3D82A

Crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GMQTKVINFNDKFSLFNQHWSPRVIAEMNDYQFKLVKVEGEFVWHEHADTDEVFIVMEGTLQIAFRDQNITLQAGEMYVIPKGVEHKPMAKEECKIMIIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function with a Cupin Fold (YP_752209.1) from SHEWANELLA FRIGIDIMARINA NCIMB 400 at 2.05 A resolution
rcsb
source organism Shewanella frigidimarina ncimb 400
molecule tags Metal binding protein
molecule keywords Cupin 2, conserved barrel domain protein
total genus 17
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d82A00
3E6BA 1X8EA 4KL1A 2GC3A 4QMAA 5I8SA 2OZJA 1FI2A 1QXRA 3S7IA 2IXHA 3LA7A 1QWRA 4AVCA 1V70A 4JV4A 3PVBB 2HKXA 4MUVA 2Q30A 1ZZ7A 1NYWA 1QXJA 2CV6A 4I0BA 4Z07A 2VPVA 1GQGA 4KU8A 3H7YA 4Q0UA 5JSPA 4IEYA 5J48A 1YLLA 1RUOA 1SQ4A 5E1RA 5LEJA 2Z2SB 1YFXA 1YUDA 3WW4A 5JSRA 1Q43A 1VP6A 1CAXB 5J3UA 3KSCA 4PIZA 3WW1A 3G7DA 4LLOA 2XKOA 5J7MA 2XLAA 3FX3A 2BNOA 3KCCA 2OYZA 1YFYA 3RNSA 1ZVFA 3E97A 3MYXA 4XFCA 4R8HA 2BNMA 2K9ZA 3UKTA 3MZHA 2CAVA 2GH2A 3MPBA 4NVPA 4A2UA 4JVAA 3D82A 4LUMA 3RZZA 1GQHA 4MGZE 2MPFA 3WW2A 2BGCA 1TQ5A 1OI6A 4I01A 4D7TA 5CVRA 3RYKA 3ZDSA 4QGLA 4I3PA 3SHRA 2QVSB 2PHDA 3S7EA 2HJIA 4MH0E 4X6RB 4UXAA 1HW5A 3HQXA 4XF0A 3L2HA 3RYRA 1DZRA 2GU9A 5C6CA 4UBGA 4XF9A 5I93A 1VR3A 4ORFA 3CF6E 2EA7A 2UYBA 5JR7B 3SMHA 5I8YA 4XETA 4IEQA 3E5UA 2XLFA 4YSFA 1NXMA 5F1RA 5HI0A 5BPXA 1UIJA 4KWJA 1J3PA 1G6NA 1WLTA 4FAGA 2XLGA 4Q29A 4HN0A 5BXXA 5LRRA 1X7NA 4IEUA 5E16A 1RUNA 5FCCA 3BPZA 1DGRA 3U11A 1XE8A 3E6CC 1ZZBA 2IXJA 4PJYA 4KWLA 3NKTA 4BYYA 3EBRA 4IEWA 4Q0PA 2WFPA 4BIFA 2XHKA 2P17A 4MGYE 4O9GA 3LA2A 5BUVA 1SEFA 2Q4SA 1ZNPA 3BU7A 3H9AA 4I02A 5KHKA 4QM8A 3DL3A 3IDCB 3HIFA 3FWEA 1LRHA 3HT2A 1H1IA 2QDRA 1H1MA 1O3QA 4XF3A 4AQ6A 1L3JA 3QOPA 1RL3A 5C8WA 4XFBA 3LAGA 3NSTA 4AQ2A 5I0RA 4YYOA 4Q0QA 3SCHA 4TLFA 4XFHA 2Y0OA 1QY4A 1IPKA 2UYAA 2FMYA 5I91A 3H1MA 1OMIA 2OA2A 1WGPA 4IEZA 3QACA 3D0JA 2ATFA 4IESA 4ZU5A 3ES4A 4IEVA 1FXZA 2XL9A 4MX3A 3BALA 4YARA 2FQPA 3RYPA 1EY2A 4Z82A 5I0TA 1JUHA 4HSLA 3WW3A 3PLQA 4OLLA 1J3QA 2ET7A 2PAKA 2E9QA 2PYTA 3EHKA 3NVCA 3R6SA 5FLIA 3GBFA 3USSA 3DN7A 5JSOA 4F8AA 3ST7A 1J58A 4QX5A 2B9UA 2ETEA 4ZU7A 1XRUA 1U12A 2H6BA 4HZFA 1OFNA 1YWKA 4QGMA 1O3TA 3H1YA 3SCFA 3FJSA 4AVAA 1NE6A 1DGWA 1LR5A 3C3VA 4J1XA 5D1IA 5FLJA 3CEWA 4HVRA 4MGKE 4F7ZA 3RPQA 2PAEA 5EFUA 1DZTA 3S0MA 1ZRFA 3H50A 3LZZA 2GZWA 2C0ZA 4HVOA 2BEOA 3SXWA 2BNNA 2UY9A 4HMZA 1ZZ8A 3ETQA 4ONUA 3SCGA 3GYDA 4MGIE 2D40A 1UIKA 4WVZA 1O3SA 2PQQA 4LEJA 2QJVA 4BHPA 1O5UA 4AXOA 1X8MA 2UY8A 3UKVA 4N9HA 1CAVA 1YFUA 4IETA 4JTNA 3E5QA 4PIXA 5CU1A 2B8MA 2GC1A 4GULA 4XEZA 2GC0A 4BH9A 5FQ0B 4I2OA 5KHGA 3FE5A 1J1LA 2GC2A 1PMIA 4CYDA 5BY5A 5KBFA 3IDBB 5LEKA 1ZZ6A 3ELNA 1J3RA 3N4MA 2H0VA 4L11A 4IERA 1RGSA 2B5HA 2Q1ZB 4FBFA 5KHHA 4DINB 2KXLA 1CAXA 3OD0A 3UKNA 1UPIA 2H6CA 1J59A 1Q5OA 1ZX5A 5BV6A 1LKNA 1I6XA 4LA2A 1UCXA 4XFIA 3CLPA 4UBHA 1LB2A 3I59A 5I8TA 1NZCA 1EP0A 2I45A 3CJXA 2XKPA 2DCTA 3JZVA 1ZREA 1YFWA 5FPXA 4MZUA 5LRSA 4P9GA 3H1WA 4HN1A 5FPZA 1UW8A 4EWEA 1CAUA 4OFGA 2PA7A 3I54A 4MV2A 3H3UA 2VECA 3OGJA 4XFFA 3IWZA 5I0SA 2ET1A 5JCTA 1CX4A 4KWKA 2IXCA 1CGPA 4EV0A 4META 2PAMA 1ZRCA 4XFGA 5FLHA 1CAVB 3OTFA 4IEPA 3KGLA 5KHIA 4WBBA 1NE4A 4JTOA 1Y9QA 4LA3A 4FT8A 2K0GA 4YNIA 2EVXA 2Q0AA 4LTAA 2V09A 1CAWB 5FQ0A 5AVPA 2VQAA 2F4PA 4Q0SA 3ACLA 3IIAA 2GAUA 2O1QA 4HVQA 4X6QB 1XE7A 3LA3A 1CAUB 3I7DA 4Q0VA 4I0AA 5CADA 5FDBA 3RDIA 3TNQA 2XL7A 1WA4A 5EZWA 4IEOA 3NL1A 3FFQA 3TNPB 3LWCA 4N9IA 5T3NA 2PFWA 3I59B 4IEXA 3D0SA 2BYVE 3KGZA 3EQEA 3O14A 2PHLA 1ZRRA 1EPZA 1CAWA 3H7JA 2EAAA 4E2GA 1UD1A 1EYBA 1PM7A 4L2NA 1O4TA 4E2QA 2XGXA 4E2SA 2CGPA 1RTVA 2PTMA 5K8SA 4H7LA 3BB6A 4QXKA 4XFAA 3CL1A 1O5LA 1RC6A 4XF1A 4AVBA 4FAHA 4RD7A 4EWDA 4WZCA 3M3IA 3LOIA 4HSJA 4O9EA 3FZ3A 4XF4A 3CO2A 4KU7A 3OCPA 3IBMA 1O7FA 4HLTA 1O3RA 1ZZCA 2QNKA 2IXIA 4I09A 3VHRA 3PNAA 2N7GA 1ZRDA 4LULA 2IC1A 5I0UA 2ZKLA 3HT1A 4LUKA 1YHFA 2OPKA 3NJZA 4K8FA 2IXKA 2O8QA 3KMHA 2MNGA 3FHIB 1VJ2A 3E6DA 1FT9A 3ROUA 1IPJA 3EJKA 2MHFA 3NW4A 3M70A 2ZCWA 4QM9A 1ZZ9A 3DKWA 1SFNA 4PIYA 2D5FA 3H3ZA 3EO6A 3DV8A 2OZ6A 3E5XA 4B29A 4D7SA 4EWAA 2D93A 3OF1A 3MDPA 3H8UA 3BCWA 2D5HA 3ES1A 2IXLA 2CAUA 3U10A 5KHJA 1X82A 3U0ZA 1Q3EA 1I5ZA 4EROA 4R52A 4YRDA 3B02A 4QGNA 2QCSB 4HBNA 5JAXA 1Y3TA 1OD5A 2WC2A 4J1WA 4ZU4A 2Z69A
chains in the Genus database with same CATH superfamily
