3D72A

1.65 angstrom crystal structure of the cys71val variant in the fungal photoreceptor vvd
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSVALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light activation of the LOV protein vivid generates a rapidly exchanging dimer.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
total genus 38
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3d72A00
1OT9A 3MQOA 4RQ9A 4F3LA 4L9FA 4HJ4A 1LSWA 1MZUA 3LI8A 5J3WA 1DRMA 2QKPA 1UWPX 1XFNA 3H82B 3UB9A 3FG8A 4KUOA 4WL9A 4KQDA 2YKFA 2QHKA 2WKRA 4WUJA 4WN5A 4WF0A 2EA9A 4BBVA 3HJKA 5J7EA 4EETB 3EEHA 4JGOA 3K3DA 3LIAA 3C8CA 3NHQA 4HIAA 3T50A 1S4SA 3UE6A 1XJ6A 1DP8A 1T1AA 1T18A 1TS6A 3UMEA 4DJ3A 5HWVA 2Z6DA 4MN5A 3PYPA 3H9WA 1N9LA 4HI4A 4GS9A 1NWZA 4M4XA 3SW1A 2PDRA 3LIDA 4PKYG 1DP6A 2VLGA 1LSVA 5HWWA 5I5LA 4WLAA 2VV7A 1S67L 1ODVA 1F98A 3MQQA 4HP9A 2B02A 3BY9A 2ZBBA 1T1CA 3GDIA 3MJQA 4GW9A 4LRZE 3NOPC 2VV8A 5IU1A 4LRYC 1D06A 2H28A 5F5YA 5TBMB 3RTYA 2W0NA 3E4PA 3HJIA 1V9ZA 2V1BA 1OJ5A 3E4OA 2INWA 2I9VA 1P0ZA 2QJ5A 1V9YA 1S4RA 5G4ZA 5HDSA 3LYXA 4E04A 1TS7A 3LIFA 1GSXA 2WKPA 4JGQA 5HD3A 3MFXA 3IS2B 4JGRA 1T1BA 5HSQA 2YKHA 4HH3A 2A24B 2ZOIA 2QWSA 4EQ1A 5KIZA 1XFQA 2P7JA 1Y28A 3K3CA 3ULFA 5F6AA 1LT0A 1N9OA 1OTAA 3H82A 4HJ3A 4HJ6A 1LL8A 2PYRA 2J80A 2L1MA 3F1NA 4GHIB 1N9NA 2V1AA 4HH2A 4XT2B 4HNBA 1EW0A 5HWTA 4EEUA 2R78A 3PHYA 4NXEA 3MXQA 3ICYA 3UB8A 4EESA 5A8BA 4HHDA 2A24A 3BWLA 3F1PA 4I3AA 5DKKA 5F69A 3IS2A 3UMDA 1OJGA 2L0WA 2PHYA 2Z6CA 1T19A 1S66L 2PD8A 1XJ3A 2VEAA 3BY8A 3CWFA 4R3AA 1JNUA 3EWKA 3F1OB 5DKLA 1XJ4A 2KDKA 2W27A 3G6OA 4NXFA 5TBMA 2HV1A 4LLOB 4R6LA 1GSVA 3VE3A 2PYPA 2V0WA 2BASA 4I3IA 4EW7A 1GSWA 1UGUA 1X0OA 1P97A 1VB6A 3C2WA 4R38A 3MR0A 4H6JB 4I3JA 2VV6A 2WKQA 4LPZA 3UB7A 1TS8A 3H7WA 2M1CA 4GCZA 2CMNA 5HDCA 1DP9A 1OTBA 4LRXC 4HY8A 2L4RA 4GS9B 2PD7A 3VE4A 2OOLA 1OT6A 2JHEA 4I5SA 3H7WB 3KX0X 3LI9A 1XJ2A 1LSXA 3CAXA 3FC7A 4JGPA 5HDDA 4DJ2A 4H6JA 4BBUA 3A0VA 4HP4A 5HZHA 3IBRA 3NJAA 3CLOA 2V9AA 1S1YA 3LICA 3NOUC 4I38A 5AVFA 4BBTA 4B9OA 3D72A 4EERA 1OTEA 1TS0A 4HQAA 3RH8B 3LIEA 1G28A 3E4QA 3A0RA 2GJ3A 5DJTA 3VOLA 2KX6A 3P7NA 1OTDA 5F68A 4L9EA 4EXOA 5IS1A 2OWHA 3LIBA 3B33A 5HD5A 1BYWA 4K08A 4NXBA 4HOIA 1D7EA 4R70A 3UB6A 5J4EA 2V0UA 3F1OA 3NOTC 3OLOA 2ZOHA 4KUKA 4EEPA 3ZQ5A 5DJUA 2D01A 1S1ZA 2D02A 3GECA 4GHIA 5AVEA 1WA9A 3F1NB 2PR5A 4L9GA 2K7SA 4XT2A 1KOUA 1UWNX 2OWJA 4I39A 4NXGA 4PKYA 5EFWA 5G4YA 3F1PB 4YWZA 4F3LB 4MN6A 1OTIA 2JN7A 2QJ7A 1F9IA 3LUQA 2PR6A 3A0SA
chains in the Genus database with same CATH superfamily
5GLDA 1CQAA 4WBGA 3IWOA 2ZD8A 2XSSA 3D3OA 4KUOA 4EWFA 1IELA 3LR5A 1Q2QA 1LL9A 3T1RA 4EETB 3KSFA 3C8CA 1L0EA 5CERA 4HI4A 2VX8A 1FOFA 2XEPA 4DN0A 3IWIA 4R4SA 1VM1A 3VP0A 3IF6A 3KO6A 4WM9A 1V9ZA 2ACGA 3DWZA 1P0ZA 1S4RA 4Y7PA 1GSXA 2Y2HA 5FEGA 1ESUA 3B42A 5EVIB 1OTAA 3IH9A 1MKIA 4IBXA 3VP4A 1YLJA 1XXMA 3CZDA 3KYZA 4IHQA 1NJ4A 3Q81A 5FI2A 2PD8A 3BY8A 1YLYA 3IX4A 1K54A 1ZTUA 2BASA 4FH4A 5FSRA 4OVDA 4R38A 3BFDA 4LPZA 4Z1WA 3BFCA 3MXSA 5L2FA 4HY8A 5HDDA 3CAXA 1LSXA 1VEUB 1WYBA 4OPRA 4N92A 3NJAA 3V50A 4JLFA 2X71A 4B9OA 1E3UA 2B18A 4FH2A 2KX6A 2VGLM 5AQBA 3OBFA 4XT2A 3RTYA 4LV2A 3ZGAB 3Q1FA 4KQDA 4LENA 3MSHA 1W8QA 3CITA 5CX7A 1I2SA 3LR3A 1IKGA 1GHPA 3PYPA 5GL9A 3V3RA 4D2OA 4PKYG 1XGIA 1ODVA 1F98A 4Y13A 3BY9A 2ZL1A 4BENA 3Q07A 4X25A 2QPNA 2IWDA 2XQZA 4IJGA 4Z9QA 3IS2B 3UPOA 2O0YA 3A3EA 4HJ3A 2WUQA 2EWWA 1N9NA 1K4EA 4DKIA 1NZOA 3F1PA 2VA0A 1K54C 3F1OB 2XD1A 3S7PA 3LEZA 1S6RA 1M6KA 5DVAA 4S2JA 2VV6A 1BLCA 3S1YA 1VQQA 4GNUA 4EUVA 5L09A 3P01A 2O9CA 3WS5A 3IWQA 1BULA 4BBUA 2FH5A 3E0YA 5DJTA 3P7NA 4L9EA 3R4KA 3C4OA 2A3UA 1BYWA 1MBLA 3UB6A 3QHYA 3VMAA 1ES5A 4RX2A 2KOIA 2WGIA 2WAEA 4OPYA 5F1GA 3S4XA 3A0SA 3MQOA 4RQ9A 4X1LA 3O5YA 4ETZA 2ZC3B 5GHYA 3UB9A 5CECA 1OMEA 2JKTM 3BQAA 2G7UA 1DP8A 1NRJA 4Y0OA 1W5DA 5K5BA 4WELA 2VJWA 3JPUA 3HLFA 1LSVA 3C30A 1FILA 4HP9A 2FFFB 2HZ5A 4LRYC 5TJJA 4ID4A 2W0NA 3N8SA 3O3VA 2P9VA 2HF6A 4E04A 3NULA 2YKHA 1Y28A 3PBRA 4Q0JA 4HHDA 2V8FA 4GDNA 2MJ6A 5DTKA 3IS2A 4JF4A 4MEZA 3BQ8A 1ACFA 2WGVA 1RGZA 4N9KA 4KZ6A 4PM5A 1UGUA 4QD4A 5FQJA 2PD7A 4DE3A 4DJ2A 5HAPA 5EM1A 4CLCD 1ERMA 5FAPA 4MMNA 3MFDA 4XXRA 5IS1A 4WMCD 4EXOA 1HVBA 4R23A 4OQIA 3R7WA 1K56A 3FPWA 4GZBA 1Q2PA 3ZG8B 1EI5A 4NKPA 2OSUA 4O01A 3MQ0A 5AQ7A 2C6WB 1ALQA 3MKEA 1LSWA 4LV3A 3CUEA 3BW6A 2OV5A 3G31A 3IXDA 2P9VB 2E8IA 1N9LA 4OOYA 1AWIA 3MS6A 3QP5A 4G3KA 4R4RA 3LO7A 3T4KA 3DTMA 5L07A 2JBFA 4KQQA 4QWOA 5F5YA 4KZ8A 3MZDA 4OPZA 3PBQA 1PWGA 5IT5A 3BJNA 5HARA 2A24B 2P7JA 3ULFA 2BLSA 1TF1A 3GRJA 1N9OA 1FCOA 1BT5A 3LEQA 1P9RA 1K4FA 1KGEA 3M6HA 1YLZA 2PHYA 4DDSA 2JKFA 3EEAA 2XROA 2BTFP 2Y59A 2X02A 2P74A 2XDMA 3IBJA 4HBTA 1SKOB 4Y3IA 3A3JA 1PZOA 3UB7A 3SS3A 3QP2A 5GLBA 3HUNA 2EFXA 2L4RA 5EUAA 3CPTB 3VE4A 4IVIA 3H7WB 3HUMA 4GN2A 4S2PA 1JWPA 4OKPA 4HP4A 4E3IA 5F1FA 3TG9A 3E98A 3IX3A 3PBSA 3LIBA 3B33A 3F1OA 5FATA 5MC7A 3ZQ5A 1TDLA 3OPLA 3F1NB 3DTIA 4EEPA 4NXGA 5EFWA 3F1PB 4ZRRA 2LB9A 1OT9A 2QMIA 1IFQA 1MZUA 3EGDC 3FG8A 2YKFA 3U4LP 2EA9A 4BBVA 3K3DA 