3D85C

Crystal structure of il-23 in complex with neutralizing fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
133
Chain Sequence
PAWTQCQQLSQKLCTLAWSAHPLVDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody
pubmed doi rcsb
molecule keywords FAB of antibody 7G10, light chain
molecule tags Immune system/cytokine
source organism Homo sapiens
total genus 48
structure length 133
sequence length 160
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16649 IL23 Interleukin 23 subunit alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3d85C00
1PVHB 2O27A 3MZGA 2D48A 1NBPA 3SE3B 3HHRA 2B5IA 3BPNA 1ALUA 1CN4C 1EKUA 2L3YA 2HYMB 4GRWA 4YQXA 3UF5A 4I77Z 5D22A 1IRLA 1M4AA 1EXZA 3QB7A 3BPOA 3DGCL 1D9CA 3QWRB 4FA8E 3VA2A 3INKC 1V7NV 2Q98A 5E4EA 1INRA 3S9DA 1ITFA 3NCBA 4NI9A 4NKQC 4O9HA 2B90A 3QAZA 1VLKA 3B5KA 1HIJA 3N06A 2LMSA 5C7XA 2H24A 2KZ1A 3EW3A 5KNHI 1BGDA 2B8UA 1HZIA 1Z92A 1J7VL 1Z7CA 1HIKA 1B5LA 5D72A 1EMRA 4YDYI 1FG9A 1Y6KL 4MHLA 4RS1A 1M48A 1I1RB 1WU3I 1QVNA 1M4BA 2B8YA 1GA3A 1FYHA 1HULA 4X51A 4O6KA 1ILKA 3D85C 2ILKA 3SE4B 1LQSL 1RCBA 2E9WC 1P9MB 2GMFA 2LAGA 1D9GA 3L5XA 3Q1SI 5D28B 1CSGA 4ZF7A 1A22A 1HWGA 3QB1A 1RW5A 1YKBA 2B8ZA 2B8XA 1IJZA 4WRLB 4ZS7A 3G9VB 3UF2A 4YUEC 1ITIA 3N0PA 4NEJA 3D48P 4NEMA 3L5WI 2B91A 1BBNA 3QT2C 4YPGC 1BCNA 3EJJA 1BUYA 3NCFA 1ITMA 1RHGA 1LKIA 2L3OA 5D71A 4J4LC 5LQBA 2ERJD 3BPLA 5D70A 1HWHA 1Y6ML 1LK3A 1IK0A 1JLIA 1GNCA 1CNT1 1Y6NL 1HGUA 2Q7NB 3OQ3A 3PIWA 1V7MV 1HUWA 4NI7A 1IARA 4DOHA 2CYKA 2D9QA 5FHXA 3LB6A 5FUCA 3D87A 1ETEA 1SCFA 3UX9A 1BP3A 1AXIA 1F6FA 2IL6A 2O26A 3NCEA 3HMXB 3LB6B 1RFBA 1BGEA 1A7MA 1F45B 4PS4A 1N1FA 1AU1A 1PW6A 3NPZA 1ITLA 1AX8A 1M47A 4CNIC 5L6YC 3UEZE 1PGRA 1IL6A 1CD9A 3PIVA 4Z5RD 1PY2A 3WCYI 1M49A 3DUHC 1EVSA 1KF9A 1M4RA 1EERA 1M4CA 3BESL 3DLQI 1BGCA 2INTA 3G6DA 1CYLA 3NCCA
chains in the Genus database with same CATH superfamily
