3D7NA

The crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
183
structure length
157
Chain Sequence
SSNTVVVYHSGYGHTHRMAEAVAEGAEATLHAIDAEGNLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPWFSAKWQDKVFGGFTNSASLNGDKLNTLQYLVLLAGQHGGLWVSLGYIAPMAQSEMSVGDLETARLYGARVANVARQHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the flavodoxin, WrbA-like protein from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Electron transport
molecule keywords Flavodoxin, WrbA-like protein
total genus 59
structure length 157
sequence length 183
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d7nA00
3KAPA 1RLIA 4C0XA 1OFVA 1B1CA 2GSWA 2QX6A 1D4AA 4HS4A 3GFRA 5A4KA 3K1YA 3ESYA 3OWXA 4HEQA 1XI2A 4PU0A 4ICIA 1JA0A 2D5IA 2V5UA 4ESEA 1XT6A 2KLBA 3TZBA 4FGKA 3O73A 1J9ZA 3R6WA 1RTTA 4FGJA 2ARKA 3OJXA 4R81A 4S24A 1CZLA 3F2VA 5FX2A 4D02A 2F1OA 2Z9DA 2Z9BA 3B6MA 4Y7CA 2R97A 2WC1A 3EYWA 1CZNA 2Q62A 3GFQA 1BVYF 2BMVA 1ZX1A 1F4PA 2FCRA 3OX3A 1AHNA 2B3DA 3D7NA 3FVWA 5F4BA 1AKQA 1YOBA 3ES9A 1J8QA 3F6SA 2QWXA 1FLAA 3W7AA 4PTYA 3OX1A 2Z9CA 3P0RA 1FX1A 3SVLA 3HR4A 3B6JA 3JSXA 3NHJA 3HA2A 3OWHA 2R96A 5JROA 3L9WA 1FLNA 1FTGA 2V9CA 2W5UA 3FJOA 3TE7A 1E5DA 4YAUA 2X2PA 3F6RA 4ZVLA 3KLBA 1C7FA 3OJWA 4C14A 4QOIA 1NNI1 1X77A 1I1OA 1T5BA 1FLVA 3NHUA 4GR9A 3NHKA 1BU5A 1QRDA 2QMYA 3HLYA 1TIKA 3W79A 1OBVA 3FW1A 4U7GA 4BMOB 1WSWA 2XOEA 1ZWLA 3GAMA 1SQSA 3OVMA 5B3LA 4CETA 4QODA 1H69A 4LTMA 2BN4A 5LBUA 5LJIA 4XDHA 1AKVA 2XODA 1DXOA 1GG5A 1KBQA 3N39C 3B6KA 5TGZA 2Z98A 4C76A 4FGLA 1FUEA 1AKTA 2QX4A 5EAIA 1T0IA 2FLVA 4QOHA 3NLLA 1CZUA 2FVXA 2MOKA 3L9XA 4PTZA 1WSBA 2OHIA 2FOXA 4H2DA 2AMJA 1FVXA 2QX8A 3QE2A 4QOGA 4YAFA 5NLLA 3W78A 4C0WA 4YAOA 4LA4A 2HPVA 1AKWA 1J9GA 1YKGA 1YCFA 2QX9A 3NHSA 1QHEA 2FZ5A 4NULA 3NHLA 4GQIA 2MTBA 1VMEA 4DIKA 3B6IA 1SG0A 4ZVKA 4XDGA 4CF6A 3EDOA 1QR2A 3G5MA 3KEGA 3FNIA 3NHPA 4OXXA 4U7HA 3S2YA 4H6PA 3LT5A 3UXEA 3O2NA 4GI5A 5EA2A 3N3BC 1V4BA 3GFSA 1XYVA 5ULLA 2QR2A 3NHWA 2OHJA 1TLLA 3W77A 1D03A 1FLDA 1XYYA 1CZRA 1YRHA 2OHHA 3ESXA 3UXHA 1D04A 5LLDA 1OBOA 4ZVNA 3U7RA 2BF4A 2ZKIA 1JA1A 2QMZA 4LTDA 5LBTA 3NHRA 3TEMA 3U7IA 4Y9UA 1AMOA 4N82A 1RCFA 1ZWKA 4F8YA 2MWMA 4DY4A 1DXQA 1QBGA 4LAFA 3KAQA 2FZVA 4NLLA 3RPEA 4DILA 2A5LA 5NULA 1AKUA 2RG1A 3NHFA 1AG9A 3QFCA 4N9QA 3OX2A 4QOFA 5BUCA 1CZKA 1KBOA 4YAWA 2X2OA 1RLJA 1CZOA 5FA6A 3ESZA 4QOJA 1H66A 3NHYA 4J8PA 2KQUA 2M6SA 2BPOA 5B3KA 5EMNA 4ZVMA 3FX2A 5F12A 4LTNA 5LVAA 3NFRA 4N65A 1YDGA 2FX2A 1YCHA 2BZSA 2OYSA 4U7FA 6NULA 1AKRA 3QFRA 3K20A 1J9EA 2FAXA 1DX9A 2V5VA 3N3AC 1YCGA 2MT9A 5LMCA 4YQEA 5F51A 1CZHA 2HNBA 2Q9UA 5LJLA 2HNAA 2M6RA 2N1MA 2FDXA 3F90A 4M0CA 4QOEA 1AZLA 4YALA 4BMPB 3LCMA 4Y9RA 5FUQA 4FX2A 1C7EA 3ZHOA
chains in the Genus database with same CATH superfamily
1OV4A 1QAOA 3CRMA 4BQEA 1M74A 2YRXA 3D5QA 1U9IA 4KK3A 3CHYA 2OV6A 2Y1CA 4BNYA 1KWGA 4IY1A 1GKIA 2HRDA 4MUJA 1SIUA 1TKRA 1Z5OA 2A0KA 2W6IA 4C08A 2IGTA 1EFHA 5GP1A 1VJRA 2ZAMA 2HK6A 3A14A 2GK7A 3N0XA 5H02A 3WLLA 4I50A 4ITRC 1TJYA 4PW0A 5GIOE 4N12A 1PTJC 1EVIA 1USVA 4J1TC 1ZZEA 1FUUA 1MO6A 4BN0A 1E9DA 5H4GA 4BFVA 2D3WA 2ES4A 3BWEA 1Q0HA 3M4NA 5BV1A 1VYVA 3D7NA 3ZDEA 1N0HA 4YDQA 1F8YA 2JKVA 4FNGA 3HCBA 3NONA 4NJMB 3OX1A 1EGMB 2IYYA 1O57A 3T5CA 4XX0B 2V0CA 3EGOA 5DKFA 2AT1A 1JAYA 3IEXA 4Q9JA 1FLNA 3RKSA 3OJEA 4Q18A 5ALSA 3KR1A 1AE1A 3QKRA 4OQPA 4D4JA 4LOKA 2EX4A 3AHHA 1LRKA 1CY6A 2VSOA 3HO6A 4L28A 5HDQA 5HUHA 2PZBA 4AKSA 2I6UA 1W581 1QIIA 4DTCA 1T4GA 1NM5A 4GOXA 1V1MB 2P75A 3LLCA 2J9XB 4M7PA 1PV2A 2YJTD 3BF8A 2AG6A 3DMYA 4TXJA 5K4HA 4DVGA 1TIBA 1X39A 3B9PA 4AF8A 4DJ5X 5BT9A 3LX8A 4B4VA 3GBPA 3HB7A 3UKOA 2NYAA 2EJUA 3II6X 1ULUA 4WKPA 4XQ9A 4ND1A 5K8JB 2FUCA 1WY7A 4IKPA 1X7YA 3TGPA 2DWQA 3U09A 3V9PA 4P31A 1ZVJA 3U61B 3TPFA 1Z5ZA 3BHIA 3CIFA 1HYQA 1CQXA 4JVMA 2XDAA 1X92A 4Z0HO 1Y42X 1EVLA 5ALOA 2GBLC 1E6WA 1WV1A 4XUCA 1E59A 4AZSA 3NC1C 5GQSA 3DO8A 2FQYA 1FS4A 3UWSA 1GZ4A 2Q4RA 4L5IA 3VDQA 1FC0A 1GLVA 1Z4OA 3NWJA 2ZJ3A 4N5MA 3UW3A 4AYWA 2C78A 2F6RA 2V97A 1NUQA 3R40A 4PLCA 1CJBA 1WMFA 3DB2A 4QPPA 4MRRA 3ZXXA 4BRWA 2FQ1A 2F3SA 4M1EA 4KODA 2Y8EA 4E08A 3HRHA 5BPHA 4ILEA 1GJRA 1KR2A 2Z08A 1CZRA 1IOZA 1UODA 2A5DA 3QX7A 5B6IA 1Q2XA 4TWJA 1BMFD 5DXJA 4B6OA 4JQOA 4D9IA 3IHLA 4N82A 1AQ6A 1Y9ZA 2CD7A 4QLAA 4QGHA 4RY9A 5JSHA 1ZIPA 3ONEA 2JDIA 3FFXA 2JGRA 2VN8A 3QA9A 4H7JA 4Q3NA 2QTRA 4UMVA 4FM9A 3QEAZ 3HVKA 3DE7X 4LGMA 1DEKA 5IJZA 3ENKA 3MJDA 1AK9A 1J6UA 2WSSA 3DOUA 4OAOA 3U7FB 1RLJA 3GFPA 1M34B 4MYDA 3B1WA 4X94A 1OLUA 2FJPA 3OOSA 2D2EA 5CDSA 5IKXA 2NUPA 4FN4A 4FYXA 1ECCA 1NWCA 3V6MA 3FFBA 3VYUB 4GOKA 4O4HF 5BT8A 1KVSA 3DJYA 3O8RA 5AOCA 4UBOA 3IEKA 1VHWA 3PQ5A 3RRYA 5E4TA 1XPRA 4JEHA 3RM3A 3N2GA 3HB4X 2AHRA 1ICIA 2C7RA 4ZT7A 1UOQA 2Q4OA 1N6PA 1Y3FE 5KTSA 4ZTUB 1RZRA 3P9XA 1R5BA 2QT1A 2YVUA 4OB7A 3WQQA 2O0HA 2J9RA 2W2KB 3D4OA 3A4VA 5HIAA 3DLBA 4MRSA 1DKUA 2ZYTX 4ZI7A 4AN0A 2O6LA 2B21A 3C15C 1J1IA 4DKXA 2ZSBA 3IPAA 3O1IC 6REQB 1YB5A 3RS8A 3V4FA 5JTUA 2Q5QA 5L40A 3IE1A 1UAGA 2AG5A 1SOWA 3ZZ1A 1ABFA 1QUFA 4L0DA 2XUOA 3ZWYA 5JSZA 5GVSA 4F5EA 1E7MA 3F3YA 4U7PB 5FBWB 5REQB 2ESRA 