3D72A

1.65 angstrom crystal structure of the cys71val variant in the fungal photoreceptor vvd
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
b'MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSVALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Light activation of the LOV protein vivid generates a rapidly exchanging dimer.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 38
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3d72A00
2QHKA 2OWJA 2D02A 2PYRA 2PR6A 1GSXA 4HP9A 2V9AA 1D7EA 4GHIA 3IS2A 4EEUA 1N9NA 1TS6A 5I5LA 4I39A 5IU1A 3LI9A 4HH3A 3BWLA 2QJ5A 4NXFA 2VV7A 2KDKA 1T19A 3F1OA 4HJ6A 3H82B 4LRYC 3MFXA 3A0RA 3UB8A 5HDDA 4JGPA 1F9IA 5DJTA 1DRMA 2PR5A 2GJ3A 3NOPC 1N9OA 3MQOA 3LIAA 5J7EA 2A24B 4I5SA 1TS0A 4L9GA 4RQ9A 4R6LA 3UB7A 4EEPA 3VE3A 3MQQA 1EW0A 5TBMA 4I3AA 1OTBA 1VB6A 4JGQA 2M1CA 3CWFA 1S4RA 2JN7A 4I38A 4HI4A 4GS9B 4XT2A 4R38A 3HJKA 3LIFA 4F3LB 4HP4A 1XFQA 4HJ3A 1S67L 3ULFA 2VLGA 1T1BA 3ICYA 1S1YA 3GECA 5HSQA 3A0VA 2HV1A 3UB6A 4BBVA 2I9VA 4PKYA 4EQ1A 1T1AA 5AVEA 4NXEA 2L0WA 3H7WB 5J3WA 3G6OA 5KIZA 5HWVA 2W0NA 1OJ5A 3PYPA 3F1PB 3NJAA 3FC7A 4PKYG 1TS7A 1P0ZA 2YKHA 3K3DA 2INWA 4I3JA 3H82A 1OT9A 4HY8A 1OTIA 4WL9A 3CAXA 5F69A 4GW9A 2ZOIA 1OTDA 4DJ2A 3C2WA 2V1BA 2PD8A 1NWZA 1XFNA 3RTYA 2H28A 2A24A 5AVFA 2W27A 3UB9A 4LRZE 4DJ3A 1OTAA 2PD7A 4MN6A 4EXOA 1XJ4A 3K3CA 1V9ZA 3UE6A 4WN5A 5EFWA 4B9OA 3T50A 3SW1A 2KX6A 3E4QA 4GS9A 1T1CA 2V1AA 4GCZA 3P7NA 3C8CA 5HZHA 1DP6A 4EW7A 1UGUA 2PYPA 1LSWA 4KQDA 4HJ4A 2P7JA 4L9EA 4BBUA 1LL8A 3NOUC 4NXGA 1F98A 2V0UA 5F5YA 2QWSA 4LRXC 5G4ZA 4R70A 3LIDA 3FG8A 3F1OB 2WKRA 1OT6A 1LSXA 3NOTC 1LSVA 3F1PA 4HOIA 1V9YA 1S66L 1P97A 1XJ6A 5HDCA 2R78A 4YWZA 1Y28A 3LIEA 1T18A 3KX0X 5J4EA 3LIBA 3NHQA 3BY9A 2PHYA 2QJ7A 1DP8A 4LLOB 4BBTA 3HJIA 3EWKA 2YKFA 4KUKA 5TBMB 2WKQA 2ZBBA 1TS8A 3D72A 3EEHA 2VEAA 2J80A 4H6JB 5A8BA 1BYWA 4HIAA 1N9LA 1S1ZA 3A0SA 3LYXA 3E4PA 2JHEA 3F1NB 3IBRA 2OOLA 4JGOA 4WF0A 2EA9A 1ODVA 4L9FA 1DP9A 1G28A 4HNBA 1KOUA 5IS1A 2K7SA 4K08A 5G4YA 5HD3A 2BASA 4M4XA 4HH2A 2QKPA 3BY8A 5HDSA 3LUQA 4EERA 4F3LA 3CLOA 4HQAA 2Z6CA 4GHIB 3IS2B 1UWNX 5DKKA 1D06A 1XJ3A 4EESA 4E04A 2B02A 2ZOHA 5HWWA 3LICA 2CMNA 4WUJA 2VV8A 3ZQ5A 4HHDA 3H7WA 1WA9A 1OTEA 2D01A 4LPZA 2VV6A 2OWHA 1LT0A 1GSVA 1XJ2A 3UMDA 5F68A 4JGRA 2WKPA 5F6AA 1GSWA 3H9WA 5DJUA 1UWPX 4I3IA 4NXBA 4H6JA 1MZUA 2PDRA 1JNUA 4EETB 5DKLA 3LI8A 3F1NA 1X0OA 4KUOA 2L1MA 4MN5A 3OLOA 3PHYA 3MR0A 2V0WA 4XT2B 3B33A 2Z6DA 3VE4A 2L4RA 3GDIA 3MJQA 3UMEA 3E4OA 4R3AA 3MXQA 5HWTA 3RH8B 3VOLA 4WLAA 5HD5A 1OJGA 1S4SA
chains in the Genus database with same CATH superfamily
2OWJA 1E3UA 3N4IA 1ZC2A 2PBDP 3VP1A 5KMWA 2Y2LA 3PBQA 4GHIA 4B88A 3IS2A 1YLJA 1JTGA 3IX3A 4EBLA 3BWLA 3G35A 3R7WB 1FR1A 3W8KA 4NXFA 3VP4A 3VOZA 3LY4A 3T4KA 3T1XA 4EUVA 2ZC7A 5HPIA 3FKVA 3A0RA 2XRNA 1CEFA 2P04A 3EGDC 5HDDA 3ISGA 4N92A 4Z1WA 5GL9A 4X53A 3IWQA 3ZVWA 1VQQA 3IHBA 4PMAA 4YNRA 1W8YA 4EWFA 5J7EA 2Y8HA 1TS0A 3WS4A 2ZLYA 4OQGA 5DTTA 4BWIA 3T1QB 3LCEA 2H0TA 3CZDA 4CQHA 3HCYA 5TBMA 4I3AA 3HUOA 1MWTA 4Y2FA 2JN7A 2Y2MA 4GS9B 5CGSA 5AQBA 1STZA 4IBRA 4X1LA 3CUEA 1YSPA 4GD8A 3GRJA 1PI5A 1S67L 5CHMA 5CX7A 5EVIB 3ULFA 4OPQA 1PI4A 5L8MA 4D2OA 1TVFA 1NLZA 3CPTA 2HV1A 5F82A 3CG5A 4BBVA 5CTNA 2I9VA 1P9WA 3BFEA 4M3KA 4EQ1A 4JXSA 4E3MA 2B5RA 2ZQCA 1NXYA 4RA7A 4OOMA 5HWVA 3QP2A 5FA7A 4A5RA 3PYPA 2WADA 3NC8A 5C5KA 3IHAA 5AQ7A 5DFYA 2Y2QA 1P0ZA 3BFDA 3UE0A 3K3DA 2EX8A 3HLWA 1OT9A 1DJAA 3T1RA 5F69A 1K54C 4IJGA 2WK0A 3UPOA 2IWCA 1K56D 3C2WA 5JYOA 4ETZA 4KZ4A 2I72A 3IX4A 1VHMA 3UDIA 1CJFA 1WE4A 2H28A 1PWDA 4KZ7A 5HAQA 3BYDA 2ZQDA 4BMWA 3UB9A 5EE8A 3PBTA 4MN6A 4EXOA 1KGFA 3K3CA 3UE6A 1VEUA 4B9OA 3T50A 3ZG9B 2ZL1A 3SW1A 4R3BA 2WAEA 4WEKA 3BQAA 2UWXA 3P7NA 5HZHA 3FKWA 1G6OA 3VSKA 3Q81A 1UGUA 2XFTA 3A3EA 3RXXA 4EU0A 4CLCC 1LL8A 3GVBA 3KYZA 4LRXC 5G4ZA 2XDMA 5GLDA 3F1OB 1OT6A 3GSGA 4G3VA 3VFFA 3Q7VB 1XJ6A 2J3WA 3HBRA 1K38A 4ME4A 3UPNA 5TGFA 4O01A 5E2GA 1T18A 3T4TA 4KZ8A 3GMWA 3LIBA 3EEAA 3BY9A 2QYBA 2PHYA 1DP8A 4PPRA 1W8QA 1YMXA 4ESPA 3HJIA 4S2PA 3TG9A 3PAGA 3WS1A 4FH2A 4GB7A 1EI5A 2Y2OA 4KUKA 2ZC4B 3ZNTA 2ZBBA 4Y17A 2GX5A 4ARZA 3UDXA 4S2IA 3IWIA 5TR7A 3V50A 1BLHA 1K54A 2J80A 4H6JB 3S7PA 3OOVA 1N9LA 2V20A 1H3QA 1M6KA 3E4PA 5DTKA 3SS5A 1RGZA 1IYPA 3PBSA 4L9FA 4KZ9A 1FIKA 4KQRA 1HLUP 2K31A 2JBFA 1HZOA 4UEYA 5FI7A 1CK3A 1MPLA 5I94A 4R23A 2P08A 4FH4A 4ZJ2A 4M4XA 5EM0A 3SH8A 2QKPA 4QHCA 5GLAA 2XR0A 1MC0A 5HDSA 2JKTM 3VMAA 5FDSA 3WS0A 3PBRA 1IOUA 4HQAA 4LGWA 4GHIB 3IS2B 1MBLA 5DKKA 5GHYA 4CLCA 4N9LA 4XUZA 1XJ3A 1BSGA 4EESA 3GV9A 4C75A 3W4OA 4KZ3A 2ZD8A 1NYMA 4KZAA 3MQ0A 4HBTA 4BENA 3M6HA 2HDUA 2PU4A 3LY3A 2D01A 3MSHA 5FAQA 4MCWA 2OWHA 4OVDA 1ZKJA 2XD1A 4R1GA 2EWVA 3BFGA 1KE0A 4JGRA 4WM9A 4B4ZA 3ZYTA 5DJUA 1ESUA 1UWPX 1C3BA 4NXBA 3MKFA 3N6IA 2PT7A 4DDSA 1MZUA 4P6ZS 2PDRA 1JNUA 1KE4A 5DKLA 4WEJA 1PWGA 2EFUA 3C5AA 3OLOA 1O07A 1BTLA 5CERA 3O88A 2Z6DA 5EUAA 2A3UA 2IA2A 3VE4A 4BJPA 1JTDA 3G4PA 2L4RA 1CI9A 2EX6A 1IKGA 4IEDA 4WMCD 2RCXA 3KSHA 4GKUA 1L0FA 2XQZA 1YLPA 2JKFA 2V9AA 3DBAA 5IHVA 