4BY7D 3MZGA 2D48A 3BPNA 1CN4C 2L3YA 3IRHA 5D22A 1M4AA 4NN5A 3DGCL 4TPJA 3HOUD 4U4VA 5E4EA 1ITFA 3NCBA 2Z3QA 4NN6A 3QAZA 1VLKA 3EW3A 5IP9D 1BGDA 4DKEA 4IKZA 1Z7CA 1HIKA 1Y1VD 1Y1WD 2VUMD 4BY1D 1M48A 5D58A 4A3CD 4DKDA 4EXPA 2ILKA 2E9WC 3Q1SI 5IYBD 2R92D 4OAAA 3AYHA 5C65A 1HWGA 5IYCD 4ZS7A 4YUEC 5EQHA 3N0PA 4NEJA 1BCNA 3EJJA 5C44D 1LKIA 4Q65A 4D2DA 1HWHA 3PO2D 3H0GD 1JLIA 5C3ED 1HUWA 5FHXA 3FKID 4ZW9A 3UX9A 3HMXB 4XNIA 2JA6D 4YBQA 4JREA 4PS4A 4NN7A 1M47A 4IKXA 4J05A 1CD9A 2R93D 3DUHC 4IU8A 3DLQI 5EQGA 3NCCA 3HOXD 1PVHB 4UVMA 1ALUA 1EKUA 3HHCA 4GRWA 2HYMB 4LDSA 5EQIA 3TGXB 1IRLA 4A3ED 4LRLA 3BPOA 4U4WA 4GBZA 1V7NV 3OG6A 5D6KA 4A3KD 1INRA 3B5KA 5FLMD 4A3LD 5KNHI 2B8UA 1PV6A 1Z92A 2V8NA 4U4TA 4XNJA 1Y6KL 4RS1A 4A3MD 4EXNA 3H3VE 1M4BA 2B8YA 1GA3A 1FYHA 1HULA 2Y5YA 4GBYA 3D85C 5IYDD 3SE4B 3L5XA 4ZWBA 1A22A 3QB1A 2B8XA 3G9VB 4A3BD 3L5WI 1BBNA 4A3ID 3NCFA 4J4LC 5LQBA 1Y6ML 1IK0A 1GNCA 1HGUA 2Q7NB 5D59A 1V7MV 4NI7A 4DOHA 4APSA 4GC0A 4IKVA 3LB6B 1BGEA 1F45B 4TPHA 2PSMA 1AU1A 1ITLA 4CNIC 5L6YC 1PGRA 1M49A 1M4RA 1CYLA 2Q14A 3OG4A 3I4ND 3O7QA 1Y14A 1EXZA 3QB7A 3HOVD 4FA8E 3VA2A 5GXBA 4O9HA 2B90A 1HIJA 2LMSA 5C7XA 2KZ1A 2JA8D 1EMRA 1FG9A 1I1RB 2CFPA 4X51A 1ILKA 4W6VA 5D28B 4LEPA 4BBSD 1PW4A 4ZF7A 1RW5A 2B8ZA 1IJZA 4WRLB 4ZWCA 1ITIA 3D48P 4NEMA 1BUYA 1ITMA 2L3OA 5D71A 2ERJD 4DKCA 3BPLA 4A3GD 2JA5D 4TPGA 4ZYRA 3DI3A 5A2OA 3PIWA 1IARA 4A3JD 3D87A 4DKFA 3HOYD 1AXIA 2IL6A 1RFBA 1PV7A 1A7MA 3PO3D 3NPZA 3UEZE 1IL6A 3WCYI 4D2CA 1EERA 1M4CA 3BESL 1BGCA 2INTA 4OH3A 3I4MD 2O27A 1NBPA 3SE3B 3HHRA 2B5IA 2B63D 4YQXA 3UF5A 2O6IA 4I77Z 2Z3RA 5A2NA 4JR9A 1D9CA 4IKWA 3QWRB 5C4XD 3INKC 2Q98A 4QIQA 3S9DA 4NI9A 5TS9A 4NKQC 4BBRD 3N06A 2H24A 4BXXD 2XUTA 1HZIA 1J7VL 1B5LA 4PYPA 5D72A 4YDYI 4YB9D 4MHLA 1WU3I 1QVNA 4O6KA 1WCMD 1LQSL 1RCBA 1P9MB 2GMFA 2LAGA 1D9GA 2R7ZD 1CSGA 5IP7D 4A93D 1YKBA 4IU9A 4A3FD 3UF2A 4JA3A 2C35A 2B91A 4IKYA 3QT2C 4YPGC 4GS7A 1RHGA 3HOWD 5D70A 1LK3A 1CNT1 1Y6NL 3OQ3A 2CYKA 2D9QA 3LB6A 2JA7D 5FUCA 1ETEA 3O7PA 1SCFA 1BP3A 1F6FA 2O26A 3NCEA 2CFQA 3DI2A 3WDOA 4A3DD 1N1FA 1PW6A 1AX8A 3PIVA 4Z5RD 1PY2A 4D2BA 2OQPA 2XQBA 1EVSA 1KF9A 3HOZD 3G6DA