1ZSNA 1NF3A 2A78A 1IFXA 3A3OA 3DWFA 3JR7A 3LQQA 2BEWB 4RAQA 5ES4B 4ZYXA 2HHCA 4FW8A 1UUFA 1NW3A 1V8BA 1SZJG 2UVPA 3V2HA 4P0QB 1TAUA 1T8RA 1RADA 1SC9A 4Q9LA 4QA9A 3CMCO 4C5BA 5DCUA 5DYYA 5U4XA 5CT9A 3DVAA 2WMDA 5IYZF 2E5FA 2C8VA 1WS6A 1U8TA 3CGGA 4L8LA 4B8ZA 3NJRA 4K9MA 4CM1A 2K7ZA 4YCJA 4KAAA 5I9NA 2XQKA 1P2BA 2I66A 3ZHTA 4MV9A 3H5AA 2A0UA 1E3EA 1AU9A 3AUSA 3SC6A 1NJ5A 2F3TA 3KSUA 5JNRA 2J9ZB 2BMJA 3TF5A 2ZATA 3MLEA 4TMKA 5DI9A 3UFXA 1N6HA 1P0QA 3HVUA 3KD3A 3GQBB 3FIUA 4TS9A 3WGGA 2BUCA 4O8CA 3QLEA 2BI7A 4IVRA 5KQPA 1OGIA 4RHEA 3BC1A 5IVHA 4B73A 1GL9B 4PTZA 5KHAA 3VHXA 3DOIA 4G4IA 4P84A 3HA7A 4JH0A 3D3KA 1KYVA 1BMDA 2R7AA 3F1LA 1KAOA 1L7RA 4DUZB 1PKXA 2BFPA 2Y6VA 2Y93A 2G07A 1J9GA 3JZMA 3N2NA 4QUAA 3RSSA 3GRZA 4W5JA 2XCLA 4G9EA 2BGKA 2VA9A 4FFVA 2ZJ0A 4S04A 1TZJA 1VMKA 5ITSA 4MQFA 4OXXA 2B8WA 1SCQA 2IHVA 3DPSA 3OOJA 3SU8A 4YMTA 5J4YA 5B4VA 1XRRA 3BUSA 5AH0A 5EUCA 1SPBS 3NBYC 4AM8A 2V1XA 4RVHA 3G2PA 5DK4A 3TW4A 3SIXA 1TLTA 1LX7A 3QE3A 4IDHA 4CIYA 1RXVA 1MW8X 3PHGA 1MXFA 2X4IA 1W30A 4BMSA 3MSXA 1V1MA 2NPOA 1Y1LA 3GLGB 3RT1A 3M4XA 1FSPA 1HTBA 4KQHA 1VJTA 2W2TA 2P0YA 4OG2A 2JAQA 4B4WA 2PVPA 2C95A 2Q5HA 1NDUA 3D2LA 1SOMA 3IPRA 3LHKA 4W9NC 5A5EA 4HNVA 5KREA 3KXDA 1M2GA 2ZB2A 1MVNA 1XBTA 4YA6A 4YCCA 1Z68A 3C24A 3R4CA 4M3NA 3UIEA 1MTOA 5ADHA 4GNKA 4I4LA 3QJ5A 3Q0IA 3KO8A 2ZFUA 4NCAA 5FIUA 5JC8A 3DULA 4TTQA 3GX1A 2Q5JA 2I2BA 3B82A 1MDBA 1RHJA 2JD2A 2QL9A 3CF0A 2P9HA 3TFWA 4EB3A 2O5EA 2A88A 1Z4PX 2FJUA 3D4BA 4KI7A 4FFBA 4ENTA 1BJRE 1IJFA 2YV3A 3TNYA 5IZCC 1UBJS 2O7QA 4DIFA 4GKJB 2POQX 4FEGA 1SVNA 2HNAA 1IHXA 1W4AA 4M0CA 5TJHA 5E6UB 2W0SA 4OGWA 1SG9A 1I4LD 3DZBA 4C05A 4M9RA 3RB8A 2RGYA 3P9QA 2GTHA 3AJ8A 4DLYA 4CF7A 1P60A 4ETMA 1U9YA 4UEWA 1MJFA 1QGED 5CFQA 5D7NA 4ITUA 1Z3IX 4DOMA 1P77A 2JFFA 2KS6A 4IO0A 4TS3A 3O4IA 2BFCB 2OC4A 1Z2EA 4M0PA 4QHSA 3FFAA 5CP8A 3L49A 1P9OA 4H1HA 3M4YA 3ZLJA 4CM8B 1IN7A 2VAMA 2FCRA 4NK5A 4YXFA 1F12A 2D7CA 2GD1O 3GG2A 3FLBA 4NC9A 1JTVA 4LW8A 2A30A 5GGXA 4F0JA 2WJIA 1VHTA 2OWDA 2OCAA 1OC2A 4NNOA 1M1XB 4TS1A 4WLVA 2HCBA 4HVTA 3KR2A 3DPUA 4LVUA 5J63A 3QJGA 4IJUA 5JS8A 3AF6A 2VDUE 5KYUA 4JR2A 5KHOC 1CF9A 2X2PA 1RP1A 2F1JA 2GCOA 5EWMB 2WFZA 1TU4A 3UAGA 4CVNA 3FNHA 5FBRB 4KIJA 3GT0A 3C7AA 3D59A 2BGWA 1RLUA 4IV0A 1AUQA 5ECDA 1FW6A 3MS4A 1QF7A 3TCXB 1YU6A 5LQNA 1K0UA 2ZRLA 1SVWA 4W1SA 4EGSA 3U3ZA 4JUFA 4CHGA 4FGLA 4H7FA 1BRTA 2R7KA 2O48X 2XXAA 4HAIA 2G63A 4ZO4A 4JC8A 1AQJA 1TTQB 4ND8B 4MI9A 2PUAA 4Y1GA 4AMUA 2J3HA 3A1EA 4TLCA 1Q0RA 4LKOA 1KZ7B 4XTCS 2YXDA 2RBGA 4K1XA 3E82A 3LBIA 4BB9A 2CCGA 5KTYA 2ZSAA 1U0RA 3PNPA 3JD2A 1KJQA 1OMOA 3G9ZA 1QAMA 2FFRA 1Q11A 4PZPA 1UJ6A 4EX7A 1R8JA 2Z3VA 1NVTA 2QTHA 4KAFA 2MMCA 1FFEA 4FR0A 1P1HA 1P4RA 4N0DA 3A1WA 5FQOA 3PYMA 3ROKA 4F8JA 4AURA 3KQUA 2QJWA 4DR5B 3RV4A 3D8NA 3G9TA 4M38A 5JADA 2AF4C 4RESA 4PG4A 3SKXA 5G4LA 1VL0A 1GFSA 2NLOA 3SVTA 3AJAA 2X9NA 3O5AA 3QI7A 5DSZA 5B36A 5LXTB 3KB2A 2HY7A 4YREA 4HDKA 4M98A 5HM6A 1HDGO 1MAHA 1BD4A 1A04A 4KYTA 1Z37A 5FUBA 4IOMA 1ABBA 2O2YA 3TTVA 1N5LA 2QU7A 3AZQA 3K70C 5TMEA 5BPFA 3NBAA 5DCYA 1O5OA 1JG1A 4XVRA 4GKVA 5E6UA 5CIYA 2JFVA 2YMLA 4RMHA 4AT1A 5H5JA 3VPFA 3JWJA 1E0AA 1OZFA 1VP9A 1UIMA 4INOA 1I36A 3OX4A 4LOIA 4CLRB 3RAJA 2JKZA 5EP4A 3WJ7A 1E2EA 2VT7A 4OX9B 4KREA 3Q7IA 1L8AA 4NZNA 1DO0A 2IPMA 2NO7A 2YR0A 3WRYC 2ZPAA 4D8TA 4WDRA 1RJFA 3FFWA 4M1OA 1UFQA 2FW0A 3HCEA 1QSGA 4GQBA 4WOBA 5IJXA 4MUHA 1BGVA 1T2UA 1JB9A 4NAVA 4MPTA 4XD2A 3GO4A 4W6ZA 4YNBA 3ROEA 3UB2A 3KETA 1T43A 4WH0A 1P74A 4RM3A 2B37A 1NJ2A 1QH1A 4YP9A 4Z54A 1C30B 4GBED 4N5DA 1HTWA 4U7WA 1GPLA 1GGKA 1V95A 2JH8A 4RTRA 1EINA 4UEJA 3SIRA 1VZ2A 2CF6A 2XIQA 4LHSA 3FHLA 4HRAA 4UVHA 2CZGA 2OXTA 1N5MA 5F7ZA 3U1TA 5IH3A 9MHTA 3QVGB 1NF2A 1OOEA 4EZEA 3TNFA 1RI2A 3TUIC 2Q62A 4AJNA 1G55A 2NZJA 3A4MA 1R10A 2PXHA 1ZX1A 2BBOA 3PDIA 1MUUA 3L6DA 3ZNQA 2OUIA 3K9BA 2ZZKA 4D3FA 1CEEA 4NG4A 2X19A 3DP9A 5DX1A 4I2VA 3GRKA 1LDMA 2OYRA 3ASYA 3PDIB 1A8HA 2JGKA 2R96A 1XGKA 4XIFA 3D6VA 4ZVOA 5BW4A 4M60A 3FOAA 3DD5A 3MS2A 4HX2A 1CTQA 4JP8A 1ZMXA 2ZE6A 4JNKA 2XXAB 3ZU4A 1DRJA 2ZSIA 2YINC 1UC8A 4R7ZA 1IB0A 5IJ0B 4REMA 2RJNA 1OX6A 2I34A 3GGOA 4MV4A 2AX4A 3IULA 2EWVA 4GR9A 1OH8A 2V0GA 5HS4A 2KMLA 1L3IA 1KK0A 4U7GA 1G20E 2XQVA 3IVAA 4NONA 4NDAA 2YOFA 4RV4A 4PSKA 1WCIA 1WMAA 5F76A 2HF7A 4KXLA 1HFWA 3FMGA 1YC2A 2GJ8A 3C5VA 4TWIA 3HB1A 2P4UA 1G6HA 5L6MB 1CUSA 1L5OA 1WETA 4UUOA 4TXNA 4HAUA 5DOZA 4WZAB 2NO6A 1B15A 1U2EA 1X9HA 4IZ6A 4QGFA 3EPHA 4PLYA 1BVHA 3F47A 1WXEA 2QL6A 1ACLA 5JBIA 2QRKA 1L5GB 2QRHA 3E9DA 5BSUA 5C1PA 1SUWA 1QFXA 2P27A 3JQFA 4G9BA 2WAAA 4Z9AA 3SQMA 2RKWA 4YJ3B 4MVCA 1EP3B 2OLJA 3NHPA 1SNYA 2OVFA 4GUAA 3KBBA 4HN2A 4JLPA 4O59O 2Z8ZA 4YO8A 3SYLA 3T5TA 2H4HA 3ZUPA 1VG8A 2V4MA 4JDPA 3D6HA 4HEJA 2HM7A 2R68A 1HEIA 3F3KA 2RGEA 2ZUVA 4HDNB 5CLIA 4BBAA 4JWTA 3V55A 3WL4A 5J4VA 4HI0E 2JIQA 1R9GA 4UDOA 3NX4A 4Z9FA 2MWMA 6PFKA 1GGFA 1Q0UA 3FPSA 2V7WA 3J7AC 2Q6LA 3VH2A 4H7DA 4K2HA 5ER6A 1K7FB 4Z4QA 1M67A 4LMAA 1H2HA 3TLJA 2O8EA 4W8GA 3DD1A 4NBVA 5YASA 1DSSG 2O3JA 2XCRB 5K0TA 2GBGA 4HD8A 3DZ8A 4NMHA 5ECWA 2JFUA 4P5PA 4FGWA 3P2OA 4D6XA 