A;  2ZAE B;  2K88 A;  1L4A C;  1NTZ E;  2D2C B;  2IYO A;  2JEE A;  5APU A;  1SQX G;  1LWU B;  1K73 Q;  1BCC E;  3TSI A;  1GL2 C;  4EI2 A;  1DD4 A;  2V7Q H;  5GTH H;  1LTI C;  2P2U A;  1Q7Y Q;  1RF1 C;  1FAV A;  4EIJ A;  2AXC A;  1MFZ A;  1VQO P;  4EYY Q;  3CCE P;  5KAW A;  3I56 P;  2R44 A;  3D70 A;  2GUV A;  1JCC A;  1BGY G;  4I2L C;  3JCU E;  3L72 D;  5APW A;  1OXZ A;  1RH5 B;  5AW1 B;  1NYH A;  4DT0 A;  1KB9 E;  1JB0 J;  1IFJ A;  2E76 C;  3L74 D;  3V4Q A;  3SWY A;  2M5A B;  1QVG O;  4AUW A;  1Q08 A;  1LTT C;  3D71 A;  5H2F E;  4C7N A;  1M7L A;  5AVQ B;  4Y99 B;  3RBZ A;  1N7S C;  3RK3 C;  4D6T J;  1LGH B;  1JYH A;  5D8C A;  1LWU C;  3W68 A;  1LT9 C;  3A7O A;  1NTK G;  1KFN A;  1X0T A;  1HBW A;  5AVY B;  2POH A;  4NPE A;  4UB6 H;  3V2R A;  1BGY D;  3WU2 E;  1S3J A;  3OA7 A;  3M9Q A;  1KB9 H;  3TGU D;  3TNU B;  1K9M Q;  2DG6 A;  1AA0 A;  1JUN A;  2O1J A;  4L76 A;  2KCU A;  1LWU A;  1BCC D;  2GA1 A;  1VQP P;  3CCR P;  2RH0 A;  1LTB C;  3HE5 A;  2M3E A;  2RN0 A;  4GIF A;  3QAO A;  3L74 G;  2Q6Q A;  2AXT E;  2QJY B;  3PH0 A;  2ZXX A;  4WB4 A;  3PP5 A;  2OYO A;  4WY4 C;  1NVO A;  1GDT A;  2E76 B;  2OYI C;  2WVR A;  3BCC E;  3N7N A;  2KNC B;  4H0L B;  1RY3 A;  1KIL A;  4Y99 C;  2GOV A;  1N7S B;  4IL6 E;  5CBN A;  2OTK E;  2Y0C A;  2K1A A;  4N3Y B;  1N7S D;  3H32 B;  1X22 A;  1FZC A;  2Y0D A;  2E76 D;  2Q9I A;  1GK6 A;  5AW4 B;  3L70 J;  2A45 I;  3CWB D;  1URQ A;  3CPW O;  3CXH E;  2KP8 A;  2M5A A;  2JJL A;  1X8Y A;  3WUU A;  3R2P A;  4U7J A;  2GUS A;  2YIU C;  3MIW A;  3CLQ A;  4O9B A;  1TU3 F;  1NTM K;  1NTZ J;  1LP1 B;  4KJM A;  1S9K D;  1PFI A;  1EXJ A;  1SQV G;  5KTB A;  1JY2 N;  4H13 B;  3W67 A;  1M1J A;  4W7Y A;  4WY4 B;  4MN4 C;  2JWD A;  3S9O A;  1IK9 A;  4AYZ A;  1NU1 D;  3RL0 g;  2WT7 B;  4K3A A;  2KS1 B;  3AEA C;  1IFI A;  1OMI A;  4WY4 D;  3M0D C;  1PGJ A;  1RF0 A;  1MFT A;  1JM0 A;  4H44 B;  1N7S A;  3GP4 A;  2KSJ A;  3KHU A;  1CW5 A;  2NZ2 A;  3UCS A;  1SQB G;  1DIP A;  1EC5 A;  3AEE C;  4JYC A;  2JP3 A;  3EFG A;  2WSF J;  1NTK J;  1NTM D;  1OVU A;  1FZF A;  3C1L A;  4ZNC A;  3L75 G;  5AW2 B;  1RF0 C;  3WUV A;  1M8O B;  1GL2 A;  4IL6 H;  2HR3 A;  1JY2 P;  1BE3 D;  3H32 A;  2VZ4 A;  2WSC H;  3LUR A;  2B88 A;  1X9V A;  3CC4 P;  1LP1 A;  2ZHH A;  3MUD C;  2MJZ A;  1ZR2 A;  2ZT9 C;  1BSH A;  1G1I