3ITBA 2ZC5B 4EBNA 4OLGA 4EEUA 1N9NA 1TS6A 2Y2NA 4U0TA 4P6BA 5CEDA 4WBGA 4L0LA 1NLYA 5CHUA 1EROA 3BM6A 4DXCA 3F1OA 4JLFA 1ZTUA 1FCNA 4LRYC 4UA9A 4FUWA 4IBXA 4RX3A 1L0DA 3A3FA 4CJNA 5KZHA 1XXMA 1F9IA 1H8ZA 1Y4OA 2HGVA 1DRMA 2PR5A 2GJ3A 3NOPC 5HX9A 2IWDA 4PAUA 3HREA 3FYZA 1N9OA 4OOLA 5FI2A 3BEBA 5TFQA 3QP8A 2ZJ9A 4I5SA 4U0XA 2JKGA 4ZJ3A 5A90A 4G3KA 1TF1A 2BTFP 1KGGA 4RQ9A 3MMHA 1OMEA 4LV3A 4KZBA 3VE3A 4BL2A 1K4FA 1L0GA 1VB6A 5E2EA 1VEUB 2PBYA 4I38A 3RXWA 2ZL1B 4EQIA 4XT2A 4R38A 3IT9A 3AGDA 4F3LB 2HP5A 4S2NC 4FSFA 2ZQAA 5HARA 4OLDA 4Y3IA 2CC1A 1T1BA 3ICYA 1S1YA 2Y2GA 2O9AA 5A92A 1M40A 5HSQA 1K6RA 3Q7ZA 5FQKA 5DF8A 3S7QA 1GHPA 2ZM0A 4PKYA 2WGIA 4HESA 5AVEA 1NZUA 2L0WA 3H7WB 3VOYA 3C4OA 4Y7PA 5J3WA 2Y2JA 4DE1A 2OAP1 2O99A 3W4QA 2JKRI 3A3IA 2LB9A 2WGVA 5FDHA 3NJAA 1G5UA 1TS7A 2YKHA 3QP5A 4GDNA 3H82A 4ZBEA 2OLVA 3PR6A 1IYSA 2ZC6B 2ACGA 4OQHA 3CAXA 1FSWA 3UE1A 2ZOIA 1G6AA 1ES4A 2WGWB 5AQ9A 4PM9A 2V1BA 2A2LA 1IKIA 1NWZA 1KVLA 1LLBA 3NY4A 2J7VA 4X56A 4F94A 4ARZB 2A24A 3LR0A 4R4SA 5AVFA 1IEMA 2HJ9C 4BD0A 3MKEA 4DJ3A 2PD7A 2EWWA 4OQIA 4MBFA 2G2UA 4CPKA 1V9ZA 3LEQA 4WN5A 1MWUA 5EFWA 2FFFB 3WWXA 4WELA 3O3VA 3E4QA 2XEPA 5DVAA 3DWKA 1DJCA 1LL9A 3QP6A 1I2SA 5FAOA 3IXDA 1MKIA 4PHTA 1DP6A 2P74A 4EW7A 1PZPA 1IYQA 4P6ZM 2Y55A 3ZCZA 1LSWA 5U47A 4MBHA 3VP2A 4OH0A 4L9EA 4IHQA 4BBUA 2ZMAA 1L3LA 5JYPA 4YINA 4NXGA 3T12B 1ONGA 5F5YA 5FQQA 4S2NA 3LIDA 3B42A 4Y5FA 5CEBA 1LSXA 3NOTC 3N8SA 3UDFA 2NUTC 1DY6A 1LSVA 5HAIA 3F1PA 4CLCB 2C5WB 1V9YA 3G34A 1S66L 1W63Q 2OLUA 5HDCA 3T4JA 2Q9MA 1NRJA 3V39A 2WYXA 1MWRA 4HEFA 3S4XA 4YOFA 2XH9A 4GLQA 3ZG7B 4DKIA 4BBTA 1PYYA 4QY6A 3LR3A 1JWPA 4KG2A 5FAPA 3HVFA 3S7NA 2WKQA 1J3WA 4O7DA 3D72A 5HL6A 3EEHA 4KZ5A 5FQJA 2V8FA 1QMFA 5CGWA 3EQVA 5FQ9A 1JWVA 3D4FA 1S1ZA 3I7JA 3QHYA 4QD4A 4JGOA 2EA9A 4GD6A 1ODVA 5GLBA 1WYCA 2K7SA 1KDWA 4K08A 3PXPA 3DWZA 5HD3A 4RX2A 2QZ6A 2XSSA 3FPWA 2PRFA 3CJMA 4HH2A 2XLNA 5EVID 4JKTA 1WYBA 5FSRA 1AXBA 4EERA 5CXWA 4F3LA 3U2AA 2VGLS 3CI6A 4JF4A 1QMEA 2XA7S 3NIAA 4O0PA 4MDZA 3HLDA 4E04A 2B02A 2O9BA 2CMNA 4WUJA 3R4KA 2W1TB 2ZQ9A 3ZQ5A 2G2WA 5D3OA 4OONA 1IFQA 2JCHA 3H7WA 2VX8A 1OTEA 3OZHA 2VV6A 1JWZA 1I5QA 3SH9A 2FZ0A 3SS3A 3UMDA 5EPHA 3QNBA 3N8LA 3DTIA 5F6AA 2HP9A 4DN0A 1L0EA 2WAFA 1H8MA 1XA7A 2HDQA 3B3XA 4QJGA 4Y0UA 3IQAA 1EWZA 1K55C 1YSQA 4P85A 4EETB 2FFYA 2WGWA 4DDYA 1BZAA 4KUOA 1J9MA 2L1MA 2B18A 5E43A 4MN5A 4DF6A 2C6WB 1KDSA 3KYEA 3E98A 2AVXA 2W3EA 3A3JA 3MR0A 4XT2B 5M1AA 5HW3A 5EV0A 3GDIA 3UMEA 4OP8A 5EVLA 3E4OA 1E25A 3TSGA 4JBFA 3O5YA 3RH8B 3VOLA 4WLAA 3N8RA 5HD5A 1OJGA 2QHKA 2PR6A 4BD1A 3JPUA 3UPPA 5FEGA 3MZDA 1HTZA 2DRWA 1ACFA 3OPRA 4S2JA 4JXVA 5I5LA 2VA0A 2ZC3B 3M2KA 3LI9A 2QJ5A 1YLZA 2O9CA 4QY5A 2W3FA 5L10A 5IT5A 3LO7A 2A49A 3ZHHA 1H5XA 2KDKA 2OV5A 4X69A 3H82B 3OCNA 4WYYA 1K56A 2UV0E 4GJ4A 1W63M 2LB5A 3EGXC 5F1GA 4JGPA 3PTEA 1FILA 1GA0A 5EECA 4Z9QA 2Q9NA 4Y0OA 3BLSA 4PM5A 4P0MA 3D9YA 1KGEA 3UO9A 2A24B 2JC7A 5CECA 1A0KA 4L9GA 4R6LA 3LEZA 4IUHA 2E8JA 3MQQA 1EW0A 1PZOA 4NG2A 1PFLA 4II7A 3P01A 4JGQA 4K0WA 2M1CA 3ZG8B 5E2HA 5HAPA 1SDNA 3FPVA 2DMWA 3FZCA 1K55A 3LIFA 1VETA 4OOYA 2VLGA 4DE2A 3JVVA 3T4QA 1ES3A 3GECA 3GR2A 3A0VA 3IXBA 3UB6A 3TOIA 3WS2A 3W4PA 2EX2A 1PWCA 1YMSA 1TEMA 1Z09A 4E3NA 4NXEA 1E3UD 3IBJA 3FWLA 4S2OA 3PAEA 3M6BA 3G6OA 5KIZA 4DE3A 5EM1A 2GDNA 2W0NA 4LENA 3F1PB 4MEZA 3C7VA 2J3TD 1YQSA 3FC7A 5DF7A 5FL3A 4PKYG 2INWA 2VKSA 4I3JA 1OTIA 2VGLM 1OTDA 3U4LP 1TDLA 2XA7M 4DJ2A 1XKZA 4MLLA 2XD5A 1BULA 4Q0HA 4OKPA 2W1TA 1XFNA 4G3WA 5FATA 3RTYA 1PW1A 1W5DA 3DW0A 4X68A 2PU2A 1VM1A 1ZG4A 1HD8A 3KYQA 1MWSA 3MXSA 1YT4A 3BFFA 5HL1A 4OPRA 3IF6C 4Q0JA 4MMNA 2KOIA 2GNXA 4LRZE 3ZDJA 4P87A 1OTAA 1ESIA 2EXBA 1XJ4A 4UAAA 5M18A 2M7VA 1BLCA 4D60A 2E8IA 4ZAMA 1PIOA 3IXHA 1T1CA 1L2SA 4GCZA 2J9OA 3DTMA 2J9PA 3MZFA 2PYPA 1CI8A 1ZG6A 4KQDA 4JXGA 1XP4A 2P7JA 3KO6A 5FI6A 3MZEA 2VK3A 1ONHA 1OPXA 3IXGA 3KSIA 2JE5A 3JVUA 3G30A 2ZQ7A 2V0UA 2QWSA 4R70A 1MY8A 3SH7A 1MXOA 2HPBA 3FG8A 3WRTA 2WZZA 2WKRA 5LBRA 4Y15A 1SCWA 3UY6A 4FD8A 5DTSA 3K2NA 1BT5A 1TD5A 1P97A 4KZ6A 3Q82A 2R78A 4LV0A 4YWZA 1GHMA 3VP3A 1Y28A 3LIEA 3VP0A 2B95A 4HBUA 5J4EA 1NJ4A 3CHWP 3NHQA 2VGKA 3LGOA 2QJ7A 3LR5A 3T4OA 4LLOB 3IF5A 5MC7A 3EWKA 1K4EA 4OPYA 4NKPA 4EV4A 2WZXA 1U60A 3IH9A 1FSYA 3PBNA 4S2KA 4H8RA 4RVAA 3UNWA 3VFHA 5F83A 2X02A 2VEAA 5FEFA 4MN7A 4NK3A 1Y54A 3DTKA 4KQQA 3GTCA 3A0SA 3G31A 3NECA 3EQUA 3IBRA 2OOLA 4WF0A 5F1FA 1XGIA 4R4RA 1G28A 3UB5P 4OPZA 4FOFA 3IF6A 1YLTA 2RL3A 3WS5A 2HZ5A 1S6RA 4KENB 2BASA 1K57C 3BRMA 2Y79A 4WMCA 3BY8A 4FCFA 1W79A 2W3GA 3WRZA 3LUQA 4OQ0A 1K25A 3UE3A 2QMIA 3ZVTA 3CLOA 3KSGA 5AJGA 5A91A 2Z6CA 1D06A 2WKHA 3S7OA 1N4OA 4E6XA 2ZOHA 5HWWA 3V67A 4IVIA 2VV8A 3HLCA 5GHZA 4HHDA 2Y91A 1BLSA 2EFXA 2EXAA 3P98A 3JYIA 4YFMA 4B93A 4LPZA 4FTXA 3B47A 4GDBA 3ZG5A 1ERQA 4UHUA 4X25A 3C30A 4ETXA 2ZMVA 1K6SA 3C38A 4EBPA 5F68A 2Y4AA 4CLCE 5J8XA 3LR4A 2Q0OA 2WUQA 3H9WA 2G7UA 3OC2A 4JPMA 1BLPA 1CEGA 2JKRM 1NYYA 2XK1A 3NCKA 3NULA 4QPRA 1YLYA 3AGFA 2ZM8A 2KLIA 2H5SA 3LI8A 4RYEA 3F1NA 1X0OA 2NUPC 5KSCA 3QP4A 3BJNA 2V0WA 2HDRA 3B33A 2V8CA 