3D72A

1.65 angstrom crystal structure of the cys71val variant in the fungal photoreceptor vvd
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSVALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Light activation of the LOV protein vivid generates a rapidly exchanging dimer.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 38
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3d72A00
1D7EA 4E04A 3SW1A 1V9ZA 1EW0A 4GS9A 4BBVA 2YKFA 4HJ4A 3RH8B 1OTBA 4I3AA 2QJ7A 2V9AA 2VLGA 1P0ZA 5AVFA 1UGUA 2W0NA 3HJKA 5G4ZA 4HH3A 4LLOB 2QJ5A 1ODVA 4GHIB 2KDKA 1LSXA 4HP9A 2WKPA 2J80A 3NHQA 3OLOA 4H6JA 4GS9B 2L4RA 5HSQA 4HQAA 3MFXA 1TS7A 5HWWA 1OT6A 1OJGA 3KX0X 4WLAA 3A0VA 4NXBA 4JGPA 4PKYA 3LIDA 1BYWA 4DJ3A 3F1PA 3ICYA 3E4OA 2ZOIA 2PD8A 3CLOA 2ZOHA 3MJQA 4HIAA 4R70A 1V9YA 3HJIA 4GW9A 3UB7A 2JHEA 2PYRA 4GCZA 3A0RA 3D72A 3ULFA 4BBTA 2B02A 2ZBBA 1N9NA 4WL9A 1T1CA 4H6JB 3B33A 4WUJA 2EA9A 2QWSA 4LRXC 3F1NA 1N9OA 3A0SA 4LRZE 5KIZA 2QKPA 5HDSA 1XJ2A 2I9VA 1TS0A 1S4RA 3FC7A 1N9LA 1GSXA 4I3JA 2R78A 3CAXA 1Y28A 1T19A 4R38A 4EW7A 4I38A 3F1PB 2K7SA 3LUQA 2PR5A 2A24B 3LIEA 1XJ3A 4EERA 4I39A 5G4YA 1WA9A 2W27A 4R6LA 1DP9A 4EXOA 1LSVA 1XJ4A 4JGQA 1TS8A 3F1OA 4BBUA 1DRMA 4MN6A 4HH2A 2QHKA 4WF0A 4LPZA 3EEHA 2VV8A 4YWZA 3VE3A 1S66L 2VV6A 1UWPX 3NJAA 3F1NB 2VEAA 3VOLA 4NXFA 5F69A 2OOLA 1DP8A 1TS6A 2V1AA 5AVEA 1LL8A 3BY9A 3UB6A 1T18A 1UWNX 3NOUC 2V0UA 3LIFA 1GSVA 2OWHA 3H9WA 4MN5A 4XT2A 3NOPC 1F9IA 2KX6A 2V1BA 3NOTC 1S1YA 2M1CA 3UB9A 4KUOA 2INWA 4R3AA 3F1OB 4PKYG 2HV1A 3MR0A 1S67L 4EESA 2GJ3A 2JN7A 5DJUA 2BASA 5IU1A 3VE4A 3LI9A 3H82A 1S1ZA 3PHYA 3LIBA 3G6OA 3MQOA 1OT9A 2YKHA 1XFNA 5J4EA 3IBRA 4I5SA 4DJ2A 5J7EA 1OTDA 3FG8A 3IS2A 4XT2B 4I3IA 4L9FA 5F5YA 2Z6DA 3K3CA 4HHDA 2WKQA 1LSWA 2PYPA 1F98A 3LYXA 5EFWA 2Z6CA 3T50A 5A8BA 3C2WA 5DJTA 3PYPA 2H28A 4K08A 3ZQ5A 4EETB 5HZHA 1OTAA 5TBMA 3UE6A 3H82B 2P7JA 3GDIA 1OJ5A 4LRYC 4JGRA 2D01A 1DP6A 3H7WA 2L0WA 4EEPA 2PHYA 3RTYA 5F6AA 3CWFA 4NXGA 2VV7A 4L9EA 3LI8A 3E4PA 5HD3A 5F68A 4KUKA 2PDRA 3LIAA 4NXEA 4WN5A 3IS2B 3K3DA 4KQDA 1KOUA 4HI4A 3UMEA 2V0WA 3BY8A 3BWLA 2PD7A 4F3LA 5HWVA 1VB6A 5HDCA 4HJ3A 1T1BA 5HWTA 3P7NA 1XFQA 1T1AA 2PR6A 5I5LA 1OTEA 2OWJA 5TBMB 5IS1A 4JGOA 5J3WA 1NWZA 1MZUA 4EEUA 3H7WB 3UMDA 5DKLA 4HP4A 1G28A 1XJ6A 5HDDA 5DKKA 2A24A 4B9OA 1S4SA 3EWKA 4HY8A 3UB8A 4HOIA 1P97A 3GECA 2CMNA 2D02A 5HD5A 3LICA 2WKRA 1X0OA 4GHIA 4F3LB 3MQQA 3E4QA 3C8CA 4HJ6A 4M4XA 4RQ9A 1GSWA 1LT0A 2L1MA 1JNUA 4HNBA 4EQ1A 1OTIA 4L9GA 3MXQA 1D06A
chains in the Genus database with same CATH superfamily
3IHAA 1D7EA 5FDHA 4P85A 2X01A 2A3UA 3HLCA 5CTMA 5L07A 4IHQA 3W2ZA 5EV0A 3CPTA 5HPIA 4EUZA 3LGOA 5GL9A 3UDFA 2V9AA 1C3BA 2VLGA 1ESIA 5E2HA 5E2EA 2V20A 3MS6A 2OLVA 1BULA 1UGUA 4L0LA 3HJKA 3WRZA 3W4PA 3B47A 4E3NA 4HH3A 4C3QA 2XRNA 3KO6A 4EQIA 1ODVA 2Q0OA 4EWFA 1ERMA 3V3SA 4UHUA 3MZEA 1FR1A 1FIKA 4OH0A 1LSXA 2O9AA 1F5MA 5MC7A 1PW8A 1VHMA 5EVEA 4S2MA 3UE0A 3MKEA 4WMCD 5JYPA 4H6JA 1TD5A 5FL3A 4RX3A 2NUPC 1U60A 1JWZA 2EX8A 3UY6A 4HQAA 4KZ8A 3CPTB 3EOIA 1STZA 3R4KA 4JBFA 5HWWA 4P6BA 4PM8A 1TEMA 3IXBA 5DTSA 2PU2A 3VP4A 3WS0A 3A0VA 4E3KA 3F1PA 4Y5FA 4S2NA 3T1QB 4MDZA 4R70A 3PBSA 4OP5A 4QPRA 4GW9A 4JXGA 4BLMA 4GCZA 4ID4A 3AGDA 1YLZA 2JKTM 2B02A 2ZBBA 1G68A 3VSLA 3T4TA 1MKIA 1XGIA 2WZXA 2UWXA 1BLPA 4H6JB 4WEJA 2P08A 4JF4A 4QJGA 3B33A 4P6ZS 4WUJA 4PHTA 3KYZA 4LRZE 1Q2QA 3IHBA 5KMWA 2J3TC 1XJ2A 1YSQA 2JKRI 2I9VA 1S4RA 2WAEA 4JKTA 1BLCA 2P74A 1N9LA 3Q07A 3MBZA 2R78A 4I3JA 1LI0A 2Y55A 1IELA 1YPRA 1T19A 4R38A 2LB9A 3F1PB 3DTMA 3LUQA 1RGZA 2A24B 1ACFA 1H3QA 2XD1A 4I39A 4WZ5C 3RJUA 4R3JA 3F1OA 2LB5A 4GLQA 3IXHA 3KSGA 4HH2A 4Q0IA 2X02A 3N7WA 4WF0A 4UA6A 2XQZA 3PBNA 2VV8A 4DE0A 3VE3A 2XA7M 5FQIA 2B5RA 2VEAA 4OQ0A 5L8MA 3C4OA 5DF9A 2IA2A 4QB8A 3T4SA 1TS6A 1QMFA 2VKSA 3BY9A 1NRJA 1IYSA 5AJGA 4KG5A 3LIFA 5EOOA 1CK3A 1RCJA 4A5RA 4WYYA 2HDSA 3C7VA 1S1YA 4PMAA 5U47A 2INWA 2Z2LB 1K4FA 3IBJA 5TFQA 3F1OB 4R4SA 2W1TA 4B4ZA 1VEUA 2ACGA 4KZ9A 2EX6A 3ZGAB 2JBFA 5IU1A 3N8LA 4QY5A 4OOYA 2EXBA 3PHYA 2QZ6A 3LIBA 3M2JA 2GNXA 2ZM0A 1OT9A 2YKHA 3VV4A 1YMXA 4CPKA 3T1XA 4R3BA 3NC8A 4AFIA 2QMIA 2ZC7A 3IBRA 3W4QA 4I5SA 2HDUA 4DJ2A 4CQHA 2OLUA 5J7EA 1OTDA 2J3TD 1BT5A 3FG8A 5IT5A 4L9FA 2Z6DA 4ETZA 4Y0TA 1GA0A 4HHDA 2WKQA 1S0WA 2HF6A 3ZVTA 2Q9MA 3TE8A 2AVXA 1J3WA 2PYPA 4KZ5A 3LYXA 5EFWA 1YLPA 5A8BA 4Y2FA 4OQHA 2W3GA 3C2WA 5DJTA 3O88A 4BL2A 1CI8A 1IKGA 1VEUB 4G3WA 2XGNA 3RXWA 3SH7A 4K08A 4ZJ3A 4K0WA 3A3FA 3ZG8B 4LV0A 3BFCA 5DTKA 2D01A 3RFBA 2PHYA 3JPUA 4BENA 3T1RA 3I7JA 2UV0E 4R1GA 1NZUA 3U2AA 3LR0A 4OKPA 3TRCA 5F68A 4ME4A 3KSFA 4WN5A 2HZ5A 3KSIA 3ZDJA 3DWZA 3ITAA 3G34A 4KQDA 1K56D 2IWBA 3UMEA 3VOZA 2ZC5B 4MLLA 1Q2PA 2PD7A 5BOHA 3P98A 5L09A 1JTGA 5HWTA 3P7NA 4MN7A 1XFQA 1KGFA 5I5LA 4X6TA 4U0XA 4MEZA 3BLMA 4FUWA 2HP9A 1PI4A 4ARZA 5CEDA 5F1GA 4EEUA 2ZMFA 4F94A 3BM6A 1K38A 3HLGA 4N9LA 3EEAA 4OVDA 3V67A 4HP4A 5DKKA 3OCLA 4DF6A 4B9OA 5GLCA 1RGYA 2O0YA 5CXWA 3D9YA 3M2KA 3EWKA 4LCMA 4NETA 4DE1A 5CHJA 3D3OA 4D60A 3JYIA 3UB8A 1P97A 3GECA 4GOGA 4MBHA 4CLCE 5GHZA 2D02A 