1ULOA 2QQVA 4QKFA 3W5MA 3E6BA 3I3EA 4QB1A 3ZPOA 4TLGA 5I8SA 1FOD3 1RUD2 3N9OA 1ZBE2 5FPUA 3SH4A 2DBNA 1QJU1 1QWRA 3JQWA 5FWEA 3BU0A 2Q5TA 4ARYA 5FREA 2NM1A 1PZ7A 4JV4A 4LHLA 4QPIA 1W6MA 2XQRA 5LA2A 3NQHA 3GHNA 2JECA 1H2MA 3PVBB 3WV6A 4JGYC 1QJU3 2GDFA 4MUVA 3SKVA 5A7OA 5A32B 2XJVA 3D5OA 3ZFGA 4A6SA 1QXJA 4RGAA 2J1RA 2VPVA 3GALA 1GV9A 1ASJ3 4XBNA 1JOPA 1C28A 1FV3A 2ZMLA 3LF7A 3MICA 3OEBA 5IVJA 5EYYA 4IEYA 4G4FA 4ES9A 3MIGA 1YLLA 2JDZA 1IS4A 3ORJA 4N43B 4QX2A 5C4WA 3T1MA 5JZGA 5F7UA 5LEJA 5JSRA 2Z42A 5BNPA 2UWCA 5E89A 4FPLA 4R4XA 1BBT1 3D8CA 5A7WA 3Q9OA 4IV1C 3O1MA 4CDQB 1K5MA 1RYYA 1AUYA 1SDWA 3G7DA 3OGSA 2XKOA 4LLOA 4NHLA 3TN93 4CCDA 4DNYA 2XLAA 5J7MA 3KCCA 3T4HB 1O8PA 2R071 3NNGA 1HN0A 2XHNA 3E97A 3H0OA 2B9VA 3NJVA 3MYXA 1SLIA 3MEPA 2ZEXA 3UKTA 1R081 3MIHA 1JZ2A 4LOSA 2TBVA 4HETA 2CAVA 4UWDA 5JUVA 3ILFA 3MPBA 4NVPA 3DCQA 1SLTA 1MQTA 2B46X 4LUMA 5GKAC 1GQHA 3RZZA 1OKOA 2XONA 2W94A 2VMEA 3JB8A 3DYOA 1OH4A 4E4SA 1TQ5A 4DUVA 2A70A 4I01A 4D7TA 1F4HA 5CVRA 5LA9A 5LY2A 3ZSEA 3ZDSA 4I3PA 4UT5A 5JXHA 3F95A 2HJIA 2HWC2 1V9U3 3DXUA 2Y34A 4FOVA 4X6RB 3WF3A 4UXAA 5CBLA 3TEYA 3L2HA 1TE1B 1YRZA 2GU9A 2XMLA 1BVVA 2JE9A 1VBD2 2R062 1CZVA 1PK6C 3THDA 1S0IA 4NPLA 5C6CA 1UY2A 3PUSA 1SFYA 5A32A 1PO12 5IVBA 1VR3A 1BVP1 1UYPA 3HMYA 4JQTA 1UMZA 3CF6E 4QU2A 1EUTA 2VMHA 3VZLA 3O1TA 3B3QE 3O1OA 1XNCA 3IAPA 3E5UA 2XLFA 3RZMA 1NXMA 2CY6A 2A6YA 2VH9A 5BPXA 2OX0A 4AVTA 4JCKA 1D4M1 1AX2A 1YI9A 2E26A 4Z2WA 1B35B 3S57A 4F83A 3J4UH 1P8JA 5DUXA 4Q8KA 2VC9A 4XZPA 3VB9A 1SHWB 2RHPA 3AKRA 2WIIB 4QDSA 3FUOA 4NROA 5FZ9A 5FP9A 4FPYA 1UOJA 4FBFA 2VZVA 5FZAA 5LATA 5T55A 4FTEA 2WYSA 3NKTA 1LGBA 1TME2 2W1WA 2RR11 3AMNA 4A44A 2BGOA 5FZ3A 2WZPP 1VRBA 5DAXA 4ZXEA 3GNEA 4YW7A 1RUE1 3C7GA 1TNFA 2GNTA 1HRI2 3J9SA 5FMOL 4P9WA 4ET7A 3V0BB 2XHKA 1SLLA 1ST8A 4O61A 4TWTA 1KJRA 4O9GA 4Y5SA 3LA2A 2HWE1 5AC93 2NZ9A 1VRH1 5L9BA 1XSRA 4V2WA 3BPSA 2VOXA 1R1A1 4FP3A 4SBVA 3ZR5A 1OVSA 3ITQA 4UFHA 2FMDA 3H9AA 1ULFA 1VBB2 4NRMA 3EB7A 4R9AA 3PUAA 4RL7A 5GLZA 5HXMA 4Q4W1 3O1RA 1ULEA 2ZX2A 4AEDA 1JZ7A 2P37A 4IV1B 1S4CA 4Y3OA 1VAVA 3HWJA 5HCBA 4BMBA 1VMJA 3AXDA 3A21A 3USUB 3ZMNA 5C3SA 2RE9A 3V0BA 4B1MA 3TN92 1DQ6A 1LOAA 3AJZA 4FSJA 1OA4A 1H1MA 1Y43B 4SLIA 3FHAA 4MGQA 4DZGA 3K4DA 1VMHA 1YI7A 2PN5A 1L3JA 3LB9A 2HH9A 3QOPA 2PXJA 2Z4FA 3OGRA 1ACCA 4A7YA 2VNGA 4NAMA 2DFCA 4CVUA 3PJYA 1J84A 4Q0QA 1CPNA 1LHOA 3HOBA 4XUPA 5I0DA 3M3EA 2NN8A 4XC9A 4HK9A 4ZZ5A 5A6QA 1QY4A 3ZXFA 1JMUB 2W68A 3H1MA 1KEXA 5JZGB 4BQ1A 4Y4YA 4TSVA 1WGPA 1JTZX 5CFDB 1NLQA 3KT4A 3VD9A 1SCRA 4OQ8A 1RXGA 3P3NA 4XIKA 1C8M3 4RFRB 3RMYA 1E57A 2VMDA 4ZU5A 4COZA 1W2OA 2Y60A 3ES4A 1POV1 5HCFA 2VQUA 5A7QA 1URXA 2RM22 2RS31 3QLQA 5LASA 2WFF2 3KLSA 1JU3A 2GP5A 1R1A3 2DBIA 1JBCA 1LU1A 4ZPIA 4YARA 1OFSA 4XJWA 2IFWA 3BVCA 3BIEA 4Z82A 1LOCA 1N3PA 3VGIA 1KGYA 1XBFA 4S2HA 3DXTA 1FMD1 3FLRA 3MV01 5KXEA 2VMFA 4BWOA 3AYDA 2ET7A 2YHJA 1EPWA 2ADEA 2YU1A 4IV3C 2C26A 1IQDC 4A3ZA 1RUJ2 1VBB3 2A6WA 3MF9A 2DUOA 2A3YA 4DXTA 5E6HA 2A73B 3WCRA 4BQ3A 4LO5B 4S2DA 2J1UA 1Q8SA 1I9RA 4GWJA 4XURA 4F8AA 2D3RA 2DF7A 2VUCA 4QB6A 4ASMB 3OPWA 5A3OA 1MZ6A 2QKDA 1SBEA 1OFNA 1SMVA 1QIQA 3V64A 5FJKA 1JYVA 1KQRA 4AVAA 5F9TA 3POFA 5FY9A 5D1IA 5FWJA 4HVRA 1SPPB 2GH8A 3IB3A 1H1AA 1UU4A 2YBPA 4LLFA 1NA1C 4YGCA 2PAEA 3O0WA 2E32A 5B2GB 1C8M1 1RMU2 2E63A 3MUY1 2V72A 3O12A 2R073 3H50A 1WZXA 1BMV1 5FTTC 3AFGA 4K40A 1GLHA 3WXPA 4CDWB 4YZ2A 3SXWA 2BEOA 4AQSA 1RVF3 3JQXA 2TEPA 1QGLA 2CSGA 2W1QA 3ETQA 3T3YA 1WCKA 2JD9A 4UW4A 4ZHNA 3AVRA 5F3CA 1CQ9A 4NN0A 1QXPA 3K48A 3OUHA 2UURA 3HNYM 3IMNA 4M01A 5JI7A 1AR73 5E88A 2PQQA 2GNMA 2ZGUA 5IVEA 1O3SA 2C6SA 2EIBA 3M7AA 4QHZA 4YG3A 1X8MA 1ULDA 1KFXL 4N9HA 2PHWA 5JOXA 3WHTA 4E4DX 4PIXA 5CU1A 3VD7A 2GC1A 3WY6A 4B4PA 4YM0A 2KD7A 4DUXA 1G9CA 4GH4C 3V56A 3VZJA 3A22A 4IQPA 1F31A 3FE5A 1TMF1 4I2OA 1IPSA 2JG8C 1TZOA 4CYDA 4C0HA 1FPN2 5LY1A 2DV9A 1CR7A 2JENA 5J37A 1ENSA 2DVGA 3N4MA 5ANQA 1UY3A 1CVNA 2H0VA 1W8UA 2AC1A 4PI2A 2D6MA 2FDHA 2BP6A 2WDBA 4CUBA 4IERA 4HK8A 4DOUA 4FQZA 5FXZA 1KD7A 4RQPB 5FYCA 2KXLA 4DINB 4EN9B 3ZSJA 5IK4A 2E51A 1PZ9A 2ENRA 2ID4A 2XJUA 3ACHA 3GJAA 3QH6A 3UKNA 2B7YA 3NMBA 3WUCA 4K1ZA 2ADDA 3Q8AA 1FOD2 4FPGA 2CWSA 1R083 1ZX5A 3MHZA 1ALYA 1RMU1 5HV4A 1LKNA 4GMP1 1W8OA 1I6XA 1ZA7A 1XSQA 5IK5A 2B45X 1OLMA 1COV3 1MACA 1AR93 5FZKA 1H9WA 1L7LA 1W28A 1VAKA 2PLV1 5FMOS 3THCA 2TUNA 4FXGB 5DAVA 4JZRA 1ZRIA 1U0AA 3ABZA 3ZFEB 2FCTA 2X29A 2WS92 3E1F1 1AR83 5F6KA 5LRSA 3B9CA 4QPGA 5L9RA 1OOPC 1WMFA 3SNMA 1Y7BA 3H1WA 2NMOA 3K4AA 1LEMA 4INDA 3PUIA 4P5YA 1CAUA 2PA7A 3AZXA 2QUOA 1JHNA 4LQRA 3WX5A 4Z92B 1OQDA 3AL5A 5I0SA 1RUF2 3S5QA 3DYMA 3U14A 1POV0 1MEC3 4J25A 3T1LA 2IZWA 1RJ8A 1MVEA 2PAMA 4LBQD 4YM1A 4LMFA 1AYN1 3A0NA 4XFGA 1U5YA 1WD3A 1TMF3 2CGNA 3OTFA 1YQ2A 4EE2A 1LCLA 4CP9B 2FDJA 2XR4A 3QD6A 4WBBA 2WABA 5FUPA 4JAAA 1V6OA 1W9TA 5IJRA 3OBRA 3VD3A 2I74A 2XUEA 2K0GA 4URTA 1JYXA 3CQOA 1REEA 3ZX7A 1NCRC 4XQWA 2ZOEB 5ACA2 3GJBA 2VQAA 4NRPA 3IIAA 1SBFA 1VPHA 2GAUA 2VZQA 2X10A 1GICA 4KI5M 1B35C 3I7DA 1W6PB 4XBLA 1QOOA 4B7KA 4I0AA 5FXVA 1XB9A 3TNQA 1ENRA 1H30A 4UF0A 4AW7A 1VLNA 4BDVB 1PVC2 1W0OA 1WA4A 2OPWA 2VJXA 5DAWA 5FY7A 3N9NA 2LALA 4LBOA 1VBD1 3BGAA 3LWCA 1N1SA 3JBG1 3CZUA 2QZ3A 3VDDB 4BA6A 1X33A 4YVWB 5EP9A 5C9AA 1E5SA 3HAGA 1G8WA 3D0SA 2C5DA 2WZR3 4M3CE 4JQRA 3SISA 2R16A 4IV1A 4IE7A 1ND2A 4Q5OA 1VRH3 2P5BA 1WD4A 3P5BA 1HRV1 1LECA 2W87A 3HVDA 3PU8A 4OUEA 3W20A 1HIXA 4XDPA 1UD1A 3VL9A 4D69A 3FBMA 3VKFC 4COWA 1O4TA 2YROA 4HPKB 2G4IA 1WCSA 2GSYA 4E2QA 5C5UA 3AKPA 2AZ5A 2P4EA 3N36A 3T30A 4E8DA 2WNVB 5C9AC 1JZ4A 4H7LA 4QXKA 1UO9A 4Z1VA 3BOWA 4Y24A 1VIWB 4XF1A 1UPSA 1MQTC 2BBAA 4Q4X3 2W95A 1W8TA 4EWDA 1DLLA 3LOIA 3FZ3A 4C8DA 5C4WB 1HKDA 2R1DA 1LESA 2CL2A 3OCPA 4JRLA 5FP8A 4X8NA 4AQTA 1HRI1 3EYPA 4IUGA 2MEV1 2QNKA 5ACA3 1TMF2 2AEZA 1MS4A 