3GVBA 3P09A 5EOOA 2IWBA 3FKVA 1GCEA 3DWKA 3BEBA 3MJQA 5TBMB 1SDNA 2H28A 3HJIA 2WK0A 1OJ5A 1J9MA 1P9WA 1NXYA 5HD3A 4S2OA 2JC7A 3UB5P 4EQIA 1LL8A 4GD6A 3T4QA 3N6IA 3MXQA 2Y2LA 5CGXA 5DF8A 3LY3A 1CEGA 4P0MA 1H8YA 1OJGA 1K55C 5F82A 4B93A 1JNUA 4WZ5A 5DF9A 4R3JA 1XP4A 3T4SA 1IYSA 1L0DA 3V39A 3CHWP 4ZJ2A 3C2WA 4R0QA 3FKWA 4GS9B 3V3SA 2XD5A 3KYQA 1XJ2A 4GKUA 4LCMA 1YMXA 2HDSA 4C3QA 4EUZA 3K2NA 1NRFA 3C4PA 4HQAA 2HDQA 3A0RA 3NDGA 3GQZA 1MXOA 5GLAA 4Y2FA 1A0KA 1YLWA 3NOTC 4WZ4A 5FQ9A 1S1ZA 2H5SA 3GMWA 1KOUA 3A3FA 3LUQA 1ZG6A 3UE1A 3UY6A 4E3JA 5J3WA 3VOYA 1FSWA 4E3NA 3W2ZA 3SOIA 3ITAA 4JGOA 4HIAA 3UE3A 1CI8A 3B3XA 4IEDA 4OOLA 3T4JA 3WS2A 4M4XA 3VSKA 3FV7A 4RYEA 4WLAA 3PAGA 4CLCB 3NOPC 5IU1A 4CLCC 2M7VA 4YNRA 4Y17A 1ZG4A 4OONA 1I5QA 3NY4A 5CEDA 3HBRA 1C3BA 1WYCA 3IHBA 2WKPA 2OAQ1 5FDHA 5KIZA 3W4QA 4BL2A 2JCHA 4OQGA 2J80A 4XT2B 4HH2A 3VOLA 1D1JA 4Q8IA 5FEFA 3BLSA 5EECA 2Y2NA 1TD5A 4GD8A 4ME4A 2ZMFA 1S0WA 1CF0A 3G35A 4ARZB 2OAP1 1K6RA 2WADA 4II7A 4YOFA 4JXSA 3OZHA 2WKIA 1W7FA 1P97A 2E8JA 1Z09A 1VEUA 1MY8A 4QJGA 3LFVA 5AQ9A 3Q7VA 5I94A 4UQIM 2O9BA 3LR4A 4NK3A 1S1YA 4I38A 2HP9A 3NC8A 4O8GA 5M1AA 1OTEA 1XKZA 1CK3A 4X55A 1JVJA 3O87A 1SHVA 3W4PA 4F3LB 4QB8A 4YFMA 3BRMA 1OTIA 1GSWA 4HJ4A 4P87A 4NETA 2QKPA 3MZEA 5FA7A 4DMZA 4WF0A 3EEHA 1XJ6A 3H9WA 3G32A 4IBRA 1SZVA 2GX5A 4JXWA 1G68A 4EU0A 5CGSA 2B02A 4BL3A 4KZ3A 4KG2A 1T1CA 4EBPA 1MWRA 3M6BA 4P85A 1VHMA 1V9YA 2Y2QA 3G30A 5HSQA 2EX6A 4QY6A 3NI9A 5EVID 4CLCE 3HCYA 1KE3A 5F6AA 3MF0A 1J3WA 4JKTA 1JTDA 5HWTA 3V5MA 4UAAA 3Q7ZA 3E2KA 5DKKA 3CJMA 2L0WA 3HLBA 5CTMA 4MCWA 1YLPA 1XJ3A 2Y2OA 3CWFA 4KZ5A 2ZMAA 1M40A 1PNEA 4R6LA 4P6ZM 1VB6A 4KZBA 4FOFA 4WMCA 5IHVA 2CMNA 2EXAA 1G5UA 4A5RA 3WS4A 1HLUP 5EV0A 3BYDA 3PXPA 2IA2A 4KG5A 3G34A 5FDSA 1OPXA 1H3QA 1YT4A 5E2EA 1FR1A 5EOEA 1D7EA 1H8MA 1BLSA 2VGJA 5AQAA 3GSGA 1YKDA 3HLWA 5DJUA 3OPRA 4GHIA 3MKFA 2NUPC 4S2NC 2QJ7A 1F9IA 3RFBA 4E3MA 4GB7A 4RX3A 1PI5A 3SS4A 5E2FA 3LI8A 4BMWA 1K38A 1DRMA 1AXBA 3LR0A 2QHKA 5FASA 2EX8A 3NHQA 1DJBA 4OLDA 3WRZA 2Z6DA 4E3LA 4ESPA 3EQVA 1N4OA 2LB5A 2VLGA 5BOHA 1ONGA 5JYPA 2ZBBA 4LRZE 3VP1A 2VV8A 1PIOA 3LY4A 2INWA 2I9VA 2W3GA 5KSHA 1T1BA 1K25A 1VETA 4GHIB 5M18A 1MWSA 1EWZA 3ZG9B 5EVIA 3T1XA 3T1SA 1YPRA 5HW3A 3BWLA 5FI6A 2GNXA 2VK3A 1XJ4A 3G6OA 2PYPA 4IUHA 4N1XA 4KZ9A 3JVVA 4RA7A 3UO9A 3MR0A 2A2LA 1LI9A 3HLGA 1PFLA 2Q0OA 1IOUA 5DTTA 4UHUA 4H6JA 3A0VA 5E2GA 5GLCA 1G28A 3BFGA 5CGWA 5HAQA 4ARZA 4UQIS 1KVLA 1BLHA 3ZFZA 2XFSA 4AFIA 4S2NA 4JPMA 3Q82A 3CUEC 1K57C 1PWDA 3DW0A 4JF6A 5HPFA 3H82B 4WEKA 3PBOA 2NUTC 4DDYA 3TW8A 1LI0A 2V8CA 5HL1A 2ZL1B 3JVUA 3NIAA 3GDIA 3C38A 5DFXA 1BLPA 3FWLA 5G4ZA 5HDSA 2J3WA 4JGQA 3A3DA 3WRTA 1HD8A 1XPBA 1Y4OA 2ZLYA 4EESA 3ICYA 1VETB 3V67A 1W63Q 2A24A 3QP6A 2XFTA 4OPQA 5AJGA 2EWVA 2PBDP 2EX9A 4DE0A 1PW8A 5G18A 5DKLA 3IXHA 1YAXA 2HV1A 3L7HA 2A49A 1TS8A 3GTCA 4S2MA 3T1QB 4BD0A 2RL3A 2GZAA 3PBTA 5CHUA 1O07A 4LRXC 1H0MA 4ZTKA 1CJFA 3C7UA 1K6SA 2JHEA 2WZXA 4I5SA 3HREA 1U60A 4Y0UA 2J8YA 1BTLA 5KMWA 4P6ZS 5HPIA 2HJ9C 1SCWA 4K91A 2OLUA 1OTDA 5EE8A 4BQMA 5J4EA 1W79A 3DTKA 1ZHHB 2D01A 5AVEA 5FI7A 4I39A 2ZQDA 4F3LA 5GHXA 1XGJA 4WN5A 1NYYA 3G2ZA 5J7EA 3NBLA 2JKTI 2XRNA 4R3BA 4CLCA 1S4SA 4DJ3A 5F83A 4E3KA 4S2IA 1DP6A 2XA7S 1S67L 4PM7A 4N9LA 3IXBA 3T4LA 1TVFA 1E4DA 4MBKA 2B5RA 3WWXA 1ES2A 2ZMVA 4OOMA 5A8BA 3SZTA 3MMHA 3PBNA 3VOZA 4K0WA 2XK1A 5F69A 2XA7M 3WS0A 3A3IA 1S66L 5FQMA 3CMZA 3KYEA 3SH9A 5HL6A 4E3OA 3BFEA 1K56D 4GDBA 4ZDXA 4HBUA 3ZNYA 1I2WA 3FPVA 4JGPA 3S7NA 2Y79A 3IT9A 3CPTA 4G3VA 3C7VA 3NOUC 3OOVA 4B4XA 2GJ3A 4EV4A 5DFYA 1SKOA 3VFHA 4BLMA 2V0UA 1ES3A 5U47A 4Q0HA 1PZPA 2PR5A 4IUKA 3EGXC 5A92A 2ZC5B 2JN7A 1PRQA 1L0FA 1GA0A 1G6AA 2HDRA 3KSIA 2PU2A 4X56A 3T4OA 1XFNA 3HLDA 2WGWB 4WUJA 4JF5A 1XX2A 3UMEA 2DCFA 2R9WA 1KGGA 3ITBA 1JWZA 1HZOA 2C5WB 1NWZA 1L2SA 4Y0TA 4HESA 3G4PA 2PBYA 4P6BA 1KE4A 1Y54A 1IYPA 2R9XA 4GW9A 1QMEA 3ZG7B 3UPPA 3QNCA 4PPRA 1RP5A 5TGFA 3K3CA 3ZG0A 2L1MA 4HNBA 1DY6A 3PHYA 4QPRA 3UB8A 4FTXA 2XH9A 5CEBA 3UMDA 5CXWA 3I7JA 1HTZA 4R3AA 3EWKA 1G6OA 2V1ZA 2KDKA 4Q0IA 4UA6A 4BJPA 2HPBA 4OP8A 3BLMA 2EX2A 4I3JA 4Y15A 3H7WA 3IF6B 2WKEA 4ZAMA 3TJZC 3HLCA 2ZM8A 3LI9A 4UA9A 1ERQA 3FC7A 4OP5A 3QP1A 2DRWA 2Y4AA 2HDUA 3MBZA 3CLOA 3N8RA 4EERA 3ZYTA 3HL9A 4ZBEA 3VSLA 3VV4A 3ZCZA 3LIEA 1XA7A 2Y91A 3M2KA 4K08A 1JTGA 1BZAA 4U0TA 4RVAA 4PMAA 2D02A 4L9GA 4MBFA 3OCLA 4OQHA 4YWZA 4S2KA 4F94A 4L9FA 3FYZA 1KDWA 2P08A 2DMWA 2EFUA 3P98A 1QMFA 4XUXA 3FZCA 2O9AA 3EQUA 2UWXA 3HJKA 5M19A 3EOIA 3W8KA 4MLLA 3G2YA 1T1AA 2ZQAA 1YMSA 4DE1A 4PM6A 4CPKA 3SW1A 4D60A 1ES4A 5I5LA 4UEYA 3M2JA 5LBRA 3DAVA 4JBFA 1JWVA 3NCKA 2I72A 4X68A 2Y2GA 1MPLA 4LCLA 3UN7A 4HH3A 4EQ1A 2WGWA 5EVLA 1TEMA 2V1AA 3VFFA 5CRFA 1EW0A 2R78A 1KDSA 1Z6FA 4I3AA 1W63M 4FD8A 5L8MA 2ZQ8A 1T19A 2HP5A 2J7VA 4KQOA 1FSYA 4LLOB 3PTEA 1E25A 2G2WA 1FIKA 3GV9A 1IYOA 4R1GA 3S22A 2P04A 4FUWA 4MDZA 3ZVWA 2VZWA 1OT6A 2RCXA 3NECA 4Y5FA 3W4OA 4B4ZA 1CI9A 4YINA 3RXXA 1K57A 1BUEA 4QHCA 1H8ZA 1MKMA 5JYOA 2ZQCA 4KG6A 2WAFA 5CTNA 5GHZA 3QNBA 1ONHA 1WA9A 1LL5A 2K7SA 5G4YA 2HP6A 