2VX8A 3Q7VA 3MFDA 2JKTI 1H8ZA 4MMNA 5GLAA 3UNWA 1LLBA 3UE3A 3BRMA 1VETB 4HJ6A 2XR0A 5EECA 2WKHA 1NLZA 4HNBA 4KZ7A 4EQ1A 4R4RA 1OTIA 2XEPA 1D06A 1CJFA 3IWIA 3O5YA 1KDSA 4ARZB 3T1SA 2WGIA 3BLSA 4ZJ1A 1OTBA 3TOIA 2H0YA 3GR2A 2QJ7A 3UE1A 2GX5A 5G18A 1P0ZA 5AVFA 5FA7A 2B18A 5FSRA 3Q7VB 3PTEA 4LLOB 5E43A 1CEFA 4ZJ2A 1TF1A 3WWXA 1XP4A 4HP9A 1TDGA 2J80A 1YAXA 3T4OA 1PNEA 2B95A 2OV5A 3BQAA 2XF3A 2XLNA 2ZC4B 3TJZC 3E2KA 3S7OA 5IHVA 3CJMA 3SOIA 4YNRA 1XPBA 2L4RA 5HSQA 4K0XA 1GA9A 4X56A 3IT9A 1IYOA 3QP4A 4JPMA 2W1RA 5D3OA 5K5BA 4Y15A 1OT6A 3T4KA 2C5WB 1JTDA 1J9MA 1FR6A 1JWVA 4KG6A 4NXBA 4PKYA 1K25A 2PD8A 2VGLS 3MF0A 1BLSA 4JF5A 1V9YA 3HJIA 4QY6A 3OBFA 3A0RA 3ISGA 2ZC3B 4DRTA 3M6HA 3GRJA 4BBTA 5F82A 1L3LA 2HJEA 1GCEA 3OPLA 5L10A 1YLTA 3CHWP 1RP5A 2Q9NA 4FH4A 1IKIA 2QPNA 1LI9A 4H8RA 5EPHA 2EFUA 1NYMA 3G4PA 5DF7A 1N9OA 3P01A 2O9BA 3WRTA 5HDSA 4E6XA 3OC2A 5FDSA 2WGWA 3K2NA 1TS0A 1PW1A 1GSXA 3LEZA 4O0PA 2G2WA 3N8SA 1PZPA 5EUAA 5HARA 4S2IA 1YKDA 4X69A 5E2GA 5J8XA 2PAVP 5G4YA 1WA9A 2W27A 1LSVA 5I94A 4DXCA 3LEQA 3NY4A 4S2NC 4PM9A 1PRQA 4UQIS 1EI5A 1DRMA 3FKVA 4X55A 3FV7A 2QHKA 4QU3A 5HAQA 2Y2NA 3IXDA 2VV6A 3CI6A 5FAPA 1H5XA 3VOLA 2WK0A 4X1MA 3GV9A 2WKIA 2WGWB 3IWOA 1DP8A 2KOIA 4O01A 5AVEA 1LL8A 1KVMA 3ZVWA 1PWGA 3MSHA 2M7UA 2XH9A 4WEKA 1MC0A 1FCOA 1ES5A 2V8FA 2IWCA 2JCHA 5KSCA 5M19A 1F9IA 2KX6A 2V1BA 3NOTC 2Y2QA 3VP1A 3V5MA 3UB9A 4KUOA 3VOYA 3VP2A 1ZHHB 1OPXA 4LV2A 3HREA 3B42A 3PAGA 5CGWA 4EESA 4RVAA 2IWDA 4S2JA 1I5QA 2Y2KA 3IXGA 4P87A 3AGFA 1SKFA 1NYYA 3FYZA 1W8QA 3UPNA 3LI9A 1JVJA 3H82A 1Y4OA 4Y7PA 2O9CA 4OP8A 4X25A 3MQOA 3ZFZA 5CECA 1M40A 5J4EA 2J9OA 1XXMA 3DBAA 2K2NA 2Y2PA 2ZM8A 1K54A 1P9RA 3DAVA 2HP6A 4CJNA 2VGJA 5AQ9A 3K3CA 3TSGA 1OMEA 1L0FA 2V8CA 5CRFA 2GDNA 1BTLA 1XKZA 2Y2MA 3U4LP 5KZHA 2WGVA 1ONGA 2Z6CA 1WYCA 4JXSA 5EM0A 4JLFA 1L0DA 2EXAA 3PYPA 3TW8A 2H0TA 3CITA 4BD0A 3DWKA 3ZQ5A 5HZHA 2X71A 1FCNA 1OTAA 4E6WA 3H82B 3EQUA 1OJ5A 2GZAA 4LRYC 4JGRA 1FCMA 3H7WA 3AGEA 2L0WA 5DTTA 4EEPA 2W3HA 3HVFA 2VZWA 2J9PA 3HLFA 4NXGA 1K6RA 1IEMA 2VV7A 4L9EA 3LFVA 2ZQAA 5FQ9A 3ZNTA 1DY6A 4KUKA 3LIAA 2EWWA 4ZAMA 4NXEA 3L7HA 3NECA 5CERA 4B4XA 3K3DA 2V0WA 3BY8A 3BWLA 2HPBA 2WADA 3BFDA 3DW0A 5EVIC 4HJ3A 1N9BA 2CC1A 4EBPA 1T1AA 1GHPA 4DE2A 4XUXA 2OWJA 4S2LA 4Z9QA 4LGWA 5IS1A 3HUOA 1FILA 5EE8A 4IVKA 5J3WA 3SH8A 5CTNA 3H7WB 4PM5A 3DTIA 2XSSA 1KDWA 4RX2A 2WYXA 3FPVA 4BQMA 5A92A 1Z09A 4KG2A 1PFLA 4PAUA 5HX9A 1K0KA 3NULA 4MBKA 4IJGA 4E3MA 4U0TA 2FFFB 4X68A 3LY3A 1I2WA 1ALQA 4HOIA 1ZG4A 3DTKA 4KENB 4BD1A 4GN2A 2ZD8A 1NJ4A 1ZKJA 2WKRA 4GHIA 3MQQA 3E4QA 4IBRA 4OPQA 5EVIA 2WUQA 3C8CA 1PWCA 3HLEA 4M4XA 3IQAA 1CI9A 1LT0A 4K91A 1JNUA 2E8IA 1ONHA 1V9ZA 4S2OA 1EW0A 3SZTA 2ZQ7A 4ZTKA 2W1TB 1XX2A 3KYEA 4BBVA 3S7PA 4PM7A 4GD6A 4BJPA 4IUHA 5FQKA 1XA1A 4GDNA 1G6AA 1GHIA 1FSWA 4GJ4A 3GTCA 1FSYA 1NY0A 4G3VA 2W0NA 5M18A 3RXXA 4S2KA 5G4ZA 5CGSA 2ZL1A 3SS3A 1BLHA 2QJ5A 2Y91A 5HPFA 4GHIB 5EVIB 4DN0A 4DDSA 5FEGA 3VP3A 2KDKA 2WKPA 3HBRA 5FQQA 1TDLA 1SZVA 2J3WA 5HAIA 1PZOA 4N9KA 5EVID 2WZZA 3OLOA 4EU0A 1NXYA 1KVLA 4E3JA 1YLWA 1KGEA 1TS7A 1SHVA 3GMWA 3KX0X 1YQSA 4QHCA 1W5DA 1L0GA 2A2LA 4JGPA 1BUEA 2HP5A 3ICYA 3E4OA 2ZL1B 2ZOIA 3BFEA 2PRFA 3CLOA 3T12B 3G35A 3HUMA 3MJQA 3T4JA 1E4DA 1SDNA 3ZHHA 3BEBA 1ZTUA 2FZ0A 2VA0A 2JHEA 2Y4AA 4GNUA 5EM1A 4DDYA 3A3EA 4NK3A 4UQIM 3MZDA 3MZFA 2BG1A 3OOVA 1N9NA 4WL9A 1T1CA 2EWVA 4C6YA 2OAQ1 5KSHA 4JF6A 2P9VA 2PBYA 4E3OA 4OLGA 5CGXA 5CHMA 5FAQA 2QWSA 4LRXC 5M1AA 1P9WA 5KIZA 4QD4A 2JKRM 3N8RA 5HFOA 4UAAA 3CAXA 4OQIA 4ETXA 2VJWA 1G5UA 2P04A 3C5AA 2ZMAA 2K7SA 3JVUA 4EERA 3PXPA 2JC7A 4G3KA 3IF6A 1W63M 4KQQA 4R6LA 5DVAA 2HGVA 1XJ4A 1FOFA 2ZQDA 3DTEA 5CHUA 3EGDC 1MWTA 4BBUA 3MKFA 4MN6A 2VGKA 3ITBA 2XD5A 3IH8A 1E3UA 5FASA 3G2ZA 3EEHA 2P9VB 4YWZA 3IH9A 5EOEA 4DE3A 3NJAA 2O99A 4NXFA 3ZYTA 1MKMA 3VFFA 3ZCZA 1XGJA 4P6ZM 4R0QA 4O7DA 3EQVA 1UWNX 2V0UA 2XROA 1GSVA 2OWHA 5FAOA 4GD8A 4MN5A 4O8GA 2WAFA 4XT2A 3NOPC 3ZNYA 1DJBA 2M1CA 3W4OA 2DMWA 1BSGA 1KE3A 3ZG7B 2HV1A 1K55C 3HUNA 1MY8A 2JN7A 5DJUA 4EBNA 3N6IA 3IX4A 2J7VA 3PAEA 5F1FA 1NLYA 1MBLA 1D1JA 3G6OA 1E3UD 4UA7A 4B88A 3LR5A 3VP0A 1QMEA 4YOFA 4HEFA 3KSHA 1YLYA 3FPWA 4OLDA 3BW6A 4ESPA 3IX8A 4Q0HA 4XT2B 4ZBEA 5F5YA 3SS5A 4II7A 4MCWA 5HL1A 4X1LA 5FI7A 2R9XA 3QNCA 1O7EA 3BYDA 2W3DA 4IVIA 3S4XA 1LSWA 1Y54A 1K4EA 1K57C 3T50A 1K55A 4EETB 4OONA 5TBMA 2G7UA 2R9WA 2P7JA 3GDIA 4LENA 2OSUA 3O87A 4FD8A 4CLCC 3N4IA 1IOUA 4S2PA 5F6AA 4FCFA 4KZ6A 3MXSA 3LI8A 3R7WA 5HD3A 2PDRA 5DFXA 3A3IA 1DJAA 3Q1FA 5A93A 2W3EA 3OPHA 2KLIA 3GSGA 3HLBA 4BL3A 4KZAA 3ZG0A 1KOUA 4HI4A 2JKGA 4BWIA 1MWUA 1K54C 5FI2A 4F3LA 1VB6A 4NKPA 5HDCA 1YLJA 1K57A 3E2LA 4E3IA 4WELA 4ZDXA 1OTEA 4KQOA 4Y17A 3M6BA 5TBMB 1PYYA 2DNSA 3OCNA 4PM6A 3PBQA 1NWZA 1MZUA 3S22A 3VFHA 3UMDA 4CLCA 5DKLA 4UEYA 2Y2JA 1W7FA 1NRFA 1E25A 1G28A 2BTFP 1O07A 1GHMA 1PI5A 3WS4A 2BLSA 3R7WB 2A24A 4UA9A 3QP5A 4FTXA 3EGXC 2A49A 1ESUA 2PBDP 2CMNA 4BMWA 3V50A 1HD8A 1JWPA 5HD5A 3W8KA 3LICA 1X0OA 4F3LB 3NDEA 3C38A 4HESA 5HW3A 5AQAA 4GKUA 3NBLA 4GZBA 3QNBA 4C75A 2XK1A 4FOFA 5JYOA 5L2FA 