3D8FA

Crystal structure of the human fe65-ptb1 domain with bound phosphate (trigonal crystal form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
127
Chain Sequence
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
total genus 32
structure length 127
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8fA00
4TYZA 1UEFA 2J0MA 2RVBB 3SV1A 3QIJA 1FGZA 3ODXA 3OANA 4YONA 2IFSA 4GMVA 3P6AA 3WA0A 2PZ1A 1RRPB 2EJ8A 2N0YA 1QQGA 2KGXB 3QWMA 3BINA 2H7EA 4BBKA 1FAOA 3D8FA 2R0DA 1KI1B 5GOWB 2HTHB 3IVFA 1XKEA 2J59M 4Z2NA 4Z2MB 4IAPA 1M7EA 2L1CA 3WYFB 1U5DA 2G35A 2Y8FA 5JHHA 4IFSA 2DHJA 2D9WA 2DKPA 2DLWA 5HE3A 2MWNB 3TO1A 1I2HA 3TVVA 4WVFB 1ZC4B 2QKMA 3AU4A 2NZ8B 1WVHA 1U5EA 3TFMA 1DDMA 2M14A 1X05A 2GCJA 1XX0A 5D27A 4XWXA 3A98B 4MT7A 1J0WA 4GPTB 1V5UA 1MKEA 1LB1A 1H4RA 2MKRA 4C0AA 3PZDA 4HATB 2P0HA 3P7ZA 1Z87A 4ZRIA 5JP4A 2OQBA 3CXBB 1V89A 4D0NB 5C16A 4HB2B 3UZTA 2LG1A 4KHAA 1N3HA 4K2PA 4CHMA 2RLOA 1U2BA 4MK0A 5FI0A 1NI2A 1M7RA 3PVLA 2GJYA 2L2IA 2RGNB 3A8QA 2D4QA 2NMBA 5EFXA 1WJ1A 5HE1A 4A6HA 2AL6A 2DX5A 2J0JA 3F5RA 2LYDA 5JLJB 4HAVB 2RUKB 3GYOA 1PLSA 3T06A 1H10A 4K2OA 2ROZB 3G9WA 1WGQA 4GZUA 4HB0B 1Q67A 2ROVA 3HQCA 4HAZB 3KZ1A 5KQ4A 2V76A 2YF0A 5DI9B 1XODA 4HAWB 3U8ZA 3ZDTA 4B6HA 4HB4B 1B55A 5J3TA 5D3WA 1NTVA 1ZC3B 5LOPB 2I1JA 4WJ7A 2D9YA 1X1GA 2RSGA 4F7UP 2I5CA 2GCLA 3N7CA 4ZRJA 4MY6A 2K00A 4CHJA 1ZVRA 3TW1A 1P5TA 2EC1A 1DDVA 1TXDA 3DXEA 1OY2A 1LW3A 2YS5A 1U29A 4HAUB 2VRWB 1DBHA 2EMSA 1EGXA 2H7DA 4HDOA 2CRFA 1FOEA 3PVWA 3FEHA 3TCAA 3SUZA 3RCPA 3VIAA 2D9ZA 2Z0QA 2LKOA 4A6FA 3AU5A 4GXBA 5FI1A 3MPXA 2YSZA 1W1DA 3O96A 1UNPA 4KVGB 1TJ6A 3LJUX 1GC7A 2VKIA 3ODWA 1P6SA 2W2XD 4A6KA 4KAXB 3BJIA 1Y5OA 1OQNA 1W1HA 2D11A 4NY0A 2KUPA 3A8PA 1Y19B 2P0FA 3ULCA 2COFA 2D10A 5KCVA 5DHAB 5D3VA 1EVHA 2UZRA 4F7GA 4HB3B 4EJNA 4HAXB 4EKUA 3QBVB 5CLQB 5DIFB 5HE0A 2CY5A 2LOZA 2GS0A 5C5BA 2I5FA 3KRXA 4PQ0A 3F0WA 2DX1A 2IYBA 2K2UA 5LONB 3ML4A 3SO6A 2Y7BA 4K81A 1FHOA 1FGYA 1MIZB 1WJMA 5L81A 4EMOA 4WSFA 1UPRA 3ODOA 2E2XA 5CLLB 1BTNA 4HAYB 1E5WA 2YT1A 1FHWA 2CODA 