3C5AA 2ZQ9A 3OPHA 4PKYA 4DRTA 5HAIA 4PAUA 3T12B 2Y2PA 2B95A 2M7UA 5EM0A 3O88A 4G3WA 2Y8HA 1DJCA 3UE6A 3SS5A 4B88A 5C5KA 3ISGA 4GJ4A 1EROA 3MQQA 2XLNA 3UDFA 2ZM0A 1PI4A 2W3EA 3QP4A 1K55A 3OPPA 3MFXA 2ZQ7A 4DE2A 1XFQA 3PR6A 2V20A 3QP8A 2H10A 2PYRA 3BM6A 4EEUA 2PT7A 1YQSA 4K0XA 4EBNA 1CEFA 3UE0A 4ETXA 3BFFA 2Y2JA 4NXFA 4O0PA 5KSCA 4PM9A 4OLGA 4QY5A 3UDXA 3IQAA 2ZC7A 2WKQA 3HLEA 3BECA 3TOIA 1DP9A 2W1TB 2ZC6B 2JE5A 3N8LA 3IH8A 3LICA 3DTEA 1XA1A 3IF5A 1TS0A 3E4QA 1IKIA 1H5XA 2OWHA 2HGVA 5HD5A 1GHMA 1NYMA 2J3TC 3B47A 3PAEA 2FFYA 2QYBA 1UWNX 1LHYA 2H0YA 2UV0E 4BD1A 5CHMA 2CC1A 3T4TA 2FZ0A 1FCNA 1UWPX 2K31A 3LIAA 3T50A 4LGWA 5FQKA 5CHJA 1TS6A 2W1RA 5DF7A 1FR6A 3SH8A 2PDRA 3MZFA 3MXRA 1NLYA 3ZHHA 2V2FF 4MBHA 4MN7A 1BSGA 3CG5A 1WE4A 2WKHA 3E4PA 2V1BA 1FQGA 2QJ5A 3LIFA 4GOGA 4JGRA 2ZOIA 2QWSA 4X69A 1LLBA 1YSQA 5HX9A 3DBAA 3TSGA 2Y2MA 3H82A 4GLQA 1ESIA 4KZ4A 4NXEA 4DXBA 2GDNA 5A90A 2Z2LB 4E6XA 1KVMA 3AGFA 2X01A 2VEAA 4OH0A 4PM8A 2W27A 2Z2MB 2G2UA 5KZHA 1GSVA 5TFQA 2V0WA 4I3IA 5FQQA 1X0OA 3N7WA 4MNRA 2IWCA 3TRCA 1OTBA 3D4FA 2W1TA 4KZ7A 1PYYA 4KQRA 2WYXA 1KE0A 3WS1A 2V9AA 5AVFA 4LV1A 5EVEA 3IF6C 1O7EA 5F68A 5EPHA 1MWUA 1YLTA 2PAVP 2XF3A 4U3TA 2JKRI 3GECA 5HWVA 2OWJA 4N1HA 5FAOA 2PR6A 3UNWA 5A93A 1ZKJA 2J9PA 1E3UD 4WL9A 1GA9A 1DJAA 2W3FA 4FCFA 4MN5A 4X6TA 1YSPA 3LIDA 3IHAA 3O86A 4HEFA 4CJNA 5HWWA 5FL3A 2VV7A 3U2AA 3AGEA 4FSFA 4EBLA 2HJEA 1D06A 4ZJ1A 4ZJ3A 3E4OA 4S2LA 4LV0A 2O99A 3AGDA 2Q9MA 5FAQA 3S7OA 1NZUA 4L0LA 3F1NA 3S7QA 1K0KA 4U0XA 2VKSA 2Z6CA 1GHIA 1KGFA 2Y2KA 1IEMA 3R7WB 4XUZA 1F2KA 5HFOA 4KZAA 4H6JB 4KENB 2AVXA 1F5MA 4GCZA 2W3DA 1MWTA 2VGLS 2OOLA 3KX0X 3N4IA 4OQ0A 4QU3A 1W8YA 3IX8A 4CQHA 4UA7A 2EXBA 2QZ6A 3HUOA 3IBRA 4BBTA 3LCEA 4IVKA 1N9BA 4BWIA 2ZM2A 2H0TA 2VGKA 4R70A 1SDEA 2JKRM 4NEED 1ZC2A 3UDIA 2Y55A 5TR7A 3RJUA 5EVIC 2BG1A 4MN6A 3OLOA 2W3HA 2ZJ9A 4E6WA 3ZDJA 5FQIA 3VP3A 2J9OA 2WKRA 4X1MA 3KSGA 1FCMA 1L0GA 1NLZA 1T18A 3NDEA 4H8RA 3L9KA 4GS9A 5E2HA 1SKFA 3ZVTA 3UPNA 1PWCA 1STZA 4LFUA 4WEJA 2XGNA 3ZG5A 4WYYA 3LYXA 1TS7A 2WZZA 1RGYA 2JKGA 1L3LA 2XR0A 1LT0A 2J3TD 2DNSA 1IYQA 3E2LA 4HJ6A 2ZC4B 4DF6A 2KLIA 4X53A 3KSHA 4DXCA 3D9YA 4JXGA 3HVFA 3OCNA 1TDGA 5DTSA 4M3KA 3ZNTA 5TBMA 4C6YA 3VE3A 4EW7A 4WZ5C 3TE8A 2M1CA 5HDCA 2Y2IA 3RXWA 5D3OA 5L10A 3GR2A 3VP2A 1PW1A 2K2NA 3CI6A 4JXVA 2PU4A 3JYIA 1MC0A 5HZHA 3Q7VB 4NG2A 5E43A 3D72A 3RH8B 3SH7A 2OLVA 4NXBA 4HOIA 1YM1A 5A91A 2PRFA 4KUKA 4O7DA 2ZOHA 3IXGA 3OC2A 3LGOA 1RCJA 4PHTA 5J8XA 4C75A 1NY0A 2Q9NA
chains in the Genus database with same CATH topology
1OT9A 4PAUA 1IFQA 1MZUA 2M7UA 5HPFA 3EGDC 3H82B 2XSSA 3D3OA 3FG8A 4G3WA 4KUOA 4WEKA 2YKFA 3PBOA 2Y8HA 3LR5A 2EA9A 4BBVA 4EETB 3K3DA 3KSFA 3C8CA 3UE6A 2NUTC 5C5KA 3TW8A 4HI4A 2VX8A 4GJ4A 3JVUA 4DN0A 3MQQA 3GDIA 3MJQA 2W3EA 5TBMB 2H28A 3C38A 3KO6A 3HJIA 1V9ZA 1OJ5A 5DFXA 1P0ZA 1P9WA 1S4RA 5G4ZA 5HDSA 2J3WA 1GSXA 4JGQA 5HD3A 3MFXA 3B42A 1XFQA 3PR6A 1OTAA 1LL8A 2PYRA 4EEUA 3T4QA 4EESA 2PT7A 3ICYA 3MXQA 3V67A 1W63Q 2A24A 4ETXA 3KYZA 4IHQA 1OJGA 5AJGA 2EWVA 2PD8A 3BY8A 4B93A 1JNUA 5DKLA 4NXFA 4O0PA 5DF9A 1ZTUA 1YAXA 2HV1A 3T4SA 2BASA 3C2WA 4R38A 2WKQA 4LPZA 1TS8A 4Z1WA 3PBTA 2GZAA 1DP9A 2W1TB 4LRXC 4HY8A 4GS9B 2JHEA 4I5SA 5HDDA 3KYQA 1XJ2A 1LSXA 3CAXA 3NJAA 3LICA 4P6ZS 5HPIA 4B9OA 3K2NA 2HJ9C 1TS0A 4HQAA 2B18A 3E4QA 3A0RA 2KX6A 1OTDA 2VGLM 4Y2FA 2OWHA 2HGVA 5HD5A 2J3TC 5J4EA 3NOTC 3B47A 1ZHHB 2D01A 3OBFA 1S1ZA 5AVEA 4XT2A 2QYBA 3RTYA 1KOUA 1UWNX 4I39A 3LUQA 4F3LA 5J3WA 3T4TA 2FZ0A 1UWPX 4KQDA 3W2ZA 4WN5A 2K31A 3CITA 5CX7A 5J7EA 4JGOA 2JKTI 3LR3A 2XRNA 3LIAA 4CLCA 4HIAA 3T50A 1S4SA 3UE3A 4DJ3A 1TS6A 4OOLA 3T4JA 2W1RA 3PYPA 4M4XA 2PDRA 4PKYG 1DP6A 1NLYA 4MN7A 4WLAA 2XA7S 1S67L 1ODVA 1F98A 4CLCB 3BY9A 3NOPC 5IU1A 4CLCC 2M7VA 4YNRA 3E4PA 2V1BA 2QJ5A 3T4LA 3LIFA 4IJGA 2WKPA 4JGRA 3IS2B 2OAQ1 2ZOIA 2QWSA 5KIZA 1YSQA 2O0YA 3DBAA 2ZMVA 4OOMA 3H82A 4HJ3A 2EWWA 2J80A 4XT2B 4HH2A 3VOLA 1N9NA 5A8BA 4GLQA 3MMHA 3PBNA 4NXEA 5F69A 3F1PA 2VA0A 2XA7M 1TD5A 1S66L 2VEAA 4ME4A 2ZMFA 3F1OB 5HL6A 2W27A 3S7PA 2OAP1 4ARZB 4YOFA 4II7A 1GSVA 2V0WA 4I3IA 1X0OA 1P97A 2VV6A 3LFVA 4EUVA 3TRCA 1OTBA 2W1TA 3P01A 2O9CA 3FPVA 4JGPA 3S7NA 2Y79A 4UQIM 2O9BA 2FH5A 4BBUA 3LR4A 2V9AA 1S1YA 4G3VA 3NOUC 3E0YA 4I38A 4O8GA 5AVFA 3OOVA 1OTEA 2GJ3A 5DJTA 3P7NA 5F68A 4L9EA 3R4KA 5DFYA 1BYWA 3UB6A 2V0UA 2JKRI 4Q0HA 2KOIA 3GECA 5HWVA 2PR5A 4IUKA 4F3LB 3EGXC 2OWJA 1OTIA 2JN7A 1GSWA 3A0SA 2PR6A 3KSIA 3MQOA 4RQ9A 3T4OA 3O5YA 4HJ4A 4ETZA 2QKPA 3UB9A 1XFNA 4WL9A 2JKTM 4WUJA 4DMZA 4WF0A 3EEHA 3BQAA 2G7UA 3UMEA 2W3FA 1XJ6A 1DP8A 1NRJA 4MN5A 3H9WA 1NWZA 5K5BA 4WELA 1YSPA 2VJWA 2GX5A 3LIDA 1LSVA 5HWWA 3C30A 5FL3A 2VV7A 3U2AA 4EU0A 4HP9A 2B02A 4FSFA 1T1CA 4GW9A 2HJEA 4LRYC 1D06A 5TJJA 2W0NA 3E4OA 1VHMA 1V9YA 2HF6A 4E04A 5HSQA 2O99A 2YKHA 4CLCE 3HCYA 1Y28A 3K3CA 3PBRA 5F6AA 3S7OA 3MF0A 4Q0JA 4L0LA 2L1MA 3F1NA 5HWTA 4HNBA 3PHYA 4QPRA 3UB8A 3S7QA 4HHDA 2VKSA 5DKKA 2MJ6A 3IS2A 3UMDA 2L0WA 2Z6CA 4MCWA 3BQ8A 4R3AA 1XJ3A 3CWFA 3EWKA 1G6OA 2KDKA 4Q0IA 3R7WB 4BJPA 4R6LA 4P6ZM 1UGUA 1VB6A 4H6JB 4FOFA 