5DHPA 3AVWA 1G6OA 3UW1A 4X6LA 5C32A 4HDSA 3ELWA 1XDWA 3ABZA 3DTVB 4UUNA 2UUCB 1XJ5A 5THXA 4POOA 1IQRA 3VR1A 4L9SA 2YJ6A 3DEZA 3PKJA 2RE8A 2AXPA 2Z1NA 4F04A 1Q7BA 3S6JA 4L50A 2AK3A 5MFZA 1EWVA 2YXBA 3RC2A 3REQB 1JE0A 2O0JA 4Z8YA 5AJUA 1II8A 3NETA 1DS6A 4OJYA 4S1NA 2G9RA 1XAIA 3HCFA 5KVCA 3AVPA 4MUMA 4Q03A 4CE6A 5MF6A 4DQKA 4QDTA 1PR9A 2AEMA 2IYXA 1T3LA 4NFYA 5DM2A 3UANA 4MARA 3GFTA 4CMJA 2NU7B 4ZV7A 2RGAA 4P54A 4RANA 1FQWA 3C16C 3GLHE 1XAJA 2ZRJA 4GBMA 4NOKA 4Q34A 4X1KB 2WUVA 1J8QA 3ZD8A 2H9AA 2JFHA 1EXDA 1M1UA 1JU4A 3QEMB 2B8JA 4PG7A 4YXWA 4DMGA 4KLCA 4Q19A 5ALKA 4J0JA 1MENA 4LWQA 4OLAA 2ZWOA 3HXPA 1VBMA 1DIGA 2ZRMA 1UFOA 3BD9A 3MJRA 5KYXA 3KKLA 5L3QA 3MWDB 4TMZA 1PEDA 1O9BA 4LJRA 3K2QA 3PP8A 1A3CA 2CKMA 3BXPA 1DC5A 3PCRB 3HVIA 3W8EA 4YUYA 5A2QA 3REFA 5KTNA 1DBVO 1VCMA 2OXFA 2H1RA 4LCJA 1PT7A 3RWBA 4C7MA 1WQ1R 4DA4A 2KE5A 1JJIA 3AUYA 5JFOA 2HPAA 3TSCA 1DAFA 4P34A 3OC6A 3R09A 3H8VA 1P9RA 3EWIA 4RYDA 2GH1A 3QLJA 2X41A 3K0AB 1VP3A 2BKAA 2HSWA 2O2HA 3NB0A 5CYFA 4WECA 5FOTA 5B2ZA 3ZDCA 3TMYA 4ISBA 3EXHA 4OFXA 2QN2A 4CLXA 4GI3A 4LCEA 5AXBA 4F4CA 1P5ZB 1OCEA 4JLKA 3AOEA 3MXOA 1CDEA 1NAIA 1ODKA 2CDBA 2HMSA 2DKNA 3NKLA 1EX7A 4C6TB 3G2QA 3FVTA 4AS1A 2Q8PA 2VA8A 2AOXA 3ZBQA 1EXNA 4RIIA 1T8YA 5A5DA 2K2WA 1ICEA 3L4BC 3HB5X 5FBKA 2YHBA 2R66A 2QTFA 1UBFA 1W8IA 2PKCA 4UBKA 2OQVA 3SYNA 2Z2YA 4EAQA 2XUZA 1IY2A 1UINA 4QXQA 5EVJA 4ZCPA 5BR7A 1ZHOA 4FDUA 4B3SB 3HP7A 2MDTA 1C9YA 5I4KA 1P7ZA 1GRVA 4PYOA 4EJFA 1ADJA 3AEQA 4UEQA 5D2CA 5AK0A 3AETB 3ER8A 2F3RA 3BXGA 1BJTA 1MNQA 1MTZA 4J6EA 5L3VA 5F7JA 3DFZA 2VAPA 1I10A 3PPVA 1CIPA 1R5JA 3HYCA 4HPJB 1Z75A 1N8TA 1JSCA 4RV9A 4ARZA 5B4TA 2X8BA 3FPFA 3TLMA 1Y3CE 3N8DA 4UHKA 1WW8A 2ZWIA 3BXEA 4ZVMA 5AW3A 1QUEA 2WF9A 3R5JA 1PZFA 3EOZA 5DGTA 1U7OA 3IILA 4Y18A 5BURA 3ENWA 1JR3A 2DOKA 2V5VA 4JMLA 3H1BA 1ESNA 1YE5A 5IU6A 2VOJA 2E4VA 1PR0A 1LNZA 4FUQA 4LK2A 4EYSA 1I3KA 4HNSA 3S2FA 2XW6A 4X7BA 3RAEC 1GQFA 4F2GA 3CLTD 2ZUDA 3W4IA 3JATA 4J90A 2QAGC 4XGRA 2R8ZA 2QMEA 2UZIR 5PNTA 3UMRA 3KQSA 2E7ZA 3UMCA 4INAA 1F2TB 3I9MA 2DQKA 3RR2A 3BDVA 4MYSA 1FMJA 2E82A 1LBEA 3OQIA 4UM9D 4CCYA 1IU9A 3GFGA 3MGBA 4MS3B 5DE3A 3DBRA 2WUDA 3KSMA 4V0RA 3ZTTA 3ZJ5A 2BCGY 5BN5B 1SC4A 2AN9A 1A9ZA 2ASEA 3TLEA 1V2HE 2F9FA 3GMTA 4WA7A 2WD7A 1OX4B 5KMGB 5TIIA 3PTZA 1L4FA 1WMDA 4QARA 1DRUA 2N3ZA 1X1EA 3QBEA 4WW0A 2JBHA 4NOLA 1IAVA 3V8BA 2PUBA 2I7TA 3OIYA 2PPLA 1H4QA 4FDMA 4YO7A 1AN0A 2ODEA 4WESA 2ZXFA 1EP1B 3HUEA 3SC2B 1FVOA 1GDHA 2QNBA 3OZWA 5ALQA 5JSKA 1YL6A 2QN9A 1DJNA 4M1MA 3U3MA 4YUXA 5T7BA 2XRZA 3M5CA 1EUQA 2QVXX 3SZGA 3IJ5A 4MO9A 3T7DA 4DCOA 5AMXA 1RHKA 4G1BA 1C7IA 2RGRA 3IP5A 1ISJA 4UFNA 1DC6A 3RUHA 3OVMA 3ANNA 2AYYA 4QDKA 5DGXA 4K9PA 2X0DA 4EJSC 2BOVA 3RJTA 3KQLA 1UM9A 3O74A 2AJBA 1O96A 1F38A 3KUKA 5EYPB 1CUAA 3H11A 2ZYDA 5AXCA 5I9MA 4A27A 5IVIA 4EW1A 4F7DA 5KSYA 4RTMA 5CFOA 3UT5B 5AUQA 1KTIA 2DKOA 4B5LA 4HGRA 2HQSA 2PSHA 4DCMA 3K9FC 3GD5A 2QSUA 1TEXA 2GHIA 3EDCA 1R37A 3CJRA 4XE5A 3U56A 4DZZA 3R0ZA 2PSEA 2V6BA 5BSGA 1KPGA 1RIFA 4IF4A 4IQ8A 3CQ9A 3VR5D 1J5EB 2FUG6 1QHSA 5EJ5A 1WRBA 1B3BA 2FZWA 2JANA 5DCLA 4AF7A 4BRUA 3L4EA 2I99A 2NSHA 1SZPA 4EHIA 1A4IA 1C3XA 4FYWA 1KMNA 5JCJA 3VOSA 4E5MA 2PE5A 3ULKA 1E6CA 3F5MA 4HAOA 3U7EB 5E9JA 4B6GA 3PXDA 5A4IS 3I52A 4PSAA 1UK9A 2C4HA 1ZRHA 1NXOA 3AR3A 4KUGA 3MWJA 3OD5A 2PWYA 3B7PA 5BYJA 3D2CA 2ZYWX 4MIEA 1KH1A 4RNDB 2FZVA 2IBTA 4QOSA 3ZBPA 1FTSA 4UAJA 3IMEA 4G25A 2X5KO 4KJXA 1HDXA 1WZUA 4RW0A 4ZXFA 2F9LA 2R7MA 2AX3A 3HP1A 3K6SB 3IXMA 1MO4A 4YBZA 4AKEA 4DYDA 2CY0A 2W00A 3L3BA 3OKCA 4JL5A 4JVLA 1XPJA 2WILA 2J5BA 3LO5A 2QTZA 4JT8A 4U7FA 3TAXA 2AB0A 1ZL0A 2VBGA 2A8YA 1JXOA 1HURA 1YE8A 3KPJA 4KMRA 4RHXA 2HT1A 1XOIA 4JB2A 3I5UA 2WWXA 4WLUA 2BI8A 3TBKA 2OMEA 2G9VA 3LU1A 1TEHA 4I1YA 3HC7A 2RAUA 1YK1A 4HS9A 4OMCA 4BPRA 1AY0A 3PX7A 3KXIA 2QTMA 1NVUQ 1RLMA 2D5AA 2ZBUA 3I23A 4XEHA 1HOXA 4RH3A 5LC1A 1XELA 2H2IA 4FLFA 2CL7X 4EG5A 1UKVY 2IYPA 3GHHA 3H3XA 4E15A 3PEEA 3RLIA 1GNLA 3TEJA 3T0IA 1CY2A 2VH1A 4OQEA 4REQB 3N2KA 1XCOA 1GP2A 4BYGA 2A14A 2RK6A 1WXQA 1IIBA 3HKBA 4EYEA 1X7DA 2UZ1B 2FWNA 3ABIA 3RYCB 3N7UA 3PX3A 4EK9A 1NU6A 2Z2XA 3AJ9A 3CNOA 4K05A 4YMVA 5IWCA 1JU3A 1M8FA 1MHPA 3A6DA 1RAEA 3OO1A 3DEFA 3UJDA 1QS0B 4DNFA 1MT3A 4E5KA 4EMSA 3CIOA 3OZDA 1W9HA 1TECE 4EEZA 2GASA 5SYAA 2QX7A 4CT0A 1SD5A 4YUVA 1KAQA 1MO2A 4ZJZA 2MSDB 2ZSUA 4P7JA 1X70A 4WZZA 5A1TA 3ADCA 4GMHA 4HBZA 2I62A 2IBMA 4EUEA 5DVZA 5JXWA 3AUAA 1T2EA 2C9DA 1TMYA 3IDQA 1I5OA 4GXNA 3ZQ4A 1Q91A 5IN4A 2GHTA 2XXBA 1ISRA 3CEAA 4KRGA 4ZCQA 1QIMA 4FFNA 4D92A 2Q2WA 3UXMA 5C7YA 1U3GA 3K8OE 2JFYA 1OILA 2QKYA 3EXAA 4CQNA 2QTCA 3P5SA 1XRSB 4R5HA 5HIKA 2HREA 1T9AA 5DSXA 4BUJA 4ESHA 5FI1B 1Z4JA 3U9LA 3WSVA 1W7AA 2ATXA 2E6UX 3WRYA 5CA0F 3EVTA 4C0WA 3B12A 4F4UA 1U4NA 2AA3A 4EI2A 5JXGA 1T4DA 2IP2A 2VZ0A 2C42A 1M9NA 1Q7RA 3QPUA 5REQA 3ZOZA 1F0NA 1NBAA 4WEOA 5ARCA 3KR0A 1NVGA 3PRHA 3LQYA 3FD8A 4OQLA 5CJJA 5DASA 1G4AE 3JQBC 4L8VA 2AFIA 1KBZA 2OZPA 2R6R1 3R8FA 4ZCTA 1TZKA 1BE6A 1M2OA 1DG1G 1VE7A 2ZDHA 1GR1A 4BCDA 3OFSA 2FEWB 4L8GA 1O4VA 3U7RA 4Y67A 2IS6A 1N2ZA 3ZIAD 1N9GA 2Y1EA 3D1JA 3JY6A 