chains in the Genus database with same CATH topology
3HOXD 1PVHB 3I4ND 4BY7D 2O27A 3MZGA 2D48A 1NBPA 1Y14A 3HHRA 2B5IA 3SE3B 3BPNA 1ALUA 1CN4C 1EKUA 2L3YA 2HYMB 3HHCA 4GRWA 3IRHA 4YQXA 2O6IA 3TGXB 4I77Z 5D22A 3UF5A 1IRLA 1M4AA 4NN5A 2Z3RA 1EXZA 4A3ED 3QB7A 4LRLA 3BPOA 3DGCL 3HOVD 1D9CA 3QWRB 4FA8E 3VA2A 3HOUD 5C4XD 3INKC 1V7NV 3OG6A 2Q98A 5E4EA 1INRA 4A3KD 3S9DA 1ITFA 3NCBA 4NI9A 2Z3QA 4NN6A 5TS9A 4NKQC 4BBRD 4O9HA 2B90A 3QAZA 1VLKA 3B5KA 5FLMD 1HIJA 3N06A 2LMSA 5C7XA 2H24A 4A3LD 2KZ1A 3EW3A 5IP9D 5KNHI 4BXXD 1BGDA 4DKEA 2JA8D 2B8UA 1HZIA 1Z92A 1J7VL 1Z7CA 1HIKA 1Y1VD 1B5LA 5D72A 1Y1WD 1EMRA 4YDYI 1FG9A 1Y6KL 2VUMD 4MHLA 4BY1D 4RS1A 1M48A 1I1RB 4A3MD 1WU3I 4EXNA 1QVNA 3H3VE 4A3CD 1M4BA 2B8YA 4DKDA 1GA3A 1FYHA 1HULA 4X51A 4EXPA 4O6KA 1ILKA 3D85C 2ILKA 5IYDD 1WCMD 1LQSL 1RCBA 2E9WC 3SE4B 1P9MB 2GMFA 2LAGA 1D9GA 3L5XA 3Q1SI 5D28B 2R7ZD 4BBSD 5IYBD 2R92D 1CSGA 4ZF7A 5IP7D 1A22A 3AYHA 1HWGA 3QB1A 1RW5A 1YKBA 2B8ZA 4A93D 4A3FD 2B8XA 1IJZA 4WRLB 4ZS7A 3G9VB 3UF2A 4YUEC 5IYCD 1ITIA 3N0PA 4A3BD 4NEJA 3D48P 2C35A 4NEMA 3L5WI 2B91A 1BBNA 3QT2C 4A3ID 4YPGC 1BCNA 3EJJA 1BUYA 3NCFA 1ITMA 4GS7A 1RHGA 5C44D 1LKIA 3HOWD 2L3OA 5D71A 4J4LC 5LQBA 2ERJD 4DKCA 3BPLA 5D70A 2JA5D 4A3GD 1HWHA 1Y6ML 3PO2D 3H0GD 2B63D 1LK3A 1IK0A 1JLIA 1GNCA 3DI3A 1CNT1 1Y6NL 1HGUA 2Q7NB 5C3ED 3OQ3A 3PIWA 1V7MV 1HUWA 4NI7A 1IARA 4DOHA 2CYKA 2D9QA 5FHXA 3LB6A 2JA7D 3FKID 5FUCA 3D87A 4DKFA 4A3JD 1ETEA 1SCFA 3HOYD 3UX9A 1BP3A 1AXIA 1F6FA 2IL6A 2O26A 3NCEA 3HMXB 3LB6B 1RFBA 3DI2A 2JA6D 1BGEA 1A7MA 1F45B 4PS4A 4A3DD 1N1FA 2PSMA 3PO3D 1AU1A 4NN7A 1PW6A 3NPZA 1ITLA 1AX8A 1M47A 4CNIC 5L6YC 3UEZE 1PGRA 1IL6A 1CD9A 3PIVA 4Z5RD 1PY2A 2OQPA 3WCYI 1M49A 2XQBA 3DUHC 1EVSA 1KF9A 3HOZD 2R93D 1M4RA 1EERA 1M4CA 3BESL 3DLQI 1BGCA 2INTA 3G6DA 1CYLA 3NCCA 2Q14A 3OG4A 3I4MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVH B;  2O27 