4I3JA 3H7WA 1F5MA 4GCZA 2W3DA 2CMNA 2VGLS 3TJZC 2PD7A 2OOLA 3KX0X 3LI9A 3FC7A 4CQHA 4DJ2A 4CLCD 3PXPA 2IA2A 3IBRA 3CLOA 4BBTA 4MMNA 4EERA 3ZYTA 4BWIA 1OPXA 1H3QA 3VV4A 3LIEA 5IS1A 4EXOA 4K08A 4R70A 1D7EA 2JKRM 3R7WA 4NEED 1H8MA 3FPWA 1YKDA 5DJUA 2D02A 4GHIA 4L9GA 3OCLA 2NUPC 4YWZA 4MN6A 4NKPA 2QJ7A 3OLOA 1F9IA 2W3HA 3RFBA 4O01A 3MQ0A 4L9FA 1LSWA 3LI8A 4BMWA 1DRMA 2P08A 2DMWA 3CUEA 3BW6A 3LR0A 2QHKA 2WKRA 2O9AA 3KSGA 3EQUA 3HJKA 3EOIA 3NHQA 1NLZA 1T1AA 1T18A 2Z6DA 1N9LA 4GS9A 3EQVA 3SW1A 2LB5A 2VLGA 5I5LA 4G3KA 4UEYA 1STZA 5LBRA 4WEJA 3T4KA 2ZBBA 4LRZE 2VV8A 5F5YA 2INWA 2I9VA 2W3GA 3PBQA 5KSHA 3LYXA 1TS7A 5IT5A 1T1BA 3BJNA 4HH3A 2A24B 4EQ1A 2P7JA 3ULFA 1TF1A 1LT0A 1N9OA 2J3TD 4HJ6A 4GHIB 2V1AA 1EW0A 2R78A 2KLIA 1P9RA 3BWLA 4I3AA 1W63M 2PHYA 3KSHA 5L8MA 3EEAA 2XROA 1T19A 2GNXA 3OCNA 1XJ4A 3G6OA 3IBJA 4KQOA 5TBMA 4LLOB 3VE3A 4Y3IA 2PYPA 4IUHA 4EW7A 3JVVA 3MR0A 3UB7A 2A2LA 3TE8A 2M1CA 2P04A 5HDCA 4MDZA 2L4RA 1IOUA 2VZWA 3VE4A 1OT6A 2K2NA 3H7WB 3CI6A 4H6JA 1MC0A 3A0VA 4HP4A 4Y5FA 5HZHA 3D72A 3RH8B 3E98A 1G28A 3PBSA 3LIBA 3B33A 4NXBA 1MKMA 4HOIA 4ARZA 3F1OA 4KUKA 4UQIS 2ZOHA 5MC7A 3ZQ5A 3OC2A 1WA9A 3F1NB 4PHTA 4AFIA 2K7SA 4EEPA 4NXGA 4PKYA 5G4YA 5EFWA 3F1PB 3CUEC 4ZRRA 2LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT9 A;  3MQO A;  4RQ9 A;  4F3L A;  4L9F A;  4HJ4 A;  1LSW A;  1MZU A;  3LI8 A;  5J3W A;  1DRM A;  2QKP A;  1UWP X;  1XFN A;  3H82 B;  3UB9 A;  3FG8 A;  4KUO A;  4WL9 A;  4KQD A;  2YKF A;  2QHK A;  2WKR A;  4WUJ A;  4WN5 A;  4WF0 A;  2EA9 A;  4BBV A;  3HJK A;  5J7E A;  4EET B;  3EEH A;  4JGO A;  3K3D A;  3LIA A;  3C8C A;  3NHQ A;  4HIA A;  3T50 A;  1S4S A;  3UE6 A;  1XJ6 A;  1DP8 A;  1T1A A;  1T18 A;  1TS6 A;  3UME A;  4DJ3 A;  5HWV A;  2Z6D A;  4MN5 A;  3PYP A;  3H9W A;  1N9L A;  4HI4 A;  4GS9 A;  1NWZ A;  4M4X A;  3SW1 A;  2PDR A;  3LID A;  4PKY G;  1DP6 A;  2VLG A;  1LSV A;  5HWW A;  5I5L A;  4WLA A;  2VV7 A;  1S67 L;  1ODV A;  1F98 A;  3MQQ A;  4HP9 A;  2B02 A;  3BY9 A;  2ZBB A;  1T1C A;  3GDI A;  3MJQ A;  4GW9 A;  4LRZ E;  3NOP C;  2VV8 A;  5IU1 A;  4LRY C;  1D06 A;  2H28 A;  5F5Y A;  5TBM B;  3RTY A;  2W0N A;  3E4P A;  3HJI A;  1V9Z A;  2V1B A;  1OJ5 A;  3E4O A;  2INW A;  2I9V A;  1P0Z A;  2QJ5 A;  1V9Y A;  1S4R A;  5G4Z A;  5HDS A;  3LYX A;  4E04 A;  1TS7 A;  3LIF A;  1GSX A;  2WKP A;  4JGQ A;  5HD3 A;  3MFX A;  3IS2 B;  4JGR A;  1T1B A;  5HSQ A;  2YKH A;  4HH3 A;  2A24 B;  2ZOI A;  2QWS A;  4EQ1 A;  5KIZ A;  1XFQ A;  2P7J A;  1Y28 A;  3K3C A;  3ULF A;  5F6A A;  1LT0 A;  1N9O A;  1OTA A;  3H82 A;  4HJ3 A;  4HJ6 A;  1LL8 A;  2PYR A;  2J80 A;  2L1M A;  3F1N A;  4GHI B;  1N9N A;  2V1A A;  4HH2 A;  4XT2 B;  4HNB A;  1EW0 A;  5HWT A;  4EEU A;  2R78 A;  3PHY A;  4NXE A;  3MXQ A;  3ICY A;  3UB8 A;  4EES A;  5A8B A;  4HHD A;  2A24 A;  3BWL A;  3F1P A;  4I3A A;  5DKK A;  5F69 A;  3IS2 A;  3UMD A;  1OJG A;  2L0W A;  2PHY A;  2Z6C A;  1T19 A;  1S66 L;  2PD8 A;  1XJ3 A;  2VEA A;  3BY8 A;  3CWF A;  4R3A A;  1JNU A;  3EWK A;  3F1O B;  5DKL A;  1XJ4 A;  2KDK A;  2W27 A;  3G6O A;  4NXF A;  5TBM A;  2HV1 A;  4LLO B;  4R6L A;  1GSV A;  3VE3 A;  2PYP A;  2V0W A;  2BAS A;  4I3I A;  4EW7 A;  1GSW A;  1UGU A;  1X0O A;  1P97 A;  1VB6 A;  3C2W A;  4R38 A;  3MR0 A;  4H6J B;  4I3J A;  2VV6 A;  2WKQ A;  4LPZ A;  3UB7 A;  1TS8 A;  3H7W A;  2M1C A;  4GCZ A;  2CMN A;  5HDC A;  1DP9 A;  1OTB A;  4LRX C;  4HY8 A;  2L4R A;  4GS9 B;  2PD7 A;  3VE4 A;  2OOL A;  1OT6 A;  2JHE A;  4I5S A;  3H7W B;  3KX0 X;  3LI9 A;  1XJ2 A;  1LSX A;  3CAX A;  3FC7 A;  4JGP A;  5HDD A;  4DJ2 A;  4H6J A;  4BBU A;  3A0V A;  4HP4 A;  5HZH A;  3IBR A;  3NJA A;  3CLO A;  2V9A A;  1S1Y A;  3LIC A;  3NOU C;  4I38 A;  5AVF A;  4BBT A;  4B9O A;  3D72 A;  4EER A;  1OTE A;  1TS0 A;  4HQA A;  3RH8 B;  3LIE A;  1G28 A;  3E4Q A;  3A0R A;  2GJ3 A;  5DJT A;  3VOL A;  2KX6 A;  3P7N A;  1OTD A;  5F68 A;  4L9E A;  4EXO A;  5IS1 A;  2OWH A;  3LIB A;  3B33 A;  5HD5 A;  1BYW A;  4K08 A;  4NXB A;  4HOI A;  1D7E A;  4R70 A;  3UB6 A;  5J4E A;  2V0U A;  3F1O A;  3NOT C;  3OLO A;  2ZOH A;  4KUK A;  4EEP A;  3ZQ5 A;  5DJU A;  2D01 A;  1S1Z A;  2D02 A;  3GEC A;  4GHI A;  5AVE A;  1WA9 A;  3F1N B;  2PR5 A;  4L9G A;  2K7S A;  4XT2 A;  1KOU A;  1UWN X;  2OWJ A;  4I39 A;  4NXG A;  4PKY A;  5EFW A;  5G4Y A;  3F1P B;  4YWZ A;  4F3L B;  4MN6 A;  1OTI A;  2JN7 A;  2QJ7 A;  1F9I A;  3LUQ A;  2PR6 A;  3A0S A; 
#chains in the Genus database with same CATH topology
