3D8EA

Crystal structure of the human fe65-ptb1 domain (trigonal crystal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
123
Chain Sequence
KCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
total genus 28
structure length 123
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8eA00
3MPXA 2ELAA 4YONA 5J3YA 1XR0B 2RGNB 3A8PA 1FAOA 1KZGA 1GC7A 1MIZB 3OANA 5DHFB 1NI2A 3A8QA 5CLLB 1FB8A 2GJYA 2DX5A 1ZVRA 1P6SA 2MWNB 1V5UA 3SNHA 2Y7BA 2QKMA 1W1DA 1UPQA 4B6HA 2D9WA 5J3TA 3ZDTA 2UZSA 4IOYX 3ML4A 1SGHA 1DDVA 1FHXA 5D3YA 1QQGA 3WYFB 3X23A 2YF0A 3T06A 4L6EA 1P5TA 2GS0A 4H8SA 2K2JA 1Q67A 1U5EA 2CAYA 1PLSA 2P8VA 4KHOA 2D10A 5KQ4A 5LOPB 4K2PA 5FI1A 1V89A 1LB1A 3DXEA 2LYDA 3CIKA 2YVCA 2DTCA 1AWEA 1MK9B 1N3HA 2DA0A 3ODXA 1UNRA 3PVLA 3TFMA 1H10A 1ZC3B 2GCJA 3ULBA 4HAZB 1QC6A 4BBKA 5C5BA 4PNKA 2ELBA 4A5KA 3N7CA 3O96A 1NU2A 4A6KA 1M7EA 1XODA 1DDMA 5JHHA 2COAA 2I5CA 1BTNA 2L1CA 2D9ZA 1DYNA 2YS5A 1WGQA 1PMSA 5HE1A 3F5RA 1KI1B 2J0MA 2DHJA 3LJUX 1J0WA 4Z2NA 3CXBB 2HE7A 1BTKA 2Z0PA 3FEHA 5JHGA 2DN6A 3QIJA 4F7HA 2DLWA 2DHIA 1W1HA 2YT0A 1OY2A 3U7DA 4MK0A 2DKPA 3WA0A 5HE3A 5D27A 2RSGA 5DI9B 3TCAA 2EC1A 2YRYA 1MAIA 1MK7B 2AL6A 1Y19B 1EVHA 1KZ7A 2M38A 1UNQA 2AEHA 1WG7A 4K2OA 2RVBB 2LOZA 5JLJB 1BWNA 2E2XA 5JP4A 4EKUA 1WVHA 2Q13A 1ZM0A 2COCA 5KQ1A 1X1GA 2J0JA 1U2BA 4YL8A 4P7IA 4NSWA 1J19A 2L2IA 2R0DA 4KHBB 4CHMA 5C79A 5C6RA 2Y8GA 1K5GB 3IVFA 3SO6A 1RRPB 1ISNA 3AU4A 2UVMA 5D3WA 1H4RA 4HDQA 4F7GA 1PFJA 3PVUA 5D3VA 1FHOA 1FGZA 2V76A 1WJMA 4IAPA 1X86A 2EJ8A 1B55A 1RJ2A 3AU5A 4TYZA 2W2XC 3PG7A 2QKLA 2HTHB 2D2QA 1E5WA 2KGXB 3PSCA 5CLQB 5EFXA 1V61A 5L81A 2I5FA 1OQNA 1V5PA 1SHCA 2BCJA 2H7EA 2GCLA 3A98B 3BJIA 2D4QA 2DYNA 4C0AA 2ROVA 5C16A 2K2UA 4HB2B 4A6FB 3KY9A 4EJNA 3BINA 3ODWA 4XWXA 1UNPA 4MY6A 1XCGA 3ULCA 2OTXA 5DHAB 4GN1A 1V5MA 3U8ZA 1Z87A 2XQNM 5DH9B 2I1KA 2OQBA 4A6HA 1EF1A 3ZVRA 5FI0A 3D8FA 4MT7A 1XKEA 2Z0QA 3RCPA 4PQ0A 2ROZB 5DIFB 2MFQA 3UZTA 1U5FA 1WJ1A 1NTYA 4A6FA 2J59M 3GYPA 1I7AA 5D3XA 3KSYA 2W2XD 3ODOA 4KHAA 1U27A 3KZ1A 1MIXA 2EMSA 2LG1A 2UZRA 4F7UP 3DXDA 1XX0A 2IYBA 4GZUA 4HAYB 1ZSQA 2VRWB 2KCJA 4HDOA 3DXCA 2RLOA 5LONB 1ZC4B 4K17A 2R09A 1IRSA 1NTVA 5GOWB 1FGYA 1EAZA 2EMTA 2VKIA 2Y8FA 3TW1A 3P7ZA 2CODA 4NY0A 5HE2A 1TXDA 4CYEA 4K81A 1Y5OA 2DFKA 2D9YA 4HAWB 3QWMA 2MKRA 1UEFA 1U5GA 1UPRA 2LULA 4HAVB 1TJ6A 3HK0A 1MPHA 3SUZA 4ZRIA 3HQCA 2IFSA 4DX90 1X11A 2MDXA 3MDBC 4HAXB 2YSZA 4HHVA 2YS3A 4IFSA 3NSUA 1EGXA 1DBHA 2DX1A 2N0YA 3PP2A 1M7RA 3M1IB 4HATB 1OMWA 4WVFB 2D9XA 3PEGA 1AQCA 3D8EA 2PZ1A 3FSSA 1WI1A 3QBVB 4GMXB 3TO1A 2J0KA 2RNRB 4HB0B 3P6AA 4DBBA 2ZPYA 3SV1A 2JP2A 4WSFA 3FM8C 2FJLA 1TQZA 3F0WA 4KAXB 2P0HA 3AJ4A 2ADZA 3PVWA 1K5DB 2CY4A 2DHKA 4GXBA 3GYOA 4Y94A 2G35A 1FHWA 4Z2MB 2I1JA 2COFA 3KRWA 5KCVA 4CHJA 1BAKA 2D9VA 4HB4B 2DYQA 2W2WA 4DXAB 5C5BB 4WJ7A 3KRXA 4ZRKA 2X18A 3VOQA 4GMVA 2CY5A 1X05A 3HW2B 2P0DA 1GG3A 2NMBA 1GC6A 4GPTB 1DROA 4TKNA 3G9WA 4DX8A 4HAUB 1MKEA 5J3QA 2KUPA 3V5WA 4EMOA 2NZ8B 2CRFA 2H7DA 3D8DA 1U29A 1XD4A 4ZRJA 1LW3A 1V88A 2VSZA 2DKQA 2YS1A 3VIAA 2N23A 2LKOA 1P3RA 1X1FA 5HE0A 1W1GA 3TVVA 1U5DA 2K00A 2P0FA 1WGUA 2M14A 2D11A 3SYXA 2YT1A 2LOXA 3PZDA 1FOEA 2RUKB 2Z0OA 1DDWA 4D0NB 4HB3B 1I2HA 4KVGB