A;  3MZG A;  2D48 A;  1NBP A;  3SE3 B;  3HHR A;  2B5I A;  3BPN A;  1ALU A;  1CN4 C;  1EKU A;  2L3Y A;  2HYM B;  4GRW A;  4YQX A;  3UF5 A;  4I77 Z;  5D22 A;  1IRL A;  1M4A A;  1EXZ A;  3QB7 A;  3BPO A;  3DGC L;  1D9C A;  3QWR B;  4FA8 E;  3VA2 A;  3INK C;  1V7N V;  2Q98 A;  5E4E A;  1INR A;  3S9D A;  1ITF A;  3NCB A;  4NI9 A;  4NKQ C;  4O9H A;  2B90 A;  3QAZ A;  1VLK A;  3B5K A;  1HIJ A;  3N06 A;  2LMS A;  5C7X A;  2H24 A;  2KZ1 A;  3EW3 A;  5KNH I;  1BGD A;  2B8U A;  1HZI A;  1Z92 A;  1J7V L;  1Z7C A;  1HIK A;  1B5L A;  5D72 A;  1EMR A;  4YDY I;  1FG9 A;  1Y6K L;  4MHL A;  4RS1 A;  1M48 A;  1I1R B;  1WU3 I;  1QVN A;  1M4B A;  2B8Y A;  1GA3 A;  1FYH A;  1HUL A;  4X51 A;  4O6K A;  1ILK A;  3D85 C;  2ILK A;  3SE4 B;  1LQS L;  1RCB A;  2E9W C;  1P9M B;  2GMF A;  2LAG A;  1D9G A;  3L5X A;  3Q1S I;  5D28 B;  1CSG A;  4ZF7 A;  1A22 A;  1HWG A;  3QB1 A;  1RW5 A;  1YKB A;  2B8Z A;  2B8X A;  1IJZ A;  4WRL B;  4ZS7 A;  3G9V B;  3UF2 A;  4YUE C;  1ITI A;  3N0P A;  4NEJ A;  3D48 P;  4NEM A;  3L5W I;  2B91 A;  1BBN A;  3QT2 C;  4YPG C;  1BCN A;  3EJJ A;  1BUY A;  3NCF A;  1ITM A;  1RHG A;  1LKI A;  2L3O A;  5D71 A;  4J4L C;  5LQB A;  2ERJ D;  3BPL A;  5D70 A;  1HWH A;  1Y6M L;  1LK3 A;  1IK0 A;  1JLI A;  1GNC A;  1CNT 1;  1Y6N L;  1HGU A;  2Q7N B;  3OQ3 A;  3PIW A;  1V7M V;  1HUW A;  4NI7 A;  1IAR A;  4DOH A;  2CYK A;  2D9Q A;  5FHX A;  3LB6 A;  5FUC A;  3D87 A;  1ETE A;  1SCF A;  3UX9 A;  1BP3 A;  1AXI A;  1F6F A;  2IL6 A;  2O26 A;  3NCE A;  3HMX B;  3LB6 B;  1RFB A;  1BGE A;  1A7M A;  1F45 B;  4PS4 A;  1N1F A;  1AU1 A;  1PW6 A;  3NPZ A;  1ITL A;  1AX8 A;  1M47 A;  4CNI C;  5L6Y C;  3UEZ E;  1PGR A;  1IL6 A;  1CD9 A;  3PIV A;  4Z5R D;  1PY2 A;  3WCY I;  1M49 A;  3DUH C;  1EVS A;  1KF9 A;  1M4R A;  1EER A;  1M4C A;  3BES L;  3DLQ I;  1BGC A;  2INT A;  3G6D A;  1CYL A;  3NCC A; 
#chains in the Genus database with same CATH topology