 5GLD A;  1CQA A;  4WBG A;  3IWO A;  2ZD8 A;  2XSS A;  3D3O A;  4KUO A;  4EWF A;  1IEL A;  3LR5 A;  1Q2Q A;  1LL9 A;  3T1R A;  4EET B;  3KSF A;  3C8C A;  1L0E A;  5CER A;  4HI4 A;  2VX8 A;  1FOF A;  2XEP A;  4DN0 A;  3IWI A;  4R4S A;  1VM1 A;  3VP0 A;  3IF6 A;  3KO6 A;  4WM9 A;  1V9Z A;  2ACG A;  3DWZ A;  1P0Z A;  1S4R A;  4Y7P A;  1GSX A;  2Y2H A;  5FEG A;  1ESU A;  3B42 A;  5EVI B;  1OTA A;  3IH9 A;  1MKI A;  4IBX A;  3VP4 A;  1YLJ A;  1XXM A;  3CZD A;  3KYZ A;  4IHQ A;  1NJ4 A;  3Q81 A;  5FI2 A;  2PD8 A;  3BY8 A;  1YLY A;  3IX4 A;  1K54 A;  1ZTU A;  2BAS A;  4FH4 A;  5FSR A;  4OVD A;  4R38 A;  3BFD A;  4LPZ A;  4Z1W A;  3BFC A;  3MXS A;  5L2F A;  4HY8 A;  5HDD A;  3CAX A;  1LSX A;  1VEU B;  1WYB A;  4OPR A;  4N92 A;  3NJA A;  3V50 A;  4JLF A;  2X71 A;  4B9O A;  1E3U A;  2B18 A;  4FH2 A;  2KX6 A;  2VGL M;  5AQB A;  3OBF A;  4XT2 A;  3RTY A;  4LV2 A;  3ZGA B;  3Q1F A;  4KQD A;  4LEN A;  3MSH A;  1W8Q A;  3CIT A;  5CX7 A;  1I2S A;  3LR3 A;  1IKG A;  1GHP A;  3PYP A;  5GL9 A;  3V3R A;  4D2O A;  4PKY G;  1XGI A;  1ODV A;  1F98 A;  4Y13 A;  3BY9 A;  2ZL1 A;  4BEN A;  3Q07 A;  4X25 A;  2QPN A;  2IWD A;  2XQZ A;  4IJG A;  4Z9Q A;  3IS2 B;  3UPO A;  2O0Y A;  3A3E A;  4HJ3 A;  2WUQ A;  2EWW A;  1N9N A;  1K4E A;  4DKI A;  1NZO A;  3F1P A;  2VA0 A;  1K54 C;  3F1O B;  2XD1 A;  3S7P A;  3LEZ A;  1S6R A;  1M6K A;  5DVA A;  4S2J A;  2VV6 A;  1BLC A;  3S1Y A;  1VQQ A;  4GNU A;  4EUV A;  5L09 A;  3P01 A;  2O9C A;  3WS5 A;  3IWQ A;  1BUL A;  4BBU A;  2FH5 A;  3E0Y A;  5DJT A;  3P7N A;  4L9E A;  3R4K A;  3C4O A;  2A3U A;  1BYW A;  1MBL A;  3UB6 A;  3QHY A;  3VMA A;  1ES5 A;  4RX2 A;  2KOI A;  2WGI A;  2WAE A;  4OPY A;  5F1G A;  3S4X A;  3A0S A;  3MQO A;  4RQ9 A;  4X1L A;  3O5Y A;  4ETZ A;  2ZC3 B;  5GHY A;  3UB9 A;  5CEC A;  1OME A;  2JKT M;  3BQA A;  2G7U A;  1DP8 A;  1NRJ A;  4Y0O A;  1W5D A;  5K5B A;  4WEL A;  2VJW A;  3JPU A;  3HLF A;  1LSV A;  3C30 A;  1FIL A;  4HP9 A;  2FFF B;  2HZ5 A;  4LRY C;  5TJJ A;  4ID4 A;  2W0N A;  3N8S A;  3O3V A;  2P9V A;  2HF6 A;  4E04 A;  3NUL A;  2YKH A;  1Y28 A;  3PBR A;  4Q0J A;  4HHD A;  2V8F A;  4GDN A;  2MJ6 A;  5DTK A;  3IS2 A;  4JF4 A;  4MEZ A;  3BQ8 A;  1ACF A;  2WGV A;  1RGZ A;  4N9K A;  4KZ6 A;  4PM5 A;  1UGU A;  4QD4 A;  5FQJ A;  2PD7 A;  4DE3 A;  4DJ2 A;  5HAP A;  5EM1 A;  4CLC D;  1ERM A;  5FAP A;  4MMN A;  3MFD A;  4XXR A;  5IS1 A;  4WMC D;  4EXO A;  1HVB A;  4R23 A;  4OQI A;  3R7W A;  1K56 A;  3FPW A;  4GZB A;  1Q2P A;  3ZG8 B;  1EI5 A;  4NKP A;  2OSU A;  4O01 A;  3MQ0 A;  5AQ7 A;  2C6W B;  1ALQ A;  3MKE A;  1LSW A;  4LV3 A;  3CUE A;  3BW6 A;  2OV5 A;  3G31 A;  3IXD A;  2P9V B;  2E8I A;  1N9L A;  4OOY A;  1AWI A;  3MS6 A;  3QP5 A;  4G3K A;  4R4R A;  3LO7 A;  3T4K A;  3DTM A;  5L07 A;  2JBF A;  4KQQ A;  4QWO A;  5F5Y A;  4KZ8 A;  3MZD A;  4OPZ A;  3PBQ A;  1PWG A;  5IT5 A;  3BJN A;  5HAR A;  2A24 B;  2P7J A;  3ULF A;  2BLS A;  1TF1 A;  3GRJ A;  1N9O A;  1FCO A;  1BT5 A;  3LEQ A;  1P9R A;  1K4F A;  1KGE A;  3M6H A;  1YLZ A;  2PHY A;  4DDS A;  2JKF A;  3EEA A;  2XRO A;  2BTF P;  2Y59 A;  2X02 A;  2P74 A;  2XDM A;  3IBJ A;  4HBT A;  1SKO B;  4Y3I A;  3A3J A;  1PZO A;  3UB7 A;  3SS3 A;  3QP2 A;  5GLB A;  3HUN A;  2EFX A;  2L4R A;  5EUA A;  3CPT B;  3VE4 A;  4IVI A;  3H7W B;  3HUM A;  4GN2 A;  4S2P A;  1JWP A;  4OKP A;  4HP4 A;  4E3I A;  5F1F A;  3TG9 A;  3E98 A;  3IX3 A;  3PBS A;  3LIB A;  3B33 A;  3F1O A;  5FAT A;  5MC7 A;  3ZQ5 A;  1TDL A;  3OPL A;  3F1N B;  3DTI A;  4EEP A;  4NXG A;  5EFW A;  3F1P B;  4ZRR A;  2LB9 A;  1OT9 A;  2QMI A;  1IFQ A;  1MZU A;  3EGD C;  3FG8 A;  2YKF A;  3U4L P;  2EA9 A;  4BBV A;  3K3D A;  3GVB A;  3P09 A;  5EOO A;  2IWB A;  3FKV A;  1GCE A;  3DWK A;  3BEB A;  3MJQ A;  5TBM B;  1SDN A;  2H28 A;  3HJI A;  2WK0 A;  1OJ5 A;  1J9M A;  1P9W A;  1NXY A;  5HD3 A;  4S2O A;  2JC7 A;  3UB5 P;  4EQI A;  1LL8 A;  4GD6 A;  3T4Q A;  3N6I A;  3MXQ A;  2Y2L A;  5CGX A;  5DF8 A;  3LY3 A;  1CEG A;  4P0M A;  1H8Y A;  1OJG A;  1K55 C;  5F82 A;  4B93 A;  1JNU A;  4WZ5 A;  5DF9 A;  4R3J A;  1XP4 A;  3T4S A;  1IYS A;  1L0D A;  3V39 A;  3CHW P;  4ZJ2 A;  3C2W A;  4R0Q A;  3FKW A;  4GS9 B;  3V3S A;  2XD5 A;  3KYQ A;  1XJ2 A;  4GKU A;  4LCM A;  1YMX A;  2HDS A;  4C3Q A;  4EUZ A;  3K2N A;  1NRF A;  3C4P A;  4HQA A;  2HDQ A;  3A0R A;  3NDG A;  3GQZ A;  1MXO A;  5GLA A;  4Y2F A;  1A0K A;  1YLW A;  3NOT C;  4WZ4 A;  5FQ9 A;  1S1Z A;  2H5S A;  3GMW A;  1KOU A;  3A3F A;  3LUQ A;  1ZG6 A;  3UE1 A;  3UY6 A;  4E3J A;  5J3W A;  3VOY A;  1FSW A;  4E3N A;  3W2Z A;  3SOI A;  3ITA A;  4JGO A;  4HIA A;  3UE3 A;  1CI8 A;  3B3X A;  4IED A;  4OOL A;  3T4J A;  3WS2 A;  4M4X A;  3VSK A;  3FV7 A;  4RYE A;  4WLA A;  3PAG A;  4CLC B;  3NOP C;  5IU1 A;  4CLC C;  2M7V A;  4YNR A;  4Y17 A;  1ZG4 A;  4OON A;  1I5Q A;  3NY4 A;  5CED A;  3HBR A;  1C3B A;  1WYC A;  3IHB A;  2WKP A;  2OAQ 1;  5FDH A;  5KIZ A;  3W4Q A;  4BL2 A;  2JCH A;  4OQG A;  2J80 A;  4XT2 B;  4HH2 A;  3VOL A;  1D1J A;  4Q8I A;  5FEF A;  3BLS A;  5EEC A;  2Y2N A;  1TD5 A;  4GD8 A;  4ME4 A;  2ZMF A;  1S0W A;  1CF0 A;  3G35 A;  4ARZ B;  2OAP 1;  1K6R A;  2WAD A;  4II7 A;  4YOF A;  4JXS A;  3OZH A;  2WKI A;  1W7F A;  1P97 A;  2E8J A;  1Z09 A;  1VEU A;  1MY8 A;  4QJG A;  3LFV A;  5AQ9 A;  3Q7V A;  5I94 A;  4UQI M;  2O9B A;  3LR4 A;  4NK3 A;  1S1Y A;  4I38 A;  2HP9 A;  3NC8 A;  4O8G A;  5M1A A;  1OTE A;  1XKZ A;  1CK3 A;  4X55 A;  1JVJ A;  3O87 A;  1SHV A;  3W4P A;  4F3L B;  4QB8 A;  4YFM A;  3BRM A;  1OTI A;  1GSW A;  4HJ4 A;  4P87 A;  4NET A;  2QKP A;  