4YINA 5FATA 4E04A 3SW1A 1M6KA 1LL9A 2I72A 4GS9A 2YKFA 4HJ4A 3RH8B 3O86A 5FEFA 4CLCB 2C6WB 4IBXA 3PR6A 5TJJA 3Q81A 4I3AA 4P0MA 1AWIA 2G2UA 3NIAA 5F83A 1FQGA 4XUZA 1ERQA 4N92A 1KGGA 4MBFA 2XFSA 4CLCD 3B3XA 3WS5A 4OPZA 3QP1A 4HBUA 4JXWA 3TG9A 1Z6FA 1G6OA 3NHQA 3G31A 1CQAA 1SCWA 3CUEC 4LCLA 5A91A 3BJNA 4GS9B 5GLDA 2FH5A 2RL3A 3PBTA 2PT7A 3BFGA 3MFXA 2JE5A 5AQBA 1OJGA 3HCYA 3GVBA 1PWDA 1H8YA 4N1HA 5TR7A 3ZG5A 3IF5A 4WLAA 1MWSA 1DJCA 1HLUP 2Y59A 1KE0A 4WZ5A 4JXVA 4MNRA 3LIDA 2J8YA 1BYWA 1XA7A 2ZM2A 4DJ3A 1W79A 1ZC2A 2Y2IA 3NDGA 3S1YA 3A3DA 3BQ8A 3UO9A 2ZOHA 1I2SA 3BECA 5FQJA 3G32A 4HIAA 4Y13A 3VMAA 3UB7A 3UB5P 2PYRA 3CZDA 2HDQA 3C7UA 4KZ3A 3D72A 3ULFA 3P09A 4E3LA 4M3KA 3CUEA 1IYPA 2DRWA 1K6SA 1ZG6A 2EFXA 1ES3A 1EWZA 4LV3A 1K56A 3HLDA 2EA9A 3MXRA 1AXBA 3A0SA 3F1NA 4OPYA 4LFUA 2QKPA 1ES2A 1NZOA 4FH2A 3FC7A 3LCEA 2Y2GA 3G2YA 1Y28A 1SKOA 4WM9A 3PBOA 4EW7A 4I38A 3WS2A 5HAPA 1CEGA 2PR5A 3LIEA 1XJ3A 4XXRA 3LY4A 1N4OA 4OOMA 2XDMA 1DP9A 5C5KA 4EXOA 1YMSA 4JGQA 4B93A 1TS8A 5CX7A 3IX3A 2ZQCA 2ZMVA 3HLWA 2VGLM 4DMZA 4Q0JA 1A0KA 3SH9A 2ZLYA 3UPPA 4LPZA 4Q8IA 4DXBA 5GHXA 3IWQA 1S66L 1UWPX 2JKFA 4X53A 4N1XA 3F1NB 4YFMA 5DF8A 4LV1A 3QHYA 5F69A 5FQMA 2OOLA 5DFYA 4WZ4A 2VK3A 2V1AA 1H8MA 4NG2A 2FFYA 3UPOA 3UB6A 1T18A 1SKOB 2MJ6A 3NOUC 4KZ4A 3VSKA 1HVBA 3H9WA 1IFQA 2M7VA 1VETA 3QP6A 3G30A 5EVLA 3S7QA 1H0MA 3FZCA 3NCKA 1W63Q 4R3AA 2H10A 4PKYG 3MR0A 4Z1WA 1S67L 3IF6C 2GJ3A 3LR3A 1HTZA 1YSPA 2NUTC 4Y0OA 2HJ9C 2BASA 2XA7S 1EROA 1ES4A 1LHYA 3VE4A 3SS4A 1S1ZA 4IUKA 3E98A 4WBGA 1SDEA 1IYQA 4U3TA 1XFNA 2ZC6B 3FWLA 3LR4A 1VQQA 2E8JA 4EUVA 2ZJ9A 3S7NA 3MQ0A 4GB7A 5FI6A 1S6RA 3IS2A 4OPRA 2H5SA 4I3IA 5LBRA 1CF0A 3HL9A 3JVVA 3C30A 1YM1A 2OAP1 1PIOA 5GLBA 2Y2LA 5AQ7A 2DCFA 1F98A 3UDXA 4D2OA 2Y2HA 2V2FF 1VM1A 2H28A 4KQRA 4GDBA 2HDRA 4PPRA 4RA7A 4Y0UA 3UE6A 4FSFA 2Y8HA 3FKWA 4DKIA 3V3RA 1DP6A 3OPPA 3RTYA 5A90A 3L9KA 2Y2OA 3CWFA 3CG5A 3BFFA 4OQGA 3E4PA 4IEDA 3IS2B 3A3JA 2EX9A 5HWVA 1WYBA 1T1BA 3LO7A 5E2FA 4EV4A 3IF6B 2PR6A 2RCXA 3PBRA 1F2KA 4Y3IA 4OOLA 4EBLA 3T4QA 3V39A 3MMHA 3O3VA 3D4FA 2EX2A 4JGOA 2PU4A 3KYQA 5CEBA 3QP8A 3CMZA 2K31A 4HBTA 3E0YA 1WE4A 2WKEA 1KE4A 1XJ6A 5HDDA 1YT4A 3Q82A 5TGFA 3UDIA 5GHYA 3QP2A 3WS1A 3UN7A 1S4SA 3C4PA 2ZQ9A 3OZHA 1L2SA 3Q7ZA 4R23A 3GQZA 3OPRA 4QWOA 4HY8A 2QYBA 2V1ZA 4ZRRA 3T4LA 2Y79A 2W3FA 4NEED 1MPLA 1W8YA 1TVFA 2XFTA 1BZAA 2ZQ8A 3ZG9B 4WMCA 5HL6A 1L0EA 4KZBA 4RYEA 4RQ9A 1GSWA 2L1MA 1LL5A 1HZOA 1MXOA 3NI9A 4L9GA 1MWRA 3MXQA 2Z2MB
chains in the Genus database with same CATH topology
1D7EA 4E04A 3SW1A 1V9ZA 1EW0A 3O5YA 4ARZB 2W1TB 4GS9A 4BBVA 2YKFA 4HJ4A 3S7PA 3RH8B 4BJPA 4IUHA 4CLCB 4IHQA 1OTBA 3W2ZA 3PR6A 5TJJA 4I3AA 5HPIA 2QJ7A 2V9AA 2VLGA 4GJ4A 2GX5A 1P0ZA 5AVFA 4G3VA 1UGUA 4L0LA 2W0NA 4CLCD 3HJKA 2B18A 3B47A 5G4ZA 4HH3A 2XRNA 4LLOB 3KO6A 2QJ5A 1ODVA 5HPFA 4GHIB 1TF1A 4DN0A 2KDKA 1LSXA 4HP9A 2O9AA 2WKPA 1F5MA 1G6OA 2J80A 5MC7A 1VHMA 1YAXA 3NHQA 3T4OA 2J3WA 3BQAA 3CUEC 3TJZC 3S7OA 3OLOA 4EU0A 4H6JA 3BJNA 4YNRA 1TD5A 4GS9B 2L4RA 5FL3A 5HSQA 2FH5A 2NUPC 3PBTA 2PT7A 2W1RA 5K5BA 4HQAA 3EOIA 3MFXA 1STZA 3R4KA 1TS7A 5HWWA 1OT6A 1OJGA 3T4KA 3HCYA 3KX0X 4WLAA 2A2LA 3A0VA 4NXBA 4JGPA 4PKYA 3LIDA 1BYWA 4DJ3A 3F1PA 4Y5FA 3ICYA 3E4OA 2ZOIA 3CLOA 2PD8A 3BQ8A 2VGLS 2ZOHA 3MF0A 4MDZA 3MJQA 3T4JA 4HIAA 4R70A 3PBSA 1ZTUA 1V9YA 3HJIA 4QPRA 4GW9A 3UB7A 2FZ0A 2VA0A 2JHEA 2PYRA 3OBFA 4GCZA 3A0RA 3D72A 2JKTM 3ULFA 4BBTA 2B02A 4UQIM 3CUEA 2ZBBA 3OOVA 3T4TA 1N9NA 2HJEA 4WL9A 1T1CA 2EWVA 2OAQ1 4H6JB 5KSHA 4WEJA 2P08A 3B33A 4P6ZS 4WUJA 4PHTA 2EA9A 2QWSA 4LRXC 3F1NA 1N9OA 3A0SA 3KYZA 4LRZE 3P01A 1P9WA 2O9BA 5KIZA 2QKPA 2J3TC 5HDSA 1XJ2A 1YSQA 2JKRI 3OC2A 2I9VA 2JKRM 3K2NA 1TS0A 1S4RA 3FC7A 1N9LA 1GSXA 4I3JA 2R78A 4O0PA 3CAXA 1Y28A 1T19A 4R38A 4ETXA 2LB9A 2VJWA 3PBOA 4EW7A 2P04A 4I38A 3F1PB 2K7SA 3LUQA 1YKDA 2PR5A 2A24B 3JVUA 1XJ3A 3LIEA 4EERA 1H3QA 4I39A 3PXPA 4G3KA 1W63M 5G4YA 4OOMA 1WA9A 2W27A 4R6LA 1DP9A 5C5KA 4EXOA 1LSVA 2HGVA 1XJ4A 4JGQA 4B93A 1TS8A 5CX7A 3F1OA 2LB5A 2ZMVA 3EGDC 4UQIS 1DRMA 4BBUA 4MN6A 4GLQA 2VGLM 4DMZA 4Q0JA 3KSGA 4HH2A 4Q0IA 2QHKA 4WF0A 4LPZA 3EEHA 2VV8A 3PBNA 4YWZA 3VE3A 1S66L 2VV6A 2XA7M 1UWPX 3CI6A 3NJAA 3F1NB 2VEAA 2O99A 3VOLA 5L8MA 4NXFA 3ZYTA 5DF9A 5F69A 2IA2A 1MKMA 2OOLA 5DFYA 1DP8A 3T4SA 2KOIA 4O01A 1TS6A 2V1AA 1H8MA 2VKSA 5AVEA 1LL8A 3BY9A 3UB6A 4P6ZM 1T18A 2MJ6A 3EQVA 1NRJA 1UWNX 3NOUC 5AJGA 2M7UA 2V0UA 3LIFA 2XROA 1GSVA 2OWHA 4WEKA 1MC0A 3H9WA 1IFQA 4MN5A 4O8GA 4XT2A 3NOPC 2M7VA 1F9IA 2KX6A 2V1BA 3NOTC 1S1YA 2M1CA 3S7QA 2DMWA 3UB9A 4KUOA 1W63Q 2INWA 4R3AA 1ZHHB 1OPXA 3IBJA 3F1OB 3B42A 4PKYG 2HV1A 3MR0A 4Z1WA 1S67L 2W1TA 4EESA 2GJ3A 3LR3A 2JN7A 5DJUA 1YSPA 2NUTC 2HJ9C 2BASA 2XA7S 5IU1A 3VE4A 3LI9A 3H82A 1S1ZA 3PHYA 3E98A 4IUKA 1NLYA 2O9CA 3LIBA 2GNXA 3G6OA 3MQOA 1OT9A 2YKHA 3VV4A 1XFNA 3LR5A 4YOFA 3LR4A 3KSHA 4AFIA 4EUVA 5J4EA 3FPWA 3IBRA 3DBAA 4I5SA 3MQ0A 2K2NA 3BW6A 3S7NA 4DJ2A 4CQHA 5J7EA 1P9RA 1OTDA 2J3TD 3FG8A 3IS2A 4Q0HA 4XT2B 5IT5A 4I3IA 5LBRA 4L9FA 5F5YA 2Z6DA 4II7A 4ETZA 4MCWA 3JVVA 3K3CA 3C30A 