3ZSLA 1W2TA 3VBFB 4LE4A 2QTWB 4OHYA 1ZRDA 4LULA 1OLME 2RDNA 4LUKA 3KQ4B 4BLIA 5C33A 2I07B 4CXXA 3MW3A 2OPKA 3NJZA 2E7QA 2IXKA 2WNUA 1RUH1 1VJ2A 1QQP3 1IPJA 3EJKA 5GLUA 3I3DA 3M70A 3N3HA 3WG2A 4LHSA 4N8MA 5CIRA 1GUIA 4FPHA 4NIAA 4QM9A 2OIIA 5ACA1 3NKGA 1GSLA 1ZZ9A 5A3TA 1SFNA 1D0GA 1AR62 4XDOA 1UYZA 5FZBA 4M4PA 3EO6A 2ZX3A 1R1ZA 5FZOA 4B29A 5GM0A 3ZXLA 2D93A 2RJ2A 5A1AA 2HBTA 1C8M2 3V0AB 4CU7A 1ZBA3 1E5IA 4BZ4A 4K20A 4CCLA 5ABJC 3DUIA 2VBBA 5IVFA 5KWRA 3POIA 3FBYA 1ND3C 3U10A 5KHJA 2W08A 1AYM1 5JLVA 3U0ZA 3C7OA 4YM3A 1GNHA 4LR4A 1TME3 3TB0A 4EROA 3HJRA 1A8MA 4NWVA 4YRDA 4P02B 4QGNA 2ZHNA 4WV8A 1HRV3 5IWFA 4OUMA 2OVUA 2VY0A 5CISA 3RZGA 3LIGA 3M3CA 1GWKA 5A80A 5FZIA 3A7QA 4XUNA 5ABJA 1XNBA 1YC61 2DCKA 5IYYA 1RB8G 2HYKA 3ZMOA 5A3PA 2BU9A 3F2ZA 4HFSA 2PELA 3GHMA 5A3UA 1PK6B 1RUE3 2DTYA 2GC3A 4QMAA 1Q8QA 3SH3A 4GJYA 2OZJA 3S7IA 5EXOA 1QOTA 1DQ4A 4IGOA 2IXHA 1Y9MA 3U4SA 3ZN5A 4D3WA 4E8CA 4D0QA 5C3QA 1VBA3 1RUF1 4AVCA 4L0PA 3S5AA 2VOKA 1UQXA 1V70A 3WINE 2ARAA 2HWB2 3VBSC 1ND3B 3WD5A 3K46A 1W0NA 4M3CB 3CJIB 4WM8A 4XBQA 1NY71 1GZWB 2VVDA 1NYWA 3NNMA 2CV6A 1HJGA 1CIYA 4Z07A 5DAPA 4Q0UA 5FPVA 5JSPA 4FFIA 5FZ4A 2X5IA 2GNDA 4XCBA 5J48A 1VALA 1CD3G 1SQ4A 3N35A 2Z2SB 4CEWB 1RIRA 1V6JA 3WW4A 2K46A 3U75A 3DKQA 3MLJA 3POEA 2JX9A 4ZY9A 2HWC3 3U78A 3I2GA 3DPRA 1Q43A 3VDDA 4Y1ZA 2UWAA 2P6HA 2VOTA 3LFIA 4MO3M 2JE7A 3NNLA 4P9YA 4RFT0 4W8JA 3ZYRA 3CNAA 1AYM3 3M4FA 2HEVF 5IAXA 5ISLA 2BNOA 1QOSA 2HLEA 2QBXA 4Q1RA 1H6XA 2OYZA 4LBNA 3FUQA 5F5IA 2Y64A 2HWE3 4M0HA 4XXAA 2RJKA 5CYYA 2WNEA 4QD2A 3T2OA 3VBRA 4AI2A 3WQ0A 5GZCA 2ARCA 1IKQA 1KS4A 4QQHA 2K9ZA 3HR9A 2XVGA 1US2A 3ZM8A 3MZHA 1MVQA 1GMMA 3LSDA 4YVSA 1RUD1 4A2UA 4IXLA 2VCCA 2D98A 2GP3A 5A1LA 4RR3C 1WMEA 1GOFA 1QJX1 2BGCA 2JD4A 5ANNA 5D2AA 1OI6A 3MUZ1 4IV3A 4B1LA 4CEWC 2YDEA 4JGZC 3RYKA 4QKDA 1BEV2 3ILRA 2QVSB 1HQNA 2PHDA 4LKEA 1MZFA 1JZ6A 3ZYPA 4EZHA 4CP1A 3I3MA 5DUVA 1QQP1 1LENA 3MFAA 4XF0A 1HW5A 3HQXA 3HEIA 4ZS3A 3RYRA 3T0BA 1RUE2 5L7OB 1YNAA 4NHKA 2EIEA 3J7LA 4W50A 3I2DA 2L9LA 1F4AA 4RR3A 5I93A 2JKBA 2WO1A 3GZEA 3GM8A 2HEYF 1SLBA 2K2SA 4ORFA 1OKQA 4NO4A 4UI9L 2QQLA 3J8F2 4JGZA 5A7SA 2EA7A 2WO2A 3AZVA 1QH6A 2UYBA 2ZGNA 3PJQA 4OZXA 3IKWA 4UFIA 4BK4A 1DGWX 1V0AA 1NA1A 2OUHA 2ZJCA 4BQ2A 5HI0A 3UT0A 5K9YA 4GALA 4KWJA 4LBKA 3UV9A 4XMAA 1WLTA 5JXJA 3VBHB 1A78A 1RUF3 4FAGA 5D8AB 4FCAA 4Q29A 2VQ0A 1MEC2 2VZPA 3JB4C 5JDBA 2WS91 4GJZA 4AEKA 5A3MA 1X7NA 3THPA 3ASIA 4HKOA 5E16A 1RUNA 1WMDA 5FCCA 3BPZA 1DGRA 2PLV2 2VZOA 1VBE1 1GP6A 5LBEA 5BNOB 2IXJA 3BYWA 4HOOA 4PJYA 4OULA 4ZONA 5FP3A 2WQZC 5C70A 1SBDA 4C1XA 1JN2P 4FOQA 3GBWA 3QBQA 3ACGA 3USUA 4CE8A 3KB5A 4A41A 4DUWA 3ZDVA 2ORXA 3EBRA 4LBQB 1W6MB 3IDAA 1GNZA 3RRDA 2D3PA 1HRI3 1V6NA 1AR82 4GZ9A 1UZVA 3NAPA 5F32A 5JVVA 4AAXA 2WAOA 1BMV2 2FDGA 4IL7A 3T2QA 1PM4A 4AAPA 4RGKA 2DU1A 2WFF1 3MF6A 4Q4Y3 5DMYA 2WWJA 1RUC2 2FHRA 3PDQA 2Q4SA 2BW8A 1C1FA 1FPN3 3WHUA 4AFDA 3IAQA 3RMXA 4LORA 2XJQA 3TN91 3KD4A 5C8CB 3TYJA 5KHKA 4FPKA 1GQPA 4GWNA 2WN2A 4P14A 5BNOC 3DL3A 2P34A 3POBA 1BEV3 5FPBA 5K0UC 3MPPG 3ZXEA 3WP4A 5A6XA 3I97A 3UYJA 1K5MB 1QF3A 1R082 1VBB1 2IWGB 3I3QA 5HPOA 5KC6A 4DPNA 3CZJA 2VVFA 4AGRA 1XU2A 5FOJB 5F37A 5FO8B 5J96B 1MS0A 4QQOA 2JB8A 4JKLA 3WDVA 4X8PA 3MLLA 4GKXA 2QDRA 3TWIA 4CCEA 4XUOA 4AQ6A 3PU3A 3NJXA 4CU8A 4CDUB 3LFMA 4XFBA 3O0VA 5K0UA 1QNWA 1HXS2 4AFMA 4YZ3A 4YGEA 3WLUA 4IE5A 3VUOA 5F3IA 4AFCA 5KC5A 1IPKA 4EQVA 5I91A 3M3OA 5J1XA 3VZNA 1XC6A 2JB4A 3K3OA 3VBHA 4IEZA 3QACA 1KDKA 5DUWA 4EN0A 5C9AB 3D0JA 5DZEA 1R1A2 5FYHA 3HBZA 5FXWA 2QQKA 4IEVA 4Q4X1 5IATA 2YGMA 5CFDC 1Z7S3 1S0BA 2EALA 3POGA 1SCSA 4MX3A 5FO9B 2FQPA 4CEYB 1PHMA 2XPJA 4PBOA 5IFPA 1D0HA 1JUHA 3JBG2 2YXSA 1D7PM 3ZVXA 1NCRA 1Q8OA 5KXDA 4MG2A 1K3IA 2XB6C 1C5IA 4JDNA 3FLTA 1ODMA 1ZM1A 3GZAA 2WR9A 4Y4RA 2Y33A 1NQJA 1CWPA 1WBLA 1TME1 1WCQA 2ZGQA 4M3CF 4AFAA 4ATEA 4C0BA 4AGVA 1E5HA 3KT7A 1NG0A 3WSOA 1H9PA 4YVWC 4JRAA 1FX5A 4ISQA 1CN1A 3OY8A 1NCQA 3KHBA 5JSOA 4LKFA 4L97A 1C57A 3ST7A 4QXBA 4XIOA 4YLZA 4LKSA 3WG1A 4LBMA 1JODA 2VTXJ 4ZU7A 2XVLA 4HZFA 1YWKA 5FPAA 4QPIC 1W2UA 1N3QA 4IGQA 3VD4A 3IPVB 3OEAA 5FRAA 1RHI1 1XNAA 4QKNA 3C3VA 4K9SA 2B4KA 4JGYA 2WFF3 1OC1A 2YPDA 5FY1A 1GANA 3WDWA 3WVJA 1JZ3A 2W1SA 3OUJA 3GDBA 1WUVA 2FBEA 2YG0A 3RGBA 1DZTA 1IOAA 3AB0A 2JDKA 3BKZA 3KV4A 3LZZA 4YW4A 1JOJA 2GZWA 2R1BA 4UYBA 2R061 3ATGA 4LT5A 1S0GA 3EXUA 2BVVA 4BISA 4QT6A 4HMZA 3MIDA 5CZKA 4ONUA 5F8PA 3SCGA 3GYDA 5H9PA 1L7RA 3C8XA 3N9MA 3HQRA 4K6BA 2WNUC 4YVWA 1PGSA 1YXWA 4WVZA 4N43C 3APBA 4IE6A 1JH5A 1O5UA 4KNCA 4R4ZA 1HJFA 1CAVA 1PMJX 4IETA 4JTNA 5F2WA 1U5XA 4Z2AA 3O1UA 5FZCA 4GULA 1JYCA 1DQ0A 2SBAA 4LIVA 5KHGA 3URFA 4NHMA 2VCAA 3O0XA 4DY5A 1PMIA 4LHNA 5KBFA 4Q4V3 4UFMA 5LEKA 1HV1A 3J26N 5HXVA 2CHHA 1DZQA 4YVSB 4L11A 1CJDA 1DHKB 4OMDA 1RGSA 2B5HA 4TTGA 3IMMA 1JU4A 4WVMB 2D97A 4QWNA 2IVJA 2H6CA 2YPJA 3ZIWA 2A3WA 3MO4A 5C8CA 2J1EA 4FFHA 5DAQA 3RSJA 3ZXGA 3VN4A 2RR12 2WLQA 5BV6A 3WG3A 2JXAA 1KFUL 1A6CA 3J7NA 4LA2A 5CAZA 1OUXA 1VBD3 4XFIA 1MS8A 4OI1A 1MZ5A 1MPXA 3CLPA 4UBHA 4D94A 2JDPA 1WA6X 2JDNA 3I59A 5EJZB 1NZCA 3IM0A 3MW2A 3I2HA 