 4BY7 D;  3MZG A;  2D48 A;  3BPN A;  1CN4 C;  2L3Y A;  3IRH A;  5D22 A;  1M4A A;  4NN5 A;  3DGC L;  4TPJ A;  3HOU D;  4U4V A;  5E4E A;  1ITF A;  3NCB A;  2Z3Q A;  4NN6 A;  3QAZ A;  1VLK A;  3EW3 A;  5IP9 D;  1BGD A;  4DKE A;  4IKZ A;  1Z7C A;  1HIK A;  1Y1V D;  1Y1W D;  2VUM D;  4BY1 D;  1M48 A;  5D58 A;  4A3C D;  4DKD A;  4EXP A;  2ILK A;  2E9W C;  3Q1S I;  5IYB D;  2R92 D;  4OAA A;  3AYH A;  5C65 A;  1HWG A;  5IYC D;  4ZS7 A;  4YUE C;  5EQH A;  3N0P A;  4NEJ A;  1BCN A;  3EJJ A;  5C44 D;  1LKI A;  4Q65 A;  4D2D A;  1HWH A;  3PO2 D;  3H0G D;  1JLI A;  5C3E D;  1HUW A;  5FHX A;  3FKI D;  4ZW9 A;  3UX9 A;  3HMX B;  4XNI A;  2JA6 D;  4YBQ A;  4JRE A;  4PS4 A;  4NN7 A;  1M47 A;  4IKX A;  4J05 A;  1CD9 A;  2R93 D;  3DUH C;  4IU8 A;  3DLQ I;  5EQG A;  3NCC A;  3HOX D;  1PVH B;  4UVM A;  1ALU A;  1EKU A;  3HHC A;  4GRW A;  2HYM B;  4LDS A;  5EQI A;  3TGX B;  1IRL A;  4A3E D;  4LRL A;  3BPO A;  4U4W A;  4GBZ A;  1V7N V;  3OG6 A;  5D6K A;  4A3K D;  1INR A;  3B5K A;  5FLM D;  4A3L D;  5KNH I;  2B8U A;  1PV6 A;  1Z92 A;  2V8N A;  4U4T A;  4XNJ A;  1Y6K L;  4RS1 A;  4A3M D;  4EXN A;  3H3V E;  1M4B A;  2B8Y A;  1GA3 A;  1FYH A;  1HUL A;  2Y5Y A;  4GBY A;  3D85 C;  5IYD D;  3SE4 B;  3L5X A;  4ZWB A;  1A22 A;  3QB1 A;  2B8X A;  3G9V B;  4A3B D;  3L5W I;  1BBN A;  4A3I D;  3NCF A;  4J4L C;  5LQB A;  1Y6M L;  1IK0 A;  1GNC A;  1HGU A;  2Q7N B;  5D59 A;  1V7M V;  4NI7 A;  4DOH A;  4APS A;  4GC0 A;  4IKV A;  3LB6 B;  1BGE A;  1F45 B;  4TPH A;  2PSM A;  1AU1 A;  1ITL A;  4CNI C;  5L6Y C;  1PGR A;  1M49 A;  1M4R A;  1CYL A;  2Q14 A;  3OG4 A;  3I4N D;  3O7Q A;  1Y14 A;  1EXZ A;  3QB7 A;  3HOV D;  4FA8 E;  3VA2 A;  5GXB A;  4O9H A;  2B90 A;  1HIJ A;  2LMS A;  5C7X A;  2KZ1 A;  2JA8 D;  1EMR A;  1FG9 A;  1I1R B;  2CFP A;  4X51 A;  1ILK A;  4W6V A;  5D28 B;  4LEP A;  4BBS D;  1PW4 A;  4ZF7 A;  1RW5 A;  2B8Z A;  1IJZ A;  4WRL B;  4ZWC A;  1ITI A;  3D48 P;  4NEM A;  1BUY A;  1ITM A;  2L3O A;  5D71 A;  2ERJ D;  4DKC A;  3BPL A;  