chains in the Genus database with same CATH superfamily
3MPXA 2ELAA 4YONA 5J3YA 1XR0B 2RGNB 3A8PA 1FAOA 1KZGA 1GC7A 1MIZB 3OANA 5DHFB 1NI2A 3A8QA 3OHMB 1FB8A 5CLLB 2NBVA 2GJYA 2DX5A 1ZVRA 2K8EA 1P6SA 2MWNB 1V5UA 3SNHA 2Y7BA 2QKMA 1W1DA 1UPQA 4B6HA 2D9WA 5J3TA 3ZDTA 2UZSA 4IOYX 3ML4A 1SGHA 2Z4DA 1DDVA 1FHXA 5D3YA 1QQGA 3WYFB 3X23A 2YF0A 3T06A 4L6EA 4QXAB 1P5TA 2GS0A 4H8SA 4QJ3B 2KIEA 2K2JA 1Q67A 1U5EA 2CAYA 1PLSA 2P8VA 4KHOA 2D10A 5KQ4A 5LOPB 4K2PA 5FI1A 1V89A 1LB1A 3DXEA 2LYDA 3CIKA 3U12A 2YVCA 2DTCA 1AWEA 1MK9B 1N3HA 2DA0A 3ODXA 1UNRA 3PVLA 1ZYIA 3TFMA 1H10A 1ZC3B 2GCJA 3ULBA 4HAZB 1QC6A 4BBKA 5C5BA 4PNKA 2ELBA 3NWAA 5I2MA 4A5KA 3N7CA 3O96A 1NU2A 4A6KA 1M7EA 1XODA 1DDMA 3NW8A 5JHHA 2COAA 2I5CA 1BTNA 2L1CA 2D9ZA 1DYNA 2YS5A 1WGQA 1PMSA 5HE1A 3F5RA 1KI1B 2J0MA 2DHJA 3LJUX 1J0WA 4Z2NA 3CXBB 2HE7A 1BTKA 2Z0PA 3FEHA 5JHGA 2DN6A 4GNKB 3QIJA 4F7HA 2DLWA 2DHIA 3FVCA 1W1HA 2YT0A 4L1RA 1OY2A 3U7DA 4MK0A 2DKPA 3WA0A 5HE3A 5D27A 2RSGA 5M4YB 5DI9B 3TCAA 2EC1A 2YRYA 1MAIA 1MK7B 2AL6A 1Y19B 1EVHA 1KZ7A 2M38A 1UNQA 2AEHA 1WG7A 4K2OA 2RVBB 2LOZA 5JLJB 1BWNA 2E2XA 5JP4A 4EKUA 1WVHA 2Q13A 1ZM0A 2COCA 5KQ1A 1X1GA 2J0JA 1U2BA 4YL8A 4P7IA 4NSWA 1J19A 2L2IA 2R0DA 4KHBB 4CHMA 5C79A 5C6RA 2KR0A 3NWFA 2Y8GA 1K5GB 3IVFA 3SO6A 1RRPB 1T77A 1ISNA 3AU4A 2UVMA 5D3WA 1H4RA 4HDQA 4F7GA 1PFJA 3PVUA 5D3VA 1FHOA 1FGZA 3NWDA 2V76A 1WJMA 4IAPA 5I2SA 1X86A 2EJ8A 1B55A 1RJ2A 3AU5A 4TYZA 2W2XC 3PG7A 4OT1A 2QKLA 2HTHB 2D2QA 1E5WA 2KGXB 3A58A 4QJ4B 3PSCA 5CLQB 5EFXA 1V61A 5L81A 2I5FA 1OQNA 1V5PA 1SHCA 2BCJA 2H7EA 2GCLA 3A98B 3BJIA 2D4QA 2DYNA 4C0AA 2ROVA 5C16A 2K2UA 4HB2B 4A6FB 3KY9A 2RRFA 4EJNA 3BINA 3ODWA 4XWXA 1UNPA 4MY6A 1XCGA 3ULCA 2OTXA 5DHAB 4GN1A 1V5MA 5LG4B 4CSQA 3U8ZA 1Z87A 2XQNM 5DH9B 2I1KA 3B77A 2OQBA 4A6HA 1EF1A 3ZVRA 5FI0A 3D8FA 4MT7A 1XKEA 2Z0QA 3RCPA 4PQ0A 2KUQA 2ROZB 5DIFB 2MFQA 3UZTA 1U5FA 1WJ1A 1NTYA 4A6FA 2J59M 3GYPA 1I7AA 5D3XA 3KSYA 2W2XD 3ODOA 4KHAA 1MI1A 1U27A 3KZ1A 1MIXA 2EMSA 2LG1A 2UZRA 2YT2A 4F7UP 3DXDA 1XX0A 2IYBA 4GZUA 4HAYB 1ZSQA 2VRWB 2KCJA 4HDOA 3DXCA 2RLOA 4D6WA 5LONB 5IRSA 1ZC4B 4K17A 4DIXA 2R09A 1IRSA 1NTVA 5GOWB 1FGYA 1EAZA 2EMTA 2VKIA 2Y8FA 3TW1A 3P7ZA 2CODA 4NY0A 5HE2A 1TXDA 4CYEA 4K81A 1Y5OA 2DFKA 3DCXA 2KIGA 2D9YA 2Z14A 4HAWB 3QWMA 2MKRA 3HSAA 1UEFA 1U5GA 1UPRA 2LULA 4HAVB 1TJ6A 3HK0A 1MPHA 3SUZA 4ZRIA 3HQCA 2IFSA 2Z59A 4DX90 1X11A 2MDXA 3MDBC 4HAXB 2YSZA 4HHVA 2YS3A 4IFSA 3NSUA 4HSIA 1EGXA 1DBHA 2DX1A 2N0YA 3PP2A 1M7RA 3M1IB 4HATB 1OMWA 4WVFB 2D9XA 3PEGA 1AQCA 3D8EA 2PZ1A 3FSSA 1WI1A 3QBVB 4GMXB 3TO1A 2J0KA 2RNRB 