1XYPA 1ZBA2 2BQPA 4QPYA 2WL1A 2JEMA 1LHNA 2OS2A 3LQCA 5FPXA 3WNMA 4QDQA 1KXGA 1WCDJ 3POYA 1W2NA 4D6SA 3PHMA 3U07A 4XQDA 1CPMA 2P3YA 4MV2A 3H3UA 1OOPB 5JI9A 1LEDA 2XOMA 2R32A 5F6LB 4XUTA 5IT6A 1CX4A 1JUIA 2IXCA 2QZ2A 2W2IA 4TYSA 3VBSA 1CGPA 1AF9A 4EV0A 4META 2VD7A 3PTRB 3ZFFA 2FZ2A 4AI1A 4DRRA 1NKGA 3WQBA 4IEPA 1GNYA 1N47A 3KGLA 1QJY3 4BK5A 2XBO2 1CZSA 5FY4A 2JDHA 2RVAA 4QPIB 5IVCA 4YNIA 5BNNC 4QAWA 2EVXA 1HDKA 2Q0AA 2AUYA 1CAWB 2V09A 2WN3A 4LTAA 5AVPA 1YQCA 4XJAA 5LA0A 1OD3A 3ACLA 4JC1A 3I3BA 4JDMA 1GZCA 1XJAA 2EXIA 5EWSA 3W58A 2JDAA 3ZYFA 1W9YA 2C1FA 1XE7A 2VAUA 1CAUB 1NLRA 3LA3A 3T0DA 4A45A 3WP3A 4IE0A 5FDBA 3JUUA 1ZYBA 4LXLA 5LK5A 4GWMA 5T5OA 1W06A 2AREA 3H8OA 3RI9A 1W99A 5EZWA 4IEOA 3ZKYA 3FFQA 3TNPB 1UOGA 4XJZA 1HXS1 2Q8CA 5BNQA 4HKLA 3VZOA 4AI3A 4YWAA 1H4GA 1W3VA 1PO22 1PX3A 4RS5B 2YBSA 2RS51 1G9AA 4YM2A 1EPZA 3GXUA 4UAPA 3VDDC 4XW3A 4BQ5A 1AX0A 4XUQA 2EAAA 2WWUA 1FPN1 1C3HA 4E2GA 4LK7A 5FOBB 1JYWA 1EV13 4OCTA 2AACA 4A7ZA 4JGYB 4WM8B 5FZFA 3ZYIB 3OBZA 1O8SA 1DCSA 1ULPA 1I1EA 4Q27A 4E2SA 1JHJA 3VBRC 2BDRA 1LOFC 1US3A 1H6YA 1RTVA 2DFBA 4I30A 4OZOA 2CGPA 1AJKA 2WQ4A 1LHVA 2PTMA 3ALQA 3M1HA 2VCBA 3WOGA 2D44A 1UU5A 3CL1A 4Y22B 4BM8A 5K0UB 1POV3 2Y26A 1REDA 1W8WA 4XF4A 4Y1UA 4KMQA 4PQ9A 5FY5A 1ZBE3 4PHZA 1IS5A 2X53S 2ZGLA 4Y5Z0 3C7HA 3DECA 4KU7A 3VBSB 3IBMA 4Q1PA 4CEWA 3UESA 4TN7A 3ZFFB 2QE3A 4HLTA 1S0EA 1O3RA 1ZZCA 3WF4A 4CU9A 3FL7A 3VDBA 4MXWB 5EJ1B 2DWRA 1S0JA 5FYMA 5DN2A 3ZR6A 4QKBA 2N7GA 4KGGA 2D6KA 2Y6FA 1IS3A 5JR2A 1TG7A 2IC1A 2IFRA 5FZ0A 2CTVA 2ZKLA 2D6PA 3LDBA 5FAXA 1BLZA 1U5IA 1YHFA 1GZ9A 1YEWA 2VCMA 2VTXA 3AC0A 4NWWA 4FFFA 4WM8C 4AVSA 2O8QA 1QJY1 4QXHA 5CKMA 1AR71 3VBFC 4L99A 3NAPB 3RVHA 2V5YA 3E6DA 5FBZA 1VBE2 2ZX1A 1TEIA 4LO4B 3RJRA 3ROUA 3T2PA 1GOHA 2OKXA 3ZIXA 5GLVA 3ZYGA 3J8F3 2X5IC 2BV4A 2GMMA 2ZCWA 2D6LX 4AEDC 4DFSA 3I2OA 3DKWA 3A0KA 4CZSA 3NV3A 1LNSA 2ZPXA 4PIYA 4PLOA 4PDWB 4CP2A 2B39A 1SLCA 2E7AA 1QH7A 2ZGPA 2BGPA 1PMHX 5CNAA 4JDOA 4CRQA 2RMU1 2A7AA 5BNPB 3NV4A 3OF1A 1S1AA 1GFF2 4XXPA 5FY8A 1PIV3 1W0PA 3AL6A 4B3NA 1LGNA 1PO23 1CIWA 4N90A 1DQ5A 2D5HA 3ES1A 3RI8A 4BU2A 2QQNA 3Q8BA 4GD4A 4P00B 2Z79A 4QB2A 1V9U1 5FZDA 2DU0A 1O91A 1RINA 3RWKX 3L2YA 2QQJA 4NIDA 1W6OB 2FCVA 5J36A 4NIHA 1GZWA 2YC2A 5FP7A 1N1VA 5FZ6A 2QCSB 1S0CA 2WJSA 3B94A 1XNKA 2VOVA 3BIWE 5JAXA 2QQMA 3OJBA 1OD5A 1ZBA1 3J7MA 4MYEA 4J1WA 1N1TA 2P2KA 3WNPA 3AP9A 3SQOA 1AL0G 3KS7A 4Q4V1 4Z8BA 3MBWA 1X8EA 4KL1A 3VBUB 2A5ZA 2EF6A 1ASJ1 2F6BA 1HV0A 1FI2A 5APAA 1ENXA 4RS5C 4TXWA 3LA7A 1SLAA 1W3XA 1XOYA 3T2TA 1G9BA 2Y6LA 1GBGA 3KWVA 5BNOA 3AKTA 5A7PA 1RVF1 1W05A 1ND2B 5IVYA 2YB7A 4GWIA 2A71A 2HKXA 4QPGB 4E4HA 3B7MA 1WWYA 1S2EA 1ZZ7A 3BTYA 1ONAA 4XILA 1NCRB 3KF3A 3VKNA 4AF9A 3CKHA 4KU8A 4OHWA 3BUCA 3WZ1A 4ISRA 5K4LA 5FP4A 4QDRA 1H8TA 1AX1A 4PBPA 5JMOA 3HBKA 1PNFA 2MEV3 4WVVA 4UW3A 5E1RA 4AYUA 5CG9A 1H2KA 1LHUA 1QEXA 1YFXA 1YUDA 2EIGA 3B00A 4D7YA 4AEJA 3CHXA 2WZR2 3OD4A 1DYKA 1PIV2 2G1MA 3AM2A 3IN9A 1VP6A 1O59A 1CAXB 1J83A 3LDRA 5H9QA 4DEVA 5TSWA 2VNOA 2VW1A 3KSCA 4PIZA 3IIIA 1HX6A 1UOFA 2ZZQA 2HWE2 3ILNA 1HB2A 3FX3A 5F3GA 3HNMA 3WG4A 4ITCA 3KCYA 5FKBA 4J6GA 2Q1MA 4FVVA 3FLPA 4MHUA 3I2IA 3RZHA 4AFBA 4QPGC 4XFCA 3WDXA 4R8HA 2BNMA 4YFWA 1APNA 1LU2A 2R6QA 2GH2A 4RHV3 2Y0IA 4HKWA 1IKPA 3Q8EA 4UF0B 4AE2A 3KVBA 3WW2A 2XH6A 4QX8A 3TEXA 3PVNA 2YFUA 4FI9A 4XACA 3PMEA 2P1BA 1YJLA 4HG6B 3WUDA 4YG6A 5FK8A 2WKKA 4PQQA 3V0AA 5LCWL 2DUQA 2JDMA 4MH0E 2VZ3A 2Q8EA 2WWSA 4N7UA 3FC0A 1T6GC 1UL9A 1UZ0A 3WF1A 4K8RB 4FPEA 1W2AX 5JOYA 2FDFA 3O1VA 3LSEA 4LBQA 4PDWC 2VG9A 2WZEA 1ASJ2 1WKYA 2RDSA 2VMGA 4CCJA 4Q4V2 4HXCA 3C7EA 4XETA 4BJ0A 3N7MA 3HN3A 4YSFA 4IW3A 5F1RA 3KM5A 5FYZA 3CU7A 4HL0A 5FXXA 2YC4A 2J1SA 5JOZA 5FYVA 3R4UA 1H8TB 4HN0A 4FP2A 3WCSA 1G7YA 3NV2A 1AJOA 2GMPA 4GIQA 3TOJA 5L36A 2BERA 2WZ8A 3AZWA 4AI9A 1NCQB 5LK7B 3U11A 1NUKA 1ZZBA 2I2SA 1V6KA 1JXNA 1X50A 2VW2A 2WA4A 5CFDA 5G04L 4A4AA 2W0XA 1EUUA 4BYYA 2RS12 2DTWA 5CEHA 5A6ZA 2WO7A 4Q0PA 1OUSA 4DXSA 1K12A 5FKCA 4Q4Y1 1N3OA 1W6PA 5C4WC 5A6YA 1XPWA 5LWBA 1S2BA 2ZGOA 1DGRN 2VZRA 3SC7X 1UZWA 2WFPA 3BOPA 4BIFA 4CDUA 1QQP2 1UN1A 2P17A 4MGYE 1DQ2A 4QHOA 5BNNB 1PGW1 4U36A 1F2NA 4Q4X2 4C91A 2C4XA 2JDUA 1KJLA 3P3PA 3WDTA 4Y33A 1REFA 4I02A 2PHFA 3QCWA 2ZHKA 4FPCA 1AR72 2HBUA 4QM8A 1QJY2 5KXCA 4DY3A 3UGHA 2XBO3 3HD8B 3ZN6B 3PUHA 3RZKA 4M0NA 1H2LA 3W59A 3I4IA 1W6QA 3UJOA 1D2QA 4P9XA 3IDCB 2GN3A 3HIFA 3WQ1A 2JICA 4XAAA 1DP0A 3NJYA 3OYWB 4NHXA 4QQLA 2PHTA 2BVBA 1CZTA 4AR2A 1H1IA 5HBAA 1UXXX 1A8DA 4CP0A 4XF3A 5FJHA 1GZTA 2VGDA 4YZ5A 1SPPA 1RL3A 4ARXA 1GP4A 5JMCA 5T5JA 1KITA 3NSTA 5CA6A 3GCWA 4CDQC 4AZZA 2VL4A 3D4KA 3D6EA 4IV3B 3TAYA 2J22A 1WW7A 4AI8A 1SZBA 1HB1A 4COVA 4ASLA 2Y0OA 4H7MA 3PL0A 4CDUC 4CDXC 1AL22 2G9FA 2WQ8A 4AI0A 2JG8A 2Y6HA 2Y8KA 1OMIA 1RUG2 1HQWA 1PK6A 5EV7A 4CPBD 2AEYA 1BZWA 1S0DA 4W65A 1OF3A 1AZDA 4NJ4A 5K7PA 4BQYA 5CG8A 2ZABA 2Y38A 1H4HA 4IESA 2DCYA 4FXKB 3R4DB 1V00A 1IZ3A 1NY72 1VBA2 4PLNA 1MEC1 3M2MA 5A33A 2WSUA 2XL9A 1JW6A 1ND3A 3BALA 3I2KA 4QQ2A 5B4XA 3ME2A 1KS5A 1PO21 2VE1A 4XVHA 3HN1A 2IVIB 5A3NA 4HSLA 4XJUA 1HLCA 4OLLA 