3MF0A 5FASA 5K5BA 3Q1FA 4XUXA 4OP5A 3E2KA 1VETB 3M2JA 3MJQA 4U3TA 4R3AA 2BLSA 1RCJA 3MXQA 4Q0IA 3VSLA 4X1MA 2D02A 2PYRA 1ES5A 1S0WA 1GSXA 1D1JA 4HP9A 3T1SA 2J8YA 1D7EA 3V5MA 4PM7A 4GNUA 1K57A 2DNSA 2VGJA 1SDEA 4ZRRA 2HP6A 4I39A 5IU1A 4CLCD 4HH3A 3UN7A 5KSHA 3CMZA 3NI9A 4S2MA 2VV7A 3MXRA 1JVJA 1NY0A 1ES2A 3TW8A 1PRQA 4Y13A 1T19A 1FOFA 4HJ6A 3G32A 4R0QA 3NDEA 2W3DA 3MFXA 3UB8A 1KVMA 3SOIA 5DJTA 1AWIA 1ERMA 2VZWA 1SKFA 3Q07A 4B4XA 4BLMA 3AGEA 4QWOA 3OPPA 1MKMA 2BG1A 2ZMFA 3MQOA 3LIAA 3BW6A 3T4LA 2JKTI 2WKEA 5E2FA 4C6YA 2ZQ8A 5M19A 4DMZA 3UB7A 4EUZA 5EVIC 1BUEA 4EEPA 3S1YA 4QU3A 3V3SA 4KG5A 1OTBA 2HF6A 3CWFA 1S4RA 2Z2LB 2IWBA 1FCMA 4HI4A 3HJKA 4HP4A 1XFQA 4HJ3A 4LCMA 4GZBA 4GOGA 3OPLA 1SKOA 3QP1A 2FH5A 1Z6FA 5G18A 4ID4A 5L09A 1K0KA 4UQIS 3EOIA 1T1AA 3HLEA 4O8GA 1GA9A 1H0MA 5CGXA 3O86A 4UA7A 1OJ5A 4LCLA 3S22A 3R7WA 2X71A 3IWOA 5GLCA 3ZG0A 3BQ8A 2HDSA 1YM1A 4Y0TA 4HY8A 4JXWA 1IYOA 4BQMA 4WL9A 5CRFA 3G2ZA 4GW9A 5CTMA 3PBOA 1RP5A 2Z2MB 1HVBA 3RFBA 3TJZC 4K0XA 4N1HA 2PD8A 4LV2A 1YKDA 5AQAA 4NEED 3W2ZA 3TRCA 4ZDXA 2Y2IA 2EX9A 3OCLA 4E3KA 4QB8A 3MS6A 4IUKA 4DE0A 2W27A 3A3DA 4BL3A 1IELA 3RJUA 4DRTA 1LHYA 1YLWA 1G68A 2P9VB 2XF3A 2PAVP 2KX6A 3O87A 4GS9A 1CF0A 4UA6A 2V1AA 4GN2A 3IF6B 1H8YA 3C7UA 3C8CA 5EVIA 3G2YA 4WZ5C 2R9WA 3TE8A 2GZAA 2Y2PA 4KG6A 4MNRA 4HJ4A 4S2LA 1LI9A 1TDGA 2Y2HA 3FV7A 5CHJA 3L7HA 4NETA 3N7WA 3NOUC 3V3RA 3OPHA 1F98A 3HLGA 2VJWA 1F2KA 1PW8A 3HL9A 4KQOA 1GHIA 2X01A 1FR6A 3ZGAB 3HUNA 5GHXA 5L07A 4HOIA 3HLBA 3IH8A 3BECA 4E3LA 3SZTA 3MFDA 1N9BA 3KX0X 5BOHA 1E4DA 3IX8A 2Y2KA 2Y59A 4WZ4A 1KE3A 1FCOA 1DJBA 2XFSA 2YKFA 4E3OA 2M7UA 3ITAA 2H10A 5TBMB 3E0YA 2XGNA 1TS8A 4JF6A 3DAVA 4N1XA 3LFVA 5HFOA 1ZHHB 3NBLA 3CITA 1CQAA 3E2LA 5A8BA 4HIAA 1BYWA 2O0YA 4PM8A 3LYXA 2JHEA 3F1NB 4E3JA 4DXBA 3CPTB 3HLFA 4LV1A 3T4SA 1DP9A 1W7FA 1I2WA 4HNBA 1KOUA 5IS1A 3L9KA 5HPFA 4X55A 5G4YA 2DCFA 2W3HA 2V2FF 2V1ZA 4PM6A 2MJ6A 4X6TA 2J3TC 5DF9A 5FQMA 4E6WA 3P09A 5FQIA 1GCEA 2WKIA 2ZM2A 4R3JA 4N9KA 2H0YA 4WZ5A 1SZVA 3GQZA 1SHVA 1XGJA 1UWNX 4C3QA 3Q7VA 1P9RA 3MBZA 3LICA 1LI0A 2HJEA 1PNEA 1FQGA 5EOEA 4UQIM 1NZOA 3SS4A 1WA9A 2OSUA 1XA1A 2QPNA 2XROA 5DFXA 1LT0A 1GSVA 5EVEA 4MBKA 1XJ2A 2WKPA 2R9XA 1GSWA 1Q2QA 3QNCA 3ZFZA 5A93A 1O7EA 4I3IA 5EOOA 5TJJA 4H6JA 3BFCA 3CUEC 1NRFA 3C4PA 2K2NA 4Q8IA 3KSFA 3HUMA 4K91A 4IVKA 3BLMA 3PHYA 4ZTKA 4E3IA 3VV4A 3D3OA 3NDGA 3DTEA 2W1RA 4JF5A 1XX2A 1XPBA 3OBFA 1LL5A 4LFUA 4AFIA 1YAXA 1F5MA 3ZNYA 4XXRA 1RGYA 5L2FA 1YPRA 1Q2PA 1SKOB 2P9VA 5HWTA 2OAQ1 1ALQA 4ZJ1A 1S4SA
chains in the Genus database with same CATH topology
2QHKA 2OWJA 3KSHA 2D02A 2PYRA 2PR6A 1GSXA 4HP9A 2V9AA 3DBAA 1D7EA 3PBQA 4GHIA 3IS2A 4EEUA 1N9NA 1TS6A 4ZRRA 5I5LA 2VA0A 4I39A 5IU1A 3LI9A 4L0LA 4CLCD 1NLYA 4HH3A 3BWLA 2QJ5A 2O9CA 3R7WB 2W3FA 5KSHA 5IT5A 4NXFA 2VV7A 3TW8A 2KDKA 1T19A 3T4KA 4EUVA 3F1OA 4HJ6A 1ZTUA 3H82B 5HPIA 4LRYC 2W3DA 3OCNA 3MFXA 3A0RA 3UB8A 4GJ4A 1W63M 2XRNA 2LB5A 2P04A 3EGXC 3EGDC 5HDDA 4JGPA 4Z1WA 1F9IA 2HGVA 5DJTA 1DRMA 2PR5A 2VZWA 2GJ3A 3NOPC 4PAUA 1N9OA 4YNRA 1MKMA 2ZMFA 4OOLA 3MQOA 3LIAA 3BW6A 3T4LA 2JKTI 5J7EA 2Y8HA 2A24B 4I5SA 1TS0A 4BWIA 4G3KA 1TF1A 4DMZA 4L9GA 4RQ9A 4R6LA 3UB7A 4IUHA 3MMHA 4EEPA 3VE3A 3MQQA 1EW0A 4CQHA 3HCYA 5TBMA 4I3AA 1OTBA 4II7A 1VB6A 3P01A 4JGQA 2M1CA 2HF6A 3CWFA 4Y2FA 1S4RA 2JN7A 4I38A 4HI4A 4GS9B 3FPVA 4XT2A 1STZA 2DMWA 4R38A 3CUEA 1YSPA 3HJKA 3LIFA 4F3LB 4HP4A 1XFQA 4FSFA 4HJ3A 1S67L 5CX7A 3ULFA 4Y3IA 2VLGA 1T1BA 5L8MA 3ICYA 1S1YA 2FH5A 2O9AA 1NLZA 3JVVA 3T4QA 3GECA 5HSQA 3A0VA 2HV1A 3UB6A 4BBVA 3S7QA 2I9VA 1P9WA 4UQIS 3EOIA 4PKYA 4EQ1A 1T1AA 5AVEA 4NXEA 2L0WA 3H7WB 4O8GA 3IBJA 5J3WA 3G6OA 4OOMA 5KIZA 2OAP1 5HWVA 2O99A 2JKRI 2W0NA 1OJ5A 3PYPA 3F1PB 5C5KA 2LB9A 3R7WA 3NJAA 2J3TD 5DFYA 3FC7A 5FL3A 4PKYG 1TS7A 1P0ZA 2YKHA 3K3DA 2INWA 3BQ8A 2VKSA 4I3JA 3H82A 1OT9A 3PR6A 4HY8A 1OTIA 2VGLM 4WL9A 3CAXA 5F69A 4GW9A 2ZOIA 3PBOA 1OTDA 2XA7M 4IJGA 4DJ2A 3RFBA 3C2WA 3TJZC 2V1BA 2A2LA 2PD8A 4Q0HA 1NWZA 4ETZA 1YKDA 2W1TA 1XFNA 4G3WA 3RTYA 4NEED 1VHMA 3W2ZA 2H28A 3TRCA 4ARZB 2A24A 3KYQA 3LR0A 3OCLA 4Q0JA 5AVFA 4MMNA 2KOIA 2GNXA 2HJ9C 4IUKA 2W27A 4BMWA 4LRZE 3UB9A 4DJ3A 1OTAA 2PD7A 3PBTA 4MN6A 2EWWA 4EXOA 1XJ4A 3K3CA 1V9ZA 2M7VA 3UE6A 4WN5A 5EFWA 4B9OA 3T50A 4WELA 3SW1A 2KX6A 3E4QA 4GS9A 1T1CA 4WEKA 3BQAA 2V1AA 4GCZA 3P7NA 3C8CA 5HZHA 4PHTA 1DP6A 4EW7A 1G6OA 4P6ZM 3TE8A 1UGUA 2GZAA 2PYPA 1LSWA 4KQDA 4HJ4A 2P7JA 3KO6A 4L9EA 4CLCC 4EU0A 4IHQA 4BBUA 1LL8A 1OPXA 3NOUC 3KSIA 3KYZA 4NXGA 3JVUA 1F98A 2V0UA 5F5YA 2QWSA 4LRXC 5G4ZA 4R70A 2VJWA 3LIDA 3FG8A 3F1OB 3B42A 2WKRA 4Y5FA 1OT6A 1LSXA 4KQOA 3NOTC 5LBRA 4G3VA 2NUTC 1LSVA 3K2NA 3F1PA 4CLCB 4HOIA 1V9YA 1S66L 1TD5A 1P97A 1XJ6A 1W63Q 2J3WA 4ME4A 5HDCA 2R78A 4YWZA 3T4JA 1NRJA 1Y28A 4O01A 3LIEA 1T18A 3T4TA 3KX0X 5J4EA 3LIBA 3EEAA 3NHQA 4YOFA 3BY9A 2QYBA 2PHYA 2QJ7A 3LR5A 3T4OA 1DP8A 4LLOB 4GLQA 5MC7A 4BBTA 3HJIA 3EWKA 3LR3A 4NKPA 2YKFA 2M7UA 4KUKA 3S7NA 5TBMB 3E0YA 2WKQA 2ZBBA 3PBNA 2GX5A 4ARZA 1TS8A 3D72A 5HL6A 3EEHA 2VEAA 2J80A 4H6JB 3LFVA 1ZHHB 3EQVA 4MN7A 3CITA 5A8BA 