4HB0B 2FJUB 3P6AA 4DBBA 2ZPYA 3SV1A 2JP2A 4WSFA 3FM8C 2FJLA 1TQZA 3F0WA 4KAXB 2P0HA 3AJ4A 2ADZA 3PVWA 1K5DB 2CY4A 4GOUA 2DHKA 4GXBA 2ZKMX 3GYOA 4Y94A 3HIEA 2G35A 1FHWA 4Z2MB 2I1JA 2COFA 3KRWA 2Z13A 5KCVA 4CHJA 1BAKA 2D9VA 2W2WA 2DYQA 4HB4B 4DXAB 2K49A 5C5BB 4WJ7A 3KRXA 4ZRKA 2X18A 3VOQA 4GMVA 2CY5A 1X05A 3HW2B 2P0DA 1GG3A 2NMBA 1GC6A 4GPTB 1DROA 4TKNA 3G9WA 4DX8A 4HAUB 1MKEA 5J3QA 2KUPA 3V5WA 4EMOA 4OSNA 2NZ8B 2CRFA 2H7DA 3D8DA 1U29A 1XD4A 4ZRJA 1LW3A 1V88A 2VSZA 2DKQA 2YS1A 3VIAA 2N23A 2LKOA 1P3RA 2GUMA 1X1FA 5HE0A 1W1GA 3TVVA 1U5DA 2R2YA 2K00A 2P0FA 1WGUA 2M14A 2D11A 3SYXA 2YT1A 4KHBA 2LOXA 3PZDA 1FOEA 4QJ5B 2RUKB 2Z0OA 1DDWA 4D0NB 4HB3B 1I2HA 4KVGB
chains in the Genus database with same CATH topology
3MPXA 2ELAA 4YONA 5J3YA 1XR0B 2RGNB 3A8PA 1FAOA 1KZGA 1GC7A 1MIZB 3OANA 5DHFB 1NI2A 3A8QA 5CLLB 1FB8A 2GJYA 2DX5A 1ZVRA 1P6SA 2MWNB 1V5UA 3SNHA 2Y7BA 2QKMA 1W1DA 1UPQA 4B6HA 2D9WA 5J3TA 3ZDTA 2UZSA 4IOYX 3ML4A 1SGHA 1DDVA 1FHXA 5D3YA 1QQGA 3WYFB 3X23A 2YF0A 3T06A 4L6EA 1P5TA 2GS0A 4H8SA 2K2JA 1Q67A 1U5EA 2CAYA 1PLSA 2P8VA 4KHOA 2D10A 5KQ4A 5LOPB 4K2PA 5FI1A 1V89A 1LB1A 3DXEA 2LYDA 3CIKA 2YVCA 2DTCA 1AWEA 1MK9B 1N3HA 2DA0A 3ODXA 1UNRA 3PVLA 3TFMA 1H10A 1ZC3B 2GCJA 3ULBA 4HAZB 1QC6A 4BBKA 5C5BA 4PNKA 2ELBA 4A5KA 3N7CA 3O96A 1NU2A 4A6KA 1M7EA 1XODA 1DDMA 5JHHA 2COAA 2I5CA 1BTNA 2L1CA 2D9ZA 1DYNA 2YS5A 1WGQA 1PMSA 5HE1A 3F5RA 1KI1B 2J0MA 2DHJA 3LJUX 1J0WA 4Z2NA 3CXBB 2HE7A 1BTKA 2Z0PA 3FEHA 5JHGA 2DN6A 3QIJA 4F7HA 2DLWA 2DHIA 1W1HA 2YT0A 1OY2A 3U7DA 4MK0A 2DKPA 3WA0A 5HE3A 5D27A 2RSGA 5DI9B 3TCAA 2EC1A 2YRYA 1MAIA 1MK7B 2AL6A 1Y19B 1EVHA 1KZ7A 2M38A 1UNQA 2AEHA 1WG7A 4K2OA 2RVBB 2LOZA 5JLJB 1BWNA 2E2XA 5JP4A 4EKUA 1WVHA 2Q13A 1ZM0A 2COCA 5KQ1A 1X1GA 2J0JA 1U2BA 4YL8A 4P7IA 4NSWA 1J19A 2L2IA 2R0DA 4KHBB 4CHMA 5C79A 5C6RA 2Y8GA 1K5GB 3IVFA 3SO6A 1RRPB 1ISNA 3AU4A 2UVMA 5D3WA 1H4RA 4HDQA 4F7GA 1PFJA 3PVUA 5D3VA 1FHOA 1FGZA 2V76A 1WJMA 4IAPA 1X86A 2EJ8A 1B55A 1RJ2A 3AU5A 4TYZA 2W2XC 3PG7A 2QKLA 2HTHB 2D2QA 1E5WA 2KGXB 3PSCA 5CLQB 5EFXA 1V61A 5L81A 2I5FA 1OQNA 1V5PA 1SHCA 2BCJA 2H7EA 2GCLA 3A98B 3BJIA 2D4QA 2DYNA 4C0AA 2ROVA 5C16A 2K2UA 4HB2B 4A6FB 3KY9A 4EJNA 3BINA 3ODWA 4XWXA 1UNPA 4MY6A 1XCGA 3ULCA 2OTXA 5DHAB 4GN1A 1V5MA 3U8ZA 1Z87A 2XQNM 5DH9B 2I1KA 2OQBA 4A6HA 1EF1A 3ZVRA 5FI0A 3D8FA 4MT7A 1XKEA 2Z0QA 3RCPA 4PQ0A 2ROZB 5DIFB 2MFQA 3UZTA 1U5FA 1WJ1A 1NTYA 4A6FA 2J59M 3GYPA 1I7AA 5D3XA 3KSYA 2W2XD 3ODOA 4KHAA 1U27A 3KZ1A 1MIXA 2EMSA 2LG1A 2UZRA 4F7UP 3DXDA 1XX0A 2IYBA 4GZUA 4HAYB 1ZSQA 2VRWB 2KCJA 4HDOA 3DXCA 2RLOA 5LONB 1ZC4B 4K17A 2R09A 1IRSA 1NTVA 5GOWB 1FGYA 1EAZA 2EMTA 2VKIA 2Y8FA 3TW1A 3P7ZA 2CODA 4NY0A 5HE2A 1TXDA 4CYEA 4K81A 1Y5OA 2DFKA 2D9YA 4HAWB 3QWMA 2MKRA 1UEFA 1U5GA 1UPRA 2LULA 4HAVB 1TJ6A 3HK0A 1MPHA 3SUZA 4ZRIA 3HQCA 2IFSA 4DX90 1X11A 2MDXA 3MDBC 4HAXB 2YSZA 4HHVA 2YS3A 4IFSA 3NSUA 1EGXA 1DBHA 