4HGOA 4JP3A 4TSFA 3WYDA 2FMTA 1L7DA 4X91A 4DKJA 1UMBA 3P4XA 3V4RA 4FHEA 1AG9A 1N8NA 2X2OA 3BIFA 2IT1A 3ABSB 3U44A 3NHAA 1Y4ZA 3Q7PA 1TKBA 1QVWA 1J25A 1RJ9B 1W1UA 2I1VB 4IDDA 3WVNA 4G5GA 1Q14A 2XGGA 1RWMA 1ZG3A 2TMDA 3NASA 3RDPA 3D0QA 1S2DA 4NS4A 4ND8A 2W8BB 1T5LA 1TM2A 5JANA 1LSUA 5KSZA 2MT9A 4E6PA 4P3PA 4Y2VA 4F3KA 3TZLA 3TD2A 1GCAA 1V6AA 3R8XA 2Y92A 4PZUA 4AU1A 1BWQA 2OAQ1 1PR6A 1CJTC 3JQAD 3L41A 4IJWA 3A6ZA 4KPFC 1XZAA 1L5SA 4HEA6 4GX2A 1YZ3A 4UFOA 3WRXC 2IH4A 1BU8A 5CYPA 2C2XA 2OG1A 4BLUA 4MS1B 1IXYA 4Q7MB 5GVRA 1SEVA 1U2GA 3KYDA 3QKWA 2HHLA 4PO3X 3RVPA 4G5OA 4A6PA 1KS2A 4HGPA 5COBA 2J9GA 2FPPA 4L4YA 3TQTA 3PFCA 2C1ZA 2NZXA 1RPNA 4E30A 4QG3A 5FDFA 1EU1A 3HZHA 3GFQA 3PJGA 2ANCA 5DOVA 1M73E 1Q57A 2B4TO 4GZLA 3THOA 3WAJA 1Z0FA 3W6OA 2WZQA 1QV6A 1V6SA 4LBWA 1EUDA 3OWHA 5F2OA 1XEWY 2AJCA 4B7CA 2PKYX 5CA0A 3QWHA 1YE3A 3RG2A 3UWOA 3VBCA 2PLWA 5M7EA 4YAUA 1E6KA 5M2QA 2UYHA 3FUXA 1P4HA 2RH4A 2OHXA 4UBLA 2F3UA 4PHHA 2FMKA 1O1YA 2O2GA 4WNAA 3DYBA 1PE0A 1F3LA 4BXOB 4WLEA 4JIGA 4X92A 3RV3A 3V2GA 1GUBA 2DM6A 5ITVA 2GX6A 5K3OA 3N2EA 4JIMA 2IV3A 4K6CA 1AQUA 5I8PA 1D2AA 2I6QA 4MWBA 4U2CA 3LHFA 3NP7A 2AQIA 1E4VA 2V74B 4FQ8A 1F5NA 4UM8B 4O2RA 2Z5GA 4J7UA 4MGIR 2FWJA 3PD7A 2D5BA 4OOEA 4UMDA 1QF6A 1NJ8A 5I9LA 1P4GA 2TMKA 4LSWA 5JS6A 5DIFA 3TXYA 1KY4A 2OK7A 5HVNA 2QL5A 3LKDA 2OFWA 4RULA 4TQUS 1PJ3A 2JHGA 2X6QA 3G0IA 3O93A 1E1QA 3FYUA 1KDZA 4JCCA 1YZHA 3UJBA 6ADHA 3IT1A 3PTLA 4BNDB 1NFQA 4M0KA 4U39A 4M2LA 3UWMA 1OYWA 2XDQB 2FR8C 3CF2A 4GMXA 4QYIB 2WYUA 2QL7A 5FP0A 1ISMA 5H81A 3WKAA 3U4CA 3C8ZA 4F1KA 1QNFA 3FNBA 4TWRA 4UUMA 3OLCX 4PX3A 3TPZA 1VJ0A 4AG3A 1VE5A 3IAS6 2B1RA 4QICA 5LSAA 2H2AA 3E5RA 4MTLA 1W4LA 1Q44A 1KKLA 3O83A 1H2AS 3K0EA 1P2SA 4NU6A 3TG2A 2D1TA 4B3TB 5JZSA 2MSCB 2QD3A 3NEPX 3S55A 4MDFA 1HX7A 3HDTA 1ZM7A 4IZHA 2CF5A 1E2MA 2X1HA 1II9A 1RC8A 3N0WA 1X1SA 2YVKA 3QBTA 5FA6A 5BV8A 4X41A 2ZJOA 2C4KA 4J0EA 4G4SP 4O2BF 3FX2A 4PQRA 3MJ4A 1LJLA 3GLIE 3AFGA 2AFRA 4BU1A 3KYDB 1ZKDA 1U5AA 2NXCA 3KVOA 4B7ZA 1ZOPA 1ST2A 4FEEA 3NR2A 1QGUA 4OK5A 4JBLA 1N77A 1MNAA 3CG4A 3ESAA 3N1UA 3QF4A 5ANRB 1UMCB 3OQHA 4HXGA 5AVKA 2CMHA 2O8NA 2P65A 5HKLA 5FUYA 1MX9A 2BBWA 4X8MA 4CM7A 1YZQA 4C7XA 2GN0A 4ZC8A 3ZHOA 4HWKA 3QITA 1Z9BA 1RACA 1ZD2P 4MDYA 4TV9A 4YH1A 3KFXA 4ZODA 4F4JA 4RLHA 1IZ0A 1RMQA 2B1IA 2VCEA 3ESCA 4WMLA 5D1NA 1GTG1 4JI1B 2JAPA 3S27A 2FX3A 3C5EA 4D26A 1NZDA 4MIKA 1FA9A 1A76A 3NZEA 2HU5A 1Y1SA 3L8DA 1U3WA 5K8VA 2ODQA 4LJAA 4D8WA 2TSYB 1KYTA 1NMQA 4RZHA 1ZN8A 1DAMA 3HCRA 5LMZA 3GT7A 1BW9B 5A9TA 1XQ9A 2HN9A 2YMMA 2IL1A 1YR1A 4YK7A 4B71A 1N0VC 4ZYZA 4L0QA 4PTYA 2OFXA 2CUTA 3OF5A 3D6UA 2A9QA 3SC4A 5A5FA 2AI3A 2DB3A 1V5GA 3DL7A 1NI4B 5FBZA 1ZCBA 1E4EB 2AG1A 1JJFA 2DMRA 3D7MA 3O3NB 4NCNA 3TB6A 1JLHA 4WNAB 2OHFA 3F8TA 5AM5A 3IT3A 2OV2A 4RXTA 2FMIA 2EWMA 4MH0R 1ZH8A 2PYZA 3MNFA 3OEYA 4UDXX 2DWCA 2ZUWA 4B40A 1D2NA 3P96A 3VX4A 1G6Q1 1S4QA 3JYNA 4GDFA 4X61A 2O3QA 4TV9F 5IXSA 1NNSA 4PZCA 3AO0B 4EKNB 4PNHA 2OQ2A 1LLFA 2GK3A 1KI9A 5BQOA 2JK1A 5HFNA 2WJAA 1N6OA 1GTRA 3I9V1 3P9NA 1DG9A 1LI5A 3PDCA 4JR0A 4W9RA 3SJCA 4JODA 2W6MA 1PYOA 2I91A 3OQOA 4JN6B 2X5JO 5C2JB 4YRJA 3FWHA 2R8OA 4FINA 3TTTA 2ZE5A 1WX1A 3B6IA 4A23A 5CCBA 1KPHA 4OTZA 5DH9A 1XZQA 2ZSDA 1JDBC 4QYMA 3E6AA 2VNAA 2HA7A 1PX2A 5JIBA 1IN1A 2PUEA 1PWYE 3ABOB 3U13A 1KH3A 1OI7A 3DL4A 4C2BA 5KOJB 4WI1A 4IDOA 2CWWA 4YJ2B 3HUTA 5FADA 3PGJA 1EXWA 4ZVNA 3X1KA 3CNHA 4ZN6A 4LYYA 1CRZA 1B42A 2IIQA 4PM4A 4C03A 2OCBA 4XPZA 4CM5A 1UT6A 2OXEA 2VKTA 4RVGA 5DEOA 5J40A 4NIMA 5K8LA 1PHRA 5EHIA 3RJ9A 3K9CA 3MGCA 2QRMA 1X7WA 2R6DA 5ALYA 3JYQA 2NADA 3G2LA 4RD0A 2LD4A 1KE2A 2JHCA 3H04A 1SKBA 2P2ZA 4WCVA 3MCWA 4QOJA 1CDOA 1ZNXA 4X6YA 3ZLBA 2QOEA 1MO5A 2XX3A 2HBRA 2YV2A 3CSUA 3X1DA 1LVHA 3BTOA 2OAEA 2WFLB 4Q3EA 3T95A 2J3DA 2BHRA 3EPPA 4DTIA 3LQRA 2E18A 1OIWA 3GMDA 3X3HA 3W5UA 4DRYA 2VP6A 5FPPA 3W5VA 3RSOA 4HPWA 4DMLA 1X19A 2Y1FA 4IXDA 1YS9A 3AJEA 3BMOB 5FBHA 1DKNA 3WOVA 4QOEA 2X3FA 2VCYA 2ZTSA 1YA8A 4FDAA 4KQWA 4R8MA 4IUDS 5CH3A 3SE7A 1BC5A 4KQ1A 3U3JA 4ENUA 3W5SA 1W85A 5JAUA 5JATA 3C6QA 1WLYA 1QO0A 3BGOS 2O3TA 3GDFA 3TZEA 2C5BA 1BIFA 1JE1A 1SIOA 4GD3Q 4WCDA 1S9DA 1L1RA 3NXKA 4L2IB 4KR3A 3WJ1A 1Y6ZA 4JFRA 5B6JA 4KZPA 1XK6A 2CHQA 1X86B 4NJEA 4EQ6A 4N9WA 4YC7A 1JYFA 1CK4A 4V0KA 1XTZA 2E37A 1K06A 4FUTA 3VNRA 1NI5A 2WYVA 3KQOA 2GETA 3CTPA 2KSQA 2LWIA 4MXDA 3WQBA 3CNQS 2JI8A 3JYHA 4K9NA 1YOBA 3QKTA 3ADKA 4KLNA 4J16A 5I3CA 3KZNA 3PQEA 1GD1O 4MW7A 3MGKA 1BCSB 1BROA 2YIDA 2VPXA 3GCGA 3L9WA 5J23A 3MQ4A 2I4OA 4TXMA 1GSOA 1IOWA 1CUEA 1II8B 1N6LA 1WXXA 2PLFA 2DULA 1EP9A 3FN4A 3LWBA 4HH1A 2MR6A 2WHQA 2AUNA 1T15A 4CKCB 4Y2PA 1WMSA 1RBYA 2IX3A 1ZK1A 1C0LA 1HLPA 4GIBA 2OMKA 1MQAA 2OXRA 5TEVA 5AJYA 3H6HA 1MEOA 2GVDC 3ZQ6A 1KP9A 3WAKA 4I55B 4QJ5A 5C8ZA 1P7YA 3ICQB 2ZJ6A 2HMUA 5K0JA 4XJXA 4ZVRA 5JW6A 1QZUA 2QMHA 3P2IA 1V1JA 3AW9A 4Q3CA 3WP0A 3I9KA 3RUEA 4KVFA 4DT1A 4MHOA 4EVSA 3A1VA 4GICA 4K9OA 1Z29A 2I9KA 1MIOA 3WHPA 3S0JA 1U0LA 3TD9A 4YCSA 4RTQA 4QLBA 1WSBA 1KO7A 1C4XA 4NCJA 3T61A 2NSYA 3W2FA 2AC4A 4FWIB 3FBTA 3RK1A 1KZ1A 3WYNA 4F91B 3HJRA 3C7KA 4LDQA 1ZVVA 4K9RA 