3S7PA 1BYWA 3OOVA 4HIAA 1N9LA 1H3QA 1S1ZA 2O0YA 3A0SA 3LYXA 3E4PA 2JHEA 3EQUA 3F1NB 3IBRA 2OOLA 4JGOA 4WF0A 2EA9A 1ODVA 3PBSA 4L9FA 1DP9A 1G28A 3T4SA 4FOFA 4HNBA 1KOUA 5IS1A 2K7SA 5HPFA 4K08A 5G4YA 2W3HA 3PXPA 5HD3A 2K31A 2XSSA 4UEYA 2BASA 3FPWA 2P08A 4M4XA 4HH2A 2MJ6A 2Y79A 2QKPA 2J3TC 3BY8A 1MC0A 5HDSA 5DF9A 2W3GA 3LUQA 2JKTM 4EERA 3UE3A 3PBRA 1IOUA 4F3LA 3U2AA 3CLOA 2VGLS 3CI6A 4HQAA 3KSGA 5AJGA 2Z6CA 4GHIB 3IS2B 1UWNX 2XA7S 4O0PA 5DKKA 4CLCA 4MDZA 1D06A 1XJ3A 4EESA 1P9RA 3S7OA 4E04A 2B02A 2O9BA 2ZOHA 5HWWA 3LICA 3V67A 2CMNA 4WUJA 2VV8A 3R4KA 2W1TB 2HJEA 3ZQ5A 3MQ0A 4HHDA 4UQIM 1IFQA 3H7WA 2VX8A 4B93A 1WA9A 1OTEA 2D01A 4LPZA 2VV6A 3B47A 4MCWA 2OWHA 2XROA 5DFXA 1LT0A 1GSVA 2FZ0A 2EWVA 3C30A 4ETXA 2ZMVA 1XJ2A 3C38A 3UMDA 5F68A 4JGRA 4CLCE 2WKPA 5F6AA 1GSWA 3ZYTA 3LR4A 4DN0A 3H9WA 5DJUA 2G7UA 3OC2A 1UWPX 4I3IA 4NXBA 1H8MA 5TJJA 2PT7A 4H6JA 2JKRM 4QPRA 1MZUA 3CUEC 4P6ZS 2K2NA 2PDRA 1JNUA 1YSQA 2KLIA 4EETB 5DKLA 3KSFA 3LI8A 4WEJA 3F1NA 1X0OA 4KUOA 2L1MA 2B18A 2NUPC 4MN5A 3OLOA 3PHYA 3BJNA 3VV4A 3E98A 3D3OA 2W3EA 3MR0A 2W1RA 2V0WA 4XT2B 3B33A 2Z6DA 3MF0A 5K5BA 2IA2A 3VE4A 3OBFA 4BJPA 2L4RA 4AFIA 3GDIA 3MJQA 3UMEA 1YAXA 1F5MA 3E4OA 4R3AA 3MXQA 3O5YA 5HWTA 3RH8B 2OAQ1 3VOLA 4WLAA 5HD5A 1OJGA 4Q0IA 1S4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHK A;  2OWJ A;  2D02 A;  2PYR A;  2PR6 A;  1GSX A;  4HP9 A;  2V9A A;  1D7E A;  4GHI A;  3IS2 A;  4EEU A;  1N9N A;  1TS6 A;  5I5L A;  4I39 A;  5IU1 A;  3LI9 A;  4HH3 A;  3BWL A;  2QJ5 A;  4NXF A;  2VV7 A;  2KDK A;  1T19 A;  3F1O A;  4HJ6 A;  3H82 B;  4LRY C;  3MFX A;  3A0R A;  3UB8 A;  5HDD A;  4JGP A;  1F9I A;  5DJT A;  1DRM A;  2PR5 A;  2GJ3 A;  3NOP C;  1N9O A;  3MQO A;  3LIA A;  5J7E A;  2A24 B;  4I5S A;  1TS0 A;  4L9G A;  4RQ9 A;  4R6L A;  3UB7 A;  4EEP A;  3VE3 A;  3MQQ A;  1EW0 A;  5TBM A;  4I3A A;  1OTB A;  1VB6 A;  4JGQ A;  2M1C A;  3CWF A;  1S4R A;  2JN7 A;  4I38 A;  4HI4 A;  4GS9 B;  4XT2 A;  4R38 A;  3HJK A;  3LIF A;  4F3L B;  4HP4 A;  1XFQ A;  4HJ3 A;  1S67 L;  3ULF A;  2VLG A;  1T1B A;  3ICY A;  1S1Y A;  3GEC A;  5HSQ A;  3A0V A;  2HV1 A;  3UB6 A;  4BBV A;  2I9V A;  4PKY A;  4EQ1 A;  1T1A A;  5AVE A;  4NXE A;  2L0W A;  3H7W B;  5J3W A;  3G6O A;  5KIZ A;  5HWV A;  2W0N A;  1OJ5 A;  3PYP A;  3F1P B;  3NJA A;  3FC7 A;  4PKY G;  1TS7 A;  1P0Z A;  2YKH A;  3K3D A;  2INW A;  4I3J A;  3H82 A;  1OT9 A;  4HY8 A;  1OTI A;  4WL9 A;  3CAX A;  5F69 A;  4GW9 A;  2ZOI A;  1OTD A;  4DJ2 A;  3C2W A;  2V1B A;  2PD8 A;  1NWZ A;  1XFN A;  3RTY A;  2H28 A;  2A24 A;  5AVF A;  2W27 A;  3UB9 A;  4LRZ E;  4DJ3 A;  1OTA A;  2PD7 A;  4MN6 A;  4EXO A;  1XJ4 A;  3K3C A;  1V9Z A;  3UE6 A;  4WN5 A;  5EFW A;  4B9O A;  3T50 A;  3SW1 A;  2KX6 A;  3E4Q A;  4GS9 A;  1T1C A;  2V1A A;  4GCZ A;  3P7N A;  3C8C A;  5HZH A;  1DP6 A;  4EW7 A;  1UGU A;  2PYP A;  1LSW A;  4KQD A;  4HJ4 A;  2P7J A;  4L9E A;  4BBU A;  1LL8 A;  3NOU C;  4NXG A;  1F98 A;  2V0U A;  5F5Y A;  2QWS A;  4LRX C;  5G4Z A;  4R70 A;  3LID A;  3FG8 A;  3F1O B;  2WKR A;  1OT6 A;  1LSX A;  3NOT C;  1LSV A;  3F1P A;  4HOI A;  1V9Y A;  1S66 L;  1P97 A;  1XJ6 A;  5HDC A;  2R78 A;  4YWZ A;  1Y28 A;  3LIE A;  1T18 A;  3KX0 X;  5J4E A;  3LIB A;  3NHQ A;  3BY9 A;  2PHY A;  2QJ7 A;  1DP8 A;  4LLO B;  4BBT A;  3HJI A;  3EWK A;  2YKF A;  4KUK A;  5TBM B;  2WKQ A;  2ZBB A;  1TS8 A;  3D72 A;  3EEH A;  2VEA A;  2J80 A;  4H6J B;  5A8B A;  1BYW A;  4HIA A;  1N9L A;  1S1Z A;  3A0S A;  3LYX A;  3E4P A;  2JHE A;  3F1N B;  3IBR A;  2OOL A;  4JGO A;  4WF0 A;  2EA9 A;  1ODV A;  4L9F A;  1DP9 A;  1G28 A;  4HNB A;  1KOU A;  5IS1 A;  2K7S A;  4K08 A;  5G4Y A;  5HD3 A;  2BAS A;  4M4X A;  4HH2 A;  2QKP A;  3BY8 A;  5HDS A;  3LUQ A;  4EER A;  4F3L A;  3CLO A;  4HQA A;  2Z6C A;  4GHI B;  3IS2 B;  1UWN X;  5DKK A;  1D06 A;  1XJ3 A;  4EES A;  4E04 A;  2B02 A;  2ZOH A;  5HWW A;  3LIC A;  2CMN A;  4WUJ A;  2VV8 A;  3ZQ5 A;  4HHD A;  3H7W A;  1WA9 A;  1OTE A;  2D01 A;  4LPZ A;  2VV6 A;  2OWH A;  1LT0 A;  1GSV A;  1XJ2 A;  3UMD A;  5F68 A;  4JGR A;  2WKP A;  5F6A A;  1GSW A;  3H9W A;  5DJU A;  1UWP X;  4I3I A;  4NXB A;  4H6J A;  1MZU A;  2PDR A;  1JNU A;  4EET B;  5DKL A;  3LI8 A;  3F1N A;  1X0O A;  4KUO A;  2L1M A;  4MN5 A;  3OLO A;  3PHY A;  3MR0 A;  2V0W A;  4XT2 B;  3B33 A;  2Z6D A;  3VE4 A;  2L4R A;  3GDI A;  3MJQ A;  3UME A;  3E4O A;  4R3A A;  3MXQ A;  5HWT A;  3RH8 B;  3VOL A;  4WLA A;  5HD5 A;  1OJG A;  1S4S A; 
#chains in the Genus database with same CATH topology