2DX1A 2N0YA 3PP2A 1M7RA 3M1IB 4HATB 1OMWA 4WVFB 2D9XA 3PEGA 1AQCA 3D8EA 2PZ1A 3FSSA 1WI1A 3QBVB 4GMXB 3TO1A 2J0KA 2RNRB 4HB0B 3P6AA 4DBBA 2ZPYA 3SV1A 2JP2A 4WSFA 3FM8C 2FJLA 1TQZA 3F0WA 4KAXB 2P0HA 3AJ4A 2ADZA 3PVWA 1K5DB 2CY4A 2DHKA 4GXBA 3GYOA 4Y94A 2G35A 1FHWA 4Z2MB 2I1JA 2COFA 3KRWA 5KCVA 4CHJA 1BAKA 2D9VA 4HB4B 2DYQA 2W2WA 4DXAB 5C5BB 4WJ7A 3KRXA 4ZRKA 2X18A 3VOQA 4GMVA 2CY5A 1X05A 3HW2B 2P0DA 1GG3A 2NMBA 1GC6A 4GPTB 1DROA 4TKNA 3G9WA 4DX8A 4HAUB 1MKEA 5J3QA 2KUPA 3V5WA 4EMOA 2NZ8B 2CRFA 2H7DA 3D8DA 1U29A 1XD4A 4ZRJA 1LW3A 1V88A 2VSZA 2DKQA 2YS1A 3VIAA 2N23A 2LKOA 1P3RA 1X1FA 5HE0A 1W1GA 3TVVA 1U5DA 2K00A 2P0FA 1WGUA 2M14A 2D11A 3SYXA 2YT1A 2LOXA 3PZDA 1FOEA 2RUKB 2Z0OA 1DDWA 4D0NB 4HB3B 1I2HA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPX A;  2ELA A;  4YON A;  5J3Y A;  1XR0 B;  2RGN B;  3A8P A;  1FAO A;  1KZG A;  1GC7 A;  1MIZ B;  3OAN A;  5DHF B;  1NI2 A;  3A8Q A;  5CLL B;  1FB8 A;  2GJY A;  2DX5 A;  1ZVR A;  1P6S A;  2MWN B;  1V5U A;  3SNH A;  2Y7B A;  2QKM A;  1W1D A;  1UPQ A;  4B6H A;  2D9W A;  5J3T A;  3ZDT A;  2UZS A;  4IOY X;  3ML4 A;  1SGH A;  1DDV A;  1FHX A;  5D3Y A;  1QQG A;  3WYF B;  3X23 A;  2YF0 A;  3T06 A;  4L6E A;  1P5T A;  2GS0 A;  4H8S A;  2K2J A;  1Q67 A;  1U5E A;  2CAY A;  1PLS A;  2P8V A;  4KHO A;  2D10 A;  5KQ4 A;  5LOP B;  4K2P A;  5FI1 A;  1V89 A;  1LB1 A;  3DXE A;  2LYD A;  3CIK A;  2YVC A;  2DTC A;  1AWE A;  1MK9 B;  1N3H A;  2DA0 A;  3ODX A;  1UNR A;  3PVL A;  3TFM A;  1H10 A;  1ZC3 B;  2GCJ A;  3ULB A;  4HAZ B;  1QC6 A;  4BBK A;  5C5B A;  4PNK A;  2ELB A;  4A5K A;  3N7C A;  3O96 A;  1NU2 A;  4A6K A;  1M7E A;  1XOD A;  1DDM A;  5JHH A;  2COA A;  2I5C A;  1BTN A;  2L1C A;  2D9Z A;  1DYN A;  2YS5 A;  1WGQ A;  1PMS A;  5HE1 A;  3F5R A;  1KI1 B;  2J0M A;  2DHJ A;  3LJU X;  1J0W A;  4Z2N A;  3CXB B;  2HE7 A;  1BTK A;  2Z0P A;  3FEH A;  5JHG A;  2DN6 A;  3QIJ A;  4F7H A;  2DLW A;  2DHI A;  1W1H A;  2YT0 A;  1OY2 A;  3U7D A;  4MK0 A;  2DKP A;  3WA0 A;  5HE3 A;  5D27 A;  2RSG A;  5DI9 B;  3TCA A;  2EC1 A;  2YRY A;  1MAI A;  1MK7 B;  2AL6 A;  1Y19 B;  1EVH A;  1KZ7 A;  2M38 A;  1UNQ A;  2AEH A;  1WG7 A;  4K2O A;  2RVB B;  2LOZ A;  5JLJ B;  1BWN A;  2E2X A;  5JP4 A;  4EKU A;  1WVH A;  2Q13 A;  1ZM0 A;  2COC A;  5KQ1 A;  1X1G A;  2J0J A;  1U2B A;  4YL8 A;  4P7I A;  4NSW A;  1J19 A;  2L2I A;  2R0D A;  4KHB B;  4CHM A;  5C79 A;  5C6R A;  2Y8G A;  1K5G B;  3IVF A;  3SO6 A;  1RRP B;  1ISN A;  3AU4 A;  2UVM A;  5D3W A;  1H4R A;  4HDQ A;  4F7G A;  1PFJ A;  3PVU A;  5D3V A;  1FHO A;  1FGZ A;  2V76 A;  1WJM A;  4IAP A;  1X86 A;  2EJ8 A;  1B55 A;  1RJ2 A;  3AU5 A;  4TYZ A;  2W2X C;  3PG7 A;  2QKL A;  2HTH B;  2D2Q A;  1E5W A;  2KGX B;  3PSC A;  5CLQ B;  5EFX A;  1V61 A;  5L81 A;  2I5F A;  1OQN A;  1V5P A;  1SHC A;  2BCJ A;  2H7E A;  2GCL A;  3A98 B;  3BJI A;  2D4Q A;  2DYN A;  4C0A