1SVIA 3EVCA 3OMXA 3NUQA 1G19A 3MWYW 1Q74A 3FNIA 2E1RA 2XNSA 2DERA 1LDYA 1W6UA 1N6KA 3OJCA 4I5EA 4M4SA 3RABA 5KNBH 4IWYA 2AFIB 5BW5A 3NHWA 2A9JA 5DP2A 2ZXUA 3UK6A 5IF9A 2DQ4A 3KT0A 3ETGA 1Q7TA 4X20A 5EIBD 3E58A 4IHJF 5JAIA 3IOBA 3RS4A 1YTLA 2QE6A 1SFRA 2OCIA 4GZ6A 4QX6A 1G59A 1H05A 3K72B 2VZ9A 4JJKA 4DMMA 3O38A 1E1NA 1N8KA 4N0PA 3SGLA 2ACWA 2Q0QA 3OTQA 4ZVUA 2ZSEA 1XC7A 2JH9A 3KEQA 2NYRA 3QEJA 4PHCA 3VJMA 2WI8A 3CN7A 4QTZA 2ZYRA 1PR5A 2R8YA 2XWSA 2CVOA 2YYSA 4F9GA 2DZDA 2Y1KA 1YRWA 3F6PA 2GYYA 5EMNA 3GRVA 4WK6A 3ADDA 1IXSB 4MQEA 1SBNE 4ZU1X 3EULA 2NUBA 1QTNA 5F5LA 1K0FA 1VM6A 4M36A 3WSTA 1QU3A 3JPYA 4ABYA 8GPBA 1MPTA 2XWQA 3GEMA 3BMQA 1ZLYA 4D4IA 3IL2A 2AZXA 1GAXA 2D74A 2JI9A 1Q1AA 3H9QA 3RQSA 4BE7B 3KQMA 1Z26A 2Z5VA 2R87A 1XZCA 3N05A 1NE2A 4O0MA 5K09A 3OQJA 2CFRA 3LQKA 5FEMA 3U1VA 1AUVA 3WK5A 4X90A 4C3UA 3UHPA 3DEJA 3IUMA 2X8WA 2Y99A 3V7UA 4BKMA 4BVLA 5CDTA 1E8DA 4EM6A 1KIAA 1O0BA 4M6WB 3M1AA 4I9HA 4F2PA 1P80A 3GP3A 1LWOA 3A2NA 3CLVA 1NVFA 1MOZA 3R5TA 4CIDA 4PRZA 1P3DA 4KPYA 3UHAA 2ZIEA 2YYYA 1GGJA 3KHSA 1GLGA 1CV2A 1SUDA 3QXXA 4ZARA 1VOTA 4PHGA 4XX0A 1Q17A 4N5HX 1T2VA 5ALUA 1NR7A 1Y4DE 3MUOA 4G89A 4HFMA 3QMVA 1Q3HA 4OFWA 7YASA 1VI5A 1Q0PA 2XTMA 1N7IA 5IH7A 2P62A 3ENVA 1MKYA 2PSJA 4HYYA 1NJGA 4R98A 1IRIA 4MW1A 3OZRA 1V1RA 1YB2A 3D6JA 4RD4A 3LKBA 1KK2A 4FNAA 4Z0PA 4FWTA 4HY3A 2D13A 1USKA 2VXCA 3TE7A 3ZE6A 1WNTA 2ROQA 3F1KA 2IV2X 1KOLA 4HGZA 4ENVA 2D54A 1SKYE 4G0YA 2PUTA 2DWUA 2WTMA 5A3JA 1TPZA 4MSUA 5TR9A 4JQYA 2C0CA 2C1XA 1B16A 1JIKA 5IKPA 3QELA 1Q0TA 2Z4TA 2HSZA 4IMJB 3ESDA 1I4TD 3E1KA 3OLWA 3LQ1A 3IODA 1M0SA 3HG7A 3OPMA 5LBUA 3TVTA 3RHSA 1RWOA 1U9JA 4C76A 5TX7A 1TM7E 3RODA 1DDOA 4UTZA 1A4RA 5ALNA 1C9DB 1T3SA 3HDJA 4HXYA 4Y2YA 1YA6A 1HDZA 3DR3A 4M89A 5A3RA 5CCEA 3FUCA 1K8RA 4NYJQ 4DHEA 2FN4A 2BP7A 4TSRA 4Q39A 2EFDB 3FUTA 1F9EA 1A27A 1OFHA 2CYCA 3UO8B 4NHEA 1Z0IA 4RVOA 5BMVB 1EFUA 3ZH2A 2GM4A 1D2MA 1IWPB 1XZFA 5FLYA 3D8RA 1G9SA 4KVGA 3UPUA 4MUBA 1I8TA 1NW9B 3I9FA 3Q98A 1XLTC 2MTBA 2F00A 2Q8NA 1CP3A 3EDOA 3G5MA 3W04A 3G2JA 4V39A 3V1TC 4DCSA 1IEQA 4FE7A 3D4IA 3O4JA 3UXEA 1B6RA 1I7QB 1YTUA 2VHQA 3N3BC 4LPKA 4LJLA 4KSBA 4R6XA 5I4IA 4B31A 3EZFA 3V6LA 2JK0A 4JT4A 4OKNA 4QUKA 5EUMA 4DCCA 5I9SA 3OZ7A 5HTOA 3DYVA 3FXAA 1AXGA 4W63A 4XGKA 3NGLA 5KQMA 1RABA 4JQSA 1T4CB 4KR0A 4S1VA 3DT9A 4YECA 2F59A 4YUAA 4XIJA 3TFOA 4FMPA 2QG4A 1PVVA 3EWAA 4QO8A 3OZAA 3IIKA 4YONB 3WR5A 3TW8A 1ZRNA 1VPWA 3EQ6A 3KZMA 5CM8B 5DLPA 1XVUA 3K5HA 3DXFA 3H9GA 5MGBA 1GCUA 3GGGA 1BTOA 3UAZA 2D1SA 1AUPA 2BPOA 2EWWA 4L85A 2QYSA 4M6WA 4UEOA 3QVLA 4ZO8A 3QVOA 4NU8X 4PWYA 4LFCB 3LCVB 2IY7A 4IVPA 5G02A 4BZWA 2A9VA 4O29A 4KOEC 3DMPA 3MMSA 3EXFB 2FN7A 3DP7A 4NE2A 2BFFB 3QVKA 1UXOA 2JH3A 4RSGA 2XJ9A 3EQ2A 5JARA 2RGGA 4DQVA 3TG8A 1Z2CA 1DC8A 1R3DA 2EJWA 1LK5A 4QM6A 4QBKA 3T94A 3JAWA 2ZBQA 4YUZA 1YOVB 3NNDA 3O95A 3CONA 1LY1A 1G66A 1T6BY 4N40A 1NX6A 1XTSA 2JLCA 3EIUA 3ILXA 3JSAA 1FSFA 4O63O 4DV3B 5CVCA 2FY8A 5IMBA 2UXCB 1DBWA 3DM9B 3SJAA 3VZCA 1J1ZA 2P7HA 1MAAA 3F2IA 1C1HA 4EJ6A 4K0KB 2CJFA 1I30A 3ANLA 3WYBA 1DJPA 3H86A 4B7UA 4Q4CA 1RWKA 1LDEA 2QYOA 3BCHA 1YKSA 1Y5RA 1DEOA 1M2HA 3QQPA 3WYEA 5IHXA 4WXEA 1T8SA 1T10A 1V16B 2JEYA 1QYWA 3DSRA 1RXUA 3BSWA 3KKQA 5GV7A 4G1UC 5CJPA 4OHCA 5AVZA 5JNUA 3PBKA 1Y8RA 2W5UA 2GXAA 5AIAA 5KDDA 3RW9A 1FZQA 2GCOB 4Y1RA 4AN4A 2BBTA 2PWZA 2R4UA 3AKEA 3F9IA 1VIDA 5DTEA 2OVBA 3W34A 4EUKA 1QQTA 3OFJA 4D0GA 1HQYE 2A0FA 1Y1QA 5K5EA 1A9OA 1SU8A 1YMUA 2WOOA 5DX8A 3SBXA 3T1VA 4QEZA 4N3BA 4UE3S 1V41E 5IW8A 1LPPA 1TF2A 5ALXA 5JJCA 2JIMA 4YQYA 3DQQA 4C0JA 3H18A 4IQGA 4PVDA 4FSDA 4BKPA 2BFWA 1AURA 1QKKA 1Q3TA 1XWIA 2BLNA 5FOXA 1WCV1 2C2GA 1I13A 1UFVA 1ZI6A 3TZQA 1THZA 5G3YA 1TA0A 1JHAA 4NBWA 1PYGA 4MWCA 1DP4A 1BE8A 1M6VB 1RI1A 1R74A 4H2DA 3DPIA 4U63A 1EESA 1NKTA 3ZZ0A 1S2MA 1P17A 3ZTYA 1L7QA 2EHJA 2ZG6A 3AETA 4BASA 3E27A 3OTIA 5KC9A 1K98A 1R9NA 2JFWA 3H11B 1K08A 3KB8A 2WSIA 3GCWA 2H4JA 3IIMA 3BRSA 4H4EA 3W0LB 4B81A 1C9EA 1WZCA 1MVOA 2XSZA 5CT5A 2JGLA 2MR5A 4HLNA 1FEZA 4KE7A 3NFYA 3GLGA 1K97A 4KDEA 1Z7YA 3DDWA 4IGKA 2ERCA 4NBNA 4ROTA 2DUWA 4UM9B 1ENZA 5HMMA 4H35A 3DLAA 3V42A 1C7QA 1F17A 5HZGA 3ISVA 3TQFA 1IN6A 1JR2A 1Y7TA 5CYOA 3I76A 3OZEA 4JI2B 4IINA 1KYWA 2WWIA 3F6EX 3P45A 2Z6AA 2P5SA 1IM2A 1GLNA 2PKRA 2WJJA 1L5QA 2P9EA 1FJHA 3BBLA 3LDHA 1VCHA 1XALA 2GO7A 1MJ5A 5FTWA 3MWKA 4WT7A 1PEAA 4TSKA 5F78A 2JATA 3FNGA 4ZGBA 3FH0A 4Q5IA 1P0CA 5G4KB 1LPSA 4X66B 3HCPA 1JDNA 1LCIA 2VPTA 1V8PA 1RWVA 4KPUA 1ZSYA 3N7AA 2KQUA 4HYQA 2CXPA 3EMBA 2PLNA 4FLMA 4L4SA 4CCWA 1MG0A 5GGYA 1L4EA 1BFUA 1EAMA 1Z2OX 2GM5A 1IBMB 2PBLA 3MJHA 1CY7A 3DBRB 3ORSA 4OGGA 4K9KA 1QIDA 2ZU6A 3HB0A 2OD2A 1E9VA 3DHVA 1SD1A 1IYZA 3FCSB 3QENA 1KMIY 3ZDRA 5KNDA 3KHKA 4P4TA 1XA4A 3RF7A 1E79A 4IXMA 2P9GA 2O8VA 4FOLA 2WU1A 5FWNA 4OY3A 4DSTA 4HNTA 2O2ZA 3FUUA 3T7AA 4N8DA 4KQKA 4E2XA 1X2EA 1FMCA 4M53A 3DAOA 5DHFA 5FI5A 4H0FA 4ZK6A 2AI2A 3G89A 3PT9A 1U8CB 2IY9A 4DIOA 1CW2B 1W5SA 5AVWA 1PZNA 2D1FA 1H65A 1FJXA 2QGNA 1NQXA 1XRLA 3OFNA 4II3A 4PC6A 3NVDA 2QP3A 3V3TA 2VRNA 1LBTA 3B53X 4CGZA 4IIGA 4LUCA 4R01A 3N75A 1TT7A 3BWBA 4E5UA 