1ISNA 3DXCA 2DKQA 4HDQA 3NSUA 3KY9A 3DXDA 5HE2A 4DX90 2RNRB 2QKLA 4K17A 1U5GA 1V5PA 4IOYX 1MAIA 1BTKA 2ELAA 1FB8A 1P3RA 3SNHA 2KCJA 1GC6A 4H8SA 3U7DA 1X11A 1J19A 2DTCA 2ZPYA 5KQ1A 2Z0PA 5C5BB 3AJ4A 1KZGA 3V5WA 1XCGA 2DN6A 2YS3A 5D3YA 1SHCA 5C6RA 2ADZA 2HE7A 4F7HA 2P0DA 1GG3A 2YS1A 1K5GB 2DFKA 2VSZA 2COAA 1X86A 2DA0A 2CY4A 1KZ7A 2YRYA 2Y8GA 3D8DA 2Q13A 2DHKA 1PMSA 5D3XA 2R09A 1U27A 1XR0B 2D2QA 4NSWA 5J3YA 2K2JA 2BCJA 2W2WA 1ZSQA 1WGUA 4CYEA 4A5KA 1I7AA 2J0KA 1MIXA 1WG7A 2YT0A 4DBBA 3ZVRA 1EF1A 5C79A 2DHIA 2EMTA 1BAKA 1DDWA 4GMXB 3SYXA 4Y94A 3MDBC 3KRWA 1TQZA 1NU2A 1V88A 3HW2B 5J3QA 2JP2A 1FHXA 2D9XA 2UVMA 3X23A 3GYPA 4KHOA 1DROA 4A6FB 2W2XC 3M1IB 1SGHA 1UNQA 1NTYA 1MPHA 3PP2A 1XD4A 1X1FA 1IRSA 3FSSA 1UPQA 2N23A 4KHBB 1K5DB 4DXAB 2ELBA 2COCA 4GN1A 1MK7B 1WI1A 3FM8C 1OMWA 4P7IA 1ZM0A 2AEHA 1V5MA 4ZRKA 2XQNM 2MFQA 3PG7A 2CAYA 1MK9B 4HHVA 3VOQA 2I1KA 1AQCA 1QC6A 1BWNA 3KSYA 4L6EA 1AWEA 4PNKA 3D8EA 2D9VA 3PSCA 4YL8A 1PFJA 3ULBA 2Z0OA 1EAZA 5DH9B 1DYNA 1RJ2A 1UNRA 2YVCA 2DYQA 2OTXA 2FJLA 2LOXA 2P8VA 2X18A 1W1GA 2UZSA 3HK0A 4DX8A 2DYNA 3PEGA 5DHFB 2M38A 1V61A 2LULA 5JHGA 4TKNA 3PVUA 1U5FA 2MDXA 3CIKA
chains in the Genus database with same CATH superfamily
4CSQA 4TYZA 1UEFA 2K49A 2J0MA 2RVBB 1MI1A 3SV1A 3QIJA 1FGZA 3ODXA 5I2MA 3OANA 4KHBA 4YONA 2IFSA 4GMVA 3P6AA 3WA0A 2PZ1A 1RRPB 2EJ8A 2N0YA 1QQGA 2KGXB 3QWMA 3BINA 2H7EA 4BBKA 1FAOA 3D8FA 4HSIA 2R0DA 1KI1B 2NBVA 5GOWB 2HTHB 3IVFA 1XKEA 2J59M 4Z2NA 4Z2MB 4IAPA 1M7EA 2L1CA 3WYFB 1U5DA 2G35A 2Y8FA 5JHHA 2KIEA 4QJ3B 2K8EA 4IFSA 2DHJA 2D9WA 2DKPA 2DLWA 5HE3A 2MWNB 3TO1A 1I2HA 3TVVA 4WVFB 4OT1A 1ZC4B 2QKMA 3AU4A 2KR0A 2NZ8B 1WVHA 1U5EA 3TFMA 1DDMA 2M14A 1X05A 2GCJA 1XX0A 5D27A 4XWXA 3A98B 4MT7A 1J0WA 1MKEA 1V5UA 2KIGA 4GPTB 1LB1A 1H4RA 2MKRA 4C0AA 3PZDA 4HATB 2P0HA 3P7ZA 1Z87A 4ZRIA 5JP4A 2OQBA 3CXBB 1V89A 2RRFA 4D0NB 5C16A 4HB2B 3UZTA 2LG1A 4KHAA 1N3HA 4K2PA 4CHMA 2RLOA 1U2BA 3OHMB 4MK0A 5FI0A 1NI2A 1M7RA 3PVLA 2GJYA 2L2IA 2RGNB 3A8QA 2D4QA 2NMBA 5EFXA 1WJ1A 5HE1A 4A6HA 2AL6A 2DX5A 2J0JA 