4HHDA 2WKQA 2OAP1 2HF6A 2W3DA 3TE8A 1LSWA 2PYPA 1F98A 3LYXA 5EFWA 2Z6CA 3T50A 5A8BA 4Y2FA 2W3GA 3C2WA 5DJTA 3PYPA 3TW8A 3CITA 4G3WA 2H28A 4K08A 3ZQ5A 4EETB 5HZHA 1OTAA 5TBMA 2G7UA 3UE6A 4FSFA 3H82B 2Y8HA 3EQUA 2P7JA 3GDIA 1OJ5A 2GZAA 4LRYC 4JGRA 2D01A 1DP6A 3H7WA 3RFBA 2L0WA 4EEPA 2PHYA 2W3HA 3RTYA 4CLCC 1IOUA 2VZWA 5F6AA 3CWFA 4NXGA 3U2AA 2VV7A 3LR0A 4L9EA 3LFVA 3LI8A 3E4PA 3R7WA 5HD3A 3TRCA 5F68A 4KUKA 2PDRA 3LIAA 2EWWA 5DFXA 4ME4A 4NXEA 3KSFA 4WN5A 3IS2B 3KSIA 2W3EA 2KLIA 3K3DA 4KQDA 1KOUA 4HI4A 3UMEA 2V0WA 3BY8A 3BWLA 4BWIA 2PD7A 4F3LA 5HWVA 1VB6A 4NKPA 5HDCA 4HJ3A 1T1BA 5HWTA 3P7NA 4MN7A 1XFQA 1T1AA 2PR6A 5I5LA 4WELA 3PBRA 1OTEA 2OWJA 4KQOA 4Y3IA 4OOLA 3T4QA 3MMHA 5TBMB 5IS1A 4JGOA 3OCNA 4ARZA 3PBQA 5J3WA 1NWZA 1MZUA 4EEUA 2ZMFA 3KYQA 3H7WB 2XSSA 3UMDA 4CLCA 2K31A 3EEAA 3E0YA 5DKLA 3V67A 4UEYA 4HP4A 1G28A 1XJ6A 5HDDA 3FPVA 5DKKA 3OCLA 4PAUA 3R7WB 2A24A 4B9OA 1S4SA 2O0YA 3EWKA 3EGXC 4IJGA 4HY8A 3D3OA 2QYBA 4ZRRA 3UB8A 4HOIA 1P97A 3GECA 3T4LA 4CLCE 2Y79A 2CMNA 2D02A 2W3FA 2VX8A 4NEED 4BMWA 2JKTI 5HD5A 3LICA 2WKRA 1X0OA 4GHIA 4MMNA 4F3LB 3MQQA 3C38A 3E4QA 5HL6A 3UE3A 3C8CA 4HJ6A 4M4XA 4RQ9A 1GSWA 1LT0A 2L1MA 1JNUA 1NLZA 4HNBA 4EQ1A 4FOFA 1OTIA 4L9GA 3MXQA 1D06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7E A;  4E04 A;  3SW1 A;  1V9Z A;  1EW0 A;  4GS9 A;  4BBV A;  2YKF A;  4HJ4 A;  3RH8 B;  1OTB A;  4I3A A;  2QJ7 A;  2V9A A;  2VLG A;  1P0Z A;  5AVF A;  1UGU A;  2W0N A;  3HJK A;  5G4Z A;  4HH3 A;  4LLO B;  2QJ5 A;  1ODV A;  4GHI B;  2KDK A;  1LSX A;  4HP9 A;  2WKP A;  2J80 A;  3NHQ A;  3OLO A;  4H6J A;  4GS9 B;  2L4R A;  5HSQ A;  4HQA A;  3MFX A;  1TS7 A;  5HWW A;  1OT6 A;  1OJG A;  3KX0 X;  4WLA A;  3A0V A;  4NXB A;  4JGP A;  4PKY A;  3LID A;  1BYW A;  4DJ3 A;  3F1P A;  3ICY A;  3E4O A;  2ZOI A;  2PD8 A;  3CLO A;  2ZOH A;  3MJQ A;  4HIA A;  4R70 A;  1V9Y A;  3HJI A;  4GW9 A;  3UB7 A;  2JHE A;  2PYR A;  4GCZ A;  3A0R A;  3D72 A;  3ULF A;  4BBT A;  2B02 A;  2ZBB A;  1N9N A;  4WL9 A;  1T1C A;  4H6J B;  3B33 A;  4WUJ A;  2EA9 A;  2QWS A;  4LRX C;  3F1N A;  1N9O A;  3A0S A;  4LRZ E;  5KIZ A;  2QKP A;  5HDS A;  1XJ2 A;  2I9V A;  1TS0 A;  1S4R A;  3FC7 A;  1N9L A;  1GSX A;  4I3J A;  2R78 A;  3CAX A;  1Y28 A;  1T19 A;  4R38 A;  4EW7 A;  4I38 A;  3F1P B;  2K7S A;  3LUQ A;  2PR5 A;  2A24 B;  3LIE A;  1XJ3 A;  4EER A;  4I39 A;  5G4Y A;  1WA9 A;  2W27 A;  4R6L A;  1DP9 A;  4EXO A;  1LSV A;  1XJ4 A;  4JGQ A;  1TS8 A;  3F1O A;  4BBU A;  1DRM A;  4MN6 A;  4HH2 A;  2QHK A;  4WF0 A;  4LPZ A;  3EEH A;  2VV8 A;  4YWZ A;  3VE3 A;  1S66 L;  2VV6 A;  1UWP X;  3NJA A;  3F1N B;  2VEA A;  3VOL A;  4NXF A;  5F69 A;  2OOL A;  1DP8 A;  1TS6 A;  2V1A A;  5AVE A;  1LL8 A;  3BY9 A;  3UB6 A;  1T18 A;  1UWN X;  3NOU C;  2V0U A;  3LIF A;  1GSV A;  2OWH A;  3H9W A;  4MN5 A;  4XT2 A;  3NOP C;  1F9I A;  2KX6 A;  2V1B A;  3NOT C;  1S1Y A;  2M1C A;  3UB9 A;  4KUO A;  2INW A;  4R3A A;  3F1O B;  4PKY G;  2HV1 A;  3MR0 A;  1S67 L;  4EES A;  2GJ3 A;  2JN7 A;  5DJU A;  2BAS A;  5IU1 A;  3VE4 A;  3LI9 A;  3H82 A;  1S1Z A;  3PHY A;  3LIB A;  3G6O A;  3MQO A;  1OT9 A;  2YKH A;  1XFN A;  5J4E A;  3IBR A;  4I5S A;  4DJ2 A;  5J7E A;  1OTD A;  3FG8 A;  3IS2 A;  4XT2 B;  4I3I A;  4L9F A;  5F5Y A;  2Z6D A;  3K3C A;  4HHD A;  2WKQ A;  1LSW A;  2PYP A;  1F98 A;  3LYX A;  5EFW A;  2Z6C A;  3T50 A;  5A8B A;  3C2W A;  5DJT A;  3PYP A;  2H28 A;  4K08 A;  3ZQ5 A;  4EET B;  5HZH A;  1OTA A;  5TBM A;  3UE6 A;  3H82 B;  2P7J A;  3GDI A;  1OJ5 A;  4LRY C;  4JGR A;  2D01 A;  1DP6 A;  3H7W A;  2L0W A;  4EEP A;  2PHY A;  3RTY A;  5F6A A;  3CWF A;  4NXG A;  2VV7 A;  4L9E A;  3LI8 A;  3E4P A;  5HD3 A;  5F68 A;  4KUK A;  2PDR A;  3LIA A;  4NXE A;  4WN5 A;  3IS2 B;  3K3D A;  4KQD A;  1KOU A;  4HI4 A;  3UME A;  2V0W A;  3BY8 A;  3BWL A;  2PD7 A;  4F3L A;  5HWV A;  1VB6 A;  5HDC A;  4HJ3 A;  1T1B A;  5HWT A;  3P7N A;  1XFQ A;  1T1A A;  2PR6 A;  5I5L A;  1OTE A;  2OWJ A;  5TBM B;  5IS1 A;  4JGO A;  5J3W A;  1NWZ A;  1MZU A;  4EEU A;  3H7W B;  3UMD A;  5DKL A;  4HP4 A;  1G28 A;  1XJ6 A;  5HDD A;  5DKK A;  2A24 A;  4B9O A;  1S4S A;  3EWK A;  4HY8 A;  3UB8 A;  4HOI A;  1P97 A;  3GEC A;  2CMN A;  2D02 A;  5HD5 A;  3LIC A;  2WKR A;  1X0O A;  4GHI A;  4F3L B;  3MQQ A;  3E4Q A;  3C8C A;  4HJ6 A;  4M4X A;  4RQ9 A;  1GSW A;  1LT0 A;  2L1M A;  1JNU A;  4HNB A;  4EQ1 A;  1OTI A;  4L9G A;  3MXQ A;  1D06 A; 
#chains in the Genus database with same CATH topology
