3D8EA

Crystal structure of the human fe65-ptb1 domain (trigonal crystal form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
123
Chain Sequence
KCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 28
structure length 123
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8eA00
4H8SA 3MDBC 2Z0OA 3PG7A 2D9ZA 2K00A 3P7ZA 3KSYA 3LJUX 1BAKA 1U5DA 4F7UP 4WJ7A 3KRXA 4HB0B 2D2QA 2YT0A 3WYFB 3D8FA 4PNKA 1X86A 5DI9B 1SHCA 1U5EA 1LB1A 2AEHA 2GCLA 5GOWB 4Y94A 3TVVA 1H10A 1K5DB 1UNPA 2GCJA 5KQ1A 2ROZB 1U29A 2Y8GA 3G9WA 3TO1A 4K17A 4HDOA 1MK9B 2CAYA 4HAWB 3HK0A 5D27A 1ZVRA 4XWXA 2VKIA 2I5FA 2JP2A 2RVBB 2ZPYA 2CY5A 1LW3A 2EMTA 1Z87A 2H7DA 1E5WA 3GYPA 1X1FA 2EMSA 4CHMA 2DX5A 1AWEA 1X05A 2CODA 4HHVA 3SV1A 4GMVA 5J3QA 2OQBA 1TJ6A 1M7RA 5D3WA 2D9WA 2UZRA 4ZRJA 4HB2B 1FHOA 2J0JA 4KHBB 4GPTB 2DTCA 3ODXA 2P0DA 2KGXB 2Q13A 3N7CA 1J0WA 2ROVA 1K5GB 4IFSA 2P8VA 1PMSA 3M1IB 5DHFB 2J59M 2KCJA 4K2PA 2NZ8B 5C5BB 3QBVB 2YF0A 3IVFA 3AU4A 5J3YA 4CYEA 3BJIA 4EKUA 1EF1A 1WJ1A 2Y8FA 5EFXA 2ELBA 3DXEA 3PVLA 1UEFA 4MT7A 1DROA 1WJMA 2UVMA 4GMXB 3BINA 4WSFA 1P6SA 1XCGA 2HE7A 2VRWB 1I2HA 2W2WA 3F0WA 2I1JA 3PEGA 3A8PA 1FAOA 1BTNA 1ISNA 5LOPB 2PZ1A 2R0DA 1ZC3B 3SYXA 4GN1A 1ZM0A 2MWNB 5DIFB 2I5CA 5D3YA 2RUKB 2D9VA 5D3XA 5HE2A 1UPQA 1V5PA 1NU2A 2DA0A 2E2XA 1N3HA 4HDQA 1QQGA 2HTHB 1U5GA 2J0MA 3ULBA 2GS0A 4F7HA 3GYOA 3MPXA 1TXDA 2D9YA 1DDWA 5CLLB 5LONB 5HE3A 5JP4A 2N23A 2COFA 2LYDA 1XKEA 4YONA 4DX8A 2COCA 4K81A 1XD4A 5J3TA 4GZUA 5KQ4A 3KRWA 3FM8C 4A6HA 2P0FA 1U5FA 4A6FA 2ELAA 3SNHA 2LKOA 1Y5OA 5HE1A 2Z0QA 2P0HA 1TQZA 4EJNA 1EGXA 1KI1B 3ZDTA 4YL8A 1J19A 1WG7A 2QKLA 1M7EA 1U27A 4D0NB 2M14A 1RJ2A 1V61A 5HE0A 3RCPA 2YVCA 4HAVB 1MIZB 2RLOA 3V5WA 3CXBB 1GG3A 2R09A 2RGNB 3PSCA 3P6AA 1W1DA 2EC1A 3O96A 2DFKA 2W2XC 1OQNA 4KVGB 1UNQA 2DHJA 3U7DA 2DHIA 4P7IA 4DXAB 1DDMA 1B55A 5DHAB 2MDXA 1KZGA 2D4QA 2DKQA 1FHXA 1EVHA 4HAYB 1X1GA 4A6KA 2RSGA 4B6HA 3AU5A 1XODA 5FI1A 4F7GA 1ZSQA 2ADZA 2D11A 3TFMA 4ZRIA 2YT1A 4PQ0A 2V76A 2DN6A 3A98B 1MPHA 1FOEA 3ZVRA 1W1HA 2YS5A 1FB8A 2IFSA 2X18A 1XX0A 2BCJA 2MKRA 3U8ZA 2CRFA 2LOXA 2LULA 2N0YA 3TCAA 2Y7BA 2W2XD 3ML4A 1BTKA 2MFQA 3ODOA 3DXDA 4C0AA 4A6FB 1GC6A 3AJ4A 1U2BA 2K2UA 2NMBA 3F5RA 2UZSA 4A5KA 2CY4A 5JHGA 3D8DA 1WVHA 3UZTA 5FI0A 2M38A 1SGHA 2IYBA 3QWMA 3D8EA 2Z0PA 4IOYX 4TYZA 4KHOA 1QC6A 5D3VA 1ZC4B 4HB3B 2I1KA 4Z2NA 1KZ7A 1I7AA 1XR0B 3WA0A 4DX90 1OMWA 4HATB 2AL6A 2DYQA 1Q67A 3FSSA 5C16A 4HAXB 3X23A 5DH9B 1AQCA 5C79A 1Y19B 5C6RA 2VSZA 4EMOA 3PZDA 2G35A 3FEHA 1V89A 1DBHA 2DX1A 2DHKA 3KY9A 3ODWA 3KZ1A 3A8QA 3QIJA 3ULCA 2OTXA 1UPRA 3HW2B 4ZRKA 1FGYA 1UNRA 4K2OA 1V5MA 2LOZA 2GJYA 2J0KA 4IAPA 1WI1A 1IRSA 4TKNA 1X11A 3CIKA 4KAXB 1MIXA 3NSUA 1MKEA 4NSWA 5CLQB 4L6EA 1PFJA 5KCVA 1V88A 1OY2A 2DKPA 1NTYA 4WVFB 1DDVA 3T06A 5JLJB 2L2IA 2QKMA 2D10A 1V5UA 1NI2A 2K2JA 2DYNA 2RNRB 1MK7B 4HB4B 3VIAA 3VOQA 3TW1A 2L1CA 2YSZA 1WGQA 1BWNA 2COAA 1EAZA 3PVUA 2LG1A 3PP2A 2H7EA 4MY6A 1WGUA 3OANA 2YRYA 3PVWA 5JHHA 4MK0A 3SUZA 5L81A 2KUPA 1P3RA 1H4RA 1P5TA 1RRPB 1W1GA 5C5BA 1FHWA 4CHJA 1MAIA 1GC7A 4KHAA 3HQCA 2FJLA 1DYNA 3DXCA 4HAUB 1PLSA 1NTVA 2EJ8A 4Z2MB 2XQNM 2D9XA 4NY0A 2DLWA 4BBKA 4GXBA 1FGZA 2YS1A 4HAZB 2YS3A 3SO6A 4DBBA