3MZE A;  5FA7 A;  4DMZ A;  4WF0 A;  3EEH A;  1XJ6 A;  3H9W A;  3G32 A;  4IBR A;  1SZV A;  2GX5 A;  4JXW A;  1G68 A;  4EU0 A;  5CGS A;  2B02 A;  4BL3 A;  4KZ3 A;  4KG2 A;  1T1C A;  4EBP A;  1MWR A;  3M6B A;  4P85 A;  1VHM A;  1V9Y A;  2Y2Q A;  3G30 A;  5HSQ A;  2EX6 A;  4QY6 A;  3NI9 A;  5EVI D;  4CLC E;  3HCY A;  1KE3 A;  5F6A A;  3MF0 A;  1J3W A;  4JKT A;  1JTD A;  5HWT A;  3V5M A;  4UAA A;  3Q7Z A;  3E2K A;  5DKK A;  3CJM A;  2L0W A;  3HLB A;  5CTM A;  4MCW A;  1YLP A;  1XJ3 A;  2Y2O A;  3CWF A;  4KZ5 A;  2ZMA A;  1M40 A;  1PNE A;  4R6L A;  4P6Z M;  1VB6 A;  4KZB A;  4FOF A;  4WMC A;  5IHV A;  2CMN A;  2EXA A;  1G5U A;  4A5R A;  3WS4 A;  1HLU P;  5EV0 A;  3BYD A;  3PXP A;  2IA2 A;  4KG5 A;  3G34 A;  5FDS A;  1OPX A;  1H3Q A;  1YT4 A;  5E2E A;  1FR1 A;  5EOE A;  1D7E A;  1H8M A;  1BLS A;  2VGJ A;  5AQA A;  3GSG A;  1YKD A;  3HLW A;  5DJU A;  3OPR A;  4GHI A;  3MKF A;  2NUP C;  4S2N C;  2QJ7 A;  1F9I A;  3RFB A;  4E3M A;  4GB7 A;  4RX3 A;  1PI5 A;  3SS4 A;  5E2F A;  3LI8 A;  4BMW A;  1K38 A;  1DRM A;  1AXB A;  3LR0 A;  2QHK A;  5FAS A;  2EX8 A;  3NHQ A;  1DJB A;  4OLD A;  3WRZ A;  2Z6D A;  4E3L A;  4ESP A;  3EQV A;  1N4O A;  2LB5 A;  2VLG A;  5BOH A;  1ONG A;  5JYP A;  2ZBB A;  4LRZ E;  3VP1 A;  2VV8 A;  1PIO A;  3LY4 A;  2INW A;  2I9V A;  2W3G A;  5KSH A;  1T1B A;  1K25 A;  1VET A;  4GHI B;  5M18 A;  1MWS A;  1EWZ A;  3ZG9 B;  5EVI A;  3T1X A;  3T1S A;  1YPR A;  5HW3 A;  3BWL A;  5FI6 A;  2GNX A;  2VK3 A;  1XJ4 A;  3G6O A;  2PYP A;  4IUH A;  4N1X A;  4KZ9 A;  3JVV A;  4RA7 A;  3UO9 A;  3MR0 A;  2A2L A;  1LI9 A;  3HLG A;  1PFL A;  2Q0O A;  1IOU A;  5DTT A;  4UHU A;  4H6J A;  3A0V A;  5E2G A;  5GLC A;  1G28 A;  3BFG A;  5CGW A;  5HAQ A;  4ARZ A;  4UQI S;  1KVL A;  1BLH A;  3ZFZ A;  2XFS A;  4AFI A;  4S2N A;  4JPM A;  3Q82 A;  3CUE C;  1K57 C;  1PWD A;  3DW0 A;  4JF6 A;  5HPF A;  3H82 B;  4WEK A;  3PBO A;  2NUT C;  4DDY A;  3TW8 A;  1LI0 A;  2V8C A;  5HL1 A;  2ZL1 B;  3JVU A;  3NIA A;  3GDI A;  3C38 A;  5DFX A;  1BLP A;  3FWL A;  5G4Z A;  5HDS A;  2J3W A;  4JGQ A;  3A3D A;  3WRT A;  1HD8 A;  1XPB A;  1Y4O A;  2ZLY A;  4EES A;  3ICY A;  1VET B;  3V67 A;  1W63 Q;  2A24 A;  3QP6 A;  2XFT A;  4OPQ A;  5AJG A;  2EWV A;  2PBD P;  2EX9 A;  4DE0 A;  1PW8 A;  5G18 A;  5DKL A;  3IXH A;  1YAX A;  2HV1 A;  3L7H A;  2A49 A;  1TS8 A;  3GTC A;  4S2M A;  3T1Q B;  4BD0 A;  2RL3 A;  2GZA A;  3PBT A;  5CHU A;  1O07 A;  4LRX C;  1H0M A;  4ZTK A;  1CJF A;  3C7U A;  1K6S A;  2JHE A;  2WZX A;  4I5S A;  3HRE A;  1U60 A;  4Y0U A;  2J8Y A;  1BTL A;  5KMW A;  4P6Z S;  5HPI A;  2HJ9 C;  1SCW A;  4K91 A;  2OLU A;  1OTD A;  5EE8 A;  4BQM A;  5J4E A;  1W79 A;  3DTK A;  1ZHH B;  2D01 A;  5AVE A;  5FI7 A;  4I39 A;  2ZQD A;  4F3L A;  5GHX A;  1XGJ A;  4WN5 A;  1NYY A;  3G2Z A;  5J7E A;  3NBL A;  2JKT I;  2XRN A;  4R3B A;  4CLC A;  1S4S A;  4DJ3 A;  5F83 A;  4E3K A;  4S2I A;  1DP6 A;  2XA7 S;  1S67 L;  4PM7 A;  4N9L A;  3IXB A;  3T4L A;  1TVF A;  1E4D A;  4MBK A;  2B5R A;  3WWX A;  1ES2 A;  2ZMV A;  4OOM A;  5A8B A;  3SZT A;  3MMH A;  3PBN A;  3VOZ A;  4K0W A;  2XK1 A;  5F69 A;  2XA7 M;  3WS0 A;  3A3I A;  1S66 L;  5FQM A;  3CMZ A;  3KYE A;  3SH9 A;  5HL6 A;  4E3O A;  3BFE A;  1K56 D;  4GDB A;  4ZDX A;  4HBU A;  3ZNY A;  1I2W A;  3FPV A;  4JGP A;  3S7N A;  2Y79 A;  3IT9 A;  3CPT A;  4G3V A;  3C7V A;  3NOU C;  3OOV A;  4B4X A;  2GJ3 A;  4EV4 A;  5DFY A;  1SKO A;  3VFH A;  4BLM A;  2V0U A;  1ES3 A;  5U47 A;  4Q0H A;  1PZP A;  2PR5 A;  4IUK A;  3EGX C;  5A92 A;  2ZC5 B;  2JN7 A;  1PRQ A;  1L0F A;  1GA0 A;  1G6A A;  2HDR A;  3KSI A;  2PU2 A;  4X56 A;  3T4O A;  1XFN A;  3HLD A;  2WGW B;  4WUJ A;  4JF5 A;  1XX2 A;  3UME A;  2DCF A;  2R9W A;  1KGG A;  3ITB A;  1JWZ A;  1HZO A;  2C5W B;  1NWZ A;  1L2S A;  4Y0T A;  4HES A;  3G4P A;  2PBY A;  4P6B A;  1KE4 A;  1Y54 A;  1IYP A;  2R9X A;  4GW9 A;  1QME A;  3ZG7 B;  3UPP A;  3QNC A;  4PPR A;  1RP5 A;  5TGF A;  3K3C A;  3ZG0 A;  2L1M A;  4HNB A;  1DY6 A;  3PHY A;  4QPR A;  3UB8 A;  4FTX A;  2XH9 A;  5CEB A;  3UMD A;  5CXW A;  3I7J A;  1HTZ A;  4R3A A;  3EWK A;  1G6O A;  2V1Z A;  2KDK A;  4Q0I A;  4UA6 A;  4BJP A;  2HPB A;  4OP8 A;  3BLM A;  2EX2 A;  4I3J A;  4Y15 A;  3H7W A;  3IF6 B;  2WKE A;  4ZAM A;  3TJZ C;  3HLC A;  2ZM8 A;  3LI9 A;  4UA9 A;  1ERQ A;  3FC7 A;  4OP5 A;  3QP1 A;  2DRW A;  2Y4A A;  2HDU A;  3MBZ A;  3CLO A;  3N8R A;  4EER A;  3ZYT A;  3HL9 A;  4ZBE A;  3VSL A;  3VV4 A;  3ZCZ A;  3LIE A;  1XA7 A;  2Y91 A;  3M2K A;  4K08 A;  1JTG A;  1BZA A;  4U0T A;  4RVA A;  4PMA A;  2D02 A;  4L9G A;  4MBF A;  3OCL A;  4OQH A;  4YWZ A;  4S2K A;  4F94 A;  4L9F A;  3FYZ A;  1KDW A;  2P08 A;  2DMW A;  2EFU A;  3P98 A;  1QMF A;  4XUX A;  3FZC A;  2O9A A;  3EQU A;  2UWX A;  3HJK A;  5M19 A;  3EOI A;  3W8K A;  4MLL A;  3G2Y A;  1T1A A;  2ZQA A;  1YMS A;  4DE1 A;  4PM6 A;  4CPK A;  3SW1 A;  4D60 A;  1ES4 A;  5I5L A;  4UEY A;  3M2J A;  5LBR A;  3DAV A;  4JBF A;  1JWV A;  3NCK A;  2I72 A;  4X68 A;  2Y2G A;  1MPL A;  