 3IHA A;  1D7E A;  5FDH A;  4P85 A;  2X01 A;  2A3U A;  3HLC A;  5CTM A;  5L07 A;  4IHQ A;  3W2Z A;  5EV0 A;  3CPT A;  5HPI A;  4EUZ A;  3LGO A;  5GL9 A;  3UDF A;  2V9A A;  1C3B A;  2VLG A;  1ESI A;  5E2H A;  5E2E A;  2V20 A;  3MS6 A;  2OLV A;  1BUL A;  1UGU A;  4L0L A;  3HJK A;  3WRZ A;  3W4P A;  3B47 A;  4E3N A;  4HH3 A;  4C3Q A;  2XRN A;  3KO6 A;  4EQI A;  1ODV A;  2Q0O A;  4EWF A;  1ERM A;  3V3S A;  4UHU A;  3MZE A;  1FR1 A;  1FIK A;  4OH0 A;  1LSX A;  2O9A A;  1F5M A;  5MC7 A;  1PW8 A;  1VHM A;  5EVE A;  4S2M A;  3UE0 A;  3MKE A;  4WMC D;  5JYP A;  4H6J A;  1TD5 A;  5FL3 A;  4RX3 A;  2NUP C;  1U60 A;  1JWZ A;  2EX8 A;  3UY6 A;  4HQA A;  4KZ8 A;  3CPT B;  3EOI A;  1STZ A;  3R4K A;  4JBF A;  5HWW A;  4P6B A;  4PM8 A;  1TEM A;  3IXB A;  5DTS A;  2PU2 A;  3VP4 A;  3WS0 A;  3A0V A;  4E3K A;  3F1P A;  4Y5F A;  4S2N A;  3T1Q B;  4MDZ A;  4R70 A;  3PBS A;  4OP5 A;  4QPR A;  4GW9 A;  4JXG A;  4BLM A;  4GCZ A;  4ID4 A;  3AGD A;  1YLZ A;  2JKT M;  2B02 A;  2ZBB A;  1G68 A;  3VSL A;  3T4T A;  1MKI A;  1XGI A;  2WZX A;  2UWX A;  1BLP A;  4H6J B;  4WEJ A;  2P08 A;  4JF4 A;  4QJG A;  3B33 A;  4P6Z S;  4WUJ A;  4PHT A;  3KYZ A;  4LRZ E;  1Q2Q A;  3IHB A;  5KMW A;  2J3T C;  1XJ2 A;  1YSQ A;  2JKR I;  2I9V A;  1S4R A;  2WAE A;  4JKT A;  1BLC A;  2P74 A;  1N9L A;  3Q07 A;  3MBZ A;  2R78 A;  4I3J A;  1LI0 A;  2Y55 A;  1IEL A;  1YPR A;  1T19 A;  4R38 A;  2LB9 A;  3F1P B;  3DTM A;  3LUQ A;  1RGZ A;  2A24 B;  1ACF A;  1H3Q A;  2XD1 A;  4I39 A;  4WZ5 C;  3RJU A;  4R3J A;  3F1O A;  2LB5 A;  4GLQ A;  3IXH A;  3KSG A;  4HH2 A;  4Q0I A;  2X02 A;  3N7W A;  4WF0 A;  4UA6 A;  2XQZ A;  3PBN A;  2VV8 A;  4DE0 A;  3VE3 A;  2XA7 M;  5FQI A;  2B5R A;  2VEA A;  4OQ0 A;  5L8M A;  3C4O A;  5DF9 A;  2IA2 A;  4QB8 A;  3T4S A;  1TS6 A;  1QMF A;  2VKS A;  3BY9 A;  1NRJ A;  1IYS A;  5AJG A;  4KG5 A;  3LIF A;  5EOO A;  1CK3 A;  1RCJ A;  4A5R A;  4WYY A;  2HDS A;  3C7V A;  1S1Y A;  4PMA A;  5U47 A;  2INW A;  2Z2L B;  1K4F A;  3IBJ A;  5TFQ A;  3F1O B;  4R4S A;  2W1T A;  4B4Z A;  1VEU A;  2ACG A;  4KZ9 A;  2EX6 A;  3ZGA B;  2JBF A;  5IU1 A;  3N8L A;  4QY5 A;  4OOY A;  2EXB A;  3PHY A;  2QZ6 A;  3LIB A;  3M2J A;  2GNX A;  2ZM0 A;  1OT9 A;  2YKH A;  3VV4 A;  1YMX A;  4CPK A;  3T1X A;  4R3B A;  3NC8 A;  4AFI A;  2QMI A;  2ZC7 A;  3IBR A;  3W4Q A;  4I5S A;  2HDU A;  4DJ2 A;  4CQH A;  2OLU A;  5J7E A;  1OTD A;  2J3T D;  1BT5 A;  3FG8 A;  5IT5 A;  4L9F A;  2Z6D A;  4ETZ A;  4Y0T A;  1GA0 A;  4HHD A;  2WKQ A;  1S0W A;  2HF6 A;  3ZVT A;  2Q9M A;  3TE8 A;  2AVX A;  1J3W A;  2PYP A;  4KZ5 A;  3LYX A;  5EFW A;  1YLP A;  5A8B A;  4Y2F A;  4OQH A;  2W3G A;  3C2W A;  5DJT A;  3O88 A;  4BL2 A;  1CI8 A;  1IKG A;  1VEU B;  4G3W A;  2XGN A;  3RXW A;  3SH7 A;  4K08 A;  4ZJ3 A;  4K0W A;  3A3F A;  3ZG8 B;  4LV0 A;  3BFC A;  5DTK A;  2D01 A;  3RFB A;  2PHY A;  3JPU A;  4BEN A;  3T1R A;  3I7J A;  2UV0 E;  4R1G A;  1NZU A;  3U2A A;  3LR0 A;  4OKP A;  3TRC A;  5F68 A;  4ME4 A;  3KSF A;  4WN5 A;  2HZ5 A;  3KSI A;  3ZDJ A;  3DWZ A;  3ITA A;  3G34 A;  4KQD A;  1K56 D;  2IWB A;  3UME A;  3VOZ A;  2ZC5 B;  4MLL A;  1Q2P A;  2PD7 A;  5BOH A;  3P98 A;  5L09 A;  1JTG A;  5HWT A;  3P7N A;  4MN7 A;  1XFQ A;  1KGF A;  5I5L A;  4X6T A;  4U0X A;  4MEZ A;  3BLM A;  4FUW A;  2HP9 A;  1PI4 A;  4ARZ A;  5CED A;  5F1G A;  4EEU A;  2ZMF A;  4F94 A;  3BM6 A;  1K38 A;  3HLG A;  4N9L A;  3EEA A;  4OVD A;  3V67 A;  4HP4 A;  5DKK A;  3OCL A;  4DF6 A;  4B9O A;  5GLC A;  1RGY A;  2O0Y A;  5CXW A;  3D9Y A;  3M2K A;  3EWK A;  4LCM A;  4NET A;  4DE1 A;  5CHJ A;  3D3O A;  4D60 A;  3JYI A;  3UB8 A;  1P97 A;  3GEC A;  4GOG A;  4MBH A;  4CLC E;  5GHZ A;  2D02 A;  2VX8 A;  3Q7V A;  3MFD A;  2JKT I;  1H8Z A;  4MMN A;  5GLA A;  3UNW A;  1LLB A;  3UE3 A;  3BRM A;  1VET B;  4HJ6 A;  2XR0 A;  5EEC A;  2WKH A;  1NLZ A;  4HNB A;  4KZ7 A;  4EQ1 A;  4R4R A;  1OTI A;  2XEP A;  1D06 A;  1CJF A;  3IWI A;  3O5Y A;  1KDS A;  4ARZ B;  3T1S A;  2WGI A;  3BLS A;  4ZJ1 A;  1OTB A;  3TOI A;  2H0Y A;  3GR2 A;  2QJ7 A;  3UE1 A;  2GX5 A;  5G18 A;  1P0Z A;  5AVF A;  5FA7 A;  2B18 A;  5FSR A;  3Q7V B;  3PTE A;  4LLO B;  5E43 A;  1CEF A;  4ZJ2 A;  1TF1 A;  3WWX A;  1XP4 A;  4HP9 A;  1TDG A;  2J80 A;  1YAX A;  3T4O A;  1PNE A;  2B95 A;  2OV5 A;  3BQA A;  2XF3 A;  2XLN A;  2ZC4 B;  3TJZ C;  3E2K A;  3S7O A;  5IHV A;  3CJM A;  3SOI A;  4YNR A;  1XPB A;  2L4R A;  5HSQ A;  4K0X A;  1GA9 A;  4X56 A;  3IT9 A;  1IYO A;  3QP4 A;  4JPM A;  2W1R A;  5D3O A;  5K5B A;  4Y15 A;  1OT6 A;  3T4K A;  2C5W B;  1JTD A;  1J9M A;  1FR6 A;  1JWV A;  4KG6 A;  4NXB A;  4PKY A;  1K25 A;  2PD8 A;  2VGL S;  3MF0 A;  1BLS A;  4JF5 A;  1V9Y A;  3HJI A;  4QY6 A;  3OBF A;  3A0R A;  3ISG A;  2ZC3 B;  4DRT A;  3M6H A;  3GRJ A;  4BBT A;  5F82 A;  1L3L A;  2HJE A;  1GCE A;  3OPL A;  5L10 A;  1YLT A;  3CHW P;  1RP5 A;  2Q9N A;  4FH4 A;  1IKI A;  2QPN A;  1LI9 A;  4H8R A;  5EPH A;  2EFU A;  1NYM A;  3G4P A;  5DF7 A;  1N9O A;  3P01 A;  2O9B A;  3WRT A;  5HDS A;  4E6X A;  3OC2 A;  5FDS A;  2WGW A;  3K2N A;  1TS0 A;  1PW1 A;  1GSX A;  3LEZ A;  4O0P A;  2G2W A;  3N8S A;  1PZP A;  5EUA A;  5HAR A;  4S2I A;  1YKD A;  4X69 A;  5E2G A;  5J8X A;  2PAV P;  5G4Y A;  1WA9 A;  2W27 A;  1LSV A;  5I94 A;  4DXC A;  3LEQ A;  3NY4 A;  4S2N C;  4PM9 A;  1PRQ A;  4UQI S;  1EI5 A;  1DRM A;  3FKV A;  4X55 A;  3FV7 A;  2QHK A;  4QU3 A;  5HAQ A;  2Y2N A;  3IXD A;  2VV6 A;  3CI6 A;  5FAP A;  1H5X A;  3VOL A;  2WK0 A;  4X1M A;  3GV9 A;  2WKI A;  2WGW B;  3IWO A;  1DP8 A;  2KOI A;  4O01 A;  5AVE A;  1LL8 A;  1KVM