chains in the Genus database with same CATH superfamily
4H8SA 3MDBC 2Z0OA 3PG7A 2D9ZA 2K00A 3KSYA 3P7ZA 3LJUX 1BAKA 1U5DA 4F7UP 4WJ7A 3NWDA 3HSAA 3KRXA 4HB0B 2D2QA 2YT0A 3WYFB 3D8FA 4PNKA 1X86A 5DI9B 1SHCA 1U5EA 4HSIA 1LB1A 2ZKMX 2AEHA 2GCLA 5GOWB 4Y94A 3TVVA 1H10A 1K5DB 1UNPA 2GCJA 5KQ1A 2ROZB 1U29A 2Y8GA 3G9WA 3TO1A 4K17A 4HDOA 1MK9B 2CAYA 2Z13A 2K8EA 4HAWB 3HK0A 5D27A 1ZVRA 4XWXA 2VKIA 2I5FA 2JP2A 2RVBB 2ZPYA 2CY5A 1LW3A 2EMTA 1Z87A 2H7DA 1E5WA 3GYPA 1X1FA 3A58A 2EMSA 4CHMA 2DX5A 1AWEA 1X05A 2CODA 4HHVA 3SV1A 4GMVA 3U12A 5J3QA 2OQBA 1TJ6A 1M7RA 4QJ3B 5D3WA 2D9WA 2UZRA 4ZRJA 4HB2B 1FHOA 2J0JA 4KHBB 4GPTB 2DTCA 3ODXA 2P0DA 2KGXB 2Q13A 3N7CA 1J0WA 2ROVA 4QJ4B 1K5GB 4IFSA 2P8VA 1PMSA 3M1IB 5DHFB 2J59M 3OHMB 2KCJA 4K2PA 2KUQA 2NZ8B 5C5BB 3QBVB 2YF0A 3IVFA 3AU4A 5J3YA 4CYEA 3BJIA 4EKUA 1EF1A 1WJ1A 2Y8FA 5EFXA 2ELBA 3DXEA 3PVLA 1UEFA 4MT7A 1DROA 1WJMA 2UVMA 4GMXB 3BINA 4WSFA 1P6SA 1XCGA 2HE7A 2VRWB 1I2HA 2W2WA 3F0WA 2I1JA 3PEGA 3A8PA 1FAOA 1BTNA 1ISNA 5LOPB 2PZ1A 2R0DA 1ZC3B 3SYXA 4GN1A 1ZM0A 2MWNB 5DIFB 2I5CA 5D3YA 2RUKB 2D9VA 5D3XA 5HE2A 1UPQA 1V5PA 1NU2A 2DA0A 2E2XA 1N3HA 4GNKB 1QQGA 4HDQA 2HTHB 1U5GA 2J0MA 3ULBA 2GS0A 4F7HA 3GYOA 3MPXA 1TXDA 2Z4DA 2D9YA 1DDWA 5CLLB 5LONB 5HE3A 5JP4A 2N23A 2COFA 2LYDA 1XKEA 4YONA 4DX8A 2COCA 4K81A 1XD4A 5J3TA 4GZUA 5KQ4A 3KRWA 3FM8C 4A6HA 2P0FA 1U5FA 4A6FA 2GUMA 1ZYIA 2ELAA 3HIEA 3SNHA 2LKOA 1Y5OA 3NW8A 3NWAA 5HE1A 2Z0QA 2P0HA 1MI1A 1TQZA 4EJNA 1EGXA 1KI1B 3ZDTA 4YL8A 1J19A 1WG7A 2KIEA 2QKLA 1M7EA 5LG4B 1U27A 4D0NB 2M14A 1RJ2A 1V61A 5HE0A 3RCPA 2YVCA 4HAVB 1MIZB 2RLOA 3V5WA 3CXBB 2Z14A 1GG3A 2R09A 2RGNB 3PSCA 3P6AA 1W1DA 2YT2A 2EC1A 3O96A 2DFKA 2W2XC 1OQNA 4KVGB 1UNQA 2R2YA 2DHJA 3U7DA 2DHIA 4P7IA 4DXAB 2RRFA 1DDMA 1B55A 5DHAB 4QXAB 2MDXA 1KZGA 5I2SA 2D4QA 2DKQA 1FHXA 1EVHA 4HAYB 1X1GA 4A6KA 2RSGA 4B6HA 3AU5A 1XODA 5FI1A 4F7GA 1ZSQA 2ADZA 2D11A 3TFMA 1T77A 4ZRIA 2YT1A 4PQ0A 2V76A 2DN6A 3A98B 3NWFA 1MPHA 1FOEA 3ZVRA 1W1HA 2YS5A 1FB8A 2IFSA 2X18A 1XX0A 2BCJA 2MKRA 3U8ZA 2CRFA 2LOXA 2LULA 2N0YA 3TCAA 2Y7BA 2W2XD 3ML4A 1BTKA 2MFQA 3B77A 3ODOA 3DXDA 4C0AA 4A6FB 3DCXA 1GC6A 2Z59A 3AJ4A 1U2BA 2K2UA 2NMBA 3F5RA 2UZSA 4A5KA 2CY4A 5JHGA 3D8DA 1WVHA 5IRSA 3UZTA 5FI0A 2M38A 1SGHA 2IYBA 3QWMA 3D8EA 5M4YB 2Z0PA 4IOYX 4TYZA 4KHOA 1QC6A 5D3VA 1ZC4B 4HB3B 2I1KA 4Z2NA 1KZ7A 1I7AA 1XR0B 3WA0A 4DX90 1OMWA 4HATB 2AL6A 3FVCA 2DYQA 1Q67A 3FSSA 5C16A 4HAXB 3X23A 5DH9B 1AQCA 5C79A 1Y19B 5C6RA 2VSZA 4EMOA 3PZDA 2G35A 2KIGA 3FEHA 1V89A 1DBHA 2DX1A 2NBVA 2DHKA 3KY9A 3ODWA 3KZ1A 3A8QA 4GOUA 4L1RA 3QIJA 2K49A 3ULCA 