1M4WA 1NLSA 1W39A 2KA3A 1J3QA 3NNFA 3WR0A 3AYAA 4YW6A 5FBJA 3WDYA 2LROA 3FFZA 3ZLIA 1W8FA 3WDUA 3MLKA 2R041 1PGL2 1YQ5A 2ZZJA 1COV1 2HYXA 3USSA 3DN7A 1CONA 4RSUA 3LPGA 3VBOC 4NIGA 3JCIA 3OOXA 4RHV1 5GZEA 4QX5A 4CDXA 1OPMA 1GWMA 3TBDA 1TVGA 4ATFA 2H6BA 3C7FA 3KVAA 4QGMA 3H1YA 5FUNA 3FJSA 5F5QA 4AEDB 1NE6A 1DGWA 2VMIA 2WNOA 4YPJA 2O0OA 2VQTA 3VBRB 2DVFA 4J1XA 5FLJA 3T09A 2Q8DA 3BTAA 4AHZA 1HQLA 2R042 4OUSA 1QDCA 1PGL1 1YYNA 1T6BX 1K5MC 2ZACA 4GB32 4WM7A 3N9PA 1AHSA 2YZ4A 2WNVA 3RPQA 5FR3A 1EV12 1VE0A 3MW4A 4ZS2A 3TEWA 2E6VA 3TEZA 4LIUA 3ZXAC 1LJ7A 4A3XA 4COUA 5ERLA 2E7TA 4HT1T 4YG0A 4D6QA 3O5SA 3ZSMA 4HVOA 3ZKUA 3I2FA 5AC92 3N7JA 1ZZ8A 4MLOA 1UOBA 3ZFFC 3WEZA 2BZDA 4CP9A 4CUAA 1B35A 3VHNA 5GALA 3WT3A 1VBA1 1NT0A 5DABA 5J98B 1UIKA 4DXRA 5EHDA 3AP7A 2W92A 4EN7B 4JX0A 2VW0A 5SV8A 2WNVC 5L9VA 4YW1A 4JKMA 4BHPA 3UNPA 2UY8A 4P9IA 1QJX2 2A6VA 2FZ1A 1YFUA 2NYYA 2JE8A 1AXZA 5F5CA 1UMIA 2VBPA 4YGBA 1RUG1 3E5QA 4OVEA 1IGOA 1W8ZA 4JGZB 1FNYA 1C4RA 1VB2A 4PF5A 3H42B 5A33B 1LOEA 2GC0A 4BH9A 4CSWA 3BN6A 2YC0A 4LO8A 3UGGA 2GC2A 1G9FA 1UY4A 4AGGA 4UFLA 1QJEA 1A3KA 1UWWA 2BFUL 2V5DA 1ZZ6A 2WT0A 3ELNA 4XQ4A 2VNRA 2WUHA 5T50A 3ZXKA 2RS52 1QDOA 3AMMA 3GBGA 4P08A 1UNBA 3LPFA 2ZBJA 3M8LA 4R9BA 4CDXB 4DB5A 1BK1A 2HWB1 3AKQA 3OG2A 4MXVA 5FZOB 5FZ7A 2A6ZA 5T5LA 4G3YC 3ZYHA 1UPIA 4W6XA 5BYNA 5JZGC 3QH7A 4LBLA 3PUQA 4BQXA 1PVC3 1YIFA 1QMJA 1DIWA 1MZEA 1CJPA 3NWKA 5FZMA 3PMSA 3IDEA 3ZSKA 5LBCA 4L9BA 5J09A 2BTVC 1W9WA 2W52A 5I8TA 2I45A 4MXWA 2XKPA 2ZEWA 2VULA 2YGLA 1RMU3 2J7MA 3OYWA 5GZFA 5FFOC 1CX1A 1BQPA 4CCKA 1VRH2 1YFWA 4MZUA 4IDZA 1HXS3 3ACFA 3ACIA 4LJHA 3PIGA 2DVAA 2RMU3 2KR2A 4XHXA 4HN1A 2LRPA 3B5LB 4OFGA 5T54A 3JD71 3B69A 5A3LA 5FZEA 4XFFA 3OGJA 4Q4Y2 2BOJA 1XU1A 5IFTA 1S0FA 2RS33 2OUJA 4KWKA 2VUJA 1UYXA 3K75B 5DXDA 1JZ8A 1ZRCA 3UETA 1OHFA 3J8F1 2ARXA 1GWLA 3U37A 2G9ZA 2WO3A 1B09A 4RYDA 1QJZA 2QQOA 1Y9QA 4IE4A 2XDVA 5D8AC 1IHMA 2JDYA 4XTMA 2HWD2 3OSDA 3FMGA 2CDPA 2P3JA 3K77A 2YBKA 3VZKA 4CA9A 5JIAA 5T52A 4EZ4A 4M3CA 4JKKA 3I49A 5GLTA 2VM9A 3OBAA 3VBFA 2D6OX 2XWBB 3AMHA 1D4M2 5AFBA 1W6OA 2QQWA 2ZMNA 3KF5A 2LS6A 2O1QA 4K1YA 4UOJA 4GB33 1MS1A 3H8RA 5DDJ3 1VB4A 3VKOA 2QFEA 5AVAA 5CB7A 5CADA 1XE0A 3HQUA 3PIJA 2RG4A 5D8AA 3RQ0A 2ZA9A 3EMRA 3MV11 4COYA 4BXSV 2BFUS 2GN7A 2QQUA 5AFEA 3T08A 5A3WA 3NL1A 2A1XA 3BI3A 4JHTA 4NUBA 5FMDA 2LW8A 4MGSA 5FYBA 3CDZB 2VZTA 1AR63 5SV5A 4CCMA 2PFWA 1AXYA 1AR92 4IEXA 1SG3A 2FDIA 2BYVE 3KGZA 1SACA 4UW6A 2PHLA 2ZXQA 3SKJE 4DRVA 1CAWA 2E31A 2HWB3 2QDNA 3H7JA 5DG1A 3O7OA 3ZN6A 3VZMA 4CDWC 1PNGA 1W8NA 5KR7A 1WCUA 4OHVA 4BXFA 2JJ6A 1EYBA 1PM7A 5FUIA 2DDUA 1UMHA 1LULA 4QXCA 1VBE3 2XGXA 3T4VA 3FN9A 2D3SA 3RJ2X 1XNTA 5C3PA 2YFZA 4YFZA 1UYYA 4OYUA 2WS93 5K8SA 1MS3A 3BB6A 1O4YA 2BOIA 3LEMA 4PCRA 2LTNA 1OT5A 1RUI1 5FIXA 1RC6A 4AVBA 3OY8B 1HRV2 2PHUA 3M3IA 4O9EA 2VUAA 5FYYA 4P9LA 4PDWA 4CPBA 4XYXA 2OQ6A 1XXNA 3ON7A 3S6PA 4LE3A 4RS5A 4V1PA 2WA3A 4AG4A 4D8MA 3UK9A 2OXBA 3AYCA 2EXHA 4I09A 4MOAA 5A7WB 3VHRA 2NP0A 4RR3B 3SLIA 3THTA 4D6RA 4L92A 4QPWA 4XPVA 4KWUA 5I0UA 3HT1A 2D6NA 2CDOA 2HWD3 1JS9A 5FYSA 4K8FA 3KMHA 3AFKA 5DDJ2 3FHIB 2AR6A 1PVXA 3A4UA 4Y26A 1FT9A 1UKRA 4LK6A 2XQXA 2PHRA 2VBDA 4BMEA 1AVBA 1DFQA 1NXD1 4V2VA 4A42A 1RHI2 4Q4W3 4BLJA 2W46A 4Y22A 2JKXA 4LO7A 5F2SA 1NCQC 1GKBA 2XVKA 3LKJA 1AR91 1L7QA 1Z0HA 2R7EB 3N7LA 3OGGA 3H3ZA 3NNJA 5HCHA 2ILMA 3LOBA 2OZ6A 3E5XA 1Q8PA 2DUPA 4QX0A 2BPA2 2JIJA 3B01A 1AR81 4PF1A 4WZFA 4CUGA 1W6NA 4CCOA 1W8HA 4UW5A 4CCNA 1EV11 4R9DA 1RUI3 3P1IA 4S2GA 4GAZA 3ETPA 3BCWA 2PQSA 3RS6A 1LODA 4KH9A 1XNDA 5CFCC 2IXLA 3FHQA 2CAUA 1M06G 1Q3EA 1D2SA 3KZ4C 2JG9B 1F9KA 2RS13 2EXJA 3B9IA 4LNVA 4AHWA 4GA9A 1GOGA 1G9DA 2F4LA 2J1AA 5FZGA 1O6UA 2EAKA 1EAH3 1R093 1STMA 1NAEA 1Y3TA 4GH4A 3VBUC 4E9KA 1YO8A 4EJRA 2ZTNA 3GGLA 4E4ZA 1WLDA 4AEMA 1RUH2 3TRSB 4ZU4A 2Z69A 4NPRA 4K3UA 1UZYA 4PT6A 3NV1A 3AMPA 2WYFA 4LITA 1QXRA 1W9FA 1JOBA 1V6LA 2RR13 3AK0A 3MGUA 4H2AA 1FMD2 2WNUB 4TZDA 2NQYA 1GU3A 3OB8A 3VV1A 2VXRA 3D3AA 3OUIA 2DVDA 3I8TA 1YIPA 3ZXDA 4DO0A 2Q30A 1RITA 5EJ3A 4Y5TA 1H2NA 3VHPA 4GKYA 1BEV1 1X36A 2D43A 1GQGA 4I0BA 4Y20A 3H7YA 2B42B 4RGGA 4OI4A 5FZ1A 2XG3A 1BBT2 4QHBA 4ZXKA 4M00A 2OQ7A 2HWF1 2W47A 3AJYA 1OXCA 5C7GA 1QU0A 3NAPC 4KG0A 4Y1XA 4NIIA 3SITA 1RUOA 4M4RA 4LOTA 1UU6A 5C8CC 1OH3A 2ZS6B 1O4ZA 4XOGA 1WW5A 2GALA 2X09A 3MIBA 1XQNA 5T5PA 5L73A 4FPFA 5J3UA 5DUUA 2UWBA 3WW1A 3WNNA 3LIHA 5LZ6A 2C9AA 5DZFA 4DIQA 1W6NB 3JD73 4NMIA 2BWCA 1X9TA 1YFYA 4CXWA 3RNSA 1ZVFA 4B4RA 3S30A 4MVTA 4QQPA 4QX3A 1UX6A 4YZ4A 2RM23 1PX4A 1QJU2 1PVC1 1PZ8A 2ZGMA 4JVAA 3D82A 4W6YA 3INAA 4MGZE 4QX7A 2LUWA 3AKSA 2MPFA 1UZZA 2OT7A 4OHXA 4U2AA 5LB6A 4XDQA 1FATA 3VBOB 3ZYJB 3P6BA 1EAH2 1R092 2R0FA 4QGLA 1WW6A 3SHRA 5A1FA 4GH4B 1YJKA 4FQ4A 3S7EA 5JPMB 1FMD3 1N1YA 3PURA 1RUH3 4AHYA 1NQDA 4ASKA 3KT1A 3ZXJA 1WBFA 4OQ9A 4MADA 3O1SA 1DZRA 1WMXA 3UGFA 3X29B 4PI0A 4CUCA 4P5HA 1H8VA 4AVVA 1Y9GA 4O7XA 1COV2 3UJQA 2W9XA 4UBGA 4XF9A 3V65A 4Y20B 2FCUA 3AVSA 4CEYC 5LBBA 5F5AA 1AYN2 1BBT3 1W04A 5JR7B 2NPIA 3SMHA 5I8YA 1ND2C 2P6CA 3AP6A 2RMU2 3R05A 4IEQA 1OOPA 5FMCA 1KDMA 3GZUC 