1BEZA 1BGXT 1V11A 5D3MA 2AFHB 4MZDA 3WQRA 2E5WA 4Z7NB 2GLXA 4HZUA 3PQ2A 1Y4AE 4RPHA 2WAYA 3RKRA 2YWDA 4DM3A 2JG3A 1EVJA 1QYRA 4IFEA 2VJBA 3M70A 5IHPA 2WTAA 1C7RA 3L6EA 5AKXA 5LZ5A 4LWOA 3O8OA 3EBLA 2BI4A 5JNVA 3ZWCA 1OROA 2GPJA 2P4HX 3RS0A 3U17A 1FL9A 4EELA 5IVKA 2BSQA 2VDPB 2EC5A 2NYVA 4HDSB 5D6NA 1AQYA 2GFIA 1U7HA 3EGVA 1JEOA 1XEFA 3K73O 4CTOA 2C3PA 4G0UA 3MA0A 1NATA 3BL5A 4CM3A 1AS0A 1NQOA 2P1RA 3H5OA 1E6UA 5C5DA 5LP6B 2XBLA 4RTSA 1ONPA 1M6NA 1XFAA 2DSNA 2NVBA 4LOJA 4IAOA 1U28A 1GZDA 4HK4A 4PQGA 5KWIA 3ZK7A 1MQSA 3FHJA 1CVRA 2PYIA 4J0KA 1MR3F 1BEEA 1SBQA 3A9TA 3EXEA 3ISJA 4YJHB 5D51S 4E09A 4YQEA 1QHHB 3LBHA 1KDYA 1GN9A 3ZE2B 4LA4A 4XARA 4AJ2A 3MT8A 5EFOA 4DQXA 2OCGA 1TEZA 2YNMC 4WTOA 1GYQA 1KO8A 3ZXYA 3H1EA 1ZIOA 1D4FA 1ACJA 3ZWXA 1KGDA 3THXA 2PMBA 1KI3A 2BFOA 6LDHA 2BEUB 3GUVA 3H6KA 1QLJA 4RM2A 4ESVA 2V65A 3ZGOA 2SKCA 4RVUA 4JI7B 5A5VA 4S0ZA 3O8DA 2Y1LA 4BFZA 4BX3A 4JQCA 4OUDB 5D5QA 2YUIA 1D03A 4R2JA 5HQTA 3ER9A 1OH7A 3OLQA 5LLDA 2WVGA 4IHJA 1E5LA 2PAFA 2ILVA 3U7IA 1JIUA 2Q0HA 4LZNA 2B99A 2PRIA 4R54A 5A71A 3CLUD 3TZKA 2XBMA 1Z0DA 1LFDB 2D1QA 2JGFA 1FDSA 3ZE0B 1ZXBA 3KALA 3C6YA 4JLBA 5BNTA 5D8DA 4LNUA 4TWZA 4MRVA 2IIPA 3RYTC 3GEHA 1M1YE 3COWA 4YAWA 3WV5A 1JIIA 3KD2A 5F2KA 1SUBA 1DPGA 4JC4A 3IAAA 2TS1A 4U2BA 3SDBA 3SI7A 2WDZA 4E21A 3PHLA 1EK6A 4M9XA 3VOBA 4CL3A 4D9BA 5J1TB 4OGKA 5FPTA 3VC2A 1QO9A 5IC4A 5IKMA 3MD0A 5LUBA 4DMUB 2ATIA 3H5WA 4FBLA 4LRQA 3GLVA 1NV8A 1GHTA 1NHWA 1O4WA 1RSZA 2VWGA 4LY0A 1QORA 1CR2A 2O3UA 4UXHA 4V0NA 2NN3C 4BP9A 3BK2A 1MRSA 5A0FA 3Q8KA 2VHTA 1UC9A 2HK7A 3U2QA 1SC3A 2QUAA 3AHGA 1YDEA 5LXTF 1EG7A 2OFFA 2HMWA 2PX6A 2B4AA 1EFPB 4E3ZA 2X0JA 1WSAA 2Y0DA 1T4MA 2E49A 3ETLA 3FPCA 4ZICA 2JLVA 1QR6A 1OXXK 3LMKA 4DGSA 2ERYA 2HO4A 5JJIA 3ZHYA 1PJLA 5C5CA 5B55A 2X8JB 5T8KC 3NDRA 1JVNA 2WHYA 1FQJA 4JBYA 4HDCA 3W1VA 1BGWA 4GYWA 3WRVA 1C3VA 2B3DA 1N2CA 1HH4A 1XU4A 3C3DA 4PXAA 1DOAA 1A50B 1L4NA 1NY5A 4MNTA 4YX9A 2I6FA 1CVLA 3GJ6A 4Q15A 3A1UA 2Z9CA 4GDMA 1L5KA 3KWJA 4JUDX 2BM9A 4D3SA 1DXHA 3TQOA 2P6OA 2NO0A 5FNVA 3L0OA 4UAGA 3LHSA 4XSHA 3SZOA 4EF6A 4ARCA 3A26A 4P9NA 1UBHS 1V4NA 1ZXXA 3EGIA 2IK8A 3QLTA 1TJ3A 3U5TA 5HSGA 4CEHB 2P40A 2BTQB 2XUJA 1PRYA 1PEKE 1SXHA 1XO1A 3KDSE 1OA0A 2WDPA 3OTWA 4V0ME 5AWFC 4JI6B 1KDPA 2IDZA 1UL1X 1G5FA 1BX0A 1C8LA 3M1LA 4GPBA 1HE1C 3RWOA 3UV3A 5BVHB 2XJ4A 4FHZA 5DBEX 5BWNA 3GLFE 1I32A 3K9GA 2P77A 3DW1X 4MYHA 5I51A 1QE5A 2X7XA 5JZ9A 3I61A 3SQDA 5BYAA 2QUBA 4I1VA 1Z13A 4MEJA 1WL8A 4WFIA 1YMQA 3EUWA 3WDLA 5JXJA 1KAGA 1UP6A 3HEAA 1QOZA 3T6KA 1G5RA 4Y2XA 4L2IA 4HF7A 1ZICA 2H59A 1FVXA 4LY3A 3ZGVA 4JJEA 5ESWA 5AW4A 5GINE 1MW9X 2REQB 4Y7DA 3HXOA 2NU6A 4C7VA 1QHEA 1NVEA 5ALGA 1MPXA 5FL7A 3PUYA 3O21A 5TT1A 1PGOA 2LIVA 3JQ8B 2DPHA 1NMYA 1ZK2A 4G07A 2PMWB 5FFMA 4CR6A 5ALIA 3HCOA 2PMFA 3TAUA 2XMDA 5FRDA 4CIAA 3VHRA 4BAGA 1UJ2A 2CXRA 1XN4A 4AMVA 4AD8A 1TDJA 3PIDA 4C3VA 4P80A 4Q82A 2BMWA 1KEEA 4OQYA 5KYYB 4YRRA 3CEMA 5IARA 1C80A 3P7MA 5BSVA 2QTGA 4X85A 2B78A 2XUPA 3C8UA 3S81A 2MSWA 3U1BA 2YY6A 4AKTA 3A6FA 1EA5A 5TF4A 4I3HA 3QIAA 5HEKA 1PNRA 2IX9A 2FMHA 1T25A 3FJYA 1JIJA 4BTEA 4MRMA 1XNGA 5BUCA 3P5BA 1MB3A 3HBMA 5JJBA 3MB8A 3F98A 1OAOA 1WVIA 1S9HA 2F62A 3E3MA 2Z5FA 2GN2A 3EA5A 2ZRPA 2XUKA 1BHO1 4ZI5A 7ABPA 3FGNA 1CNEA 5F9MA 5IT5A 4GMGA 1C9JA 4P4NA 2JLBA 4F85A 5G0VA 1A5AB 3VYSB 4K81B 3CUVA 4AJ9A 2ODBA 3PJEA 4JZYA 3AVYA 5JD5A 2K5UA 1IBSA 2EJTA 2WHPB 1I4EB 1KERA 1TL7C 2W6QA 1SVSA 1YVRA 2QM3A 4P38A 3DAHA 5KQRA 1CE8A 5ICFA 3I1YA 2XD9A 3NIGB 3ZPXA 1IATA 2C2KA 3WB9A 4AROA 4HSGA 1NR5A 1S3SA 1SOAA 2BFDB 1AT1A 2PNJA 3TOXA 1RW4A 3SIWA 2HSJA 1XCGB 3TNLA 1FFAA 4GFDA 3ZG6A 1SMKA 2XRMA 1MB4A 1QK4A 1U0FA 2PH7A 3PC6A 3PFFA 4GP6A 1H3NA 1PK9A 4Z2AA 1P45A 3QM1A 3BT7A 1LLUA 2J4FA 2JIRA 2IGBA 2QNRA 3M34A 2R6JA 2PEYA 2AI1A 2C4NA 3MGGA 4OBWA 4G0OA 3WLKX 1GV1A 3C8HA 2HO5A 4PZ0A 5DBFA 4YT5A 3KJZA 2IZ7A 3HGMA 5AUPB 1JUDA 5CIQA 1WUHS 1UPCA 1VLJA 3T4UA 1GRQA 2XNDD 4C01A 1M2OB 4J94A 2VPQA 2PCLA 3K70B 2J31A 2WMOB 3CV3A 2RIPA 2YWJA 1XDUA 4FCVA 1UBRS 4FHDA 1FNNA 3F3MA 5ECYA 4BJHB 4EATA 2R6GA 5SYMA 1IQ0A 1JR6A 1AGXA 2II6A 1J90A 2P2CA 3FLEA 2V7XA 2BDEA 4CZ2A 1J22A 4H18A 1KOFA 1NNI1 3KU1A 3QK7A 4GLOA 3H2HA 5HR5A 3BZUA 4PBTA 2XB2A 4HUJA 3M7IA 5CX1B 1E61A 1OWLA 3NWOA 3Q2OA 1L6RA 2F8LA 2VJCA 3LO8A 4EG1A 3IMKA 4LWZA 4TV8F 5ICCA 4NNPA 2EQAA 2FZLA 4OK3A 4B48A 2I4MA 2Z04A 3HHEA 3EZ7A 4C7OA 4XIYA 4HMOA 1UOOA 3PDUA 3DOFA 3QWIA 1KZ9A 4FONA 1YV9A 1AGNA 2HRBA 2VDLB 4HZGA 4PLFA 4XM0A 4ED9A 1I24A 4IIXA 1LUAA 3F4KA 4DC1A 4YR7A 3SJ7A 3RTAA 5C8YF 2PZ8A 3CEHA 3OZGA 4XSGA 2FFAA 4KL8S 3R3JA 5JNSA 3LRXA 3UFBA 2O7VA 1DUVG 1ABEA 4CMEC 3MFQA 3VX3A 1YZYA 3CF6R 4NULA 3L4JA 2WSLA 1XP8A 3B1JA 1U04A 4ENPA 3P0HA 1E1KA 1V7QA 4NKRA 4YLEA 1OFUX 2YZGA 3DM5A 3IAFA 3LSTA 4E5VA 5BN3B 4LY9A 3FF1A 2B8NA 1F8XA 3H9BA 4L8YA 1P2TA 2JHAA 2OSBA 5EKUA 3KEOA 1C1DA 4H27A 4KLAA 5JI3E 4ZJYA 1G8YA 4NBSA 1H6AA 5AI9A 4EPYA 1NVKA 3FCXA 2A94A 4W5OA 2ZIXA 2E48A 1R0YA 1R8QA 5HG0A 1YVEI 1W5AA 3MYRA 3GLQA 1OI2A 3AVTA 3AF5A 2E4YA 1DXQA 1QBGA 4G41A 4UBIA 2R79A 1ZKMA 2AE2A 1DKQA 1QBKC 3O9VA 3R0VA 4KCGA 3SE0A 4Q3AA 