3F5RA 2LYDA 5JLJB 4HAVB 2RUKB 3GYOA 1PLSA 3T06A 1H10A 4K2OA 2ROZB 3G9WA 1WGQA 4GZUA 4HB0B 1Q67A 2ROVA 3HQCA 3HIEA 4HAZB 3KZ1A 4DIXA 5KQ4A 2V76A 2YF0A 5DI9B 1XODA 4HAWB 3U8ZA 3ZDTA 4B6HA 4HB4B 1B55A 5J3TA 5D3WA 3B77A 1NTVA 1ZC3B 5LOPB 3DCXA 2I1JA 3HSAA 4WJ7A 2D9YA 1X1GA 2RSGA 4F7UP 2I5CA 2GCLA 3N7CA 4ZRJA 4MY6A 5I2SA 2K00A 4CHJA 1ZVRA 3TW1A 1P5TA 2EC1A 1DDVA 1TXDA 3DXEA 3NW8A 1OY2A 3FVCA 1LW3A 2YS5A 1U29A 4HAUB 2VRWB 1DBHA 2EMSA 1EGXA 2H7DA 4HDOA 2CRFA 1FOEA 3PVWA 3FEHA 3TCAA 3SUZA 3RCPA 3VIAA 2D9ZA 2Z0QA 2LKOA 4A6FA 3AU5A 4GXBA 5FI1A 3MPXA 2YSZA 1W1DA 3O96A 1UNPA 4KVGB 1TJ6A 3LJUX 4GOUA 1GC7A 2Z14A 2VKIA 3ODWA 1P6SA 2W2XD 4A6KA 3NWAA 4KAXB 4QJ4B 3BJIA 1Y5OA 1OQNA 1W1HA 2D11A 4NY0A 2KUPA 3A8PA 1Y19B 2P0FA 3ULCA 2COFA 2D10A 5KCVA 5DHAB 5D3VA 1EVHA 2UZRA 4F7GA 4D6WA 4HB3B 4EJNA 4HAXB 4EKUA 3QBVB 5CLQB 5DIFB 5HE0A 2CY5A 2LOZA 2GS0A 5C5BA 2I5FA 3KRXA 4PQ0A 3A58A 3F0WA 2DX1A 2IYBA 2K2UA 5LONB 3ML4A 3SO6A 2Y7BA 4K81A 1FHOA 1FGYA 1MIZB 1WJMA 5L81A 4EMOA 4WSFA 1UPRA 3ODOA 5M4YB 2E2XA 5CLLB 1BTNA 4HAYB 1E5WA 2YT1A 1FHWA 2CODA 1ISNA 3DXCA 4QJ5B 2DKQA 4HDQA 2GUMA 3NSUA 3KY9A 3DXDA 3NWDA 5HE2A 4DX90 2RNRB 2QKLA 4K17A 1U5GA 1V5PA 2Z59A 4IOYX 1MAIA 2YT2A 1BTKA 2ELAA 1FB8A 1P3RA 3SNHA 2KCJA 1GC6A 4H8SA 3U7DA 1X11A 1J19A 2DTCA 2ZPYA 5KQ1A 2Z0PA 5C5BB 3AJ4A 1KZGA 3V5WA 1XCGA 2DN6A 2YS3A 5D3YA 1SHCA 5C6RA 2ADZA 2HE7A 4F7HA 2P0DA 1GG3A 2YS1A 1K5GB 2DFKA 2VSZA 2COAA 1X86A 2DA0A 2CY4A 4OSNA 1KZ7A 2YRYA 2Y8GA 3D8DA 2Q13A 2DHKA 1PMSA 5D3XA 2R09A 1U27A 1XR0B 2D2QA 4NSWA 5J3YA 2K2JA 2BCJA 2W2WA 1ZSQA 1WGUA 4CYEA 4A5KA 1I7AA 2J0KA 1MIXA 1WG7A 2YT0A 4DBBA 3ZVRA 5LG4B 1EF1A 5C79A 2DHIA 2EMTA 2R2YA 1BAKA 1DDWA 4GMXB 3SYXA 4Y94A 1T77A 3MDBC 3NWFA 3KRWA 1TQZA 1NU2A 1V88A 3HW2B 5J3QA 2JP2A 1FHXA 2D9XA 2UVMA 3X23A 3GYPA 4KHOA 1DROA 3U12A 4A6FB 2Z13A 2W2XC 3M1IB 1SGHA 4L1RA 1UNQA 1NTYA 1MPHA 3PP2A 1XD4A 1X1FA 1IRSA 3FSSA 4GNKB 1UPQA 2N23A 4KHBB 1K5DB 2Z4DA 4DXAB 2ELBA 2COCA 4GN1A 1MK7B 1WI1A 3FM8C 1OMWA 4P7IA 1ZM0A 4QXAB 2AEHA 1V5MA 4ZRKA 2ZKMX 2XQNM 2MFQA 3PG7A 