A;  1T6A A;  5KKZ C;  5KAF H;  1FZE A;  5GQQ A;  3Q2Y A;  1SQQ D;  1DH3 A;  1NTK K;  2OGU A;  1HVV A;  3U59 A;  2A45 G;  4OWF A;  1L0L K;  3I55 P;  1PPJ D;  3ABV C;  5TJH A;  3GHG C;  1JEK A;  3A2A A;  2Q5U A;  1L0N D;  2ZT9 D;  3E1I A;  3KZI E;  3HE4 A;  5C39 A;  1BDD A;  1DD3 A;  3SWF A;  1S4X A;  3SFE C;  2D2C C;  3TYY A;  3V2Q A;  1FC2 C;  4UB8 H;  1ZLL A;  4U3F J;  3EZ2 A;  5AVZ B;  3L35 A;  3HTK A;  1PP9 J;  5E79 E;  4GT1 A;  1L0N J;  1PPJ G;  1NWQ A;  2Q1K A;  1VQ6 P;  3GG2 A;  1N73 B;  3V6I A;  2XNX A;  2BCC J;  2QSI A;  2XZR A;  2P67 A;  2AEF A;  1P84 E;  4XA4 A;  1VQ7 P;  1U57 A;  2WMM A;  1NTM E;  2A06 G;  1SLQ A;  5KAV A;  2M0B A;  3H1H E;  1GL2 B;  2B9B A;  4N78 D;  1R8E A;  1YIJ P;  2G3A A;  2WSE H;  2W83 C;  1P84 I;  2IEF A;  3H1I E;  2Y9Y A;  2C9L Y;  2AXT H;  4JBZ A;  2QM7 A;  2IFN A;  2P10 A;  3NFQ A;  4C46 A;  1VL2 A;  1JOC A;  4WLS A;  4JYB A;  1IFP A;  1CSB A;  5KJ7 D;  2BEQ D;  3A3Y B;  3KZI H;  1LX8 A;  1NTZ D;  1RE4 A;  5APV A;  4GKG A;  1SQX E;  3EZ9 A;  2FYU K;  2C9N Y;  4J2N A;  4QMA A;  5CCH A;  1DX7 A;  2W6A A;  1PP9 D;  1KZU B;  1Q06 A;  5KCB A;  3V2N A;  1GD2 E;  1NO4 A;  1L4A A;  1NGM B;  1JY3 O;  3HTK B;  3R8K A;  3A0H H;  2KYV A;  1R5L A;  1Q05 A;  5APQ A;  5K5G B;  4AYZ B;  5H2F H;  5KKZ B;  1NTZ G;  1PGQ A;  2HOD A;  3F5H A;  1P84 D;  2O01 H;  4L74 A;  2VRS A;  1H0T B;  4IOI H;  1HH0 A;  3VMX A;  4NPF X;  3AEG C;  2BCC G;  4DZO A;  4JPZ B;  5KAU A;  2KXP B;  3U1C A;  2J5U A;  2KK7 A;  1SQQ J;  1Y8A A;  3KDP B;  1A02 F;  5KAX A;  3H1L J;  1H88 A;  1VQ5 P;  1RH6 A;  3AE1 C;  1SQQ G;  5M1B A;  3B8E B;  1X79 B;  2YMK A;  3AE9 C;  2RMZ A;  1BCC J;  4LGD E;  1UII A;  2H8P D;  5CCG A;  3CCV P;  2QEX P;  1H8A A;  4PJ0 E;  3TGU J;  3AEF C;  2YO2 A;  1H89 A;  3H25 A;  3CCM P;  2ZVO B;  2ZHG A;  1SQQ K;  3AE6 C;  1HGV A;  2QE7 H;  4HH2 A;  1JMM A;  2K37 A;  3L36 A;  3TNU A;  1JY2 O;  1AVO A;  4WLW A;  4H13 C;  2E74 B;  3EQ2 A;  1BGY J;  5I44 A;  1VQ9 P;  1FE6 A;  1N7L A;  4OGQ C;  1RE3 C;  1USD A;  4YTP C;  3B49 A;  5BU8 B;  2H89 C;  2CPS A;  3EWK A;  1LTS C;  3PTZ A;  1QL2 A;  3AEB C;  2FYZ A;  3L74 J;  1GL2 D;  1AFO A;  1T3U A;  1EDL A;  1L0L G;  3MTU E;  5AVT B;  3CX5 I; 
#chains in the Genus database with same CATH homology