4BIOA 2BJSA 2VUDA 4WM7C 3W21A 3VL8A 4BQWA 1UIJA 3LEKA 4NR1A 5EQUA 2RDQA 2UU8A 1NX9A 5C71A 1J3PA 1G6NA 2QQIA 3O1PA 1QKQA 2NLRA 2XLGA 2RS32 2CU5A 3AZYA 3OPZA 4GXLA 5BXXA 5LRRA 4IEUA 4FFGA 1AYM2 3K3NA 2VXJA 1Q56A 2SLIA 1DQ1A 1XE8A 3BTZA 3E6CC 4EN6B 2JWPA 5A70A 3WF2A 4G9SB 4KWLA 5H9SA 1RUJ1 2IUWA 1I3HA 2R30A 4NOTA 4IEWA 5IUQA 1BK0A 3LDKA 1OA2A 1V6MA 1PO13 1C8NA 2XJRA 4LKDA 1Z7S2 1LOFA 2BUKA 3N9LA 5FK7A 2XWJB 1E5RA 1AR61 2V4VA 2Y6KA 4CEYA 1DU3D 2BWAA 4WM7B 2HWC1 3AXEA 1HB4A 3DPRC 4XE9A 5DPNA 5BUVA 5B4NA 1SEFA 1OQEA 4XZUG 1BCXA 1JYIA 4I0WB 1VBC1 1ZNPA 3AP5A 3ZO0B 2FD8A 1MR5A 2CGOA 3BU7A 4P9JA 1UF2C 3VBOA 5FYUA 3CJIC 3SEPA 4LPLA 3WP5A 2YU2A 4BQ4A 5IHRA 5LA1A 1FNZA 5DDJ1 2BBVA 1VAMA 1AL21 1ULGA 1H0BA 2HWF2 2VO5A 1GYKA 4UFJA 1SFPA 4YVSC 3FWEA 2J42A 1LRHA 5AC91 2ZAAA 3AMQA 1VMFA 1S2KA 3HT2A 1JZ5A 2E53A 3IPVA 2CYFA 1I5PA 3VKLA 3ECQA 1YCIA 1O3QA 1HN1A 2W5FA 5GLWA 5C8WA 1C5HA 3LAGA 1OVPA 1UAIA 4AQ2A 3DF0A 5I0RA 4YYOA 5GZGA 5G05L 3SCHA 1TNRA 1W03A 4TLFA 2VZ1A 4XFHA 4EYUA 2Y6JA 5HCAA 2O8OA 3ZOIA 2UYAA 2FMYA 3GCXA 2OA2A 4OI2A 1QNYA 4BOWA 1MS9A 5EYXA 4NHYA 1V6IA 2YV8A 4K21A 4YW2A 3I2JA 2ATFA 2ZKNA 4CXYA 3L9JT 4XTPA 5E8AA 2C9KA 1FXZA 1PGW2 2A75A 1BHGA 2HEWF 3POSA 5JXGA 2E33A 3UL2A 5BNPC 4Q2FA 1D4VB 4RHV2 3PTYA 4HANA 1EY2A 3RYPA 4B8EA 1U5ZA 5LW9A 4GMP3 2ERFA 4GQ7A 3AZZA 3Q8CA 3PLQA 4N53B 1IS6A 5I0TA 3WW3A 2XBO1 2ZHMA 3ENRA 4AWDA 2EICA 5FZ8A 3WNOA 2PHXA 4OI0A 2F17A 1ZBE1 2PAKA 2E9QA 2RS11 1GR3A 5IVVA 2PYTA 3EHKA 3WQ7A 3DYPA 5IAVA 3AP4A 1OA3A 5FYIA 4XHBA 2ZGKA 3NVCA 4CDWA 4R9CA 4XAEA 5C5TA 1F35A 1LHWA 3R6SA 2CNAA 3GBFA 5FLIA 1LOGA 2VMCA 1AL23 1QHDA 2CWMA 3C2UA 1F5FA 1QJFA 2DCJA 3VKMA 1UY1A 4MGTA 1RUD3 1J58A 1WLCA 1ULCA 4GMP0 5H9RA 2B9UA 2ETEA 4KBZA 2YMZA 4EN8B 1XRUA 1U12A 5JIUA 3W5NA 1A34A 3MIFA 4W4ZA 1O3TA 3MI8A 1VBC3 1LTEA 3MFCA 3SCFA 4WVWA 3N9QA 1LR5A 3POJA 4DMIA 2XJSA 2HWF3 3CEWA 1XYNA 2C24A 4MGKE 4YZ1A 3GF6A 1ENQA 4FO9A 5EFUA 5BNNA 1MQTB 3ZPYA 4N7IA 3S0MA 1ZRFA 1PO11 1BKZA 1NOVA 5IK8A 2VTFA 2ZHLA 2KM2A 4BCUA 2VZSA 5IK7A 2OW4A 2MEV2 4IGPA 2C0ZA 5JPNB 1RUJ3 2YUEA 2BNNA 1Z78A 2VZUA 2R072 2UY9A 3JU9A 4K7JA 4C90A 4DS0A 3KQRA 4MGIE 2D40A 4O65A 2LM3A 4QU1A 3LGRA 3RG0A 2A3XA 3WF0A 3BODA 2YYOA 4LEJA 1DYOA 1XYOA 5FY0A 1IG3A 2QJVA 1RUI2 4AXOA 2ZAHA 4NRQA 2ZMKA 3T0AA 3UKVA 3MIEA 5L19A 1ODNA 3CBNA 3VDAA 3SEEA 2Q8OA 1OLRA 2R063 5KXBA 1HB3A 1OQ1A 1W90A 2B8MA 1QJX3 4YGDA 4XEZA 3ZFEA 3RZLA 4HPKA 1FOD1 5FQ0B 2DURA 4H3WA 4DXZA 3U4XA 1J1LA 3PVOA 1OURA 4W6WA 2W3JA 3KV5A 3PVEA 5BY5A 3IDBB 4AOCA 3JBG3 4NAOA 1J3RA 2W91A 4XJ9A 3GZTB 2W39A 1DGLA 1SDDB 2Q1ZB 3OPTA 1UX7A 3WNLA 3R4SA 5KHHA 1RVF2 2VVEA 1CAXA 3OD0A 3Q8FA 2ZGRA 4MHRA 5FYTA 5CFCA 5EPAA 1J59A 1AXKA 5DZGA 4Y1VA 2R49A 1Q5OA 1Q8VA 3K51A 4LHKA 4ZKTB 1YQ8A 3H8XA 3VD5A 1JI6A 4FPOB 5M0TA 1S55A 2YY1A 3SH5A 5EIYB 1UCXA 1NZIA 2D7FA 2V73A 5LBFA 2GMEA 2H0BA 2JG9C 3IWZA 1LB2A 3OBTA 3LCPA 1X9PA 1EP0A 3CJXA 1OPOA 2DCTA 4MSVA 1VBC2 4FOWA 1H8TC 4B7EA 3JZVA 1ZREA 3RWNA 1RUC1 4KQ7A 5FZLA 1ZA4A 4P9GA 4S2FA 5FMBA 4B4QA 3IZOA 5FPZA 3K4ZA 3KV6A 1UW8A 4LBJA 2NMNA 3ZFEC 4EWEA 4JHZA 3I54A 1OSGA 2HWD1 1FV2A 3KHCA 2VECA 1Z7S1 2DCZA 2ES3A 2PMWB 3AYEA 2JIGA 2ET1A 2WRAA 3HNBM 1DYPA 3VHOA 4Q8LA 3VDCA 5JCTA 4HONA 2WLPA 2Q1FA 3CIHA 3LE0A 4PLMA 1YQ6A 4CCCA 4AK3A 3VBUA 4N53C 1DDLA 1FAYA 4GB31 5C3OA 5FLHA 1CAVB 1BYHA 5KHIA 1NE4A 4JTOA 4LA3A 4NE9A 4FT8A 2Z5WA 3JD72 1MS5A 1D4M3 5FQ0A 4BPZA 1OLQA 1JYTA 1K5JA 2TNFA 4XMIA 2EIDA 5A7NA 2F4PA 4Q0SA 2JG9A 4BB3A 2QQPA 3H3LA 4N53A 4YW3A 2RV9A 2AH2A 4HVQA 3CMGA 4X6QB 4Q0VA 4A6OA 3A23A 2Y6GA 2ZX0A 3WNKA 3ZN4A 4Q26A 3RZJA 2ZGTA 4WVMA 3RDIA 5GZDA 3M3QA 4N43A 4OMCA 4XCAA 1RJ7A 4ZZ8A 1F5JA 2JG8B 4UFKA 2WSVA 2XL7A 2BRTA 2XUMA 2WT1A 4KGQA 1GP5A 5ABJB 1JYNA 2ZX4A 1UXZA 2DYCA 4N9IA 4RA0A 5T3NA 3N7KA 3HPNA 4QX1A 1R64A 2RJLA 1LOBA 3K2OA 5CFCB 3I59B 2G9GA 2WINB 2PLV3 1UY0A 1IQAA 1LGCA 3EQEA 3O14A 3LD8A 3W9AA 3BTXA 1ZRRA 5CKNA 1DLCA 2AENA 2ZEYA 1T2XA 3VBHC 5JWPA 1KRIA 3OGVA 1EAH1 1R091 2WBKA 4AHXA 3WP6A 1PIV1 2XJPA 1POQA 2R0HA 4L2NA 2WZR1 5DG2A 1G86A 4XABA 4CTEA 2ZGSA 4LO6B 2X5IB 4XFAA 1CESA 2EXKA 1NA1B 1BXHA 2VOWA 1O5LA 3IT8A 4DEQA 4KG8A 3KCXA 4FTSA 4FAHA 3LEGA 4RD7A 2XXZA 1RUG3 4WZCA 4HSJA 4RQPA 5F39A 4F7ZA 2O14A 4H14A 4YW5A 1DG6A 5L7OC 1DBNA 3LEIA 1W6QB 3CO2A 2V4AA 1O7FA 1RXFA 4URAA 5FZHA 4DQAA 2X8KA 3B93A 2VU9A 4CU6A 2FDKA 3KV9A 3NRUA 3DPRB 4FOYA 3ZYBA 2IXIA 2VNVA 4FPJA 3PNAA 1UKGA 5DQ0A 2XJTA 1DF0A 5FV3A 2W1UA 2X05A 2G19A 2ARBA 4H55A 1WW4A 3ZFGB 3U1XA 2ORZA 3J7HA 2J1TA 1LAJA 1W9SA 2MNGA 4Q4W2 1OBNA 4KBBA 5IW0A 2P3IA 2ZEZA 4A7KA 2MHFA 1AYN3 2GNBA 3NW4A 4XJ8A 3RFRA 1RUC3 5HV0A 5FO7B 5GJ6A 2WT2A 5FPLA 1RHI3 2D5FA 4I3GA 3DV8A 1V9U2 4D7SA 1OF4A 1J1TA 4EWAA 4RQPC 4Y1YA 4C1WA 3AX4A 1K42A 3MDPA 4NPMA 5JOWA 2AGSA 5L7OA 3G6JB 1FYUA 4FTBA 5F3EA 1IG0A 4L8QA 3H8UA 5CKQA 4AL9A 4BE3A 3ZFGC 5JXIA 2R043 2DVBA 4CDQA 1C1LA 2WAAA 1X82A 1K45A 5C3RA 2P3KA 3WNXA 2RDRA 1I5ZA 4ES8A 3DEMA 3CJIA 1F8VA 1Y4WA 4R52A 3B02A 5D21A 1F15A 3POWA 4E27A 4OHZA 2RM21 3VLBB 3DGTA 4HBNA 2VR4A 2WC2A 4F3JA 2AYHA 2RS53 4RN5A 1WLWA 1BJQA 3JXSA 2A6XA 3NO8A 3R0RA 2J1VA