4QJ5B 2OTXA 1UPRA 3HW2B 4ZRKA 1FGYA 1UNRA 4K2OA 1V5MA 2LOZA 2GJYA 4D6WA 2J0KA 4IAPA 1WI1A 1IRSA 4TKNA 1X11A 3CIKA 4KAXB 1MIXA 3NSUA 1MKEA 4NSWA 5CLQB 4L6EA 1PFJA 5KCVA 1V88A 1OY2A 2DKPA 1NTYA 4WVFB 1DDVA 4CSQA 3T06A 5JLJB 2L2IA 2QKMA 2D10A 1V5UA 1NI2A 2K2JA 2DYNA 2RNRB 2KR0A 1MK7B 4HB4B 3VIAA 3VOQA 3TW1A 2L1CA 2YSZA 2FJUB 1WGQA 1BWNA 4DIXA 2COAA 1EAZA 3PVUA 4KHBA 2LG1A 3PP2A 2H7EA 4MY6A 1WGUA 3OANA 2YRYA 3PVWA 5JHHA 4MK0A 3SUZA 5L81A 2KUPA 1P3RA 1H4RA 1P5TA 1RRPB 1W1GA 4OT1A 1FHWA 4CHJA 1MAIA 5C5BA 1GC7A 4KHAA 3HQCA 5I2MA 2FJLA 1DYNA 3DXCA 4HAUB 1PLSA 1NTVA 2EJ8A 4OSNA 4Z2MB 2XQNM 2D9XA 4NY0A 2DLWA 4BBKA 4GXBA 1FGZA 2YS1A 4HAZB 2YS3A 3SO6A 4DBBA
chains in the Genus database with same CATH topology
4H8SA 3MDBC 2Z0OA 3PG7A 2D9ZA 2K00A 3P7ZA 3KSYA 3LJUX 1BAKA 1U5DA 4F7UP 4WJ7A 3KRXA 4HB0B 2D2QA 2YT0A 3WYFB 3D8FA 4PNKA 1X86A 5DI9B 1SHCA 1U5EA 1LB1A 2AEHA 2GCLA 5GOWB 4Y94A 3TVVA 1H10A 1K5DB 1UNPA 2GCJA 5KQ1A 2ROZB 1U29A 2Y8GA 3G9WA 3TO1A 4K17A 4HDOA 1MK9B 2CAYA 4HAWB 3HK0A 5D27A 1ZVRA 4XWXA 2VKIA 2I5FA 2JP2A 2RVBB 2ZPYA 2CY5A 1LW3A 2EMTA 1Z87A 2H7DA 1E5WA 3GYPA 1X1FA 2EMSA 4CHMA 2DX5A 1AWEA 1X05A 2CODA 4HHVA 3SV1A 4GMVA 5J3QA 2OQBA 1TJ6A 1M7RA 5D3WA 2D9WA 2UZRA 4ZRJA 4HB2B 1FHOA 2J0JA 4KHBB 4GPTB 2DTCA 3ODXA 2P0DA 2KGXB 2Q13A 3N7CA 1J0WA 2ROVA 1K5GB 4IFSA 2P8VA 1PMSA 3M1IB 5DHFB 2J59M 2KCJA 4K2PA 2NZ8B 5C5BB 3QBVB 2YF0A 3IVFA 3AU4A 5J3YA 4CYEA 3BJIA 4EKUA 1EF1A 1WJ1A 2Y8FA 5EFXA 2ELBA 3DXEA 3PVLA 1UEFA 4MT7A 1DROA 1WJMA 2UVMA 4GMXB 3BINA 4WSFA 1P6SA 1XCGA 2HE7A 2VRWB 1I2HA 2W2WA 3F0WA 2I1JA 3PEGA 3A8PA 1FAOA 1BTNA 1ISNA 5LOPB 2PZ1A 2R0DA 1ZC3B 3SYXA 4GN1A 1ZM0A 2MWNB 5DIFB 2I5CA 5D3YA 2RUKB 2D9VA 5D3XA 5HE2A 1UPQA 1V5PA 1NU2A 2DA0A 2E2XA 1N3HA 4HDQA 1QQGA 2HTHB 1U5GA 2J0MA 3ULBA 2GS0A 4F7HA 3GYOA 3MPXA 1TXDA 2D9YA 1DDWA 5CLLB 5LONB 5HE3A 5JP4A 2N23A 2COFA 2LYDA 1XKEA 4YONA 4DX8A 2COCA 4K81A 1XD4A 5J3TA 4GZUA 5KQ4A 3KRWA 3FM8C 4A6HA 2P0FA 1U5FA 4A6FA 2ELAA 3SNHA 2LKOA 1Y5OA 5HE1A 2Z0QA 2P0HA 1TQZA 4EJNA 1EGXA 1KI1B 3ZDTA 4YL8A 1J19A 1WG7A 2QKLA 1M7EA 1U27A 4D0NB 2M14A 1RJ2A 1V61A 5HE0A 3RCPA 2YVCA 4HAVB 1MIZB 2RLOA 3V5WA 3CXBB 1GG3A 2R09A 2RGNB 3PSCA 3P6AA 1W1DA 2EC1A 3O96A 2DFKA 2W2XC 1OQNA 4KVGB 1UNQA 2DHJA 3U7DA 2DHIA 4P7IA 4DXAB 1DDMA 1B55A 5DHAB 2MDXA 1KZGA 2D4QA 2DKQA 1FHXA 1EVHA 4HAYB 1X1GA 4A6KA 2RSGA 4B6HA 3AU5A 1XODA 5FI1A 4F7GA 1ZSQA 2ADZA 2D11A 3TFMA 4ZRIA 2YT1A 4PQ0A 2V76A 2DN6A 3A98B 1MPHA 1FOEA 3ZVRA 1W1HA 2YS5A 1FB8A 2IFSA 2X18A 1XX0A 2BCJA 2MKRA 3U8ZA 2CRFA 2LOXA 2LULA 2N0YA 3TCAA 2Y7BA 2W2XD 3ML4A 1BTKA 2MFQA 3ODOA 3DXDA 4C0AA 4A6FB 1GC6A 3AJ4A 1U2BA 2K2UA 2NMBA 3F5RA 2UZSA 4A5KA 2CY4A 5JHGA 3D8DA 1WVHA 3UZTA 5FI0A 2M38A 1SGHA 2IYBA 3QWMA 3D8EA 2Z0PA 4IOYX 4TYZA 4KHOA 1QC6A 5D3VA 1ZC4B 4HB3B 2I1KA 4Z2NA 1KZ7A 1I7AA 1XR0B 3WA0A 4DX90 1OMWA 4HATB 2AL6A 2DYQA 1Q67A 3FSSA 5C16A 4HAXB 3X23A 5DH9B 