A;  2ROV A;  5C16 A;  2K2U A;  4HB2 B;  4A6F B;  3KY9 A;  4EJN A;  3BIN A;  3ODW A;  4XWX A;  1UNP A;  4MY6 A;  1XCG A;  3ULC A;  2OTX A;  5DHA B;  4GN1 A;  1V5M A;  3U8Z A;  1Z87 A;  2XQN M;  5DH9 B;  2I1K A;  2OQB A;  4A6H A;  1EF1 A;  3ZVR A;  5FI0 A;  3D8F A;  4MT7 A;  1XKE A;  2Z0Q A;  3RCP A;  4PQ0 A;  2ROZ B;  5DIF B;  2MFQ A;  3UZT A;  1U5F A;  1WJ1 A;  1NTY A;  4A6F A;  2J59 M;  3GYP A;  1I7A A;  5D3X A;  3KSY A;  2W2X D;  3ODO A;  4KHA A;  1U27 A;  3KZ1 A;  1MIX A;  2EMS A;  2LG1 A;  2UZR A;  4F7U P;  3DXD A;  1XX0 A;  2IYB A;  4GZU A;  4HAY B;  1ZSQ A;  2VRW B;  2KCJ A;  4HDO A;  3DXC A;  2RLO A;  5LON B;  1ZC4 B;  4K17 A;  2R09 A;  1IRS A;  1NTV A;  5GOW B;  1FGY A;  1EAZ A;  2EMT A;  2VKI A;  2Y8F A;  3TW1 A;  3P7Z A;  2COD A;  4NY0 A;  5HE2 A;  1TXD A;  4CYE A;  4K81 A;  1Y5O A;  2DFK A;  2D9Y A;  4HAW B;  3QWM A;  2MKR A;  1UEF A;  1U5G A;  1UPR A;  2LUL A;  4HAV B;  1TJ6 A;  3HK0 A;  1MPH A;  3SUZ A;  4ZRI A;  3HQC A;  2IFS A;  4DX9 0;  1X11 A;  2MDX A;  3MDB C;  4HAX B;  2YSZ A;  4HHV A;  2YS3 A;  4IFS A;  3NSU A;  1EGX A;  1DBH A;  2DX1 A;  2N0Y A;  3PP2 A;  1M7R A;  3M1I B;  4HAT B;  1OMW A;  4WVF B;  2D9X A;  3PEG A;  1AQC A;  3D8E A;  2PZ1 A;  3FSS A;  1WI1 A;  3QBV B;  4GMX B;  3TO1 A;  2J0K A;  2RNR B;  4HB0 B;  3P6A A;  4DBB A;  2ZPY A;  3SV1 A;  2JP2 A;  4WSF A;  3FM8 C;  2FJL A;  1TQZ A;  3F0W A;  4KAX B;  2P0H A;  3AJ4 A;  2ADZ A;  3PVW A;  1K5D B;  2CY4 A;  2DHK A;  4GXB A;  3GYO A;  4Y94 A;  2G35 A;  1FHW A;  4Z2M B;  2I1J A;  2COF A;  3KRW A;  5KCV A;  4CHJ A;  1BAK A;  2D9V A;  4HB4 B;  2DYQ A;  2W2W A;  4DXA B;  5C5B B;  4WJ7 A;  3KRX A;  4ZRK A;  2X18 A;  3VOQ A;  4GMV A;  2CY5 A;  1X05 A;  3HW2 B;  2P0D A;  1GG3 A;  2NMB A;  1GC6 A;  4GPT B;  1DRO A;  4TKN A;  3G9W A;  4DX8 A;  4HAU B;  1MKE A;  5J3Q A;  2KUP A;  3V5W A;  4EMO A;  2NZ8 B;  2CRF A;  2H7D A;  3D8D A;  1U29 A;  1XD4 A;  4ZRJ A;  1LW3 A;  1V88 A;  2VSZ A;  2DKQ A;  2YS1 A;  3VIA A;  2N23 A;  2LKO A;  1P3R A;  1X1F A;  5HE0 A;  1W1G A;  3TVV A;  1U5D A;  2K00 A;  2P0F A;  1WGU A;  2M14 A;  2D11 A;  3SYX A;  2YT1 A;  2LOX A;  3PZD A;  1FOE A;  2RUK B;  2Z0O A;  1DDW A;  4D0N B;  4HB3 B;  1I2H A;  4KVG B; 
#chains in the Genus database with same CATH topology
 3MPX A;  2ELA A;  4YON A;  5J3Y A;  1XR0 B;  2RGN B;  3A8P A;  1FAO A;  1KZG A;  1GC7 A;  1MIZ B;  3OAN A;  5DHF B;  1NI2 A;  3A8Q A;  3OHM B;  1FB8 A;  5CLL B;  2NBV A;  2GJY A;  2DX5 A;  1ZVR A;  2K8E A;  1P6S A;  2MWN B;  1V5U A;  3SNH A;  2Y7B A;  2QKM A;  1W1D A;  1UPQ A;  4B6H A;  2D9W A;  5J3T A;  3ZDT A;  2UZS A;  4IOY X;  3ML4 A;  1SGH A;  2Z4D A;  1DDV A;  1FHX A;  5D3Y A;  1QQG A;  3WYF B;  3X23 A;  2YF0 A;  3T06 A;  4L6E A;  4QXA B;  1P5T A;  2GS0 A;  4H8S A;  4QJ3 B;  2KIE A;  2K2J A;  1Q67 A;  1U5E A;  2CAY A;  1PLS A;  2P8V A;  4KHO A;  2D10 