chains in the Genus database with same CATH topology
3E6BA 5I8SA 1FOD3 1RUD2 1ZBE2 3SH4A 1QJU1 1QWRA 3JQWA 2Q5TA 5FREA 2NM1A 1PZ7A 4JV4A 4LHLA 4QPIA 1W6MA 3GHNA 2JECA 1H2MA 3PVBB 4JGYC 1QJU3 2GDFA 4MUVA 5A32B 2XJVA 3D5OA 3ZFGA 1QXJA 4RGAA 2VPVA 3GALA 1GV9A 1ASJ3 4XBNA 1C28A 1FV3A 2ZMLA 3MICA 5EYYA 4IEYA 4G4FA 4ES9A 3MIGA 1YLLA 2JDZA 1IS4A 4N43B 5C4WA 5LEJA 5JZGA 3T1MA 5JSRA 2Z42A 5BNPA 2UWCA 5E89A 4FPLA 4R4XA 1BBT1 3D8CA 3Q9OA 4IV1C 4CDQB 1K5MA 1SDWA 1AUYA 3G7DA 4LLOA 4DNYA 2XKOA 3TN93 4NHLA 5J7MA 2XLAA 3KCCA 2R071 3E97A 3H0OA 3MYXA 1SLIA 3MEPA 3UKTA 1R081 3MIHA 2TBVA 4HETA 2CAVA 3ILFA 3MPBA 4NVPA 5GKAC 1SLTA 1MQTA 2B46X 4LUMA 3RZZA 1GQHA 3JB8A 4E4SA 1TQ5A 2A70A 4I01A 4D7TA 5CVRA 3ZSEA 3ZDSA 4I3PA 2HJIA 2HWC2 1V9U3 4FOVA 4X6RB 4UXAA 5CBLA 3L2HA 1TE1B 1YRZA 2GU9A 1BVVA 2JE9A 1VBD2 2R062 1PK6C 5C6CA 1S0IA 5A32A 1SFYA 1PO12 1VR3A 1BVP1 3HMYA 1UMZA 3CF6E 4QU2A 2VMHA 3VZLA 3B3QE 1XNCA 3E5UA 2XLFA 1NXMA 2CY6A 2A6YA 2VH9A 5BPXA 4AVTA 4JCKA 1D4M1 1AX2A 1YI9A 4Z2WA 1B35B 4F83A 3J4UH 5DUXA 4Q8KA 4XZPA 2RHPA 3AKRA 2WIIB 3FUOA 4FPYA 5T55A 4FTEA 3NKTA 1LGBA 1TME2 2RR11 3AMNA 2WZPP 3GNEA 1RUE1 1TNFA 2GNTA 1HRI2 3J9SA 5FMOL 4P9WA 3V0BB 2XHKA 1SLLA 4TWTA 1KJRA 4O9GA 3LA2A 2HWE1 5AC93 2NZ9A 1VRH1 2VOXA 1R1A1 4FP3A 4SBVA 2FMDA 3H9AA 1ULFA 1VBB2 4R9AA 4RL7A 5GLZA 4Q4W1 1ULEA 2ZX2A 4AEDA 2P37A 4IV1B 4BMBA 1VAVA 3HWJA 5HCBA 3AXDA 3USUB 3ZMNA 2RE9A 3V0BA 3TN92 1DQ6A 1LOAA 3AJZA 4FSJA 1OA4A 1H1MA 1Y43B 4SLIA 4DZGA 1YI7A 2PN5A 3LB9A 1L3JA 3QOPA 4A7YA 2VNGA 2DFCA 3PJYA 4Q0QA 1CPNA 1LHOA 3M3EA 2NN8A 4HK9A 1QY4A 3ZXFA 2W68A 3H1MA 5JZGB 4BQ1A 4Y4YA 4TSVA 1WGPA 1JTZX 5CFDB 3KT4A 1SCRA 3P3NA 4XIKA 1C8M3 3RMYA 1E57A 4ZU5A 4COZA 3ES4A 1POV1 5HCFA 1URXA 2RM22 2RS31 3QLQA 2WFF2 3KLSA 1R1A3 1JBCA 1LU1A 4YARA 1OFSA 4XJWA 2IFWA 4Z82A 1LOCA 1N3PA 3VGIA 4S2HA 3FLRA 1FMD1 5KXEA 4BWOA 3AYDA 2ET7A 2YHJA 1EPWA 4IV3C 1RUJ2 1VBB3 2A6WA 3MF9A 2DUOA 2A3YA 2A73B 3WCRA 4LO5B 4S2DA 1Q8SA 1I9RA 4F8AA 2D3RA 2DF7A 4ASMB 1MZ6A 2QKDA 1SBEA 1OFNA 1SMVA 3V64A 1KQRA 4AVAA 5F9TA 5D1IA 4HVRA 2GH8A 1H1AA 1UU4A 4LLFA 1NA1C 4YGCA 2PAEA 3O0WA 5B2GB 1C8M1 1RMU2 2E63A 3O12A 2R073 3H50A 5FTTC 3AFGA 4K40A 1GLHA 3WXPA 4CDWB 4YZ2A 3SXWA 2BEOA 4AQSA 1RVF3 3JQXA 2TEPA 1QGLA 3ETQA 1WCKA 4UW4A 1CQ9A 4NN0A 1QXPA 3K48A 4M01A 2UURA 3IMNA 5JI7A 1AR73 5E88A 2PQQA 2GNMA 2ZGUA 1O3SA 4YG3A 3M7AA 1X8MA 1ULDA 1KFXL 4N9HA 2PHWA 5JOXA 3WHTA 4E4DX 4PIXA 5CU1A 2GC1A 3WY6A 4B4PA 4YM0A 1G9CA 4GH4C 3V56A 3VZJA 4IQPA 4I2OA 1F31A 3FE5A 1TMF1 2JG8C 4CYDA 4C0HA 1FPN2 2DV9A 1CR7A 2JENA 5J37A 1ENSA 2DVGA 3N4MA 1CVNA 2H0VA 2D6MA 4DOUA 4IERA 4HK8A 4FQZA 5IK4A 1KD7A 4RQPB 4DINB 2KXLA 4EN9B 3ZSJA 2E51A 1PZ9A 2ENRA 2XJUA 3QH6A 3UKNA 2B7YA 3WUCA 4K1ZA 4FPGA 1FOD2 1R083 2CWSA 1ZX5A 1ALYA 1RMU1 1LKNA 4GMP1 1I6XA 5IK5A 2B45X 1COV3 1MACA 1AR93 1H9WA 1VAKA 2PLV1 5FMOS 2TUNA 4FXGB 3ZFEB 1U0AA 2X29A 2WS92 5F6KA 1AR83 5LRSA 3B9CA 4QPGA 1OOPC 1WMFA 3SNMA 1Y7BA 3H1WA 2NMOA 1LEMA 4INDA 1CAUA 2PA7A 3AZXA 2QUOA 1JHNA 3WX5A 4Z92B 1OQDA 5I0SA 1RUF2 1POV0 1MEC3 3T1LA 2IZWA 1RJ8A 1MVEA 2PAMA 4LBQD 4YM1A 1AYN1 3A0NA 4XFGA 1U5YA 1WD3A 1TMF3 2CGNA 3OTFA 1LCLA 3QD6A 4WBBA 4JAAA 1V6OA 3OBRA 2I74A 2K0GA 4URTA 1REEA 3ZX7A 1NCRC 4XQWA 2ZOEB 5ACA2 2VQAA 3IIAA 1SBFA 2GAUA 1GICA 1B35C 3I7DA 1W6PB 4XBLA 1QOOA 4B7KA 4I0AA 3TNQA 1ENRA 1H30A 4AW7A 1VLNA 1PVC2 1W0OA 1WA4A 2LALA 4LBOA 1VBD1 3LWCA 3VDDB 1N1SA 3JBG1 4BA6A 2QZ3A 5C9AA 1X33A 4YVWB 3HAGA 3D0SA 1G8WA 2C5DA 2WZR3 4M3CE 4JQRA 3SISA 2R16A 4IV1A 1ND2A 1VRH3 1WD4A 1HRV1 1LECA 1HIXA 1UD1A 3VL9A 4D69A 3FBMA 3VKFC 4COWA 1O4TA 2YROA 4HPKB 2G4IA 1WCSA 2GSYA 4E2QA 3AKPA 2AZ5A 3N36A 2WNVB 5C9AC 4H7LA 4QXKA 4Z1VA 3BOWA 4Y24A 1VIWB 4XF1A 1UPSA 1MQTC 4Q4X3 4EWDA 1DLLA 3LOIA 3FZ3A 5C4WB 1HKDA 2R1DA 1LESA 2CL2A 3OCPA 4JRLA 4X8NA 4AQTA 1HRI1 2MEV1 2QNKA 5ACA3 1TMF2 3ZSLA 1MS4A 3VBFB 4LE4A 4OHYA 1ZRDA 4LULA 4LUKA 4BLIA 5C33A 2I07B 3MW3A 2OPKA 3NJZA 2E7QA 2IXKA 2WNUA 1RUH1 1VJ2A 1QQP3 1IPJA 3EJKA 5GLUA 3M70A 3N3HA 3WG2A 5CIRA 4FPHA 4QM9A 2OIIA 5ACA1 3NKGA 1GSLA 1ZZ9A 1SFNA 1D0GA 1AR62 3EO6A 2ZX3A 1R1ZA 4B29A 5GM0A 3ZXLA 2D93A 1C8M2 3V0AB 1ZBA3 4BZ4A 4K20A 5ABJC 3DUIA 5KWRA 3FBYA 1ND3C 3U10A 5KHJA 2W08A 1AYM1 5JLVA 3U0ZA 4YM3A 1GNHA 4LR4A 1TME3 3TB0A 4EROA 1A8MA 4NWVA 4YRDA 4QGNA 2ZHNA 4WV8A 1HRV3 4OUMA 2OVUA 2VY0A 3M3CA 5ABJA 1XNBA 2DCKA 1RB8G 2HYKA 3ZMOA 4HFSA 2PELA 3GHMA 1PK6B 1RUE3 2DTYA 2GC3A 4QMAA 1Q8QA 3SH3A 2OZJA 3S7IA 5EXOA 1QOTA 1DQ4A 3ZN5A 2IXHA 4D3WA 1F8VA 1VBA3 1RUF1 4AVCA 2VOKA 1V70A 3WINE 2HWB2 3VBSC 1ND3B 3WD5A 4M3CB 3CJIB 4WM8A 4XBQA 1NY71 1GZWB 2VVDA 1NYWA 2CV6A 4Z07A 4Q0UA 5JSPA 2X5IA 2GNDA 5J48A 1VALA 1CD3G 1SQ4A 3N35A 2Z2SB 4CEWB 1RIRA 1V6JA 3WW4A 3MLJA 2JX9A 2HWC3 3DPRA 1Q43A 3VDDA 4Y1ZA 2UWAA 4RFT0 2JE7A 4P9YA 3ZYRA 3CNAA 1AYM3 3M4FA 2HEVF 2BNOA 1QOSA 4Q1RA 2OYZA 4LBNA 3FUQA 4M0HA 2HWE3 3VBRA 4XXAA 2RJKA 4AI2A 2WNEA 4QD2A 4BIOA 5AC91 5GZCA 3WQ0A 1IKQA 1KS4A 4QQHA 2K9ZA 3HR9A 2XVGA 3MZHA 1MVQA 3LSDA 4YVSA 1RUD1 4A2UA 4IXLA 2D98A 4RR3C 1WMEA 1QJX1 2BGCA 2JD4A 1OI6A 4IV3A 4CEWC 2YDEA 4JGZC 3RYKA 1BEV2 3ILRA 2QVSB 