1AQCA 5C79A 1Y19B 5C6RA 2VSZA 4EMOA 3PZDA 2G35A 3FEHA 1V89A 1DBHA 2DX1A 2DHKA 3KY9A 3ODWA 3KZ1A 3A8QA 3QIJA 3ULCA 2OTXA 1UPRA 3HW2B 4ZRKA 1FGYA 1UNRA 4K2OA 1V5MA 2LOZA 2GJYA 2J0KA 4IAPA 1WI1A 1IRSA 4TKNA 1X11A 3CIKA 4KAXB 1MIXA 3NSUA 1MKEA 4NSWA 5CLQB 4L6EA 1PFJA 5KCVA 1V88A 1OY2A 2DKPA 1NTYA 4WVFB 1DDVA 3T06A 5JLJB 2L2IA 2QKMA 2D10A 1V5UA 1NI2A 2K2JA 2DYNA 2RNRB 1MK7B 4HB4B 3VIAA 3VOQA 3TW1A 2L1CA 2YSZA 1WGQA 1BWNA 2COAA 1EAZA 3PVUA 2LG1A 3PP2A 2H7EA 4MY6A 1WGUA 3OANA 2YRYA 3PVWA 5JHHA 4MK0A 3SUZA 5L81A 2KUPA 1P3RA 1H4RA 1P5TA 1RRPB 1W1GA 5C5BA 1FHWA 4CHJA 1MAIA 1GC7A 4KHAA 3HQCA 2FJLA 1DYNA 3DXCA 4HAUB 1PLSA 1NTVA 2EJ8A 4Z2MB 2XQNM 2D9XA 4NY0A 2DLWA 4BBKA 4GXBA 1FGZA 2YS1A 4HAZB 2YS3A 3SO6A 4DBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8S A;  3MDB C;  2Z0O A;  3PG7 A;  2D9Z A;  2K00 A;  3P7Z A;  3KSY A;  3LJU X;  1BAK A;  1U5D A;  4F7U P;  4WJ7 A;  3KRX A;  4HB0 B;  2D2Q A;  2YT0 A;  3WYF B;  3D8F A;  4PNK A;  1X86 A;  5DI9 B;  1SHC A;  1U5E A;  1LB1 A;  2AEH A;  2GCL A;  5GOW B;  4Y94 A;  3TVV A;  1H10 A;  1K5D B;  1UNP A;  2GCJ A;  5KQ1 A;  2ROZ B;  1U29 A;  2Y8G A;  3G9W A;  3TO1 A;  4K17 A;  4HDO A;  1MK9 B;  2CAY A;  4HAW B;  3HK0 A;  5D27 A;  1ZVR A;  4XWX A;  2VKI A;  2I5F A;  2JP2 A;  2RVB B;  2ZPY A;  2CY5 A;  1LW3 A;  2EMT A;  1Z87 A;  2H7D A;  1E5W A;  3GYP A;  1X1F A;  2EMS A;  4CHM A;  2DX5 A;  1AWE A;  1X05 A;  2COD A;  4HHV A;  3SV1 A;  4GMV A;  5J3Q A;  2OQB A;  1TJ6 A;  1M7R A;  5D3W A;  2D9W A;  2UZR A;  4ZRJ A;  4HB2 B;  1FHO A;  2J0J A;  4KHB B;  4GPT B;  2DTC A;  3ODX A;  2P0D A;  2KGX B;  2Q13 A;  3N7C A;  1J0W A;  2ROV A;  1K5G B;  4IFS A;  2P8V A;  1PMS A;  3M1I B;  5DHF B;  2J59 M;  2KCJ A;  4K2P A;  2NZ8 B;  5C5B B;  3QBV B;  2YF0 A;  3IVF A;  3AU4 A;  5J3Y A;  4CYE A;  3BJI A;  4EKU A;  1EF1 A;  1WJ1 A;  2Y8F A;  5EFX A;  2ELB A;  3DXE A;  3PVL A;  1UEF A;  4MT7 A;  1DRO A;  1WJM A;  2UVM A;  4GMX B;  3BIN A;  4WSF A;  1P6S A;  1XCG A;  2HE7 A;  2VRW B;  1I2H A;  2W2W A;  3F0W A;  2I1J A;  3PEG A;  3A8P A;  1FAO A;  1BTN A;  1ISN A;  5LOP B;  2PZ1 A;  2R0D A;  1ZC3 B;  3SYX A;  4GN1 A;  1ZM0 A;  2MWN B;  5DIF B;  2I5C A;  5D3Y A;  2RUK B;  2D9V A;  5D3X A;  5HE2 A;  1UPQ A;  1V5P A;  1NU2 A;  2DA0 A;  2E2X A;  1N3H A;  4HDQ A;  1QQG A;  2HTH B;  1U5G A;  2J0M A;  3ULB A;  2GS0 A;  4F7H A;  3GYO A;  3MPX A;  1TXD A;  2D9Y A;  1DDW A;  5CLL B;  5LON B;  5HE3 A;  5JP4 A;  2N23 A;  2COF A;  2LYD A;  1XKE A;  4YON A;  4DX8 A;  2COC A;  4K81 A;  1XD4 A;  5J3T A;  4GZU A;  5KQ4 A;  3KRW A;  3FM8 C;  4A6H A;  2P0F A;  1U5F A;  4A6F A;  2ELA A;  3SNH A;  2LKO A;  1Y5O A;  5HE1 A;  2Z0Q A;  2P0H A;  1TQZ A;  4EJN A;  1EGX A;  1KI1 B;  3ZDT A;  4YL8 A;  1J19 A;  1WG7 A;  2QKL A;  1M7E A;  1U27 A;  4D0N B;  2M14 A;  1RJ2 A;  1V61 A;  5HE0 A;  3RCP A;  2YVC A;  4HAV B;  1MIZ B;  