 3D71 A;  3SFD C;  2E75 C;  4PV1 D;  1Q09 A;  5KKZ C;  1GMJ A;  1RH6 A;  2BOW A;  4H0L C;  1S5L X;  2BEZ F;  3LW5 J;  3AE1 C;  4H0L D;  1Q0A A;  1UIX A;  4GDO A;  4U7J A;  5M1B A;  5GQQ A;  3Q2Y A;  2K9Y A;  5D8C A;  1Q90 D;  1JYH A;  2WSE J;  2YMK A;  3AE9 C;  2YIU C;  2IDB A;  4DCZ A;  2P10 A;  2WQY C;  3C8V A;  3GLM A;  3Q5P A;  3GPV A;  4R22 B;  4OGQ D;  1JBG A;  1FDO A;  1VL2 A;  1PV3 A;  3ABV C;  3AE7 C;  5L8R J;  2H88 C;  3D6Z A;  3Q5S A;  1TU3 F;  3EZ7 A;  3O6Q A;  4WLS A;  4R4L A;  2D2C D;  2FXP A;  4R4E A;  1K05 A;  3IN6 A;  2ZT9 D;  1EXJ A;  3AEF C;  1R8D A;  1ZRT E;  3GF3 A;  2O01 J;  1KQG B;  1VF5 D;  3H25 A;  5E01 A;  4H13 D;  1BOW A;  2JO1 A;  2FBW C;  1EXI A;  4H13 B;  4H44 D;  1VF5 B;  3Q5R A;  2G8Y A;  4H44 C;  4RKU J;  1D5Y A;  1MKM A;  1DD3 A;  2BEQ D;  1OW7 A;  1LX8 A;  2E74 C;  2ZHG A;  2DG6 A;  2V7Q J;  2OG0 A;  3AE6 C;  4Y28 J;  1PIX A;  2WSC J;  4TT3 H;  3S9O A;  4AYZ A;  3EZ9 A;  3RL0 g;  2QIW A;  2KCU A;  4I7Z B;  3GF7 A;  4Z1M H;  3AEA C;  1KIL E;  1OMI A;  3SFE C;  4B0Y A;  3EZF A;  4J2N A;  4XFJ A;  2HVA A;  4PV1 C;  1VF5 C;  2D2C C;  3AE4 C;  4WLW A;  4LHF A;  3R4Y A;  4H13 C;  3IAO A;  4H44 B;  3GK6 A;  3EZ2 A;  3QAO A;  1Q06 A;  1ZOY C;  3GP4 A;  5I44 A;  2E74 D;  2JML A;  5KCB A;  1PM6 A;  3AED C;  2QJP C;  4PV1 B;  3B71 A;  4R4M A;  1NGM B;  2NZ2 A;  3UCS A;  2D2C B;  2WPV B;  3AE8 C;  4OGQ C;  1AJY A;  2OQQ A;  4YTP C;  1DIP A;  3B49 A;  4R24 B;  2FYN C;  3R8K A;  3AEE C;  2H89 C;  1ZME C;  3FGA D;  1HF9 A;  3EZ6 A;  2E76 B;  2QSI A;  1ZP0 C;  1Q05 A;  1WMK A;  1KOR A;  2KVV A;  2QJK C;  3AE3 C;  2JP3 A;  4I7Z C;  2WSF J;  4H0L B;  3EWK A;  1DD4 A;  1IK7 A;  1RQV A;  1OW8 A;  1U57 A;  4AYZ B;  1OW6 A;  3Q3D A;  2QJY C;  3HH0 A;  1KTM A;  2GOV A;  2E75 D;  1S1C X;  1RQU A;  3R8J A;  5I41 B;  3D6Y A;  1YQ3 C;  2ZT9 B;  3GMA A;  4KT0 J;  2MKV A;  5KAW A;  1Y9B A;  3AE2 C;  1K04 A;  4IL6 X;  1FDI A;  5KAV A;  2E75 B;  3G9R A;  1Q07 A;  1HJ0 A;  5KAT A;  3D70 A;  3AEG C;  3AEB C;  1Y6U A;  5D90 A;  5KAU A;  3RK3 E;  3T97 B;  3AE5 C;  2J5U A;  2VZ4 A;  1KMI Z;  4YXD C;  2E76 D;  1NYH A;  2E76 C;  1JB0 J;  3LUR A;  4OGQ B;  1PL5 A;  1R8E A;  1YQ4 C;  3Q1M A;  2G3A A;  5KLI C;  2ZHH A;  4A1M A;  1Q08 A;  5KAX A;  2IEF A;  3E0H A;  2ZT9 C;  3AEC C;  1KQF B;  2E74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...