1HQNA 2PHDA 1MZFA 3ZYPA 4CP1A 5DUVA 1QQP1 1LENA 3MFAA 4XF0A 1HW5A 3HQXA 3RYRA 5L7OB 1RUE2 1YNAA 4NHKA 3I2DA 4RR3A 5I93A 2JKBA 2HEYF 1SLBA 2K2SA 4ORFA 1OKQA 4NO4A 3J8F2 4JGZA 2EA7A 3AZVA 1QH6A 2UYBA 2ZGNA 3PJQA 4OZXA 3IKWA 1DGWX 1NA1A 2OUHA 2ZJCA 5HI0A 5K9YA 4GALA 4KWJA 4LBKA 3UV9A 4XMAA 1WLTA 3VBHB 1A78A 1RUF3 4FAGA 5D8AB 4FCAA 4Q29A 2VQ0A 1MEC2 3JB4C 5JDBA 2WS91 4AEKA 5A3MA 1X7NA 3THPA 3ASIA 4HKOA 5E16A 1RUNA 1WMDA 5FCCA 3BPZA 1DGRA 2PLV2 5BNOB 1VBE1 2IXJA 4PJYA 4OULA 2WQZC 1SBDA 4C1XA 1JN2P 4FOQA 3GBWA 3QBQA 3USUA 3KB5A 3EBRA 4LBQB 1W6MB 1GNZA 3RRDA 1HRI3 1V6NA 2D3PA 1AR82 3NAPA 5JVVA 1BMV2 4IL7A 2DU1A 2WFF1 3MF6A 4Q4Y3 3WHUA 1RUC2 2FHRA 4AFDA 2Q4SA 2BW8A 1C1FA 1FPN3 3RMXA 2XJQA 3TN91 3KD4A 5C8CB 3TYJA 5KHKA 4FPKA 4GWNA 4P14A 5BNOC 3DL3A 2P34A 5K0UC 1BEV3 3MPPG 3ZXEA 3WP4A 1K5MB 1QF3A 1R082 1VBB1 2IWGB 5KC6A 4DPNA 5J96B 2VVFA 4AGRA 1XU2A 5FOJB 5FO8B 1MS0A 4QQOA 3WDVA 4X8PA 3MLLA 4GKXA 2QDRA 3TWIA 4AQ6A 4CDUB 4XFBA 3O0VA 5K0UA 1QNWA 1HXS2 4AFMA 4YZ3A 4YGEA 3WLUA 3VUOA 4AFCA 5KC5A 1IPKA 5I91A 3M3OA 3VZNA 3VBHA 4IEZA 3QACA 1KDKA 5DUWA 4EN0A 5C9AB 3D0JA 5DZEA 1R1A2 3HBZA 4IEVA 4Q4X1 2YGMA 5CFDC 1Z7S3 1S0BA 2EALA 4MX3A 1SCSA 5FO9B 2FQPA 4CEYB 1PHMA 2XPJA 4PBOA 1D0HA 1JUHA 3JBG2 2YXSA 3ZVXA 5KXDA 1NCRA 1Q8OA 2XB6C 1C5IA 4JDNA 3FLTA 1ZM1A 3GZAA 1NQJA 1WBLA 1TME1 4M3CF 2ZGQA 4AFAA 4ATEA 4C0BA 4AGVA 3KT7A 1NG0A 1H9PA 4YVWC 4JRAA 1FX5A 4ISQA 1CN1A 3OY8A 1NCQA 5JSOA 4L97A 1C57A 3ST7A 4XIOA 4YLZA 3WG1A 4LBMA 4ZU7A 2XVLA 4HZFA 1YWKA 4QPIC 1W2UA 1N3QA 3IPVB 5FRAA 1RHI1 3C3VA 4K9SA 4JGYA 3WDWA 2WFF3 1GANA 3WVJA 1WUVA 2FBEA 1DZTA 1IOAA 3AB0A 3LZZA 4YW4A 1JOJA 2GZWA 2R1BA 2R061 3ATGA 4LT5A 1S0GA 3EXUA 2BVVA 4QT6A 4HMZA 3MIDA 4ONUA 3SCGA 3GYDA 5H9PA 4K6BA 2WNUC 4YVWA 1PGSA 1YXWA 4WVZA 4N43C 3APBA 1JH5A 1O5UA 4KNCA 4R4ZA 1CAVA 4IETA 4JTNA 1U5XA 4GULA 1JYCA 1DQ0A 2SBAA 5KHGA 3URFA 4NHMA 3O0XA 4DY5A 1PMIA 4LHNA 5KBFA 4Q4V3 5LEKA 1HV1A 3J26N 5HXVA 1DZQA 4YVSB 4L11A 1CJDA 1DHKB 1RGSA 2B5HA 4WVMB 2D97A 2H6CA 2YPJA 3ZIWA 2A3WA 5C8CA 3RSJA 3ZXGA 3VN4A 2RR12 2WLQA 5BV6A 3WG3A 2JXAA 1KFUL 1A6CA 4LA2A 5CAZA 1VBD3 4XFIA 1MS8A 4OI1A 1MZ5A 3CLPA 4UBHA 4D94A 3I59A 1NZCA 3IM0A 3MW2A 1XYPA 1ZBA2 2BQPA 4QPYA 2WL1A 2JEMA 1LHNA 5FPXA 1KXGA 1WCDJ 3POYA 3PHMA 3U07A 4XQDA 1CPMA 4MV2A 3H3UA 1OOPB 5JI9A 1LEDA 2R32A 5F6LB 5IT6A 1CX4A 1JUIA 2IXCA 2QZ2A 4TYSA 3VBSA 1CGPA 1AF9A 4EV0A 4META 3ZFFA 2FZ2A 4AI1A 4DRRA 4IEPA 1N47A 3KGLA 1QJY3 2XBO2 4QPIB 4YNIA 5BNNC 2EVXA 1HDKA 2Q0AA 2AUYA 1CAWB 2V09A 4LTAA 5AVPA 4XJAA 3ACLA 4JC1A 4JDMA 1GZCA 2EXIA 5EWSA 3W58A 2C1FA 1XE7A 3LA3A 1CAUB 1NLRA 3WP3A 5FDBA 3JUUA 1ZYBA 5LK5A 4GWMA 5T5OA 2AREA 3RI9A 5EZWA 4IEOA 3FFQA 3TNPB 4XJZA 1HXS1 5BNQA 4HKLA 3VZOA 4AI3A 1H4GA 1PO22 4RS5B 2RS51 1G9AA 4YM2A 1EPZA 3VDDC 4XW3A 1AX0A 2EAAA 4E2GA 1FPN1 1C3HA 5FOBB 1EV13 4A7ZA 4JGYB 4WM8B 3ZYIB 1I1EA 4Q27A 4E2SA 3VBRC 1LOFC 2CGPA 1RTVA 2DFBA 4I30A 1AJKA 2WQ4A 1LHVA 2PTMA 3ALQA 3M1HA 3WOGA 2D44A 1UU5A 3CL1A 4Y22B 4BM8A 5K0UB 1POV3 2Y26A 1REDA 4XF4A 4Y1UA 4PQ9A 1ZBE3 1IS5A 2X53S 2ZGLA 4Y5Z0 4KU7A 4CEWA 3VBSB 3IBMA 4Q1PA 3ZFFB 2QE3A 4HLTA 1S0EA 1O3RA 1ZZCA 4MXWB 2DWRA 1S0JA 2N7GA 4KGGA 2D6KA 1IS3A 2IC1A 2IFRA 2ZKLA 2CTVA 2D6PA 5FAXA 1U5IA 1YHFA 4NWWA 1GZ9A 4AVSA 4WM8C 2O8QA 1QJY1 1AR71 3VBFC 4L99A 3NAPB 2V5YA 3E6DA 5FBZA 1VBE2 2ZX1A 1TEIA 4LO4B 3RJRA 3ROUA 3ZIXA 5GLVA 3ZYGA 3J8F3 2X5IC 2GMMA 2ZCWA 2D6LX 4AEDC 4DFSA 3DKWA 3A0KA 4CZSA 3NV3A 2ZPXA 4PIYA 4CP2A 4PLOA 4PDWB 2B39A 1SLCA 2E7AA 1QH7A 2ZGPA 5CNAA 4JDOA 4CRQA 2RMU1 2A7AA 5BNPB 3NV4A 3OF1A 1S1AA 1GFF2 4XXPA 1PIV3 1W0PA 4B3NA 1LGNA 1PO23 1CIWA 4N90A 1DQ5A 2D5HA 3ES1A 3RI8A 2Z79A 1V9U1 2DU0A 1O91A 1RINA 3L2YA 1W6OB 5J36A 1GZWA 1N1VA 2QCSB 1S0CA 2WJSA 3B94A 1XNKA 2VOVA 3BIWE 5JAXA 3OJBA 1OD5A 1ZBA1 4MYEA 4J1WA 1N1TA 2P2KA 4Z8BA 3AP9A 1AL0G 3KS7A 4Q4V1 1X8EA 4KL1A 3VBUB 2A5ZA 2EF6A 1ASJ1 2F6BA 1HV0A 1FI2A 1ENXA 4RS5C 3LA7A 1SLAA 3T2TA 1G9BA 1GBGA 5BNOA 3AKTA 1RVF1 1ND2B 2A71A 2HKXA 4QPGB 3B7MA 1ZZ7A 1ONAA 4XILA 1NCRB 3VKNA 4AF9A 4KU8A 4OHWA 3WZ1A 4ISRA 1H8TA 1AX1A 4PBPA 4WVVA 1PNFA 2MEV3 5E1RA 4UW3A 4AYUA 5CG9A 1H2KA 1LHUA 1YFXA 1YUDA 2EIGA 3B00A 4D7YA 4AEJA 2WZR2 3OD4A 1DYKA 1PIV2 3IN9A 3AM2A 1VP6A 1CAXB 5H9QA 5TSWA 2VNOA 2VW1A 3KSCA 4PIZA 1HX6A 2ZZQA 2HWE2 3ILNA 3FX3A 3WG4A 4ITCA 3KCYA 4J6GA 2Q1MA 4FVVA 3FLPA 4AFBA 4QPGC 4XFCA 3WDXA 4R8HA 2BNMA 4YFWA 1APNA 1LU2A 2R6QA 2GH2A 4RHV3 2Y0IA 4HKWA 1IKPA 4AE2A 3WW2A 2XH6A 3PVNA 3PMEA 1YJLA 3WUDA 4YG6A 2WKKA 3V0AA 2DUQA 4MH0E 2WWSA 4N7UA 3FC0A 1T6GC 1UL9A 4FPEA 5JOYA 3LSEA 4LBQA 4PDWC 2VG9A 1ASJ2 2VMGA 4Q4V2 4XETA 3N7MA 4YSFA 5F1RA 3KM5A 3CU7A 4HL0A 5JOZA 3R4UA 1H8TB 4HN0A 4FP2A 3WCSA 1G7YA 3NV2A 1AJOA 2GMPA 4GIQA 3TOJA 5L36A 3AZWA 1NCQB 5LK7B 3U11A 1ZZBA 2I2SA 1V6KA 1JXNA 1X50A 2VW2A 2WA4A 5CFDA 2W0XA 4BYYA 2RS12 2DTWA 4Q0PA 4Q4Y1 1N3OA 1W6PA 5C4WC 1S2BA 2ZGOA 1DGRN 2WFPA 3BOPA 4BIFA 4CDUA 1QQP2 1UN1A 2P17A 4MGYE 1DQ2A 5BNNB 1PGW1 4U36A 1F2NA 4Q4X2 4C91A 1KJLA 3P3PA 3WDTA 1REFA 4I02A 2PHFA 3QCWA 2ZHKA 4FPCA 1AR72 4QM8A 1QJY2 5KXCA 4DY3A 2XBO3 3HD8B 3ZN6B 4M0NA 1H2LA