A;  3ZVW A;  1PWG A;  3MSH A;  2M7U A;  2XH9 A;  4WEK A;  1MC0 A;  1FCO A;  1ES5 A;  2V8F A;  2IWC A;  2JCH A;  5KSC A;  5M19 A;  1F9I A;  2KX6 A;  2V1B A;  3NOT C;  2Y2Q A;  3VP1 A;  3V5M A;  3UB9 A;  4KUO A;  3VOY A;  3VP2 A;  1ZHH B;  1OPX A;  4LV2 A;  3HRE A;  3B42 A;  3PAG A;  5CGW A;  4EES A;  4RVA A;  2IWD A;  4S2J A;  1I5Q A;  2Y2K A;  3IXG A;  4P87 A;  3AGF A;  1SKF A;  1NYY A;  3FYZ A;  1W8Q A;  3UPN A;  3LI9 A;  1JVJ A;  3H82 A;  1Y4O A;  4Y7P A;  2O9C A;  4OP8 A;  4X25 A;  3MQO A;  3ZFZ A;  5CEC A;  1M40 A;  5J4E A;  2J9O A;  1XXM A;  3DBA A;  2K2N A;  2Y2P A;  2ZM8 A;  1K54 A;  1P9R A;  3DAV A;  2HP6 A;  4CJN A;  2VGJ A;  5AQ9 A;  3K3C A;  3TSG A;  1OME A;  1L0F A;  2V8C A;  5CRF A;  2GDN A;  1BTL A;  1XKZ A;  2Y2M A;  3U4L P;  5KZH A;  2WGV A;  1ONG A;  2Z6C A;  1WYC A;  4JXS A;  5EM0 A;  4JLF A;  1L0D A;  2EXA A;  3PYP A;  3TW8 A;  2H0T A;  3CIT A;  4BD0 A;  3DWK A;  3ZQ5 A;  5HZH A;  2X71 A;  1FCN A;  1OTA A;  4E6W A;  3H82 B;  3EQU A;  1OJ5 A;  2GZA A;  4LRY C;  4JGR A;  1FCM A;  3H7W A;  3AGE A;  2L0W A;  5DTT A;  4EEP A;  2W3H A;  3HVF A;  2VZW A;  2J9P A;  3HLF A;  4NXG A;  1K6R A;  1IEM A;  2VV7 A;  4L9E A;  3LFV A;  2ZQA A;  5FQ9 A;  3ZNT A;  1DY6 A;  4KUK A;  3LIA A;  2EWW A;  4ZAM A;  4NXE A;  3L7H A;  3NEC A;  5CER A;  4B4X A;  3K3D A;  2V0W A;  3BY8 A;  3BWL A;  2HPB A;  2WAD A;  3BFD A;  3DW0 A;  5EVI C;  4HJ3 A;  1N9B A;  2CC1 A;  4EBP A;  1T1A A;  1GHP A;  4DE2 A;  4XUX A;  2OWJ A;  4S2L A;  4Z9Q A;  4LGW A;  5IS1 A;  3HUO A;  1FIL A;  5EE8 A;  4IVK A;  5J3W A;  3SH8 A;  5CTN A;  3H7W B;  4PM5 A;  3DTI A;  2XSS A;  1KDW A;  4RX2 A;  2WYX A;  3FPV A;  4BQM A;  5A92 A;  1Z09 A;  4KG2 A;  1PFL A;  4PAU A;  5HX9 A;  1K0K A;  3NUL A;  4MBK A;  4IJG A;  4E3M A;  4U0T A;  2FFF B;  4X68 A;  3LY3 A;  1I2W A;  1ALQ A;  4HOI A;  1ZG4 A;  3DTK A;  4KEN B;  4BD1 A;  4GN2 A;  2ZD8 A;  1NJ4 A;  1ZKJ A;  2WKR A;  4GHI A;  3MQQ A;  3E4Q A;  4IBR A;  4OPQ A;  5EVI A;  2WUQ A;  3C8C A;  1PWC A;  3HLE A;  4M4X A;  3IQA A;  1CI9 A;  1LT0 A;  4K91 A;  1JNU A;  2E8I A;  1ONH A;  1V9Z A;  4S2O A;  1EW0 A;  3SZT A;  2ZQ7 A;  4ZTK A;  2W1T B;  1XX2 A;  3KYE A;  4BBV A;  3S7P A;  4PM7 A;  4GD6 A;  4BJP A;  4IUH A;  5FQK A;  1XA1 A;  4GDN A;  1G6A A;  1GHI A;  1FSW A;  4GJ4 A;  3GTC A;  1FSY A;  1NY0 A;  4G3V A;  2W0N A;  5M18 A;  3RXX A;  4S2K A;  5G4Z A;  5CGS A;  2ZL1 A;  3SS3 A;  1BLH A;  2QJ5 A;  2Y91 A;  5HPF A;  4GHI B;  5EVI B;  4DN0 A;  4DDS A;  5FEG A;  3VP3 A;  2KDK A;  2WKP A;  3HBR A;  5FQQ A;  1TDL A;  1SZV A;  2J3W A;  5HAI A;  1PZO A;  4N9K A;  5EVI D;  2WZZ A;  3OLO A;  4EU0 A;  1NXY A;  1KVL A;  4E3J A;  1YLW A;  1KGE A;  1TS7 A;  1SHV A;  3GMW A;  3KX0 X;  1YQS A;  4QHC A;  1W5D A;  1L0G A;  2A2L A;  4JGP A;  1BUE A;  2HP5 A;  3ICY A;  3E4O A;  2ZL1 B;  2ZOI A;  3BFE A;  2PRF A;  3CLO A;  3T12 B;  3G35 A;  3HUM A;  3MJQ A;  3T4J A;  1E4D A;  1SDN A;  3ZHH A;  3BEB A;  1ZTU A;  2FZ0 A;  2VA0 A;  2JHE A;  2Y4A A;  4GNU A;  5EM1 A;  4DDY A;  3A3E A;  4NK3 A;  4UQI M;  3MZD A;  3MZF A;  2BG1 A;  3OOV A;  1N9N A;  4WL9 A;  1T1C A;  2EWV A;  4C6Y A;  2OAQ 1;  5KSH A;  4JF6 A;  2P9V A;  2PBY A;  4E3O A;  4OLG A;  5CGX A;  5CHM A;  5FAQ A;  2QWS A;  4LRX C;  5M1A A;  1P9W A;  5KIZ A;  4QD4 A;  2JKR M;  3N8R A;  5HFO A;  4UAA A;  3CAX A;  4OQI A;  4ETX A;  2VJW A;  1G5U A;  2P04 A;  3C5A A;  2ZMA A;  2K7S A;  3JVU A;  4EER A;  3PXP A;  2JC7 A;  4G3K A;  3IF6 A;  1W63 M;  4KQQ A;  4R6L A;  5DVA A;  2HGV A;  1XJ4 A;  1FOF A;  2ZQD A;  3DTE A;  5CHU A;  3EGD C;  1MWT A;  4BBU A;  3MKF A;  4MN6 A;  2VGK A;  3ITB A;  2XD5 A;  3IH8 A;  1E3U A;  5FAS A;  3G2Z A;  3EEH A;  2P9V B;  4YWZ A;  3IH9 A;  5EOE A;  4DE3 A;  3NJA A;  2O99 A;  4NXF A;  3ZYT A;  1MKM A;  3VFF A;  3ZCZ A;  1XGJ A;  4P6Z M;  4R0Q A;  4O7D A;  3EQV A;  1UWN X;  2V0U A;  2XRO A;  1GSV A;  2OWH A;  5FAO A;  4GD8 A;  4MN5 A;  4O8G A;  2WAF A;  4XT2 A;  3NOP C;  3ZNY A;  1DJB A;  2M1C A;  3W4O A;  2DMW A;  1BSG A;  1KE3 A;  3ZG7 B;  2HV1 A;  1K55 C;  3HUN A;  1MY8 A;  2JN7 A;  5DJU A;  4EBN A;  3N6I A;  3IX4 A;  2J7V A;  3PAE A;  5F1F A;  1NLY A;  1MBL A;  1D1J A;  3G6O A;  1E3U D;  4UA7 A;  4B88 A;  3LR5 A;  3VP0 A;  1QME A;  4YOF A;  4HEF A;  3KSH A;  1YLY A;  3FPW A;  4OLD A;  3BW6 A;  4ESP A;  3IX8 A;  4Q0H A;  4XT2 B;  4ZBE A;  5F5Y A;  3SS5 A;  4II7 A;  4MCW A;  5HL1 A;  4X1L A;  5FI7 A;  2R9X A;  3QNC A;  1O7E A;  3BYD A;  2W3D A;  4IVI A;  3S4X A;  1LSW A;  1Y54 A;  1K4E A;  1K57 C;  3T50 A;  1K55 A;  4EET B;  4OON A;  5TBM A;  2G7U A;  2R9W A;  2P7J A;  3GDI A;  4LEN A;  2OSU A;  3O87 A;  4FD8 A;  4CLC C;  3N4I A;  1IOU A;  4S2P A;  5F6A A;  4FCF A;  4KZ6 A;  3MXS A;  3LI8 A;  3R7W A;  5HD3 A;  2PDR A;  5DFX A;  3A3I A;  1DJA A;  3Q1F A;  5A93 A;  2W3E A;  3OPH A;  2KLI A;  3GSG A;  3HLB A;  4BL3 A;  4KZA A;  3ZG0 A;  1KOU A;  4HI4 A;  2JKG A;  4BWI A;  1MWU A;  1K54 C;  5FI2 A;  4F3L A;  1VB6 A;  4NKP A;  5HDC A;  1YLJ A;  1K57 