2RLO A;  3V5W A;  3CXB B;  1GG3 A;  2R09 A;  2RGN B;  3PSC A;  3P6A A;  1W1D A;  2EC1 A;  3O96 A;  2DFK A;  2W2X C;  1OQN A;  4KVG B;  1UNQ A;  2DHJ A;  3U7D A;  2DHI A;  4P7I A;  4DXA B;  1DDM A;  1B55 A;  5DHA B;  2MDX A;  1KZG A;  2D4Q A;  2DKQ A;  1FHX A;  1EVH A;  4HAY B;  1X1G A;  4A6K A;  2RSG A;  4B6H A;  3AU5 A;  1XOD A;  5FI1 A;  4F7G A;  1ZSQ A;  2ADZ A;  2D11 A;  3TFM A;  4ZRI A;  2YT1 A;  4PQ0 A;  2V76 A;  2DN6 A;  3A98 B;  1MPH A;  1FOE A;  3ZVR A;  1W1H A;  2YS5 A;  1FB8 A;  2IFS A;  2X18 A;  1XX0 A;  2BCJ A;  2MKR A;  3U8Z A;  2CRF A;  2LOX A;  2LUL A;  2N0Y A;  3TCA A;  2Y7B A;  2W2X D;  3ML4 A;  1BTK A;  2MFQ A;  3ODO A;  3DXD A;  4C0A A;  4A6F B;  1GC6 A;  3AJ4 A;  1U2B A;  2K2U A;  2NMB A;  3F5R A;  2UZS A;  4A5K A;  2CY4 A;  5JHG A;  3D8D A;  1WVH A;  3UZT A;  5FI0 A;  2M38 A;  1SGH A;  2IYB A;  3QWM A;  3D8E A;  2Z0P A;  4IOY X;  4TYZ A;  4KHO A;  1QC6 A;  5D3V A;  1ZC4 B;  4HB3 B;  2I1K A;  4Z2N A;  1KZ7 A;  1I7A A;  1XR0 B;  3WA0 A;  4DX9 0;  1OMW A;  4HAT B;  2AL6 A;  2DYQ A;  1Q67 A;  3FSS A;  5C16 A;  4HAX B;  3X23 A;  5DH9 B;  1AQC A;  5C79 A;  1Y19 B;  5C6R A;  2VSZ A;  4EMO A;  3PZD A;  2G35 A;  3FEH A;  1V89 A;  1DBH A;  2DX1 A;  2DHK A;  3KY9 A;  3ODW A;  3KZ1 A;  3A8Q A;  3QIJ A;  3ULC A;  2OTX A;  1UPR A;  3HW2 B;  4ZRK A;  1FGY A;  1UNR A;  4K2O A;  1V5M A;  2LOZ A;  2GJY A;  2J0K A;  4IAP A;  1WI1 A;  1IRS A;  4TKN A;  1X11 A;  3CIK A;  4KAX B;  1MIX A;  3NSU A;  1MKE A;  4NSW A;  5CLQ B;  4L6E A;  1PFJ A;  5KCV A;  1V88 A;  1OY2 A;  2DKP A;  1NTY A;  4WVF B;  1DDV A;  3T06 A;  5JLJ B;  2L2I A;  2QKM A;  2D10 A;  1V5U A;  1NI2 A;  2K2J A;  2DYN A;  2RNR B;  1MK7 B;  4HB4 B;  3VIA A;  3VOQ A;  3TW1 A;  2L1C A;  2YSZ A;  1WGQ A;  1BWN A;  2COA A;  1EAZ A;  3PVU A;  2LG1 A;  3PP2 A;  2H7E A;  4MY6 A;  1WGU A;  3OAN A;  2YRY A;  3PVW A;  5JHH A;  4MK0 A;  3SUZ A;  5L81 A;  2KUP A;  1P3R A;  1H4R A;  1P5T A;  1RRP B;  1W1G A;  5C5B A;  1FHW A;  4CHJ A;  1MAI A;  1GC7 A;  4KHA A;  3HQC A;  2FJL A;  1DYN A;  3DXC A;  4HAU B;  1PLS A;  1NTV A;  2EJ8 A;  4Z2M B;  2XQN M;  2D9X A;  4NY0 A;  2DLW A;  4BBK A;  4GXB A;  1FGZ A;  2YS1 A;  4HAZ B;  2YS3 A;  3SO6 A;  4DBB A; 
#chains in the Genus database with same CATH topology
 4H8S A;  3MDB C;  2Z0O A;  3PG7 A;  2D9Z A;  2K00 A;  3KSY A;  3P7Z A;  3LJU X;  1BAK A;  1U5D A;  4F7U P;  4WJ7 A;  3NWD A;  3HSA A;  3KRX A;  4HB0 B;  2D2Q A;  2YT0 A;  3WYF B;  3D8F A;  4PNK A;  1X86 A;  5DI9 B;  1SHC A;  1U5E A;  4HSI A;  1LB1 A;  2ZKM X;  2AEH A;  2GCL A;  5GOW B;  4Y94 A;  3TVV A;  1H10 A;  1K5D B;  1UNP A;  2GCJ A;  5KQ1 A;  2ROZ B;  1U29 A;  2Y8G A;  3G9W A;  3TO1 A;  4K17 A;  4HDO A;  1MK9 B;  2CAY A;  2Z13 A;  2K8E A;  4HAW B;  3HK0 A;  5D27 A;  1ZVR A;  4XWX A;  2VKI A;  2I5F A;  2JP2 A;  2RVB B;  2ZPY A;  2CY5 A;  1LW3 A;  2EMT A;  