A;  5KQ4 A;  5LOP B;  4K2P A;  5FI1 A;  1V89 A;  1LB1 A;  3DXE A;  2LYD A;  3CIK A;  3U12 A;  2YVC A;  2DTC A;  1AWE A;  1MK9 B;  1N3H A;  2DA0 A;  3ODX A;  1UNR A;  3PVL A;  1ZYI A;  3TFM A;  1H10 A;  1ZC3 B;  2GCJ A;  3ULB A;  4HAZ B;  1QC6 A;  4BBK A;  5C5B A;  4PNK A;  2ELB A;  3NWA A;  5I2M A;  4A5K A;  3N7C A;  3O96 A;  1NU2 A;  4A6K A;  1M7E A;  1XOD A;  1DDM A;  3NW8 A;  5JHH A;  2COA A;  2I5C A;  1BTN A;  2L1C A;  2D9Z A;  1DYN A;  2YS5 A;  1WGQ A;  1PMS A;  5HE1 A;  3F5R A;  1KI1 B;  2J0M A;  2DHJ A;  3LJU X;  1J0W A;  4Z2N A;  3CXB B;  2HE7 A;  1BTK A;  2Z0P A;  3FEH A;  5JHG A;  2DN6 A;  4GNK B;  3QIJ A;  4F7H A;  2DLW A;  2DHI A;  3FVC A;  1W1H A;  2YT0 A;  4L1R A;  1OY2 A;  3U7D A;  4MK0 A;  2DKP A;  3WA0 A;  5HE3 A;  5D27 A;  2RSG A;  5M4Y B;  5DI9 B;  3TCA A;  2EC1 A;  2YRY A;  1MAI A;  1MK7 B;  2AL6 A;  1Y19 B;  1EVH A;  1KZ7 A;  2M38 A;  1UNQ A;  2AEH A;  1WG7 A;  4K2O A;  2RVB B;  2LOZ A;  5JLJ B;  1BWN A;  2E2X A;  5JP4 A;  4EKU A;  1WVH A;  2Q13 A;  1ZM0 A;  2COC A;  5KQ1 A;  1X1G A;  2J0J A;  1U2B A;  4YL8 A;  4P7I A;  4NSW A;  1J19 A;  2L2I A;  2R0D A;  4KHB B;  4CHM A;  5C79 A;  5C6R A;  2KR0 A;  3NWF A;  2Y8G A;  1K5G B;  3IVF A;  3SO6 A;  1RRP B;  1T77 A;  1ISN A;  3AU4 A;  2UVM A;  5D3W A;  1H4R A;  4HDQ A;  4F7G A;  1PFJ A;  3PVU A;  5D3V A;  1FHO A;  1FGZ A;  3NWD A;  2V76 A;  1WJM A;  4IAP A;  5I2S A;  1X86 A;  2EJ8 A;  1B55 A;  1RJ2 A;  3AU5 A;  4TYZ A;  2W2X C;  3PG7 A;  4OT1 A;  2QKL A;  2HTH B;  2D2Q A;  1E5W A;  2KGX B;  3A58 A;  4QJ4 B;  3PSC A;  5CLQ B;  5EFX A;  1V61 A;  5L81 A;  2I5F A;  1OQN A;  1V5P A;  1SHC A;  2BCJ A;  2H7E A;  2GCL A;  3A98 B;  3BJI A;  2D4Q A;  2DYN A;  4C0A A;  2ROV A;  5C16 A;  2K2U A;  4HB2 B;  4A6F B;  3KY9 A;  2RRF A;  4EJN A;  3BIN A;  3ODW A;  4XWX A;  1UNP A;  4MY6 A;  1XCG A;  3ULC A;  2OTX A;  5DHA B;  4GN1 A;  1V5M A;  5LG4 B;  4CSQ A;  3U8Z A;  1Z87 A;  2XQN M;  5DH9 B;  2I1K A;  3B77 A;  2OQB A;  4A6H A;  1EF1 A;  3ZVR A;  5FI0 A;  3D8F A;  4MT7 A;  1XKE A;  2Z0Q A;  3RCP A;  4PQ0 A;  2KUQ A;  2ROZ B;  5DIF B;  2MFQ A;  3UZT A;  1U5F A;  1WJ1 A;  1NTY A;  4A6F A;  2J59 M;  3GYP A;  1I7A A;  5D3X A;  3KSY A;  2W2X D;  3ODO A;  4KHA A;  1MI1 A;  1U27 A;  3KZ1 A;  1MIX A;  2EMS A;  2LG1 A;  2UZR A;  2YT2 A;  4F7U P;  3DXD A;  1XX0 A;  2IYB A;  4GZU A;  4HAY B;  1ZSQ A;  2VRW B;  2KCJ A;  4HDO A;  3DXC A;  2RLO A;  4D6W A;  5LON B;  5IRS A;  1ZC4 B;  4K17 A;  4DIX A;  2R09 A;  1IRS A;  1NTV A;  5GOW B;  1FGY A;  1EAZ A;  2EMT A;  2VKI A;  2Y8F A;  3TW1 A;  3P7Z A;  2COD A;  4NY0 A;  5HE2 A;  1TXD A;  4CYE A;  4K81 A;  1Y5O A;  2DFK A;  3DCX A;  2KIG A;  2D9Y A;  2Z14 A;  4HAW B;  3QWM A;  2MKR A;  3HSA A;  1UEF A;  1U5G A;  1UPR A;  2LUL A;  4HAV B;  1TJ6 A;  3HK0 A;  1MPH A;  3SUZ A;  4ZRI A;  3HQC A;  2IFS A;  2Z59 A;  4DX9 0;  