3V8PA 3IKTA 4NPAA 1RFGE 2ZUSA 4LHXA 5EWLA 3A6PC 5EEHA 3OMLA 1M2WA 1KDOA 1KAEA 3EIHA 2R1TB 3HUUA 3E18A 2BFEB 3OTHA 2I9PA 2XCOA 1COWD 5AKZA 2FRDC 3WQSB 4ARSA 3U5ZB 5FTLA 4A16A 4Z99A 4X6UA 2DBVO 2O5VA 3UH0A 1PQUA 4NBUA 3HUDA 1DHTA 1EH5A 4E88A 2RONA 5LL6P 5AW2A 3CMMA 1JKXA 3I39X 3PYXA 5JEDA 1YJ5A 4M0UA 4II7A 5BMVA 4OQNA 4A0FA 2V7UA 1ZUNA 1RLIA 1PT9A 4HSEA 1WBDA 3A10A 2R9VA 1M2EA 4CKEA 4WXYB 5DM0A 2WJVA 4RKFA 1GO2A 5EZ6B 1I2ZA 1OAKA 3FWZA 3Q9SA 2ZSFA 1DQRA 2XT6A 3DCNA 1A2QA 3EC1A 4LK3A 2HWXA 3W6UA 4CKEB 3RJZA 2NU9A 1SCDA 3OZFA 3U6BA 3ONWA 3A06A 1F2DA 1MO3A 1SQ6A 1SQFA 3X2FA 1T9CA 3I2YX 4I9FA 4Y0NA 1L4UA 5LYJF 3GLIB 2A2ZA 4MQ5A 3IP3A 1RBQA 1TK9A 1GPBA 1Z4LA 2HOQA 4HR7A 2ZKLA 2HU2A 5TQ0B 1G2PA 3RUDA 4G0NA 4A0HA 1K8ZB 3GT4A 2DBRA 1JXMA 3VSAA 1OT5A 1NPYA 1F48A 2RDMA 3NM4A 3HR4A 2ZT6A 3R0QA 4RX1A 2EOAA 4O08A 3TMKA 3V33A 3VVMA 1PSDA 1Z33A 2VJMB 1FTWA 2ZYHA 3DB1A 2V9CA 4RKRA 3VJKA 5EVCA 2VHUA 4HT3B 4AQYB 1R6VA 3N2GB 1RC1A 1V35A 1NLUA 2EG5A 2PS3A 1R88A 5CJ2A 3RROA 1FQKA 1L5HB 3I42A 1E18A 3I6MA 1W25A 1HEYA 2JJYA 2JPDA 2PT6A 2QV7A 3KQTA 2G80A 1GCOA 3N2ZB 3DVLA 3PICA 4M1KA 4QASA 3TS1A 1HM5A 5HF5A 3BE5A 5AT1A 3VR5A 1OBVA 1WXWA 1G0NA 3NKVA 3OCZA 4JITA 4KE6A 3RU2A 2VPWA 1T0UA 1JDBB 1QQ5A 1ODFA 4DV5B 5AKHA 3VAAA 3X1MA 2HJHA 6REQA 4E70A 4JYZA 3ZWNA 4WK2B 4GZ5A 2H7XA 5KYTA 4DDTA 4ZWNA 1R6DA 4FPXA 4RKQA 5BNWA 2PT5A 1QC5A 5LQSA 3IDOA 1ZMBA 3U9TA 5C8XA 2F67A 2QW1A 3QVWA 3ESBA 3LUBA 1GCGA 1PJTA 3WLMA 3CJTA 3VPAA 1NQWA 1A69A 2WSMA 4MHTA 3K8ZA 1EFRD 1YKGA 2NSJA 5T4FA 2FGJA 3G02A 2ZROA 4CM4B 3KKMA 4H3HB 4PGHA 1VE1A 1JR3E 4MUKA 3AERA 3IAEA 1IMJA 1NLYA 3ZW7A 5I9IA 1CUVA 2QLJA 2BGTA 1G5HA 1LS1A 3QU9A 4TZ0A 2PFGA 4EVQA 2AEEA 1MN6A 4B6EA 4C20A 1D04A 4AS2A 3MN1A 4QTXA 3W9SA 4K6KA 1AMOA 1TC1A 2FEMA 2J7PA 2KW5A 2PXCA 2MSEB 2RGUA 4NJEB 3CUUA 1CUWA 3KSDO 4EQ6B 4EKEA 1P91A 3N0RA 3NDPA 1YU9A 2CBXA 1JQ3A 2EF0A 1ZGBA 2XMRA 1ZESA 2XA2A 3HM9A 4YYEA 4B44A 5LQCA 3LM8A 3IOYA 1ZN7A 4IFTA 1PZMA 4OUDA 1F2TA 4PC1A 1XRJA 3R4VA 1Y37A 1JKJA 3AIKA 1SUAA 1JLLA 1XXLA 3NWEA 2FX2A 4YRCA 3W2GA 3Q3CA 5J1SB 4R2MA 1GPWB 2HCRA 2X0NA 5ILGA 3M2PA 3IB3A 4DIDA 2DBZA 4G0ZA 3AOGA 2YJ4A 4KQIA 5T4BA 2FU5C 1Q7GA 5M29A 3KSRA 1ZVKA 4IDGA 1MEJA 4JAVC 1Z34A 1DT3A 4GMFA 4H3KB 4V2UA 3UAWA 3YASA 1QS0A 3D4NA 1GUFA 4UDNA 5BOSA 3BRWA 3VMFA 2DYKA 4FFBB 1PGNA 5T67A 2PBFA 5A4KA 4K3VA 1H2RS 4TZTA 3C7CB 2PQMA 3GT3A 5HGJA 3BIJA 1D0SA 4XA8A 1TGYA 4JLSA 3CE9A 2AOTB 3DKVA 3KPYA 5FPHA 4S1PA 2R1ZA 1E2NA 1JJVA 4KR2A 5ADWA 4MR8B 2IEZA 3MRXA 3E9ZA 1OT3A 2GRJA 2MSLA 4P92A 3VDXA 4KRXA 4D7AA 1E66A 2ZK7A 1YGYA 4UPDA 1XEWX 5EZ5A 5AJXA 4K9LA 3REOA 4DMHA 4YASA 2Z1MA 2V7GA 1OZGA 3HBJA 2ZYUX 5DLDA 3URMA 3FF4A 5AVOA 3HPRA 16PKA 1UJCA 1XLWA 2CLMB 1N75A 3R7SA 4PRYA 3LUPA 3VDNB 2BTOA 4NCHA 4ZAGA 1R5NA 1FYFA 1NZJA 1GITA 1FYDA 4IPTA 2GEUA 2DVMA 3ZLVA 3NXSA 2B94A 2W0MA 1OFGA 1MQ9A 2QP9X 4ZEXA 3D6NB 5A9SB 1O5IA 2I0FA 2GHRA 2ZREA 1LSSA 1NIPA 4CQLA 5ALVA 4D5GA 1DJLA 1SUIA 2AN1A 2XKJE 4X60A 4MR9A 5IJAA 1GIAA 3OU6A 1YHZA 4MA0A 3O1LA 3MIZA 2VS1A 1LLQA 3UC5A 4N18A 4AJKA 3L7LA 4OP2A 1B23P 1L4KA 2VT3A 4WFQA 4A26A 4WBNB 1LTHR 2Y0CA 3IFSA 4QJ4A 2J9FB 5B6PA 3ERCA 4UREA 3DBLB 3SX2A 1WPGA 4PZLA 5FA5A 3ZQJA 5KYNA 2R8EA 2RB5A 5E6SB 2FG7C 4QXRA 4MKZA 1AX9A 3RANA 1HY3A 3WIOA 5KTRA 2VTBA 4WE3A 1J09A 3EVFA 1T2FA 1YZNA 4GW3A 2PZGA 1DIOB 2PZAA 1DCKA 2YYZA 3N28A 2FWMX 2REQA 4GRAA 1AQLA 5AHKA 5EG5A 2LVBA 4G1CA 1J56A 5EKSA 4U7JA 2ZRKA 3BH0A 1O89A 3V7YA 3VSDA 1LV8A 3HNRA 4M99A 4OKIA 3T52A 2B2XA 4KBYA 3H99A 1LGYA 2QRQA 2XQGA 3ZV7A 2RHGB 2V3WA 3UMFA 3NTQA 3SMQA 2HJ9A 3AUTA 3D2BA 1FXWF 2JARA 3EDYA 3I64A 1EXVA 4KX3A 3A7DA 1QZXA 3PE6A 4BFTA 5CXUA 5JV5A 4CKXA 3OQBA 1NW6A 3QWBA 2BGNA 1MVLA 2OG2A 5CG2A 3INTA 1RLTA 2XTZA 2HQ1A 1N6RA 1U2DC 4RHYA 4NBTA 2XZTA 5CPFA 3WIDA 3S1LA 3CLRD 1YFZA 1H5QA 2A1TR 2ABWA 1X38A 2OTCA 2ZIXB 3R7DA 2V7EA 4DR1B 1ZD5A 1JFLA 3L06A 4UHHA 5JD4A 3RTGA 1ZY2A 2JD1A 3FOFC 5JPCA 1PL0A 4I5FA 5F12A 3GLHB 4LTNA 5HKOA 1OR8A 5LVAA 3A6HA 1GPKA 5FOUA 1TUGA 2VI5A 3E1SA 4JFAA 4UATA 4Q1FA 2ONJA 1ODCA 3I1JA 5EWLB 1NP6A 1TM3E 2XWJI 4E7OA 1DX9A 1YCGA 3KOOA 2I3AA 4OVKA 4J91A 3R41A 2P9BA 4YJHA 1GNPA 5AJZA 3CBQA 1UXGA 1BO6A 3MCAA 3HJUA 4QQ8A 3IKLA 3JQ9C 1LW7A 1VKHA 1BG6A 3MZ0A 3I2HA 2FETA 3VSEA 4BWFB 4QJ3A 3K0HA 2M98A 4PINA 1A4XA 1OXKB 2BW0A 3JCZA 2PS1A 3L02A 3WZMA 2WYOA 1G9XA 2BFDA 3ZY5A 4UZFA 2YDYA 2D0OB 1P4SA 1T9BA 3PNQA 5F21A 3H05A 2QR5A 4LSGA 2OPHA 1MX3A 3FZNA 4N4AA 3LWNA 3ICOA 4L0MA 4DIUA 4HAWA 2IUFA 2IYUA 1K5PA 4TMTA 4TKLA 2FK8A 4FR2A 4UMEA 1DRVA 5JR3A 1F14A 1U7PA 4XYEA 1Z39A 4TUYA 2GN1A 2PH5A 2SCUB 1GR0A 3HU2A 3IBFA 3SPXA 2DR3A 1YBAA 2G77B 2C3YA 1HI9A 1PBNA 2QDXA 2OD9A 2YHIA 5CGZA 4C1BA 3G82C 1XHEA 3HN6A 3R5FA 4TTTS 1E4YA 2A7QA 2Z83A 4HVAA 1DBSA 2V8OA 1BS1A 4C6SA 6GPBA 1QH1B 2Q1UA 3DVQX 4JA2A 1JAHA 1UBKS 2YZ2A 3AUUA 4UCXA 5DNWA 2XPCA 3L2OB 4OJMX 5EIBC 2V4ZA 1O87A 1C7FA 4R1MA 5AVTA 3CY6A 4ZT5A 3V8EA 1GDTA 3OZBA 2WUGA 3R20A 4MPDA 5AR1A 3SQOA 1RYHA 1QP7A 3LC7O 4A36A 3MTJA 4RA6A 1PS9A 1HNXB 1QH8A 4CLEA 2ENUA 3BB1A 1KZHA 3LXUX 3W79A 1UQTA 2FEAA 2GJ9A 2YJ3A 2C5LA 2BWJA 2QUIA 3OZTA 