A;  3E2L A;  4E3I A;  4WEL A;  4ZDX A;  1OTE A;  4KQO A;  4Y17 A;  3M6B A;  5TBM B;  1PYY A;  2DNS A;  3OCN A;  4PM6 A;  3PBQ A;  1NWZ A;  1MZU A;  3S22 A;  3VFH A;  3UMD A;  4CLC A;  5DKL A;  4UEY A;  2Y2J A;  1W7F A;  1NRF A;  1E25 A;  1G28 A;  2BTF P;  1O07 A;  1GHM A;  1PI5 A;  3WS4 A;  2BLS A;  3R7W B;  2A24 A;  4UA9 A;  3QP5 A;  4FTX A;  3EGX C;  2A49 A;  1ESU A;  2PBD P;  2CMN A;  4BMW A;  3V50 A;  1HD8 A;  1JWP A;  5HD5 A;  3W8K A;  3LIC A;  1X0O A;  4F3L B;  3NDE A;  3C38 A;  4HES A;  5HW3 A;  5AQA A;  4GKU A;  3NBL A;  4GZB A;  3QNB A;  4C75 A;  2XK1 A;  4FOF A;  5JYO A;  5L2F A;  4YIN A;  5FAT A;  4E04 A;  3SW1 A;  1M6K A;  1LL9 A;  2I72 A;  4GS9 A;  2YKF A;  4HJ4 A;  3RH8 B;  3O86 A;  5FEF A;  4CLC B;  2C6W B;  4IBX A;  3PR6 A;  5TJJ A;  3Q81 A;  4I3A A;  4P0M A;  1AWI A;  2G2U A;  3NIA A;  5F83 A;  1FQG A;  4XUZ A;  1ERQ A;  4N92 A;  1KGG A;  4MBF A;  2XFS A;  4CLC D;  3B3X A;  3WS5 A;  4OPZ A;  3QP1 A;  4HBU A;  4JXW A;  3TG9 A;  1Z6F A;  1G6O A;  3NHQ A;  3G31 A;  1CQA A;  1SCW A;  3CUE C;  4LCL A;  5A91 A;  3BJN A;  4GS9 B;  5GLD A;  2FH5 A;  2RL3 A;  3PBT A;  2PT7 A;  3BFG A;  3MFX A;  2JE5 A;  5AQB A;  1OJG A;  3HCY A;  3GVB A;  1PWD A;  1H8Y A;  4N1H A;  5TR7 A;  3ZG5 A;  3IF5 A;  4WLA A;  1MWS A;  1DJC A;  1HLU P;  2Y59 A;  1KE0 A;  4WZ5 A;  4JXV A;  4MNR A;  3LID A;  2J8Y A;  1BYW A;  1XA7 A;  2ZM2 A;  4DJ3 A;  1W79 A;  1ZC2 A;  2Y2I A;  3NDG A;  3S1Y A;  3A3D A;  3BQ8 A;  3UO9 A;  2ZOH A;  1I2S A;  3BEC A;  5FQJ A;  3G32 A;  4HIA A;  4Y13 A;  3VMA A;  3UB7 A;  3UB5 P;  2PYR A;  3CZD A;  2HDQ A;  3C7U A;  4KZ3 A;  3D72 A;  3ULF A;  3P09 A;  4E3L A;  4M3K A;  3CUE A;  1IYP A;  2DRW A;  1K6S A;  1ZG6 A;  2EFX A;  1ES3 A;  1EWZ A;  4LV3 A;  1K56 A;  3HLD A;  2EA9 A;  3MXR A;  1AXB A;  3A0S A;  3F1N A;  4OPY A;  4LFU A;  2QKP A;  1ES2 A;  1NZO A;  4FH2 A;  3FC7 A;  3LCE A;  2Y2G A;  3G2Y A;  1Y28 A;  1SKO A;  4WM9 A;  3PBO A;  4EW7 A;  4I38 A;  3WS2 A;  5HAP A;  1CEG A;  2PR5 A;  3LIE A;  1XJ3 A;  4XXR A;  3LY4 A;  1N4O A;  4OOM A;  2XDM A;  1DP9 A;  5C5K A;  4EXO A;  1YMS A;  4JGQ A;  4B93 A;  1TS8 A;  5CX7 A;  3IX3 A;  2ZQC A;  2ZMV A;  3HLW A;  2VGL M;  4DMZ A;  4Q0J A;  1A0K A;  3SH9 A;  2ZLY A;  3UPP A;  4LPZ A;  4Q8I A;  4DXB A;  5GHX A;  3IWQ A;  1S66 L;  1UWP X;  2JKF A;  4X53 A;  4N1X A;  3F1N B;  4YFM A;  5DF8 A;  4LV1 A;  3QHY A;  5F69 A;  5FQM A;  2OOL A;  5DFY A;  4WZ4 A;  2VK3 A;  2V1A A;  1H8M A;  4NG2 A;  2FFY A;  3UPO A;  3UB6 A;  1T18 A;  1SKO B;  2MJ6 A;  3NOU C;  4KZ4 A;  3VSK A;  1HVB A;  3H9W A;  1IFQ A;  2M7V A;  1VET A;  3QP6 A;  3G30 A;  5EVL A;  3S7Q A;  1H0M A;  3FZC A;  3NCK A;  1W63 Q;  4R3A A;  2H10 A;  4PKY G;  3MR0 A;  4Z1W A;  1S67 L;  3IF6 C;  2GJ3 A;  3LR3 A;  1HTZ A;  1YSP A;  2NUT C;  4Y0O A;  2HJ9 C;  2BAS A;  2XA7 S;  1ERO A;  1ES4 A;  1LHY A;  3VE4 A;  3SS4 A;  1S1Z A;  4IUK A;  3E98 A;  4WBG A;  1SDE A;  1IYQ A;  4U3T A;  1XFN A;  2ZC6 B;  3FWL A;  3LR4 A;  1VQQ A;  2E8J A;  4EUV A;  2ZJ9 A;  3S7N A;  3MQ0 A;  4GB7 A;  5FI6 A;  1S6R A;  3IS2 A;  4OPR A;  2H5S A;  4I3I A;  5LBR A;  1CF0 A;  3HL9 A;  3JVV A;  3C30 A;  1YM1 A;  2OAP 1;  1PIO A;  5GLB A;  2Y2L A;  5AQ7 A;  2DCF A;  1F98 A;  3UDX A;  4D2O A;  2Y2H A;  2V2F F;  1VM1 A;  2H28 A;  4KQR A;  4GDB A;  2HDR A;  4PPR A;  4RA7 A;  4Y0U A;  3UE6 A;  4FSF A;  2Y8H A;  3FKW A;  4DKI A;  3V3R A;  1DP6 A;  3OPP A;  3RTY A;  5A90 A;  3L9K A;  2Y2O A;  3CWF A;  3CG5 A;  3BFF A;  4OQG A;  3E4P A;  4IED A;  3IS2 B;  3A3J A;  2EX9 A;  5HWV A;  1WYB A;  1T1B A;  3LO7 A;  5E2F A;  4EV4 A;  3IF6 B;  2PR6 A;  2RCX A;  3PBR A;  1F2K A;  4Y3I A;  4OOL A;  4EBL A;  3T4Q A;  3V39 A;  3MMH A;  3O3V A;  3D4F A;  2EX2 A;  4JGO A;  2PU4 A;  3KYQ A;  5CEB A;  3QP8 A;  3CMZ A;  2K31 A;  4HBT A;  3E0Y A;  1WE4 A;  2WKE A;  1KE4 A;  1XJ6 A;  5HDD A;  1YT4 A;  3Q82 A;  5TGF A;  3UDI A;  5GHY A;  3QP2 A;  3WS1 A;  3UN7 A;  1S4S A;  3C4P A;  2ZQ9 A;  3OZH A;  1L2S A;  3Q7Z A;  4R23 A;  3GQZ A;  3OPR A;  4QWO A;  4HY8 A;  2QYB A;  2V1Z A;  4ZRR A;  3T4L A;  2Y79 A;  2W3F A;  4NEE D;  1MPL A;  1W8Y A;  1TVF A;  2XFT A;  1BZA A;  2ZQ8 A;  3ZG9 B;  4WMC A;  5HL6 A;  1L0E A;  4KZB A;  4RYE A;  4RQ9 A;  1GSW A;  2L1M A;  1LL5 A;  1HZO A;  1MXO A;  3NI9 A;  4L9G A;  1MWR A;  3MXQ A;  2Z2M B; 
#chains in the Genus database with same CATH homology