1X11 A;  2MDX A;  3MDB C;  4HAX B;  2YSZ A;  4HHV A;  2YS3 A;  4IFS A;  3NSU A;  4HSI A;  1EGX A;  1DBH A;  2DX1 A;  2N0Y A;  3PP2 A;  1M7R A;  3M1I B;  4HAT B;  1OMW A;  4WVF B;  2D9X A;  3PEG A;  1AQC A;  3D8E A;  2PZ1 A;  3FSS A;  1WI1 A;  3QBV B;  4GMX B;  3TO1 A;  2J0K A;  2RNR B;  4HB0 B;  2FJU B;  3P6A A;  4DBB A;  2ZPY A;  3SV1 A;  2JP2 A;  4WSF A;  3FM8 C;  2FJL A;  1TQZ A;  3F0W A;  4KAX B;  2P0H A;  3AJ4 A;  2ADZ A;  3PVW A;  1K5D B;  2CY4 A;  4GOU A;  2DHK A;  4GXB A;  2ZKM X;  3GYO A;  4Y94 A;  3HIE A;  2G35 A;  1FHW A;  4Z2M B;  2I1J A;  2COF A;  3KRW A;  2Z13 A;  5KCV A;  4CHJ A;  1BAK A;  2D9V A;  2W2W A;  2DYQ A;  4HB4 B;  4DXA B;  2K49 A;  5C5B B;  4WJ7 A;  3KRX A;  4ZRK A;  2X18 A;  3VOQ A;  4GMV A;  2CY5 A;  1X05 A;  3HW2 B;  2P0D A;  1GG3 A;  2NMB A;  1GC6 A;  4GPT B;  1DRO A;  4TKN A;  3G9W A;  4DX8 A;  4HAU B;  1MKE A;  5J3Q A;  2KUP A;  3V5W A;  4EMO A;  4OSN A;  2NZ8 B;  2CRF A;  2H7D A;  3D8D A;  1U29 A;  1XD4 A;  4ZRJ A;  1LW3 A;  1V88 A;  2VSZ A;  2DKQ A;  2YS1 A;  3VIA A;  2N23 A;  2LKO A;  1P3R A;  2GUM A;  1X1F A;  5HE0 A;  1W1G A;  3TVV A;  1U5D A;  2R2Y A;  2K00 A;  2P0F A;  1WGU A;  2M14 A;  2D11 A;  3SYX A;  2YT1 A;  4KHB A;  2LOX A;  3PZD A;  1FOE A;  4QJ5 B;  2RUK B;  2Z0O A;  1DDW A;  4D0N B;  4HB3 B;  1I2H A;  4KVG B; 
#chains in the Genus database with same CATH homology
 3MPX A;  2ELA A;  4YON A;  5J3Y A;  1XR0 B;  2RGN B;  3A8P A;  1FAO A;  1KZG A;  1GC7 A;  1MIZ B;  3OAN A;  5DHF B;  1NI2 A;  3A8Q A;  5CLL B;  1FB8 A;  2GJY A;  2DX5 A;  1ZVR A;  1P6S A;  2MWN B;  1V5U A;  3SNH A;  2Y7B A;  2QKM A;  1W1D A;  1UPQ A;  4B6H A;  2D9W A;  5J3T A;  3ZDT A;  2UZS A;  4IOY X;  3ML4 A;  1SGH A;  1DDV A;  1FHX A;  5D3Y A;  1QQG A;  3WYF B;  3X23 A;  2YF0 A;  3T06 A;  4L6E A;  1P5T A;  2GS0 A;  4H8S A;  2K2J A;  1Q67 A;  1U5E A;  2CAY A;  1PLS A;  2P8V A;  4KHO A;  2D10 A;  5KQ4 A;  5LOP B;  4K2P A;  5FI1 A;  1V89 A;  1LB1 A;  3DXE A;  2LYD A;  3CIK A;  2YVC A;  2DTC A;  1AWE A;  1MK9 B;  1N3H A;  2DA0 A;  3ODX A;  1UNR A;  3PVL A;  3TFM A;  1H10 A;  1ZC3 B;  2GCJ A;  3ULB A;  4HAZ B;  1QC6 A;  4BBK A;  5C5B A;  4PNK A;  2ELB A;  4A5K A;  3N7C A;  3O96 A;  1NU2 A;  4A6K A;  1M7E A;  1XOD A;  1DDM A;  5JHH A;  2COA A;  2I5C A;  1BTN A;  2L1C A;  2D9Z A;  1DYN A;  2YS5 A;  1WGQ A;  1PMS A;  5HE1 A;  3F5R A;  1KI1 B;  2J0M A;  2DHJ A;  3LJU X;  1J0W A;  4Z2N A;  3CXB B;  2HE7 A;  1BTK A;  2Z0P A;  3FEH A;  5JHG A;  2DN6 A;  3QIJ A;  4F7H A;  2DLW A;  2DHI A;  1W1H A;  2YT0 A;  1OY2 A;  3U7D A;  4MK0 A;  2DKP A;  3WA0 A;  5HE3 A;  5D27 A;  2RSG A;  5DI9 B;  3TCA A;  2EC1 A;  2YRY A;  1MAI A;  1MK7 B;  2AL6 A;  1Y19 B;  1EVH A;  1KZ7 A;  2M38 A;  1UNQ A;  2AEH A;  1WG7 A;  4K2O A;  2RVB B;  2LOZ A;  5JLJ B;  1BWN A;  2E2X A;  5JP4 A;  4EKU A;  1WVH A;  2Q13 A;  1ZM0 A;  2COC A;  