 2OWJ A;  1E3U A;  3N4I A;  1ZC2 A;  2PBD P;  3VP1 A;  5KMW A;  2Y2L A;  3PBQ A;  4GHI A;  4B88 A;  3IS2 A;  1YLJ A;  1JTG A;  3IX3 A;  4EBL A;  3BWL A;  3G35 A;  3R7W B;  1FR1 A;  3W8K A;  4NXF A;  3VP4 A;  3VOZ A;  3LY4 A;  3T4K A;  3T1X A;  4EUV A;  2ZC7 A;  5HPI A;  3FKV A;  3A0R A;  2XRN A;  1CEF A;  2P04 A;  3EGD C;  5HDD A;  3ISG A;  4N92 A;  4Z1W A;  5GL9 A;  4X53 A;  3IWQ A;  3ZVW A;  1VQQ A;  3IHB A;  4PMA A;  4YNR A;  1W8Y A;  4EWF A;  5J7E A;  2Y8H A;  1TS0 A;  3WS4 A;  2ZLY A;  4OQG A;  5DTT A;  4BWI A;  3T1Q B;  3LCE A;  2H0T A;  3CZD A;  4CQH A;  3HCY A;  5TBM A;  4I3A A;  3HUO A;  1MWT A;  4Y2F A;  2JN7 A;  2Y2M A;  4GS9 B;  5CGS A;  5AQB A;  1STZ A;  4IBR A;  4X1L A;  3CUE A;  1YSP A;  4GD8 A;  3GRJ A;  1PI5 A;  1S67 L;  5CHM A;  5CX7 A;  5EVI B;  3ULF A;  4OPQ A;  1PI4 A;  5L8M A;  4D2O A;  1TVF A;  1NLZ A;  3CPT A;  2HV1 A;  5F82 A;  3CG5 A;  4BBV A;  5CTN A;  2I9V A;  1P9W A;  3BFE A;  4M3K A;  4EQ1 A;  4JXS A;  4E3M A;  2B5R A;  2ZQC A;  1NXY A;  4RA7 A;  4OOM A;  5HWV A;  3QP2 A;  5FA7 A;  4A5R A;  3PYP A;  2WAD A;  3NC8 A;  5C5K A;  3IHA A;  5AQ7 A;  5DFY A;  2Y2Q A;  1P0Z A;  3BFD A;  3UE0 A;  3K3D A;  2EX8 A;  3HLW A;  1OT9 A;  1DJA A;  3T1R A;  5F69 A;  1K54 C;  4IJG A;  2WK0 A;  3UPO A;  2IWC A;  1K56 D;  3C2W A;  5JYO A;  4ETZ A;  4KZ4 A;  2I72 A;  3IX4 A;  1VHM A;  3UDI A;  1CJF A;  1WE4 A;  2H28 A;  1PWD A;  4KZ7 A;  5HAQ A;  3BYD A;  2ZQD A;  4BMW A;  3UB9 A;  5EE8 A;  3PBT A;  4MN6 A;  4EXO A;  1KGF A;  3K3C A;  3UE6 A;  1VEU A;  4B9O A;  3T50 A;  3ZG9 B;  2ZL1 A;  3SW1 A;  4R3B A;  2WAE A;  4WEK A;  3BQA A;  2UWX A;  3P7N A;  5HZH A;  3FKW A;  1G6O A;  3VSK A;  3Q81 A;  1UGU A;  2XFT A;  3A3E A;  3RXX A;  4EU0 A;  4CLC C;  1LL8 A;  3GVB A;  3KYZ A;  4LRX C;  5G4Z A;  2XDM A;  5GLD A;  3F1O B;  1OT6 A;  3GSG A;  4G3V A;  3VFF A;  3Q7V B;  1XJ6 A;  2J3W A;  3HBR A;  1K38 A;  4ME4 A;  3UPN A;  5TGF A;  4O01 A;  5E2G A;  1T18 A;  3T4T A;  4KZ8 A;  3GMW A;  3LIB A;  3EEA A;  3BY9 A;  2QYB A;  2PHY A;  1DP8 A;  4PPR A;  1W8Q A;  1YMX A;  4ESP A;  3HJI A;  4S2P A;  3TG9 A;  3PAG A;  3WS1 A;  4FH2 A;  4GB7 A;  1EI5 A;  2Y2O A;  4KUK A;  2ZC4 B;  3ZNT A;  2ZBB A;  4Y17 A;  2GX5 A;  4ARZ A;  3UDX A;  4S2I A;  3IWI A;  5TR7 A;  3V50 A;  1BLH A;  1K54 A;  2J80 A;  4H6J B;  3S7P A;  3OOV A;  1N9L A;  2V20 A;  1H3Q A;  1M6K A;  3E4P A;  5DTK A;  3SS5 A;  1RGZ A;  1IYP A;  3PBS A;  4L9F A;  4KZ9 A;  1FIK A;  4KQR A;  1HLU P;  2K31 A;  2JBF A;  1HZO A;  4UEY A;  5FI7 A;  1CK3 A;  1MPL A;  5I94 A;  4R23 A;  2P08 A;  4FH4 A;  4ZJ2 A;  4M4X A;  5EM0 A;  3SH8 A;  2QKP A;  4QHC A;  5GLA A;  2XR0 A;  1MC0 A;  5HDS A;  2JKT M;  3VMA A;  5FDS A;  3WS0 A;  3PBR A;  1IOU A;  4HQA A;  4LGW A;  4GHI B;  3IS2 B;  1MBL A;  5DKK A;  5GHY A;  4CLC A;  4N9L A;  4XUZ A;  1XJ3 A;  1BSG A;  4EES A;  3GV9 A;  4C75 A;  3W4O A;  4KZ3 A;  2ZD8 A;  1NYM A;  4KZA A;  3MQ0 A;  4HBT A;  4BEN A;  3M6H A;  2HDU A;  2PU4 A;  3LY3 A;  2D01 A;  3MSH A;  5FAQ A;  4MCW A;  2OWH A;  4OVD A;  1ZKJ A;  2XD1 A;  4R1G A;  2EWV A;  3BFG A;  1KE0 A;  4JGR A;  4WM9 A;  4B4Z A;  3ZYT A;  5DJU A;  1ESU A;  1UWP X;  1C3B A;  4NXB A;  3MKF A;  3N6I A;  2PT7 A;  4DDS A;  1MZU A;  4P6Z S;  2PDR A;  1JNU A;  1KE4 A;  5DKL A;  4WEJ A;  1PWG A;  2EFU A;  3C5A A;  3OLO A;  1O07 A;  1BTL A;  5CER A;  3O88 A;  2Z6D A;  5EUA A;  2A3U A;  2IA2 A;  3VE4 A;  4BJP A;  1JTD A;  3G4P A;  2L4R A;  1CI9 A;  2EX6 A;  1IKG A;  4IED A;  4WMC D;  2RCX A;  3KSH A;  4GKU A;  1L0F A;  2XQZ A;  1YLP A;  2JKF A;  2V9A A;  3DBA A;  5IHV A;  3ITB A;  2ZC5 B;  4EBN A;  4OLG A;  4EEU A;  1N9N A;  1TS6 A;  2Y2N A;  4U0T A;  4P6B A;  5CED A;  4WBG A;  4L0L A;  1NLY A;  5CHU A;  1ERO A;  3BM6 A;  4DXC A;  3F1O A;  4JLF A;  1ZTU A;  1FCN A;  4LRY C;  4UA9 A;  4FUW A;  4IBX A;  4RX3 A;  1L0D A;  3A3F A;  4CJN A;  5KZH A;  1XXM A;  1F9I A;  1H8Z A;  1Y4O A;  2HGV A;  1DRM A;  2PR5 A;  2GJ3 A;  3NOP C;  5HX9 A;  2IWD A;  4PAU A;  3HRE A;  3FYZ A;  1N9O A;  4OOL A;  5FI2 A;  3BEB A;  5TFQ A;  3QP8 A;  2ZJ9 A;  4I5S A;  4U0X A;  2JKG A;  4ZJ3 A;  5A90 A;  4G3K A;  1TF1 A;  2BTF P;  1KGG A;  4RQ9 A;  3MMH A;  1OME A;  4LV3 A;  4KZB A;  3VE3 A;  4BL2 A;  1K4F A;  1L0G A;  1VB6 A;  5E2E A;  1VEU B;  2PBY A;  4I38 A;  3RXW A;  2ZL1 B;  4EQI A;  4XT2 A;  4R38 A;  3IT9 A;  3AGD A;  4F3L B;  2HP5 A;  4S2N C;  4FSF A;  2ZQA A;  5HAR A;  4OLD A;  4Y3I A;  2CC1 A;  1T1B A;  3ICY A;  1S1Y A;  2Y2G A;  2O9A A;  5A92 A;  1M40 A;  5HSQ A;  1K6R A;  3Q7Z A;  5FQK A;  5DF8 A;  3S7Q A;  1GHP A;  2ZM0 A;  4PKY A;  2WGI A;  4HES A;  5AVE A;  1NZU A;  2L0W A;  3H7W B;  3VOY A;  3C4O A;  4Y7P A;  5J3W A;  2Y2J A;  4DE1 A;  2OAP 1;  2O99 A;  3W4Q A;  2JKR I;  3A3I A;  2LB9 A;  2WGV A;  5FDH A;  3NJA A;  1G5U A;  1TS7 A;  2YKH A;  3QP5 A;  4GDN A;  3H82 A;  4ZBE A;  2OLV A;  3PR6 A;  1IYS A;  2ZC6 B;  2ACG A;  4OQH A;  3CAX A;  1FSW A;  3UE1 A;  2ZOI A;  1G6A A;  1ES4 A;  2WGW B;  5AQ9 A;  4PM9 A;  2V1B A;  2A2L A;  1IKI A;  1NWZ A;  1KVL A;  1LLB A;  3NY4 A;  2J7V A;  4X56 A;  4F94 A;  4ARZ B;  2A24 A;  3LR0 A;  4R4S A;  5AVF A;  1IEM A;  2HJ9 C;  4BD0 A;  3MKE A;  4DJ3 A;  2PD7 A;  2EWW A;  4OQI A;  4MBF A;  2G2U A;  4CPK A;  1V9Z A;  3LEQ A;  4WN5 A;  1MWU A;  5EFW A;  2FFF B;  3WWX A;  4WEL A;  3O3V A;  3E4Q A;  2XEP A;  5DVA A;  3DWK A;  1DJC A;  1LL9 A;  3QP6 A;  1I2S A;  5FAO A;  3IXD A;  1MKI A;  4PHT A;  1DP6 A;  2P74 A;  4EW7 A;  1PZP A;  1IYQ A;  4P6Z M;  2Y55 A;  3ZCZ A;  1LSW A;  