4LCL A;  3UN7 A;  4HH3 A;  4EQ1 A;  2WGW A;  5EVL A;  1TEM A;  2V1A A;  3VFF A;  5CRF A;  1EW0 A;  2R78 A;  1KDS A;  1Z6F A;  4I3A A;  1W63 M;  4FD8 A;  5L8M A;  2ZQ8 A;  1T19 A;  2HP5 A;  2J7V A;  4KQO A;  1FSY A;  4LLO B;  3PTE A;  1E25 A;  2G2W A;  1FIK A;  3GV9 A;  1IYO A;  4R1G A;  3S22 A;  2P04 A;  4FUW A;  4MDZ A;  3ZVW A;  2VZW A;  1OT6 A;  2RCX A;  3NEC A;  4Y5F A;  3W4O A;  4B4Z A;  1CI9 A;  4YIN A;  3RXX A;  1K57 A;  1BUE A;  4QHC A;  1H8Z A;  1MKM A;  5JYO A;  2ZQC A;  4KG6 A;  2WAF A;  5CTN A;  5GHZ A;  3QNB A;  1ONH A;  1WA9 A;  1LL5 A;  2K7S A;  5G4Y A;  2HP6 A;  3C5A A;  2ZQ9 A;  3OPH A;  4PKY A;  4DRT A;  5HAI A;  4PAU A;  3T12 B;  2Y2P A;  2B95 A;  2M7U A;  5EM0 A;  3O88 A;  4G3W A;  2Y8H A;  1DJC A;  3UE6 A;  3SS5 A;  4B88 A;  5C5K A;  3ISG A;  4GJ4 A;  1ERO A;  3MQQ A;  2XLN A;  3UDF A;  2ZM0 A;  1PI4 A;  2W3E A;  3QP4 A;  1K55 A;  3OPP A;  3MFX A;  2ZQ7 A;  4DE2 A;  1XFQ A;  3PR6 A;  2V20 A;  3QP8 A;  2H10 A;  2PYR A;  3BM6 A;  4EEU A;  2PT7 A;  1YQS A;  4K0X A;  4EBN A;  1CEF A;  3UE0 A;  4ETX A;  3BFF A;  2Y2J A;  4NXF A;  4O0P A;  5KSC A;  4PM9 A;  4OLG A;  4QY5 A;  3UDX A;  3IQA A;  2ZC7 A;  2WKQ A;  3HLE A;  3BEC A;  3TOI A;  1DP9 A;  2W1T B;  2ZC6 B;  2JE5 A;  3N8L A;  3IH8 A;  3LIC A;  3DTE A;  1XA1 A;  3IF5 A;  1TS0 A;  3E4Q A;  1IKI A;  1H5X A;  2OWH A;  2HGV A;  5HD5 A;  1GHM A;  1NYM A;  2J3T C;  3B47 A;  3PAE A;  2FFY A;  2QYB A;  1UWN X;  1LHY A;  2H0Y A;  2UV0 E;  4BD1 A;  5CHM A;  2CC1 A;  3T4T A;  2FZ0 A;  1FCN A;  1UWP X;  2K31 A;  3LIA A;  3T50 A;  4LGW A;  5FQK A;  5CHJ A;  1TS6 A;  2W1R A;  5DF7 A;  1FR6 A;  3SH8 A;  2PDR A;  3MZF A;  3MXR A;  1NLY A;  3ZHH A;  2V2F F;  4MBH A;  4MN7 A;  1BSG A;  3CG5 A;  1WE4 A;  2WKH A;  3E4P A;  2V1B A;  1FQG A;  2QJ5 A;  3LIF A;  4GOG A;  4JGR A;  2ZOI A;  2QWS A;  4X69 A;  1LLB A;  1YSQ A;  5HX9 A;  3DBA A;  3TSG A;  2Y2M A;  3H82 A;  4GLQ A;  1ESI A;  4KZ4 A;  4NXE A;  4DXB A;  2GDN A;  5A90 A;  2Z2L B;  4E6X A;  1KVM A;  3AGF A;  2X01 A;  2VEA A;  4OH0 A;  4PM8 A;  2W27 A;  2Z2M B;  2G2U A;  5KZH A;  1GSV A;  5TFQ A;  2V0W A;  4I3I A;  5FQQ A;  1X0O A;  3N7W A;  4MNR A;  2IWC A;  3TRC A;  1OTB A;  3D4F A;  2W1T A;  4KZ7 A;  1PYY A;  4KQR A;  2WYX A;  1KE0 A;  3WS1 A;  2V9A A;  5AVF A;  4LV1 A;  5EVE A;  3IF6 C;  1O7E A;  5F68 A;  5EPH A;  1MWU A;  1YLT A;  2PAV P;  2XF3 A;  4U3T A;  2JKR I;  3GEC A;  5HWV A;  2OWJ A;  4N1H A;  5FAO A;  2PR6 A;  3UNW A;  5A93 A;  1ZKJ A;  2J9P A;  1E3U D;  4WL9 A;  1GA9 A;  1DJA A;  2W3F A;  4FCF A;  4MN5 A;  4X6T A;  1YSP A;  3LID A;  3IHA A;  3O86 A;  4HEF A;  4CJN A;  5HWW A;  5FL3 A;  2VV7 A;  3U2A A;  3AGE A;  4FSF A;  4EBL A;  2HJE A;  1D06 A;  4ZJ1 A;  4ZJ3 A;  3E4O A;  4S2L A;  4LV0 A;  2O99 A;  3AGD A;  2Q9M A;  5FAQ A;  3S7O A;  1NZU A;  4L0L A;  3F1N A;  3S7Q A;  1K0K A;  4U0X A;  2VKS A;  2Z6C A;  1GHI A;  1KGF A;  2Y2K A;  1IEM A;  3R7W B;  4XUZ A;  1F2K A;  5HFO A;  4KZA A;  4H6J B;  4KEN B;  2AVX A;  1F5M A;  4GCZ A;  2W3D A;  1MWT A;  2VGL S;  2OOL A;  3KX0 X;  3N4I A;  4OQ0 A;  4QU3 A;  1W8Y A;  3IX8 A;  4CQH A;  4UA7 A;  2EXB A;  2QZ6 A;  3HUO A;  3IBR A;  4BBT A;  3LCE A;  4IVK A;  1N9B A;  4BWI A;  2ZM2 A;  2H0T A;  2VGK A;  4R70 A;  1SDE A;  2JKR M;  4NEE D;  1ZC2 A;  3UDI A;  2Y55 A;  5TR7 A;  3RJU A;  5EVI C;  2BG1 A;  4MN6 A;  3OLO A;  2W3H A;  2ZJ9 A;  4E6W A;  3ZDJ A;  5FQI A;  3VP3 A;  2J9O A;  2WKR A;  4X1M A;  3KSG A;  1FCM A;  1L0G A;  1NLZ A;  1T18 A;  3NDE A;  4H8R A;  3L9K A;  4GS9 A;  5E2H A;  1SKF A;  3ZVT A;  3UPN A;  1PWC A;  1STZ A;  4LFU A;  4WEJ A;  2XGN A;  3ZG5 A;  4WYY A;  3LYX A;  1TS7 A;  2WZZ A;  1RGY A;  2JKG A;  1L3L A;  2XR0 A;  1LT0 A;  2J3T D;  2DNS A;  1IYQ A;  3E2L A;  4HJ6 A;  2ZC4 B;  4DF6 A;  2KLI A;  4X53 A;  3KSH A;  4DXC A;  3D9Y A;  4JXG A;  3HVF A;  3OCN A;  1TDG A;  5DTS A;  4M3K A;  3ZNT A;  5TBM A;  4C6Y A;  3VE3 A;  4EW7 A;  4WZ5 C;  3TE8 A;  2M1C A;  5HDC A;  2Y2I A;  3RXW A;  5D3O A;  5L10 A;  3GR2 A;  3VP2 A;  1PW1 A;  2K2N A;  3CI6 A;  4JXV A;  2PU4 A;  3JYI A;  1MC0 A;  5HZH A;  3Q7V B;  4NG2 A;  5E43 A;  3D72 A;  3RH8 B;  3SH7 A;  2OLV A;  4NXB A;  4HOI A;  1YM1 A;  5A91 A;  2PRF A;  4KUK A;  4O7D A;  2ZOH A;  3IXG A;  3OC2 A;  3LGO A;  1RCJ A;  4PHT A;  5J8X A;  4C75 A;  1NY0 A;  2Q9N A; 
#chains in the Genus database with same CATH homology