4A3G D;  2JA5 D;  4TPG A;  4ZYR A;  3DI3 A;  5A2O A;  3PIW A;  1IAR A;  4A3J D;  3D87 A;  4DKF A;  3HOY D;  1AXI A;  2IL6 A;  1RFB A;  1PV7 A;  1A7M A;  3PO3 D;  3NPZ A;  3UEZ E;  1IL6 A;  3WCY I;  4D2C A;  1EER A;  1M4C A;  3BES L;  1BGC A;  2INT A;  4OH3 A;  3I4M D;  2O27 A;  1NBP A;  3SE3 B;  3HHR A;  2B5I A;  2B63 D;  4YQX A;  3UF5 A;  2O6I A;  4I77 Z;  2Z3R A;  5A2N A;  4JR9 A;  1D9C A;  4IKW A;  3QWR B;  5C4X D;  3INK C;  2Q98 A;  4QIQ A;  3S9D A;  4NI9 A;  5TS9 A;  4NKQ C;  4BBR D;  3N06 A;  2H24 A;  4BXX D;  2XUT A;  1HZI A;  1J7V L;  1B5L A;  4PYP A;  5D72 A;  4YDY I;  4YB9 D;  4MHL A;  1WU3 I;  1QVN A;  4O6K A;  1WCM D;  1LQS L;  1RCB A;  1P9M B;  2GMF A;  2LAG A;  1D9G A;  2R7Z D;  1CSG A;  5IP7 D;  4A93 D;  1YKB A;  4IU9 A;  4A3F D;  3UF2 A;  4JA3 A;  2C35 A;  2B91 A;  4IKY A;  3QT2 C;  4YPG C;  4GS7 A;  1RHG A;  3HOW D;  5D70 A;  1LK3 A;  1CNT 1;  1Y6N L;  3OQ3 A;  2CYK A;  2D9Q A;  3LB6 A;  2JA7 D;  5FUC A;  1ETE A;  3O7P A;  1SCF A;  1BP3 A;  1F6F A;  2O26 A;  3NCE A;  2CFQ A;  3DI2 A;  3WDO A;  4A3D D;  1N1F A;  1PW6 A;  1AX8 A;  3PIV A;  4Z5R D;  1PY2 A;  4D2B A;  2OQP A;  2XQB A;  1EVS A;  1KF9 A;  3HOZ D;  3G6D A; 
#chains in the Genus database with same CATH homology
 3HOX D;  1PVH B;  3I4N D;  4BY7 D;  2O27 A;  3MZG A;  2D48 A;  1NBP A;  1Y14 A;  3HHR A;  2B5I A;  3SE3 B;  3BPN A;  1ALU A;  1CN4 C;  1EKU A;  2L3Y A;  2HYM B;  3HHC A;  4GRW A;  3IRH A;  4YQX A;  2O6I A;  3TGX B;  4I77 Z;  5D22 A;  3UF5 A;  1IRL A;  1M4A A;  4NN5 A;  2Z3R A;  1EXZ A;  4A3E D;  3QB7 A;  4LRL A;  3BPO A;  3DGC L;  3HOV D;  1D9C A;  3QWR B;  4FA8 E;  3VA2 A;  3HOU D;  5C4X D;  3INK C;  1V7N V;  3OG6 A;  2Q98 A;  5E4E A;  1INR A;  4A3K D;  3S9D A;  1ITF A;  3NCB A;  4NI9 A;  2Z3Q A;  4NN6 A;  5TS9 A;  4NKQ C;  4BBR D;  4O9H A;  2B90 A;  3QAZ A;  1VLK A;  3B5K A;  5FLM D;  1HIJ A;  3N06 A;  2LMS A;  5C7X A;  2H24 A;  4A3L D;  2KZ1 A;  3EW3 A;  5IP9 D;  5KNH I;  4BXX