1Z87 A;  2H7D A;  1E5W A;  3GYP A;  1X1F A;  3A58 A;  2EMS A;  4CHM A;  2DX5 A;  1AWE A;  1X05 A;  2COD A;  4HHV A;  3SV1 A;  4GMV A;  3U12 A;  5J3Q A;  2OQB A;  1TJ6 A;  1M7R A;  4QJ3 B;  5D3W A;  2D9W A;  2UZR A;  4ZRJ A;  4HB2 B;  1FHO A;  2J0J A;  4KHB B;  4GPT B;  2DTC A;  3ODX A;  2P0D A;  2KGX B;  2Q13 A;  3N7C A;  1J0W A;  2ROV A;  4QJ4 B;  1K5G B;  4IFS A;  2P8V A;  1PMS A;  3M1I B;  5DHF B;  2J59 M;  3OHM B;  2KCJ A;  4K2P A;  2KUQ A;  2NZ8 B;  5C5B B;  3QBV B;  2YF0 A;  3IVF A;  3AU4 A;  5J3Y A;  4CYE A;  3BJI A;  4EKU A;  1EF1 A;  1WJ1 A;  2Y8F A;  5EFX A;  2ELB A;  3DXE A;  3PVL A;  1UEF A;  4MT7 A;  1DRO A;  1WJM A;  2UVM A;  4GMX B;  3BIN A;  4WSF A;  1P6S A;  1XCG A;  2HE7 A;  2VRW B;  1I2H A;  2W2W A;  3F0W A;  2I1J A;  3PEG A;  3A8P A;  1FAO A;  1BTN A;  1ISN A;  5LOP B;  2PZ1 A;  2R0D A;  1ZC3 B;  3SYX A;  4GN1 A;  1ZM0 A;  2MWN B;  5DIF B;  2I5C A;  5D3Y A;  2RUK B;  2D9V A;  5D3X A;  5HE2 A;  1UPQ A;  1V5P A;  1NU2 A;  2DA0 A;  2E2X A;  1N3H A;  4GNK B;  1QQG A;  4HDQ A;  2HTH B;  1U5G A;  2J0M A;  3ULB A;  2GS0 A;  4F7H A;  3GYO A;  3MPX A;  1TXD A;  2Z4D A;  2D9Y A;  1DDW A;  5CLL B;  5LON B;  5HE3 A;  5JP4 A;  2N23 A;  2COF A;  2LYD A;  1XKE A;  4YON A;  4DX8 A;  2COC A;  4K81 A;  1XD4 A;  5J3T A;  4GZU A;  5KQ4 A;  3KRW A;  3FM8 C;  4A6H A;  2P0F A;  1U5F A;  4A6F A;  2GUM A;  1ZYI A;  2ELA A;  3HIE A;  3SNH A;  2LKO A;  1Y5O A;  3NW8 A;  3NWA A;  5HE1 A;  2Z0Q A;  2P0H A;  1MI1 A;  1TQZ A;  4EJN A;  1EGX A;  1KI1 B;  3ZDT A;  4YL8 A;  1J19 A;  1WG7 A;  2KIE A;  2QKL A;  1M7E A;  5LG4 B;  1U27 A;  4D0N B;  2M14 A;  1RJ2 A;  1V61 A;  5HE0 A;  3RCP A;  2YVC A;  4HAV B;  1MIZ B;  2RLO A;  3V5W A;  3CXB B;  2Z14 A;  1GG3 A;  2R09 A;  2RGN B;  3PSC A;  3P6A A;  1W1D A;  2YT2 A;  2EC1 A;  3O96 A;  2DFK A;  2W2X C;  1OQN A;  4KVG B;  1UNQ A;  2R2Y A;  2DHJ A;  3U7D A;  2DHI A;  4P7I A;  4DXA B;  2RRF A;  1DDM A;  1B55 A;  5DHA B;  4QXA B;  2MDX A;  1KZG A;  5I2S A;  2D4Q A;  2DKQ A;  1FHX A;  1EVH A;  4HAY B;  1X1G A;  4A6K A;  2RSG A;  4B6H A;  3AU5 A;  1XOD A;  5FI1 A;  4F7G A;  1ZSQ A;  2ADZ A;  2D11 A;  3TFM A;  1T77 A;  4ZRI A;  2YT1 A;  4PQ0 A;  2V76 A;  2DN6 A;  3A98 B;  3NWF A;  1MPH A;  1FOE A;  3ZVR A;  1W1H A;  2YS5 A;  1FB8 A;  2IFS A;  2X18 A;  1XX0 A;  2BCJ A;  2MKR A;  3U8Z A;  2CRF A;  2LOX A;  2LUL A;  2N0Y A;  3TCA A;  2Y7B A;  2W2X D;  3ML4 A;  1BTK A;  2MFQ A;  3B77 A;  3ODO A;  3DXD A;  4C0A A;  4A6F B;  3DCX A;  1GC6 A;  2Z59 A;  3AJ4 A;  1U2B A;  2K2U A;  2NMB A;  3F5R A;  2UZS A;  4A5K A;  2CY4 A;  5JHG A;  3D8D A;  1WVH A;  5IRS A;  3UZT A;  5FI0 A;  2M38 A;  1SGH A;  2IYB A;  3QWM A;  3D8E A;  5M4Y B;  2Z0P A;  4IOY X;  4TYZ A;  4KHO A;  1QC6 A;  5D3V A;  1ZC4 B;  4HB3 B;  2I1K A;  4Z2N A;  1KZ7 A;  1I7A A;  1XR0 B;  3WA0 A;  4DX9 0;  1OMW A;  4HAT B;  2AL6 A;  