5U47 A;  4MBH A;  3VP2 A;  4OH0 A;  4L9E A;  4IHQ A;  4BBU A;  2ZMA A;  1L3L A;  5JYP A;  4YIN A;  4NXG A;  3T12 B;  1ONG A;  5F5Y A;  5FQQ A;  4S2N A;  3LID A;  3B42 A;  4Y5F A;  5CEB A;  1LSX A;  3NOT C;  3N8S A;  3UDF A;  2NUT C;  1DY6 A;  1LSV A;  5HAI A;  3F1P A;  4CLC B;  2C5W B;  1V9Y A;  3G34 A;  1S66 L;  1W63 Q;  2OLU A;  5HDC A;  3T4J A;  2Q9M A;  1NRJ A;  3V39 A;  2WYX A;  1MWR A;  4HEF A;  3S4X A;  4YOF A;  2XH9 A;  4GLQ A;  3ZG7 B;  4DKI A;  4BBT A;  1PYY A;  4QY6 A;  3LR3 A;  1JWP A;  4KG2 A;  5FAP A;  3HVF A;  3S7N A;  2WKQ A;  1J3W A;  4O7D A;  3D72 A;  5HL6 A;  3EEH A;  4KZ5 A;  5FQJ A;  2V8F A;  1QMF A;  5CGW A;  3EQV A;  5FQ9 A;  1JWV A;  3D4F A;  1S1Z A;  3I7J A;  3QHY A;  4QD4 A;  4JGO A;  2EA9 A;  4GD6 A;  1ODV A;  5GLB A;  1WYC A;  2K7S A;  1KDW A;  4K08 A;  3PXP A;  3DWZ A;  5HD3 A;  4RX2 A;  2QZ6 A;  2XSS A;  3FPW A;  2PRF A;  3CJM A;  4HH2 A;  2XLN A;  5EVI D;  4JKT A;  1WYB A;  5FSR A;  1AXB A;  4EER A;  5CXW A;  4F3L A;  3U2A A;  2VGL S;  3CI6 A;  4JF4 A;  1QME A;  2XA7 S;  3NIA A;  4O0P A;  4MDZ A;  3HLD A;  4E04 A;  2B02 A;  2O9B A;  2CMN A;  4WUJ A;  3R4K A;  2W1T B;  2ZQ9 A;  3ZQ5 A;  2G2W A;  5D3O A;  4OON A;  1IFQ A;  2JCH A;  3H7W A;  2VX8 A;  1OTE A;  3OZH A;  2VV6 A;  1JWZ A;  1I5Q A;  3SH9 A;  2FZ0 A;  3SS3 A;  3UMD A;  5EPH A;  3QNB A;  3N8L A;  3DTI A;  5F6A A;  2HP9 A;  4DN0 A;  1L0E A;  2WAF A;  1H8M A;  1XA7 A;  2HDQ A;  3B3X A;  4QJG A;  4Y0U A;  3IQA A;  1EWZ A;  1K55 C;  1YSQ A;  4P85 A;  4EET B;  2FFY A;  2WGW A;  4DDY A;  1BZA A;  4KUO A;  1J9M A;  2L1M A;  2B18 A;  5E43 A;  4MN5 A;  4DF6 A;  2C6W B;  1KDS A;  3KYE A;  3E98 A;  2AVX A;  2W3E A;  3A3J A;  3MR0 A;  4XT2 B;  5M1A A;  5HW3 A;  5EV0 A;  3GDI A;  3UME A;  4OP8 A;  5EVL A;  3E4O A;  1E25 A;  3TSG A;  4JBF A;  3O5Y A;  3RH8 B;  3VOL A;  4WLA A;  3N8R A;  5HD5 A;  1OJG A;  2QHK A;  2PR6 A;  4BD1 A;  3JPU A;  3UPP A;  5FEG A;  3MZD A;  1HTZ A;  2DRW A;  1ACF A;  3OPR A;  4S2J A;  4JXV A;  5I5L A;  2VA0 A;  2ZC3 B;  3M2K A;  3LI9 A;  2QJ5 A;  1YLZ A;  2O9C A;  4QY5 A;  2W3F A;  5L10 A;  5IT5 A;  3LO7 A;  2A49 A;  3ZHH A;  1H5X A;  2KDK A;  2OV5 A;  4X69 A;  3H82 B;  3OCN A;  4WYY A;  1K56 A;  2UV0 E;  4GJ4 A;  1W63 M;  2LB5 A;  3EGX C;  5F1G A;  4JGP A;  3PTE A;  1FIL A;  1GA0 A;  5EEC A;  4Z9Q A;  2Q9N A;  4Y0O A;  3BLS A;  4PM5 A;  4P0M A;  3D9Y A;  1KGE A;  3UO9 A;  2A24 B;  2JC7 A;  5CEC A;  1A0K A;  4L9G A;  4R6L A;  3LEZ A;  4IUH A;  2E8J A;  3MQQ A;  1EW0 A;  1PZO A;  4NG2 A;  1PFL A;  4II7 A;  3P01 A;  4JGQ A;  4K0W A;  2M1C A;  3ZG8 B;  5E2H A;  5HAP A;  1SDN A;  3FPV A;  2DMW A;  3FZC A;  1K55 A;  3LIF A;  1VET A;  4OOY A;  2VLG A;  4DE2 A;  3JVV A;  3T4Q A;  1ES3 A;  3GEC A;  3GR2 A;  3A0V A;  3IXB A;  3UB6 A;  3TOI A;  3WS2 A;  3W4P A;  2EX2 A;  1PWC A;  1YMS A;  1TEM A;  1Z09 A;  4E3N A;  4NXE A;  1E3U D;  3IBJ A;  3FWL A;  4S2O A;  3PAE A;  3M6B A;  3G6O A;  5KIZ A;  4DE3 A;  5EM1 A;  2GDN A;  2W0N A;  4LEN A;  3F1P B;  4MEZ A;  3C7V A;  2J3T D;  1YQS A;  3FC7 A;  5DF7 A;  5FL3 A;  4PKY G;  2INW A;  2VKS A;  4I3J A;  1OTI A;  2VGL M;  1OTD A;  3U4L P;  1TDL A;  2XA7 M;  4DJ2 A;  1XKZ A;  4MLL A;  2XD5 A;  1BUL A;  4Q0H A;  4OKP A;  2W1T A;  1XFN A;  4G3W A;  5FAT A;  3RTY A;  1PW1 A;  1W5D A;  3DW0 A;  4X68 A;  2PU2 A;  1VM1 A;  1ZG4 A;  1HD8 A;  3KYQ A;  1MWS A;  3MXS A;  1YT4 A;  3BFF A;  5HL1 A;  4OPR A;  3IF6 C;  4Q0J A;  4MMN A;  2KOI A;  2GNX A;  4LRZ E;  3ZDJ A;  4P87 A;  1OTA A;  1ESI A;  2EXB A;  1XJ4 A;  4UAA A;  5M18 A;  2M7V A;  1BLC A;  4D60 A;  2E8I A;  4ZAM A;  1PIO A;  3IXH A;  1T1C A;  1L2S A;  4GCZ A;  2J9O A;  3DTM A;  2J9P A;  3MZF A;  2PYP A;  1CI8 A;  1ZG6 A;  4KQD A;  4JXG A;  1XP4 A;  2P7J A;  3KO6 A;  5FI6 A;  3MZE A;  2VK3 A;  1ONH A;  1OPX A;  3IXG A;  3KSI A;  2JE5 A;  3JVU A;  3G30 A;  2ZQ7 A;  2V0U A;  2QWS A;  4R70 A;  1MY8 A;  3SH7 A;  1MXO A;  2HPB A;  3FG8 A;  3WRT A;  2WZZ A;  2WKR A;  5LBR A;  4Y15 A;  1SCW A;  3UY6 A;  4FD8 A;  5DTS A;  3K2N A;  1BT5 A;  1TD5 A;  1P97 A;  4KZ6 A;  3Q82 A;  2R78 A;  4LV0 A;  4YWZ A;  1GHM A;  3VP3 A;  1Y28 A;  3LIE A;  3VP0 A;  2B95 A;  4HBU A;  5J4E A;  1NJ4 A;  3CHW P;  3NHQ A;  2VGK A;  3LGO A;  2QJ7 A;  3LR5 A;  3T4O A;  4LLO B;  3IF5 A;  5MC7 A;  3EWK A;  1K4E A;  4OPY A;  4NKP A;  4EV4 A;  2WZX A;  1U60 A;  3IH9 A;  1FSY A;  3PBN A;  4S2K A;  4H8R A;  4RVA A;  3UNW A;  3VFH A;  5F83 A;  2X02 A;  2VEA A;  5FEF A;  4MN7 A;  4NK3 A;  1Y54 A;  3DTK A;  4KQQ A;  3GTC A;  3A0S A;  3G31 A;  3NEC A;  3EQU A;  3IBR A;  2OOL A;  4WF0 A;  5F1F A;  1XGI A;  4R4R A;  1G28 A;  3UB5 P;  4OPZ A;  4FOF A;  3IF6 A;  1YLT A;  2RL3 A;  3WS5 A;  2HZ5 A;  1S6R A;  4KEN B;  2BAS A;  1K57 C;  3BRM A;  2Y79 A;  4WMC A;  3BY8 A;  4FCF A;  1W79 A;  2W3G A;  3WRZ A;  3LUQ A;  4OQ0 A;  1K25 A;  3UE3 A;  2QMI A;  3ZVT A;  3CLO A;  3KSG A;  5AJG A;  5A91 A;  2Z6C A;  1D06 A;  2WKH A;  3S7O A;  1N4O A;  4E6X A;  2ZOH A;  5HWW A;  3V67 A;  4IVI A;  2VV8 