D;  1BGD A;  4DKE A;  2JA8 D;  2B8U A;  1HZI A;  1Z92 A;  1J7V L;  1Z7C A;  1HIK A;  1Y1V D;  1B5L A;  5D72 A;  1Y1W D;  1EMR A;  4YDY I;  1FG9 A;  1Y6K L;  2VUM D;  4MHL A;  4BY1 D;  4RS1 A;  1M48 A;  1I1R B;  4A3M D;  1WU3 I;  4EXN A;  1QVN A;  3H3V E;  4A3C D;  1M4B A;  2B8Y A;  4DKD A;  1GA3 A;  1FYH A;  1HUL A;  4X51 A;  4EXP A;  4O6K A;  1ILK A;  3D85 C;  2ILK A;  5IYD D;  1WCM D;  1LQS L;  1RCB A;  2E9W C;  3SE4 B;  1P9M B;  2GMF A;  2LAG A;  1D9G A;  3L5X A;  3Q1S I;  5D28 B;  2R7Z D;  4BBS D;  5IYB D;  2R92 D;  1CSG A;  4ZF7 A;  5IP7 D;  1A22 A;  3AYH A;  1HWG A;  3QB1 A;  1RW5 A;  1YKB A;  2B8Z A;  4A93 D;  4A3F D;  2B8X A;  1IJZ A;  4WRL B;  4ZS7 A;  3G9V B;  3UF2 A;  4YUE C;  5IYC D;  1ITI A;  3N0P A;  4A3B D;  4NEJ A;  3D48 P;  2C35 A;  4NEM A;  3L5W I;  2B91 A;  1BBN A;  3QT2 C;  4A3I D;  4YPG C;  1BCN A;  3EJJ A;  1BUY A;  3NCF A;  1ITM A;  4GS7 A;  1RHG A;  5C44 D;  1LKI A;  3HOW D;  2L3O A;  5D71 A;  4J4L C;  5LQB A;  2ERJ D;  4DKC A;  3BPL A;  5D70 A;  2JA5 D;  4A3G D;  1HWH A;  1Y6M L;  3PO2 D;  3H0G D;  2B63 D;  1LK3 A;  1IK0 A;  1JLI A;  1GNC A;  3DI3 A;  1CNT 1;  1Y6N L;  1HGU A;  2Q7N B;  5C3E D;  3OQ3 A;  3PIW A;  1V7M V;  1HUW A;  4NI7 A;  1IAR A;  4DOH A;  2CYK A;  2D9Q A;  5FHX A;  3LB6 A;  2JA7 D;  3FKI D;  5FUC A;  3D87 A;  4DKF A;  4A3J D;  1ETE A;  1SCF A;  3HOY D;  3UX9 A;  1BP3 A;  1AXI A;  1F6F A;  2IL6 A;  2O26 A;  3NCE A;  3HMX B;  3LB6 B;  1RFB A;  3DI2 A;  2JA6 D;  1BGE A;  1A7M A;  1F45 B;  4PS4 A;  4A3D D;  1N1F A;  2PSM A;  3PO3 D;  1AU1 A;  4NN7 A;  1PW6 A;  3NPZ A;  1ITL A;  1AX8 A;  1M47 A;  4CNI C;  5L6Y C;  3UEZ E;  1PGR A;  1IL6 A;  1CD9 A;  3PIV A;  4Z5R D;  1PY2 A;  2OQP A;  3WCY I;  1M49 A;  2XQB A;  3DUH C;  1EVS A;  1KF9 A;  3HOZ D;  2R93 D;  1M4R A;  1EER A;  1M4C A;  3BES L;  3DLQ I;  1BGC A;  2INT A;  3G6D A;  1CYL A;  3NCC A;  2Q14 A;  3OG4 A;  3I4M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...