3FVC A;  2DYQ A;  1Q67 A;  3FSS A;  5C16 A;  4HAX B;  3X23 A;  5DH9 B;  1AQC A;  5C79 A;  1Y19 B;  5C6R A;  2VSZ A;  4EMO A;  3PZD A;  2G35 A;  2KIG A;  3FEH A;  1V89 A;  1DBH A;  2DX1 A;  2NBV A;  2DHK A;  3KY9 A;  3ODW A;  3KZ1 A;  3A8Q A;  4GOU A;  4L1R A;  3QIJ A;  2K49 A;  3ULC A;  4QJ5 B;  2OTX A;  1UPR A;  3HW2 B;  4ZRK A;  1FGY A;  1UNR A;  4K2O A;  1V5M A;  2LOZ A;  2GJY A;  4D6W A;  2J0K A;  4IAP A;  1WI1 A;  1IRS A;  4TKN A;  1X11 A;  3CIK A;  4KAX B;  1MIX A;  3NSU A;  1MKE A;  4NSW A;  5CLQ B;  4L6E A;  1PFJ A;  5KCV A;  1V88 A;  1OY2 A;  2DKP A;  1NTY A;  4WVF B;  1DDV A;  4CSQ A;  3T06 A;  5JLJ B;  2L2I A;  2QKM A;  2D10 A;  1V5U A;  1NI2 A;  2K2J A;  2DYN A;  2RNR B;  2KR0 A;  1MK7 B;  4HB4 B;  3VIA A;  3VOQ A;  3TW1 A;  2L1C A;  2YSZ A;  2FJU B;  1WGQ A;  1BWN A;  4DIX A;  2COA A;  1EAZ A;  3PVU A;  4KHB A;  2LG1 A;  3PP2 A;  2H7E A;  4MY6 A;  1WGU A;  3OAN A;  2YRY A;  3PVW A;  5JHH A;  4MK0 A;  3SUZ A;  5L81 A;  2KUP A;  1P3R A;  1H4R A;  1P5T A;  1RRP B;  1W1G A;  4OT1 A;  1FHW A;  4CHJ A;  1MAI A;  5C5B A;  1GC7 A;  4KHA A;  3HQC A;  5I2M A;  2FJL A;  1DYN A;  3DXC A;  4HAU B;  1PLS A;  1NTV A;  2EJ8 A;  4OSN A;  4Z2M B;  2XQN M;  2D9X A;  4NY0 A;  2DLW A;  4BBK A;  4GXB A;  1FGZ A;  2YS1 A;  4HAZ B;  2YS3 A;  3SO6 A;  4DBB A; 
#chains in the Genus database with same CATH homology
 4H8S A;  3MDB C;  2Z0O A;  3PG7 A;  2D9Z A;  2K00 A;  3P7Z A;  3KSY A;  3LJU X;  1BAK A;  1U5D A;  4F7U P;  4WJ7 A;  3KRX A;  4HB0 B;  2D2Q A;  2YT0 A;  3WYF B;  3D8F A;  4PNK A;  1X86 A;  5DI9 B;  1SHC A;  1U5E A;  1LB1 A;  2AEH A;  2GCL A;  5GOW B;  4Y94 A;  3TVV A;  1H10 A;  1K5D B;  1UNP A;  2GCJ A;  5KQ1 A;  2ROZ B;  1U29 A;  2Y8G A;  3G9W A;  3TO1 A;  4K17 A;  4HDO A;  1MK9 B;  2CAY A;  4HAW B;  3HK0 A;  5D27 A;  1ZVR A;  4XWX A;  2VKI A;  2I5F A;  2JP2 A;  2RVB B;  2ZPY A;  2CY5 A;  1LW3 A;  2EMT A;  1Z87 A;  2H7D A;  1E5W A;  3GYP A;  1X1F A;  2EMS A;  4CHM A;  2DX5 A;  1AWE A;  1X05 A;  2COD A;  4HHV A;  3SV1 A;  4GMV A;  5J3Q A;  2OQB A;  1TJ6 A;  1M7R A;  5D3W A;  2D9W A;  2UZR A;  4ZRJ A;  4HB2 B;  1FHO A;  2J0J A;  4KHB B;  4GPT B;  2DTC A;  3ODX A;  2P0D A;  2KGX B;  2Q13 A;  3N7C A;  1J0W A;  2ROV A;  1K5G B;  4IFS A;  2P8V A;  1PMS A;  3M1I B;  5DHF B;  2J59 M;  2KCJ A;  4K2P A;  2NZ8 B;  5C5B B;  3QBV B;  2YF0 A;  3IVF A;  3AU4 A;  5J3Y A;  4CYE A;  3BJI A;  4EKU A;  1EF1 A;  1WJ1 A;  2Y8F A;  5EFX A;  2ELB A;  3DXE A;  3PVL A;  1UEF A;  4MT7 A;  1DRO A;  1WJM A;  2UVM A;  4GMX B;  3BIN A;  4WSF A;  1P6S A;  1XCG A;  2HE7 A;  2VRW B;  1I2H A;  2W2W A;  3F0W A;  2I1J A;  3PEG A;  3A8P A;  1FAO A;  1BTN A;  1ISN A;  5LOP B;  2PZ1 A;  2R0D A;  1ZC3 B;  3SYX A;  4GN1 A;  1ZM0 A;  2MWN B;  5DIF B;  2I5C A;  5D3Y A;  2RUK B;  2D9V A;  5D3X A;  5HE2 A;  1UPQ A;  1V5P A;  1NU2 A;  2DA0 A;  2E2X