 1OT9 A;  4PAU A;  1IFQ A;  1MZU A;  2M7U A;  5HPF A;  3EGD C;  3H82 B;  2XSS A;  3D3O A;  3FG8 A;  4G3W A;  4KUO A;  4WEK A;  2YKF A;  3PBO A;  2Y8H A;  3LR5 A;  2EA9 A;  4BBV A;  4EET B;  3K3D A;  3KSF A;  3C8C A;  3UE6 A;  2NUT C;  5C5K A;  3TW8 A;  4HI4 A;  2VX8 A;  4GJ4 A;  3JVU A;  4DN0 A;  3MQQ A;  3GDI A;  3MJQ A;  2W3E A;  5TBM B;  2H28 A;  3C38 A;  3KO6 A;  3HJI A;  1V9Z A;  1OJ5 A;  5DFX A;  1P0Z A;  1P9W A;  1S4R A;  5G4Z A;  5HDS A;  2J3W A;  1GSX A;  4JGQ A;  5HD3 A;  3MFX A;  3B42 A;  1XFQ A;  3PR6 A;  1OTA A;  1LL8 A;  2PYR A;  4EEU A;  3T4Q A;  4EES A;  2PT7 A;  3ICY A;  3MXQ A;  3V67 A;  1W63 Q;  2A24 A;  4ETX A;  3KYZ A;  4IHQ A;  1OJG A;  5AJG A;  2EWV A;  2PD8 A;  3BY8 A;  4B93 A;  1JNU A;  5DKL A;  4NXF A;  4O0P A;  5DF9 A;  1ZTU A;  1YAX A;  2HV1 A;  3T4S A;  2BAS A;  3C2W A;  4R38 A;  2WKQ A;  4LPZ A;  1TS8 A;  4Z1W A;  3PBT A;  2GZA A;  1DP9 A;  2W1T B;  4LRX C;  4HY8 A;  4GS9 B;  2JHE A;  4I5S A;  5HDD A;  3KYQ A;  1XJ2 A;  1LSX A;  3CAX A;  3NJA A;  3LIC A;  4P6Z S;  5HPI A;  4B9O A;  3K2N A;  2HJ9 C;  1TS0 A;  4HQA A;  2B18 A;  3E4Q A;  3A0R A;  2KX6 A;  1OTD A;  2VGL M;  4Y2F A;  2OWH A;  2HGV A;  5HD5 A;  2J3T C;  5J4E A;  3NOT C;  3B47 A;  1ZHH B;  2D01 A;  3OBF A;  1S1Z A;  5AVE A;  4XT2 A;  2QYB A;  3RTY A;  1KOU A;  1UWN X;  4I39 A;  3LUQ A;  4F3L A;  5J3W A;  3T4T A;  2FZ0 A;  1UWP X;  4KQD A;  3W2Z A;  4WN5 A;  2K31 A;  3CIT A;  5CX7 A;  5J7E A;  4JGO A;  2JKT I;  3LR3 A;  2XRN A;  3LIA A;  4CLC A;  4HIA A;  3T50 A;  1S4S A;  3UE3 A;  4DJ3 A;  1TS6 A;  4OOL A;  3T4J A;  2W1R A;  3PYP A;  4M4X A;  2PDR A;  4PKY G;  1DP6 A;  1NLY A;  4MN7 A;  4WLA A;  2XA7 S;  1S67 L;  1ODV A;  1F98 A;  4CLC B;  3BY9 A;  3NOP C;  5IU1 A;  4CLC C;  2M7V A;  4YNR A;  3E4P A;  2V1B A;  2QJ5 A;  3T4L A;  3LIF A;  4IJG A;  2WKP A;  4JGR A;  3IS2 B;  2OAQ 1;  2ZOI A;  2QWS A;  5KIZ A;  1YSQ A;  2O0Y A;  3DBA A;  2ZMV A;  4OOM A;  3H82 A;  4HJ3 A;  2EWW A;  2J80 A;  4XT2 B;  4HH2 A;  3VOL A;  1N9N A;  5A8B A;  4GLQ A;  3MMH A;  3PBN A;  4NXE A;  5F69 A;  3F1P A;  2VA0 A;  2XA7 M;  1TD5 A;  1S66 L;  2VEA A;  4ME4 A;  2ZMF A;  3F1O B;  5HL6 A;  2W27 A;  3S7P A;  2OAP 1;  4ARZ B;  4YOF A;  4II7 A;  1GSV A;  2V0W A;  4I3I A;  1X0O A;  1P97 A;  2VV6 A;  3LFV A;  4EUV A;  3TRC A;  1OTB A;  2W1T A;  3P01 A;  2O9C A;  3FPV A;  4JGP A;  3S7N A;  2Y79 A;  4UQI M;  2O9B A;  2FH5 A;  4BBU A;  3LR4 A;  2V9A A;  1S1Y A;  4G3V A;  3NOU C;  3E0Y A;  4I38 A;  4O8G A;  5AVF A;  3OOV A;  1OTE A;  2GJ3 A;  5DJT A;  3P7N A;  5F68 A;  4L9E A;  3R4K A;  5DFY A;  1BYW A;  3UB6 A;  2V0U A;  2JKR I;  4Q0H A;  2KOI A;  3GEC A;  5HWV A;  2PR5 A;  4IUK A;  4F3L B;  3EGX C;  2OWJ A;  1OTI A;  2JN7 A;  1GSW A;  3A0S A;  2PR6 A;  3KSI A;  3MQO A;  4RQ9 A;  3T4O A;  3O5Y A;  4HJ4 A;  4ETZ A;  2QKP A;  3UB9 A;  1XFN A;  4WL9 A;  2JKT M;  4WUJ A;  4DMZ A;  4WF0 A;  3EEH A;  3BQA A;  2G7U A;  3UME A;  2W3F A;  1XJ6 A;  1DP8 A;  1NRJ A;  4MN5 A;  3H9W A;  1NWZ A;  5K5B A;  4WEL A;  1YSP A;  2VJW A;  2GX5 A;  3LID A;  1LSV A;  5HWW A;  3C30 A;  5FL3 A;  2VV7 A;  3U2A A;  4EU0 A;  4HP9 A;  2B02 A;  4FSF A;  1T1C A;  4GW9 A;  2HJE A;  4LRY C;  1D06 A;  5TJJ A;  2W0N A;  3E4O A;  1VHM A;  1V9Y A;  2HF6 A;  4E04 A;  5HSQ A;  2O99 A;  2YKH A;  4CLC E;  3HCY A;  1Y28 A;  3K3C A;  3PBR A;  5F6A A;  3S7O A;  3MF0 A;  4Q0J A;  4L0L A;  2L1M A;  3F1N A;  5HWT A;  4HNB A;  3PHY A;  4QPR A;  3UB8 A;  3S7Q A;  4HHD A;  2VKS A;  5DKK A;  2MJ6 A;  3IS2 A;  3UMD A;  2L0W A;  2Z6C A;  4MCW A;  3BQ8 A;  4R3A A;  1XJ3 A;  3CWF A;  3EWK A;  1G6O A;  2KDK A;  4Q0I A;  3R7W B;  4BJP A;  4R6L A;  4P6Z M;  1UGU A;  1VB6 A;  4H6J B;  4FOF A;  4I3J A;  3H7W A;  1F5M A;  4GCZ A;  2W3D A;  2CMN A;  2VGL S;  3TJZ C;  2PD7 A;  2OOL A;  3KX0 X;  3LI9 A;  3FC7 A;  4CQH A;  4DJ2 A;  4CLC D;  3PXP A;  2IA2 A;  3IBR A;  3CLO A;  4BBT A;  4MMN A;  4EER A;  3ZYT A;  4BWI A;  1OPX A;  1H3Q A;  3VV4 A;  3LIE A;  5IS1 A;  4EXO A;  4K08 A;  4R70 A;  1D7E A;  2JKR M;  3R7W A;  4NEE D;  1H8M A;  3FPW A;  1YKD A;  5DJU A;  2D02 A;  4GHI A;  4L9G A;  3OCL A;  2NUP C;  4YWZ A;  4MN6 A;  4NKP A;  2QJ7 A;  3OLO A;  1F9I A;  2W3H A;  3RFB A;  4O01 A;  3MQ0 A;  4L9F A;  1LSW A;  3LI8 A;  4BMW A;  1DRM A;  2P08 A;  2DMW A;  3CUE A;  3BW6 A;  3LR0 A;  2QHK A;  2WKR A;  2O9A A;  3KSG A;  3EQU A;  3HJK A;  3EOI A;  3NHQ A;  1NLZ A;  1T1A A;  1T18 A;  2Z6D A;  1N9L A;  4GS9 A;  3EQV A;  3SW1 A;  2LB5 A;  2VLG A;  5I5L A;  4G3K A;  4UEY A;  1STZ A;  5LBR A;  4WEJ A;  3T4K A;  2ZBB A;  4LRZ E;  2VV8 A;  5F5Y A;  2INW A;  2I9V A;  2W3G A;  3PBQ A;  5KSH A;  3LYX A;  1TS7 A;  5IT5 A;  1T1B A;  3BJN A;  4HH3 A;  2A24 B;  4EQ1 A;  2P7J A;  3ULF A;  1TF1 A;  1LT0 A;  1N9O A;  2J3T D;  4HJ6 A;  4GHI B;  2V1A A;  1EW0 A;  2R78 A;  2KLI A;  1P9R A;  3BWL A;  4I3A A;  1W63 M;  2PHY A;  3KSH A;  5L8M A;  3EEA A;  2XRO A;  1T19 A;  2GNX A;  3OCN A;  1XJ4 A;  3G6O A;  3IBJ A;  4KQO A;  5TBM A;  4LLO B;  3VE3 A;  4Y3I A;  2PYP A;  4IUH A;  4EW7 A;  3JVV A;  3MR0 A;  3UB7 A;  2A2L A;  3TE8 A;  2M1C A;  2P04 A;  5HDC A;  4MDZ A;  2L4R A;  1IOU A;  2VZW A;  3VE4 A;  1OT6 A;  2K2N A;  3H7W B;  3CI6 A;  4H6J A;  1MC0 A;  3A0V A;  4HP4 A;  4Y5F A;  5HZH A;  3D72 A;  3RH8 B;  3E98 A;  1G28 A;  3PBS A;  3LIB A;  3B33 A;  4NXB A;  1MKM A;  4HOI A;  4ARZ A;  3F1O A;  4KUK A;  4UQI S;  2ZOH A;  5MC7 A;  3ZQ5 A;  3OC2 A;  1WA9 A;  3F1N B;  4PHT A;  4AFI A;  2K7S A;  4EEP A;  4NXG A;  4PKY A;  5G4Y A;  5EFW A;  3F1P B;  3CUE C;  4ZRR A;  2LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...