A;  3HLC A;  5GHZ A;  4HHD A;  2Y91 A;  1BLS A;  2EFX A;  2EXA A;  3P98 A;  3JYI A;  4YFM A;  4B93 A;  4LPZ A;  4FTX A;  3B47 A;  4GDB A;  3ZG5 A;  1ERQ A;  4UHU A;  4X25 A;  3C30 A;  4ETX A;  2ZMV A;  1K6S A;  3C38 A;  4EBP A;  5F68 A;  2Y4A A;  4CLC E;  5J8X A;  3LR4 A;  2Q0O A;  2WUQ A;  3H9W A;  2G7U A;  3OC2 A;  4JPM A;  1BLP A;  1CEG A;  2JKR M;  1NYY A;  2XK1 A;  3NCK A;  3NUL A;  4QPR A;  1YLY A;  3AGF A;  2ZM8 A;  2KLI A;  2H5S A;  3LI8 A;  4RYE A;  3F1N A;  1X0O A;  2NUP C;  5KSC A;  3QP4 A;  3BJN A;  2V0W A;  2HDR A;  3B33 A;  2V8C A;  3MF0 A;  5FAS A;  5K5B A;  3Q1F A;  4XUX A;  4OP5 A;  3E2K A;  1VET B;  3M2J A;  3MJQ A;  4U3T A;  4R3A A;  2BLS A;  1RCJ A;  3MXQ A;  4Q0I A;  3VSL A;  4X1M A;  2D02 A;  2PYR A;  1ES5 A;  1S0W A;  1GSX A;  1D1J A;  4HP9 A;  3T1S A;  2J8Y A;  1D7E A;  3V5M A;  4PM7 A;  4GNU A;  1K57 A;  2DNS A;  2VGJ A;  1SDE A;  4ZRR A;  2HP6 A;  4I39 A;  5IU1 A;  4CLC D;  4HH3 A;  3UN7 A;  5KSH A;  3CMZ A;  3NI9 A;  4S2M A;  2VV7 A;  3MXR A;  1JVJ A;  1NY0 A;  1ES2 A;  3TW8 A;  1PRQ A;  4Y13 A;  1T19 A;  1FOF A;  4HJ6 A;  3G32 A;  4R0Q A;  3NDE A;  2W3D A;  3MFX A;  3UB8 A;  1KVM A;  3SOI A;  5DJT A;  1AWI A;  1ERM A;  2VZW A;  1SKF A;  3Q07 A;  4B4X A;  4BLM A;  3AGE A;  4QWO A;  3OPP A;  1MKM A;  2BG1 A;  2ZMF A;  3MQO A;  3LIA A;  3BW6 A;  3T4L A;  2JKT I;  2WKE A;  5E2F A;  4C6Y A;  2ZQ8 A;  5M19 A;  4DMZ A;  3UB7 A;  4EUZ A;  5EVI C;  1BUE A;  4EEP A;  3S1Y A;  4QU3 A;  3V3S A;  4KG5 A;  1OTB A;  2HF6 A;  3CWF A;  1S4R A;  2Z2L B;  2IWB A;  1FCM A;  4HI4 A;  3HJK A;  4HP4 A;  1XFQ A;  4HJ3 A;  4LCM A;  4GZB A;  4GOG A;  3OPL A;  1SKO A;  3QP1 A;  2FH5 A;  1Z6F A;  5G18 A;  4ID4 A;  5L09 A;  1K0K A;  4UQI S;  3EOI A;  1T1A A;  3HLE A;  4O8G A;  1GA9 A;  1H0M A;  5CGX A;  3O86 A;  4UA7 A;  1OJ5 A;  4LCL A;  3S22 A;  3R7W A;  2X71 A;  3IWO A;  5GLC A;  3ZG0 A;  3BQ8 A;  2HDS A;  1YM1 A;  4Y0T A;  4HY8 A;  4JXW A;  1IYO A;  4BQM A;  4WL9 A;  5CRF A;  3G2Z A;  4GW9 A;  5CTM A;  3PBO A;  1RP5 A;  2Z2M B;  1HVB A;  3RFB A;  3TJZ C;  4K0X A;  4N1H A;  2PD8 A;  4LV2 A;  1YKD A;  5AQA A;  4NEE D;  3W2Z A;  3TRC A;  4ZDX A;  2Y2I A;  2EX9 A;  3OCL A;  4E3K A;  4QB8 A;  3MS6 A;  4IUK A;  4DE0 A;  2W27 A;  3A3D A;  4BL3 A;  1IEL A;  3RJU A;  4DRT A;  1LHY A;  1YLW A;  1G68 A;  2P9V B;  2XF3 A;  2PAV P;  2KX6 A;  3O87 A;  4GS9 A;  1CF0 A;  4UA6 A;  2V1A A;  4GN2 A;  3IF6 B;  1H8Y A;  3C7U A;  3C8C A;  5EVI A;  3G2Y A;  4WZ5 C;  2R9W A;  3TE8 A;  2GZA A;  2Y2P A;  4KG6 A;  4MNR A;  4HJ4 A;  4S2L A;  1LI9 A;  1TDG A;  2Y2H A;  3FV7 A;  5CHJ A;  3L7H A;  4NET A;  3N7W A;  3NOU C;  3V3R A;  3OPH A;  1F98 A;  3HLG A;  2VJW A;  1F2K A;  1PW8 A;  3HL9 A;  4KQO A;  1GHI A;  2X01 A;  1FR6 A;  3ZGA B;  3HUN A;  5GHX A;  5L07 A;  4HOI A;  3HLB A;  3IH8 A;  3BEC A;  4E3L A;  3SZT A;  3MFD A;  1N9B A;  3KX0 X;  5BOH A;  1E4D A;  3IX8 A;  2Y2K A;  2Y59 A;  4WZ4 A;  1KE3 A;  1FCO A;  1DJB A;  2XFS A;  2YKF A;  4E3O A;  2M7U A;  3ITA A;  2H10 A;  5TBM B;  3E0Y A;  2XGN A;  1TS8 A;  4JF6 A;  3DAV A;  4N1X A;  3LFV A;  5HFO A;  1ZHH B;  3NBL A;  3CIT A;  1CQA A;  3E2L A;  5A8B A;  4HIA A;  1BYW A;  2O0Y A;  4PM8 A;  3LYX A;  2JHE A;  3F1N B;  4E3J A;  4DXB A;  3CPT B;  3HLF A;  4LV1 A;  3T4S A;  1DP9 A;  1W7F A;  1I2W A;  4HNB A;  1KOU A;  5IS1 A;  3L9K A;  5HPF A;  4X55 A;  5G4Y A;  2DCF A;  2W3H A;  2V2F F;  2V1Z A;  4PM6 A;  2MJ6 A;  4X6T A;  2J3T C;  5DF9 A;  5FQM A;  4E6W A;  3P09 A;  5FQI A;  1GCE A;  2WKI A;  2ZM2 A;  4R3J A;  4N9K A;  2H0Y A;  4WZ5 A;  1SZV A;  3GQZ A;  1SHV A;  1XGJ A;  1UWN X;  4C3Q A;  3Q7V A;  1P9R A;  3MBZ A;  3LIC A;  1LI0 A;  2HJE A;  1PNE A;  1FQG A;  5EOE A;  4UQI M;  1NZO A;  3SS4 A;  1WA9 A;  2OSU A;  1XA1 A;  2QPN A;  2XRO A;  5DFX A;  1LT0 A;  1GSV A;  5EVE A;  4MBK A;  1XJ2 A;  2WKP A;  2R9X A;  1GSW A;  1Q2Q A;  3QNC A;  3ZFZ A;  5A93 A;  1O7E A;  4I3I A;  5EOO A;  5TJJ A;  4H6J A;  3BFC A;  3CUE C;  1NRF A;  3C4P A;  2K2N A;  4Q8I A;  3KSF A;  3HUM A;  4K91 A;  4IVK A;  3BLM A;  3PHY A;  4ZTK A;  4E3I A;  3VV4 A;  3D3O A;  3NDG A;  3DTE A;  2W1R A;  4JF5 A;  1XX2 A;  1XPB A;  3OBF A;  1LL5 A;  4LFU A;  4AFI A;  1YAX A;  1F5M A;  3ZNY A;  4XXR A;  1RGY A;  5L2F A;  1YPR A;  1Q2P A;  1SKO B;  2P9V A;  5HWT A;  2OAQ 1;  1ALQ A;  4ZJ1 A;  1S4S A; 
#chains in the Genus database with same CATH homology