 1D7E A;  4E04 A;  3SW1 A;  1V9Z A;  1EW0 A;  3O5Y A;  4ARZ B;  2W1T B;  4GS9 A;  4BBV A;  2YKF A;  4HJ4 A;  3S7P A;  3RH8 B;  4BJP A;  4IUH A;  4CLC B;  4IHQ A;  1OTB A;  3W2Z A;  3PR6 A;  5TJJ A;  4I3A A;  5HPI A;  2QJ7 A;  2V9A A;  2VLG A;  4GJ4 A;  2GX5 A;  1P0Z A;  5AVF A;  4G3V A;  1UGU A;  4L0L A;  2W0N A;  4CLC D;  3HJK A;  2B18 A;  3B47 A;  5G4Z A;  4HH3 A;  2XRN A;  4LLO B;  3KO6 A;  2QJ5 A;  1ODV A;  5HPF A;  4GHI B;  1TF1 A;  4DN0 A;  2KDK A;  1LSX A;  4HP9 A;  2O9A A;  2WKP A;  1F5M A;  1G6O A;  2J80 A;  5MC7 A;  1VHM A;  1YAX A;  3NHQ A;  3T4O A;  2J3W A;  3BQA A;  3CUE C;  3TJZ C;  3S7O A;  3OLO A;  4EU0 A;  4H6J A;  3BJN A;  4YNR A;  1TD5 A;  4GS9 B;  2L4R A;  5FL3 A;  5HSQ A;  2FH5 A;  2NUP C;  3PBT A;  2PT7 A;  2W1R A;  5K5B A;  4HQA A;  3EOI A;  3MFX A;  1STZ A;  3R4K A;  1TS7 A;  5HWW A;  1OT6 A;  1OJG A;  3T4K A;  3HCY A;  3KX0 X;  4WLA A;  2A2L A;  3A0V A;  4NXB A;  4JGP A;  4PKY A;  3LID A;  1BYW A;  4DJ3 A;  3F1P A;  4Y5F A;  3ICY A;  3E4O A;  2ZOI A;  3CLO A;  2PD8 A;  3BQ8 A;  2VGL S;  2ZOH A;  3MF0 A;  4MDZ A;  3MJQ A;  3T4J A;  4HIA A;  4R70 A;  3PBS A;  1ZTU A;  1V9Y A;  3HJI A;  4QPR A;  4GW9 A;  3UB7 A;  2FZ0 A;  2VA0 A;  2JHE A;  2PYR A;  3OBF A;  4GCZ A;  3A0R A;  3D72 A;  2JKT M;  3ULF A;  4BBT A;  2B02 A;  4UQI M;  3CUE A;  2ZBB A;  3OOV A;  3T4T A;  1N9N A;  2HJE A;  4WL9 A;  1T1C A;  2EWV A;  2OAQ 1;  4H6J B;  5KSH A;  4WEJ A;  2P08 A;  3B33 A;  4P6Z S;  4WUJ A;  4PHT A;  2EA9 A;  2QWS A;  4LRX C;  3F1N A;  1N9O A;  3A0S A;  3KYZ A;  4LRZ E;  3P01 A;  1P9W A;  2O9B A;  5KIZ A;  2QKP A;  2J3T C;  5HDS A;  1XJ2 A;  1YSQ A;  2JKR I;  3OC2 A;  2I9V A;  2JKR M;  3K2N A;  1TS0 A;  1S4R A;  3FC7 A;  1N9L A;  1GSX A;  4I3J A;  2R78 A;  4O0P A;  3CAX A;  1Y28 A;  1T19 A;  4R38 A;  4ETX A;  2LB9 A;  2VJW A;  3PBO A;  4EW7 A;  2P04 A;  4I38 A;  3F1P B;  2K7S A;  3LUQ A;  1YKD A;  2PR5 A;  2A24 B;  3JVU A;  1XJ3 A;  3LIE A;  4EER A;  1H3Q A;  4I39 A;  3PXP A;  4G3K A;  1W63 M;  5G4Y A;  4OOM A;  1WA9 A;  2W27 A;  4R6L A;  1DP9 A;  5C5K A;  4EXO A;  1LSV A;  2HGV A;  1XJ4 A;  4JGQ A;  4B93 A;  1TS8 A;  5CX7 A;  3F1O A;  2LB5 A;  2ZMV A;  3EGD C;  4UQI S;  1DRM A;  4BBU A;  4MN6 A;  4GLQ A;  2VGL M;  4DMZ A;  4Q0J A;  3KSG A;  4HH2 A;  4Q0I A;  2QHK A;  4WF0 A;  4LPZ A;  3EEH A;  2VV8 A;  3PBN A;  4YWZ A;  3VE3 A;  1S66 L;  2VV6 A;  2XA7 M;  1UWP X;  3CI6 A;  3NJA A;  3F1N B;  2VEA A;  2O99 A;  3VOL A;  5L8M A;  4NXF A;  3ZYT A;  5DF9 A;  5F69 A;  2IA2 A;  1MKM A;  2OOL A;  5DFY A;  1DP8 A;  3T4S A;  2KOI A;  4O01 A;  1TS6 A;  2V1A A;  1H8M A;  2VKS A;  5AVE A;  1LL8 A;  3BY9 A;  3UB6 A;  4P6Z M;  1T18 A;  2MJ6 A;  3EQV A;  1NRJ A;  1UWN X;  3NOU C;  5AJG A;  2M7U A;  2V0U A;  3LIF A;  2XRO A;  1GSV A;  2OWH A;  4WEK A;  1MC0 A;  3H9W A;  1IFQ A;  4MN5 A;  4O8G A;  4XT2 A;  3NOP C;  2M7V A;  1F9I A;  2KX6 A;  2V1B A;  3NOT C;  1S1Y A;  2M1C A;  3S7Q A;  2DMW A;  3UB9 A;  4KUO A;  1W63 Q;  2INW A;  4R3A A;  1ZHH B;  1OPX A;  3IBJ A;  3F1O B;  3B42 A;  4PKY G;  2HV1 A;  3MR0 A;  4Z1W A;  1S67 L;  2W1T A;  4EES A;  2GJ3 A;  3LR3 A;  2JN7 A;  5DJU A;  1YSP A;  2NUT C;  2HJ9 C;  2BAS A;  2XA7 S;  5IU1 A;  3VE4 A;  3LI9 A;  3H82 A;  1S1Z A;  3PHY A;  3E98 A;  4IUK A;  1NLY A;  2O9C A;  3LIB A;  2GNX A;  3G6O A;  3MQO A;  1OT9 A;  2YKH A;  3VV4 A;  1XFN A;  3LR5 A;  4YOF A;  3LR4 A;  3KSH A;  4AFI A;  4EUV A;  5J4E A;  3FPW A;  3IBR A;  3DBA A;  4I5S A;  3MQ0 A;  2K2N A;  3BW6 A;  3S7N A;  4DJ2 A;  4CQH A;  5J7E A;  1P9R A;  1OTD A;  2J3T D;  3FG8 A;  3IS2 A;  4Q0H A;  4XT2 B;  5IT5 A;  4I3I A;  5LBR A;  4L9F A;  5F5Y A;  2Z6D A;  4II7 A;  4ETZ A;  4MCW A;  3JVV A;  3K3C A;  3C30 A;  4HHD A;  2WKQ A;  2OAP 1;  2HF6 A;  2W3D A;  3TE8 A;  1LSW A;  2PYP A;  1F98 A;  3LYX A;  5EFW A;  2Z6C A;  3T50 A;  5A8B A;  4Y2F A;  2W3G A;  3C2W A;  5DJT A;  3PYP A;  3TW8 A;  3CIT A;  4G3W A;  2H28 A;  4K08 A;  3ZQ5 A;  4EET B;  5HZH A;  1OTA A;  5TBM A;  2G7U A;  3UE6 A;  4FSF A;  3H82 B;  2Y8H A;  3EQU A;  2P7J A;  3GDI A;  1OJ5 A;  2GZA A;  4LRY C;  4JGR A;  2D01 A;  1DP6 A;  3H7W A;  3RFB A;  2L0W A;  4EEP A;  2PHY A;  2W3H A;  3RTY A;  4CLC C;  1IOU A;  2VZW A;  5F6A A;  3CWF A;  4NXG A;  3U2A A;  2VV7 A;  3LR0 A;  4L9E A;  3LFV A;  3LI8 A;  3E4P A;  3R7W A;  5HD3 A;  3TRC A;  5F68 A;  4KUK A;  2PDR A;  3LIA A;  2EWW A;  5DFX A;  4ME4 A;  4NXE A;  3KSF A;  4WN5 A;  3IS2 B;  3KSI A;  2W3E A;  2KLI A;  3K3D A;  4KQD A;  1KOU A;  4HI4 A;  3UME A;  2V0W A;  3BY8 A;  3BWL A;  4BWI A;  2PD7 A;  4F3L A;  5HWV A;  1VB6 A;  4NKP A;  5HDC A;  4HJ3 A;  1T1B A;  5HWT A;  3P7N A;  4MN7 A;  1XFQ A;  1T1A A;  2PR6 A;  5I5L A;  4WEL A;  3PBR A;  1OTE A;  2OWJ A;  4KQO A;  4Y3I A;  4OOL A;  3T4Q A;  3MMH A;  5TBM B;  5IS1 A;  4JGO A;  3OCN A;  4ARZ A;  3PBQ A;  5J3W A;  1NWZ A;  1MZU A;  4EEU A;  2ZMF A;  3KYQ A;  3H7W B;  2XSS A;  3UMD A;  4CLC A;  2K31 A;  3EEA A;  3E0Y A;  5DKL A;  3V67 A;  4UEY A;  4HP4 A;  1G28 A;  1XJ6 A;  5HDD A;  3FPV A;  5DKK A;  3OCL A;  4PAU A;  3R7W B;  2A24 A;  4B9O A;  1S4S A;  2O0Y A;  3EWK A;  3EGX C;  4IJG A;  4HY8 A;  3D3O A;  2QYB A;  4ZRR A;  3UB8 A;  4HOI A;  1P97 A;  3GEC A;  3T4L A;  4CLC E;  2Y79 A;  2CMN A;  2D02 A;  2W3F A;  2VX8 A;  4NEE D;  4BMW A;  2JKT I;  5HD5 A;  3LIC A;  2WKR A;  1X0O A;  4GHI A;  4MMN A;  4F3L B;  3MQQ A;  3C38 A;  3E4Q A;  5HL6 A;  3UE3 A;  3C8C A;  4HJ6 A;  4M4X A;  4RQ9 A;  1GSW A;  1LT0 A;  2L1M A;  1JNU A;  1NLZ A;  4HNB A;  4EQ1 A;  4FOF A;  1OTI A;  4L9G A;  3MXQ A;  1D06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...