A;  1N3H A;  4HDQ A;  1QQG A;  2HTH B;  1U5G A;  2J0M A;  3ULB A;  2GS0 A;  4F7H A;  3GYO A;  3MPX A;  1TXD A;  2D9Y A;  1DDW A;  5CLL B;  5LON B;  5HE3 A;  5JP4 A;  2N23 A;  2COF A;  2LYD A;  1XKE A;  4YON A;  4DX8 A;  2COC A;  4K81 A;  1XD4 A;  5J3T A;  4GZU A;  5KQ4 A;  3KRW A;  3FM8 C;  4A6H A;  2P0F A;  1U5F A;  4A6F A;  2ELA A;  3SNH A;  2LKO A;  1Y5O A;  5HE1 A;  2Z0Q A;  2P0H A;  1TQZ A;  4EJN A;  1EGX A;  1KI1 B;  3ZDT A;  4YL8 A;  1J19 A;  1WG7 A;  2QKL A;  1M7E A;  1U27 A;  4D0N B;  2M14 A;  1RJ2 A;  1V61 A;  5HE0 A;  3RCP A;  2YVC A;  4HAV B;  1MIZ B;  2RLO A;  3V5W A;  3CXB B;  1GG3 A;  2R09 A;  2RGN B;  3PSC A;  3P6A A;  1W1D A;  2EC1 A;  3O96 A;  2DFK A;  2W2X C;  1OQN A;  4KVG B;  1UNQ A;  2DHJ A;  3U7D A;  2DHI A;  4P7I A;  4DXA B;  1DDM A;  1B55 A;  5DHA B;  2MDX A;  1KZG A;  2D4Q A;  2DKQ A;  1FHX A;  1EVH A;  4HAY B;  1X1G A;  4A6K A;  2RSG A;  4B6H A;  3AU5 A;  1XOD A;  5FI1 A;  4F7G A;  1ZSQ A;  2ADZ A;  2D11 A;  3TFM A;  4ZRI A;  2YT1 A;  4PQ0 A;  2V76 A;  2DN6 A;  3A98 B;  1MPH A;  1FOE A;  3ZVR A;  1W1H A;  2YS5 A;  1FB8 A;  2IFS A;  2X18 A;  1XX0 A;  2BCJ A;  2MKR A;  3U8Z A;  2CRF A;  2LOX A;  2LUL A;  2N0Y A;  3TCA A;  2Y7B A;  2W2X D;  3ML4 A;  1BTK A;  2MFQ A;  3ODO A;  3DXD A;  4C0A A;  4A6F B;  1GC6 A;  3AJ4 A;  1U2B A;  2K2U A;  2NMB A;  3F5R A;  2UZS A;  4A5K A;  2CY4 A;  5JHG A;  3D8D A;  1WVH A;  3UZT A;  5FI0 A;  2M38 A;  1SGH A;  2IYB A;  3QWM A;  3D8E A;  2Z0P A;  4IOY X;  4TYZ A;  4KHO A;  1QC6 A;  5D3V A;  1ZC4 B;  4HB3 B;  2I1K A;  4Z2N A;  1KZ7 A;  1I7A A;  1XR0 B;  3WA0 A;  4DX9 0;  1OMW A;  4HAT B;  2AL6 A;  2DYQ A;  1Q67 A;  3FSS A;  5C16 A;  4HAX B;  3X23 A;  5DH9 B;  1AQC A;  5C79 A;  1Y19 B;  5C6R A;  2VSZ A;  4EMO A;  3PZD A;  2G35 A;  3FEH A;  1V89 A;  1DBH A;  2DX1 A;  2DHK A;  3KY9 A;  3ODW A;  3KZ1 A;  3A8Q A;  3QIJ A;  3ULC A;  2OTX A;  1UPR A;  3HW2 B;  4ZRK A;  1FGY A;  1UNR A;  4K2O A;  1V5M A;  2LOZ A;  2GJY A;  2J0K A;  4IAP A;  1WI1 A;  1IRS A;  4TKN A;  1X11 A;  3CIK A;  4KAX B;  1MIX A;  3NSU A;  1MKE A;  4NSW A;  5CLQ B;  4L6E A;  1PFJ A;  5KCV A;  1V88 A;  1OY2 A;  2DKP A;  1NTY A;  4WVF B;  1DDV A;  3T06 A;  5JLJ B;  2L2I A;  2QKM A;  2D10 A;  1V5U A;  1NI2 A;  2K2J A;  2DYN A;  2RNR B;  1MK7 B;  4HB4 B;  3VIA A;  3VOQ A;  3TW1 A;  2L1C A;  2YSZ A;  1WGQ A;  1BWN A;  2COA A;  1EAZ A;  3PVU A;  2LG1 A;  3PP2 A;  2H7E A;  4MY6 A;  1WGU A;  3OAN A;  2YRY A;  3PVW A;  5JHH A;  4MK0 A;  3SUZ A;  5L81 A;  2KUP A;  1P3R A;  1H4R A;  1P5T A;  1RRP B;  1W1G A;  5C5B A;  1FHW A;  4CHJ A;  1MAI A;  1GC7 A;  4KHA A;  3HQC A;  2FJL A;  1DYN A;  3DXC A;  4HAU B;  1PLS A;  1NTV A;  2EJ8 A;  4Z2M B;  2XQN M;  2D9X A;  4NY0 A;  2DLW A;  4BBK A;  4GXB A;  1FGZ A;  2YS1 A;  4HAZ B;  2YS3 A;  3SO6 A;  4DBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...