 2QHK A;  2OWJ A;  3KSH A;  2D02 A;  2PYR A;  2PR6 A;  1GSX A;  4HP9 A;  2V9A A;  3DBA A;  1D7E A;  3PBQ A;  4GHI A;  3IS2 A;  4EEU A;  1N9N A;  1TS6 A;  4ZRR A;  5I5L A;  2VA0 A;  4I39 A;  5IU1 A;  3LI9 A;  4L0L A;  4CLC D;  1NLY A;  4HH3 A;  3BWL A;  2QJ5 A;  2O9C A;  3R7W B;  2W3F A;  5KSH A;  5IT5 A;  4NXF A;  2VV7 A;  3TW8 A;  2KDK A;  1T19 A;  3T4K A;  4EUV A;  3F1O A;  4HJ6 A;  1ZTU A;  3H82 B;  5HPI A;  4LRY C;  2W3D A;  3OCN A;  3MFX A;  3A0R A;  3UB8 A;  4GJ4 A;  1W63 M;  2XRN A;  2LB5 A;  2P04 A;  3EGX C;  3EGD C;  5HDD A;  4JGP A;  4Z1W A;  1F9I A;  2HGV A;  5DJT A;  1DRM A;  2PR5 A;  2VZW A;  2GJ3 A;  3NOP C;  4PAU A;  1N9O A;  4YNR A;  1MKM A;  2ZMF A;  4OOL A;  3MQO A;  3LIA A;  3BW6 A;  3T4L A;  2JKT I;  5J7E A;  2Y8H A;  2A24 B;  4I5S A;  1TS0 A;  4BWI A;  4G3K A;  1TF1 A;  4DMZ A;  4L9G A;  4RQ9 A;  4R6L A;  3UB7 A;  4IUH A;  3MMH A;  4EEP A;  3VE3 A;  3MQQ A;  1EW0 A;  4CQH A;  3HCY A;  5TBM A;  4I3A A;  1OTB A;  4II7 A;  1VB6 A;  3P01 A;  4JGQ A;  2M1C A;  2HF6 A;  3CWF A;  4Y2F A;  1S4R A;  2JN7 A;  4I38 A;  4HI4 A;  4GS9 B;  3FPV A;  4XT2 A;  1STZ A;  2DMW A;  4R38 A;  3CUE A;  1YSP A;  3HJK A;  3LIF A;  4F3L B;  4HP4 A;  1XFQ A;  4FSF A;  4HJ3 A;  1S67 L;  5CX7 A;  3ULF A;  4Y3I A;  2VLG A;  1T1B A;  5L8M A;  3ICY A;  1S1Y A;  2FH5 A;  2O9A A;  1NLZ A;  3JVV A;  3T4Q A;  3GEC A;  5HSQ A;  3A0V A;  2HV1 A;  3UB6 A;  4BBV A;  3S7Q A;  2I9V A;  1P9W A;  4UQI S;  3EOI A;  4PKY A;  4EQ1 A;  1T1A A;  5AVE A;  4NXE A;  2L0W A;  3H7W B;  4O8G A;  3IBJ A;  5J3W A;  3G6O A;  4OOM A;  5KIZ A;  2OAP 1;  5HWV A;  2O99 A;  2JKR I;  2W0N A;  1OJ5 A;  3PYP A;  3F1P B;  5C5K A;  2LB9 A;  3R7W A;  3NJA A;  2J3T D;  5DFY A;  3FC7 A;  5FL3 A;  4PKY G;  1TS7 A;  1P0Z A;  2YKH A;  3K3D A;  2INW A;  3BQ8 A;  2VKS A;  4I3J A;  3H82 A;  1OT9 A;  3PR6 A;  4HY8 A;  1OTI A;  2VGL M;  4WL9 A;  3CAX A;  5F69 A;  4GW9 A;  2ZOI A;  3PBO A;  1OTD A;  2XA7 M;  4IJG A;  4DJ2 A;  3RFB A;  3C2W A;  3TJZ C;  2V1B A;  2A2L A;  2PD8 A;  4Q0H A;  1NWZ A;  4ETZ A;  1YKD A;  2W1T A;  1XFN A;  4G3W A;  3RTY A;  4NEE D;  1VHM A;  3W2Z A;  2H28 A;  3TRC A;  4ARZ B;  2A24 A;  3KYQ A;  3LR0 A;  3OCL A;  4Q0J A;  5AVF A;  4MMN A;  2KOI A;  2GNX A;  2HJ9 C;  4IUK A;  2W27 A;  4BMW A;  4LRZ E;  3UB9 A;  4DJ3 A;  1OTA A;  2PD7 A;  3PBT A;  4MN6 A;  2EWW A;  4EXO A;  1XJ4 A;  3K3C A;  1V9Z A;  2M7V A;  3UE6 A;  4WN5 A;  5EFW A;  4B9O A;  3T50 A;  4WEL A;  3SW1 A;  2KX6 A;  3E4Q A;  4GS9 A;  1T1C A;  4WEK A;  3BQA A;  2V1A A;  4GCZ A;  3P7N A;  3C8C A;  5HZH A;  4PHT A;  1DP6 A;  4EW7 A;  1G6O A;  4P6Z M;  3TE8 A;  1UGU A;  2GZA A;  2PYP A;  1LSW A;  4KQD A;  4HJ4 A;  2P7J A;  3KO6 A;  4L9E A;  4CLC C;  4EU0 A;  4IHQ A;  4BBU A;  1LL8 A;  1OPX A;  3NOU C;  3KSI A;  3KYZ A;  4NXG A;  3JVU A;  1F98 A;  2V0U A;  5F5Y A;  2QWS A;  4LRX C;  5G4Z A;  4R70 A;  2VJW A;  3LID A;  3FG8 A;  3F1O B;  3B42 A;  2WKR A;  4Y5F A;  1OT6 A;  1LSX A;  4KQO A;  3NOT C;  5LBR A;  4G3V A;  2NUT C;  1LSV A;  3K2N A;  3F1P A;  4CLC B;  4HOI A;  1V9Y A;  1S66 L;  1TD5 A;  1P97 A;  1XJ6 A;  1W63 Q;  2J3W A;  4ME4 A;  5HDC A;  2R78 A;  4YWZ A;  3T4J A;  1NRJ A;  1Y28 A;  4O01 A;  3LIE A;  1T18 A;  3T4T A;  3KX0 X;  5J4E A;  3LIB A;  3EEA A;  3NHQ A;  4YOF A;  3BY9 A;  2QYB A;  2PHY A;  2QJ7 A;  3LR5 A;  3T4O A;  1DP8 A;  4LLO B;  4GLQ A;  5MC7 A;  4BBT A;  3HJI A;  3EWK A;  3LR3 A;  4NKP A;  2YKF A;  2M7U A;  4KUK A;  3S7N A;  5TBM B;  3E0Y A;  2WKQ A;  2ZBB A;  3PBN A;  2GX5 A;  4ARZ A;  1TS8 A;  3D72 A;  5HL6 A;  3EEH A;  2VEA A;  2J80 A;  4H6J B;  3LFV A;  1ZHH B;  3EQV A;  4MN7 A;  3CIT A;  5A8B A;  3S7P A;  1BYW A;  3OOV A;  4HIA A;  1N9L A;  1H3Q A;  1S1Z A;  2O0Y A;  3A0S A;  3LYX A;  3E4P A;  2JHE A;  3EQU A;  3F1N B;  3IBR A;  2OOL A;  4JGO A;  4WF0 A;  2EA9 A;  1ODV A;  3PBS A;  4L9F A;  1DP9 A;  1G28 A;  3T4S A;  4FOF A;  4HNB A;  1KOU A;  5IS1 A;  2K7S A;  5HPF A;  4K08 A;  5G4Y A;  2W3H A;  3PXP A;  5HD3 A;  2K31 A;  2XSS A;  4UEY A;  2BAS A;  3FPW A;  2P08 A;  4M4X A;  4HH2 A;  2MJ6 A;  2Y79 A;  2QKP A;  2J3T C;  3BY8 A;  1MC0 A;  5HDS A;  5DF9 A;  2W3G A;  3LUQ A;  2JKT M;  4EER A;  3UE3 A;  3PBR A;  1IOU A;  4F3L A;  3U2A A;  3CLO A;  2VGL S;  3CI6 A;  4HQA A;  3KSG A;  5AJG A;  2Z6C A;  4GHI B;  3IS2 B;  1UWN X;  2XA7 S;  4O0P A;  5DKK A;  4CLC A;  4MDZ A;  1D06 A;  1XJ3 A;  4EES A;  1P9R A;  3S7O A;  4E04 A;  2B02 A;  2O9B A;  2ZOH A;  5HWW A;  3LIC A;  3V67 A;  2CMN A;  4WUJ A;  2VV8 A;  3R4K A;  2W1T B;  2HJE A;  3ZQ5 A;  3MQ0 A;  4HHD A;  4UQI M;  1IFQ A;  3H7W A;  2VX8 A;  4B93 A;  1WA9 A;  1OTE A;  2D01 A;  4LPZ A;  2VV6 A;  3B47 A;  4MCW A;  2OWH A;  2XRO A;  5DFX A;  1LT0 A;  1GSV A;  2FZ0 A;  2EWV A;  3C30 A;  4ETX A;  2ZMV A;  1XJ2 A;  3C38 A;  3UMD A;  5F68 A;  4JGR A;  4CLC E;  2WKP A;  5F6A A;  1GSW A;  3ZYT A;  3LR4 A;  4DN0 A;  3H9W A;  5DJU A;  2G7U A;  3OC2 A;  1UWP X;  4I3I A;  4NXB A;  1H8M A;  5TJJ A;  2PT7 A;  4H6J A;  2JKR M;  4QPR A;  1MZU A;  3CUE C;  4P6Z S;  2K2N A;  2PDR A;  1JNU A;  1YSQ A;  2KLI A;  4EET B;  5DKL A;  3KSF A;  3LI8 A;  4WEJ A;  3F1N A;  1X0O A;  4KUO A;  2L1M A;  2B18 A;  2NUP C;  4MN5 A;  3OLO A;  3PHY A;  3BJN A;  3VV4 A;  3E98 A;  3D3O A;  2W3E A;  3MR0 A;  2W1R A;  2V0W A;  4XT2 B;  3B33 A;  2Z6D A;  3MF0 A;  5K5B A;  2IA2 A;  3VE4 A;  3OBF A;  4BJP A;  2L4R A;  4AFI A;  3GDI A;  3MJQ A;  3UME A;  1YAX A;  1F5M A;  3E4O A;  4R3A A;  3MXQ A;  3O5Y A;  5HWT A;  3RH8 B;  2OAQ 1;  3VOL A;  4WLA A;  5HD5 A;  1OJG A;  4Q0I A;  1S4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...