1R4ZA 3CLTC 4L4RA 5J2TA 3O8QA 3ZVMA 3KDAA 1NXWA 2VT2A 2PTHA 3FWYA 4B3DA 3RC3A 4UFPA 2H1SA 3R6TA 1ZD3A 4PR3A 5U1PA 1UBOS 3WL8A 3B3AA 4CFYA 2ZJFA 3C3CA 3M6IA 4DDKA 2RCNA 1XZEA 1QFSA 3EIFA 4NYMR 2EJBA 3J81k 3JAKA 2A4KA 1F2VA 1XE3A 4MKXA 3V7WA 1BKYA 3WNQA 4DG8A 1J7KA 2IP1A 1M33A 1PL8A 2ZANA 5BQXA 3SK0A 1ZITA 2P2YA 2Q2NA 1DOHA 2QRVA 3EZXA 4GOJA 4DC9A 4XWWA 2OILA 3Q10A 3THWA 4BV3A 2ETXA 3AJDA 2X0IA 3PPXA 3D8SA 3THSA 1DZ3A 3SC3A 4BC0A 4QT4A 1QH9A 4WBNF 1KWKA 2ZSHA 4Z4FA 3NANA 4CQJA 3OKFA 3VPBA 1I7SB 2R44A 5C3MA 4FCWA 3V1MA 3AG5A 3OEHA 1UEXC 3L0PA 4MJ7A 2F1KA 3W77A 5ICMA 4OYHA 7AT1A 1PHPA 4DMKA 2YFYA 1NDHA 4FGZA 4XRRA 3TRDA 5LNK1 3PXXA 4L3VA 2XKBA 3KX2A 5AVRA 2QF7A 1TO6A 3HADA 2XUIA 1TOAA 5AJTA 2AOUA 5EN4A 4X71A 3W5AA 2VP2A 1O3YA 1S96A 3PC7A 5AQEA 2NMVA 1RJEA 2EFGA 1YR3A 4PX9A 4XGIA 5CNKA 1TZ2A 2DKFA 4KQJA 4ZZ0A 5M04A 1LTKA 3FMIA 1UZAA 2NQ8A 3I01A 4KACA 3IS3A 1SU6A 2Z2IA 2ETVA 1ZW1A 4ZRDA 1GSHA 4B8YA 4BNLA 2CEAA 5EPEA 2NVWA 3GZJA 4C7BA 4QEKA 1RAFA 5K4AA 2V6GA 1J23A 3P27A 2QZZA 1AHIA 2H18A 1IVNA 1XDDA 2AVDA 2GLTA 1D9ZA 2BMAA 2RMKA 4TLEA 3SQLA 3V8RA 3ZHSA 2WV7A 1HC7A 3VH4A 2GWHA 2R7NA 1O95C 4LGCA 4XCQA 2YC2C 4FYJA 1D3AA 3IBYA 4PYLA 3CO5A 3DR5A 1XRPA 4GE3A 1VIYA 3NC0C 5ITZB 4GXRA 1UDWA 3WOHA 2RC5A 5AUOB 2NX2A 2R65A 4BQPA 2ORIA 4JXXA 1J70A 1FMTA 2I2WA 5IN5A 2AQKA 4V3CA 4RTLA 3LC2O 3ELBA 1TU0A 4O4LF 3WWEA 4UARA 4O1MA 1S8FA 3DE0X 1T2AA 3LBAA 4GBJA 1J0XO 3DH0A 4R1LA 1SVKA 4O2BB 2GLUA 2WEKA 5DDIP 3LECA 3V46A 1Y33E 5FPYA 3OE5A 5KDOA 3VV3A 2RAPA 4ITVA 5K9ZA 2H4YA 3O0DA 3PXGA 3M9WA 3WNDA 1V0JA 3L6RA 1ZMRA 3ZY4A 1A8PA 3RUFA 4WKOA 3Q7TA 2P6PA 4PRLA 4D8YA 4WXMA 1BMTA 1X9IA 4EY8A 4F2DA 3PPIA 4H9GA 2FPUA 4X65B 5JD3A 1U2SA 4KVZA 3TE6A 1MXHA 4KXUA 2HADA 1L8QA 4WN9B 1E7RA 4QODA 4PC3A 1JU9A 1N3LA 4XUGB 4XDHA 1IZ7A 3PS9A 3OJFA 4C0HA 4JX9A 2RJ3A 2WJWA 3L01A 4GUDA 4MUYA 5A4FS 2CNOA 4YJ2A 4BEWA 2ID8A 4NZOA 1CFZA 1NM5C 3QE9Y 2H08A 5JY6A 3BCRA 5ENDA 2RGNA 1QNLA 2NNLD 4CKBA 4Z51A 2MOKA 2XZDA 5LUAA 3VXKA 4TKUA 1HZZC 3EEYA 1J39A 2XNJA 3FLMA 2C5HA 3PLNA 1WE2A 2A59A 2BAGA 1YCFA 2H57A 2HPVA 2QX9A 3PWSA 4A9AA 4MZXA 1PTKA 4E33A 4ER6A 4MS4B 4Q9DA 2Z6VA 2CFTA 4BN4A 2AXNA 3GG9A 3HVRA 3A6JA 3ZOKA 5A4AA 4IMRA 2J3JA 3H2ZA 4W1QA 3ZUGA 3GROA 3QV2A 1XYVA 3H75A 1HE4A 1XYGA 1E6LA 1MEEA 2H17A 2OHHA 1ZIYA 3HKEB 1BOOA 3K4PA 2CLSA 1MIHA 3LCRA 1SVLA 2VSNA 3AONB 1IWBB 2ODTX 3VNAA 3GFFA 3E70C 1AF4A 1ZWKA 1NAHA 4OLJA 3AGPA 4AI6A 2XGOA 5JJLA 1O97D 3HP4A 2VCHA 2YS6A 1UKYA 3NDBB 3C6BA 2VUIB 4OSEA 4RS3A 2HJGA 4X1YB 4IHJB 3TRFA 1KBOA 1ZM2A 2P9QA 2C4TA 2HW8A 4XAQA 3FE2A 3TGWA 1JFFB 3G8DA 1MCZA 4B1FA 2E1PA 4B76A 1K4YA 3B1VA 1XTRA 4RAOA 4FYMA 3ZU3A 4UC0A 4EJSA 3FPKA 3HTXA 2QSZA 4N41A 1JG2A 5LYJB 2Z8YM 1UH5A 3T35A 1OYVA 3IBGA 5KKNB 3SHOA 1JG6A 1YS2X 4CLOB 1LU9A 5A04A 4EA7A 4N5IX 2VJPA 4HWTA 2GZ2A 3FG9A 5EQFA 4IXTA 4HJRA 1CETA 3QQ5A 5DLYA 1OXSC 3JASA 3I04A 1Z88A 4P32A 1G18A 3QUAA 3OWXA 3T9EA 4NFSA 5LP6A 3C1UA 3W8NA 4HWSA 1R50A 4B5KA 1BSVA 3IDZA 4LGYA 1LK7A 3KR9A 4MWZA 1WB4A 2BGMA 3MMZA 2C99A 1JKFA 3ZHBA 4AIIA 4ATNA 1OSNA 1W5EA 2Q5OA 3RBVA 4HRYA 3L0BA 4OJTA 4QT0A 2IYEA 5FFNA 3SM9A 4G5FA 3ZTWA 3CXRA 1FX1A 3VO8A 1E0SA 3DDCA 4J2TA 5HKBA 3E5NA 1JHOA 2ID9A 4B83A 4NRDA 2B4KA 5CB4F 1T6XA 3AF4A 2AHOA 4RQBA 4A6XA 4JC0A 4P4LA 4C4TA 4EW6A 3ENNA 2ZBPA 1V43A 3IXQA 4JYPA 2Z43A 1Y8QB 3RASA 3VU0A 4MR7A 2IYWA 3DE5X 5TVKA 4AG6A 4Y9DA 3LV8A 3LS2A 1EI9A 3A1NA 3HDHA 4TKZA 3N8KA 4ZP1A 5HOQA 2PX0A 3WNVA 2V7TA 1UF9A 4QUGA 4KDFA 3I5XA 4C0LA 1XTUA 1CUYA 5FWXB 1L4BA 3LF2A 4RVSA 5DGIA 3BHNA 1RC0A 4AWAA 3T1YB 2O8FA 4K87A 3MCUA 4O4LB 3LX4A 3AF3A 5BNIA 4D9JA 3DBOB 1SCKA 1H4TA 4CKZA 1P5HA 3VA7A 4L27A 1UM8A 2KX7A 5D3QA 2C1EA 2EHDA 1K8XB 3UC9A 3NYIA 4ZA2A 5BN4B 4ETWA 4AXXA 4F9TA 1PR1A 3FKQA 2C3MA 1YR2A 3OE7A 3B6EA 3PPYA 2DQSA 3PQ4A 4NQRA 5BUQA 4KFUA 3UMSA 3NAZA 4DS3A 5JMWA 4E22A 3AILA 5HKKA 1DWPA 1MOQA 3A2MA 3DTNA 4XR4A 5JVDF 4DJAA 2PHZA 1V16A 2RKBA 1TZCA 1HKHA 2EQ5A 3R9KA 2FSSA 4BVGA 2ZM5A 2QSYA 3R3HA 3GLKA 2VF5X 2YX1A 3E0QA 3QVJA 4G81A 4BKOA 3HO1A 1E96A 1KQPA 3QTLA 3K4HA 2OXIA 5AW1A 4DR3B 2GCPA 2QT0A 4Q4HB 4QPZA 3H1PA 1BH2A 1G20A 2XOKA 1P81A 3I73A 4Q0MA 4OHFA 2VLIA 4ARUA 4C4OA 5IT9A 1NU8A 2JF0A 3L04A 4RXUA 3DE1X 4AAYA 5KOJA 4EO4A 1EM8A 2VKQA 5FR2A 1G3QA 1GCIA 4L6AA 3OURA 5F33A 5HCIA 3ILSA 3SICE 1DINA 1YDGA 2FXIA 4WN3A 3AIMA 3KYCB 3L7BA 3U49A 5AHWA 1J5XA 1F6BA 1M2NA 3GXOA 4GOLD 4O4IA 3ILHA 2HF2A 1TW2A 2OCDA 3N3AC 3OMWA 2QLBA 4URYR 4Y2SA 1M2KA 1I7NA 3LPNA 1N5IA 2WUEA 2ZSJA 3KUUA 4YCBA 5EIAA 5PGMA 3HU3A 3GLGE 5CCXA 1IC6A 4BMPB 3LH5A 5KJ1A 4I4TB 1ENPA 3O9ZA 1CRWG 3DFUA 4E46A 3AV0B 1TT5B 2AN4A 1E5XA 4HS4A 5TPZD 3VZPA 4M1WA 5AM1A 3RSCA 2ZYVX 2WLTA 3TRHA 1FP2A 2RHHA 2VP5A 5THQA 3UV6A 1TRKA 4W8HA 1VKRA 4U2DA 1V4VA 1XT6A 5L3SB 2PGJA 1TK3A 2VHJA 1Z6AA 4CM9A 2I76A 3MJEA 4DDHA 3CZCA 4TRMA 1JW9B 4ZAZA 1FOEB 2PFSA 1WZIA 2A5JA 5ICGA 4BJ6A 5C7LO 4HO1X 2P68A 3EYWA 1XQVA 2PV0A 3DZFA 3FYHA 2PU5A 4HEHA 5AO9A 2CVFA 2YFQA 3PX2A 1GNTA 3I6ZA 4ZQHA 4A91A 1EIWA 4HQ6A 2R3SA 1MGPA 4R3NA 3E4CA 1JSRA 4Y9SA 4A92A 1QQ7A 1IWOA 4BQOA 1L7EA 1PG2A 4WY2A 3FDZA 3IAXA 3I2GA 1MZPA