5KQ1 A;  1X1G A;  2J0J A;  1U2B A;  4YL8 A;  4P7I A;  4NSW A;  1J19 A;  2L2I A;  2R0D A;  4KHB B;  4CHM A;  5C79 A;  5C6R A;  2Y8G A;  1K5G B;  3IVF A;  3SO6 A;  1RRP B;  1ISN A;  3AU4 A;  2UVM A;  5D3W A;  1H4R A;  4HDQ A;  4F7G A;  1PFJ A;  3PVU A;  5D3V A;  1FHO A;  1FGZ A;  2V76 A;  1WJM A;  4IAP A;  1X86 A;  2EJ8 A;  1B55 A;  1RJ2 A;  3AU5 A;  4TYZ A;  2W2X C;  3PG7 A;  2QKL A;  2HTH B;  2D2Q A;  1E5W A;  2KGX B;  3PSC A;  5CLQ B;  5EFX A;  1V61 A;  5L81 A;  2I5F A;  1OQN A;  1V5P A;  1SHC A;  2BCJ A;  2H7E A;  2GCL A;  3A98 B;  3BJI A;  2D4Q A;  2DYN A;  4C0A A;  2ROV A;  5C16 A;  2K2U A;  4HB2 B;  4A6F B;  3KY9 A;  4EJN A;  3BIN A;  3ODW A;  4XWX A;  1UNP A;  4MY6 A;  1XCG A;  3ULC A;  2OTX A;  5DHA B;  4GN1 A;  1V5M A;  3U8Z A;  1Z87 A;  2XQN M;  5DH9 B;  2I1K A;  2OQB A;  4A6H A;  1EF1 A;  3ZVR A;  5FI0 A;  3D8F A;  4MT7 A;  1XKE A;  2Z0Q A;  3RCP A;  4PQ0 A;  2ROZ B;  5DIF B;  2MFQ A;  3UZT A;  1U5F A;  1WJ1 A;  1NTY A;  4A6F A;  2J59 M;  3GYP A;  1I7A A;  5D3X A;  3KSY A;  2W2X D;  3ODO A;  4KHA A;  1U27 A;  3KZ1 A;  1MIX A;  2EMS A;  2LG1 A;  2UZR A;  4F7U P;  3DXD A;  1XX0 A;  2IYB A;  4GZU A;  4HAY B;  1ZSQ A;  2VRW B;  2KCJ A;  4HDO A;  3DXC A;  2RLO A;  5LON B;  1ZC4 B;  4K17 A;  2R09 A;  1IRS A;  1NTV A;  5GOW B;  1FGY A;  1EAZ A;  2EMT A;  2VKI A;  2Y8F A;  3TW1 A;  3P7Z A;  2COD A;  4NY0 A;  5HE2 A;  1TXD A;  4CYE A;  4K81 A;  1Y5O A;  2DFK A;  2D9Y A;  4HAW B;  3QWM A;  2MKR A;  1UEF A;  1U5G A;  1UPR A;  2LUL A;  4HAV B;  1TJ6 A;  3HK0 A;  1MPH A;  3SUZ A;  4ZRI A;  3HQC A;  2IFS A;  4DX9 0;  1X11 A;  2MDX A;  3MDB C;  4HAX B;  2YSZ A;  4HHV A;  2YS3 A;  4IFS A;  3NSU A;  1EGX A;  1DBH A;  2DX1 A;  2N0Y A;  3PP2 A;  1M7R A;  3M1I B;  4HAT B;  1OMW A;  4WVF B;  2D9X A;  3PEG A;  1AQC A;  3D8E A;  2PZ1 A;  3FSS A;  1WI1 A;  3QBV B;  4GMX B;  3TO1 A;  2J0K A;  2RNR B;  4HB0 B;  3P6A A;  4DBB A;  2ZPY A;  3SV1 A;  2JP2 A;  4WSF A;  3FM8 C;  2FJL A;  1TQZ A;  3F0W A;  4KAX B;  2P0H A;  3AJ4 A;  2ADZ A;  3PVW A;  1K5D B;  2CY4 A;  2DHK A;  4GXB A;  3GYO A;  4Y94 A;  2G35 A;  1FHW A;  4Z2M B;  2I1J A;  2COF A;  3KRW A;  5KCV A;  4CHJ A;  1BAK A;  2D9V A;  4HB4 B;  2DYQ A;  2W2W A;  4DXA B;  5C5B B;  4WJ7 A;  3KRX A;  4ZRK A;  2X18 A;  3VOQ A;  4GMV A;  2CY5 A;  1X05 A;  3HW2 B;  2P0D A;  1GG3 A;  2NMB A;  1GC6 A;  4GPT B;  1DRO A;  4TKN A;  3G9W A;  4DX8 A;  4HAU B;  1MKE A;  5J3Q A;  2KUP A;  3V5W A;  4EMO A;  2NZ8 B;  2CRF A;  2H7D A;  3D8D A;  1U29 A;  1XD4 A;  4ZRJ A;  1LW3 A;  1V88 A;  2VSZ A;  2DKQ A;  2YS1 A;  3VIA A;  2N23 A;  2LKO A;  1P3R A;  1X1F A;  5HE0 A;  1W1G A;  3TVV A;  1U5D A;  2K00 A;  2P0F A;  1WGU A;  2M14 A;  2D11 A;  3SYX A;  2YT1 A;  2LOX A;  3PZD A;  1FOE A;  2RUK B;  2Z0O A;  1DDW A;  4D0N B;  4HB3 B;  1I2H A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...