2CAYA 1MK9B 4HHVA 3VOQA 2I1KA 1AQCA 1QC6A 1BWNA 3KSYA 4L6EA 1AWEA 4PNKA 3D8EA 2D9VA 3PSCA 4YL8A 1PFJA 3ULBA 2Z0OA 1EAZA 1ZYIA 5DH9B 1DYNA 1RJ2A 1UNRA 2YVCA 2DYQA 2OTXA 2FJLA 2KUQA 2LOXA 2P8VA 2X18A 1W1GA 2UZSA 2FJUB 3HK0A 4DX8A 2DYNA 3PEGA 5DHFB 2M38A 1V61A 2LULA 5JHGA 4TKNA 3PVUA 1U5FA 2MDXA 5IRSA 3CIKA
chains in the Genus database with same CATH topology
4TYZA 1UEFA 2J0MA 2RVBB 3SV1A 3QIJA 1FGZA 3ODXA 3OANA 4YONA 2IFSA 4GMVA 3P6AA 3WA0A 2PZ1A 1RRPB 2EJ8A 2N0YA 1QQGA 2KGXB 3QWMA 3BINA 2H7EA 4BBKA 1FAOA 3D8FA 2R0DA 1KI1B 5GOWB 2HTHB 3IVFA 1XKEA 2J59M 4Z2NA 4Z2MB 4IAPA 1M7EA 2L1CA 3WYFB 1U5DA 2G35A 2Y8FA 5JHHA 4IFSA 2DHJA 2D9WA 2DKPA 2DLWA 5HE3A 2MWNB 3TO1A 1I2HA 3TVVA 4WVFB 1ZC4B 2QKMA 3AU4A 2NZ8B 1WVHA 1U5EA 3TFMA 1DDMA 2M14A 1X05A 2GCJA 1XX0A 5D27A 4XWXA 3A98B 4MT7A 1J0WA 4GPTB 1V5UA 1MKEA 1LB1A 1H4RA 2MKRA 4C0AA 3PZDA 4HATB 2P0HA 3P7ZA 1Z87A 4ZRIA 5JP4A 2OQBA 3CXBB 1V89A 4D0NB 5C16A 4HB2B 3UZTA 2LG1A 4KHAA 1N3HA 4K2PA 4CHMA 2RLOA 1U2BA 4MK0A 5FI0A 1NI2A 1M7RA 3PVLA 2GJYA 2L2IA 2RGNB 3A8QA 2D4QA 2NMBA 5EFXA 1WJ1A 5HE1A 4A6HA 2AL6A 2DX5A 2J0JA 3F5RA 2LYDA 5JLJB 4HAVB 2RUKB 3GYOA 1PLSA 3T06A 1H10A 4K2OA 2ROZB 3G9WA 1WGQA 4GZUA 4HB0B 1Q67A 2ROVA 3HQCA 4HAZB 3KZ1A 5KQ4A 2V76A 2YF0A 5DI9B 1XODA 4HAWB 3U8ZA 3ZDTA 4B6HA 4HB4B 1B55A 5J3TA 5D3WA 1NTVA 1ZC3B 5LOPB 2I1JA 4WJ7A 2D9YA 1X1GA 2RSGA 4F7UP 2I5CA 2GCLA 3N7CA 4ZRJA 4MY6A 2K00A 4CHJA 1ZVRA 3TW1A 1P5TA 2EC1A 1DDVA 1TXDA 3DXEA 1OY2A 1LW3A 2YS5A 1U29A 4HAUB 2VRWB 1DBHA 2EMSA 1EGXA 2H7DA 4HDOA 2CRFA 1FOEA 3PVWA 3FEHA 3TCAA 3SUZA 3RCPA 3VIAA 2D9ZA 2Z0QA 2LKOA 4A6FA 3AU5A 4GXBA 5FI1A 3MPXA 2YSZA 1W1DA 3O96A 1UNPA 4KVGB 1TJ6A 3LJUX 1GC7A 2VKIA 3ODWA 1P6SA 2W2XD 4A6KA 4KAXB 3BJIA 1Y5OA 1OQNA 1W1HA 2D11A 4NY0A 2KUPA 3A8PA 1Y19B 2P0FA 3ULCA 2COFA 2D10A 5KCVA 5DHAB 5D3VA 1EVHA 2UZRA 4F7GA 4HB3B 4EJNA 4HAXB 4EKUA 3QBVB 5CLQB 5DIFB 5HE0A 2CY5A 2LOZA 2GS0A 5C5BA 2I5FA 3KRXA 4PQ0A 3F0WA 2DX1A 2IYBA 2K2UA 5LONB 3ML4A 3SO6A 2Y7BA 4K81A 1FHOA 1FGYA 1MIZB 1WJMA 5L81A 4EMOA 4WSFA 1UPRA 3ODOA 2E2XA 5CLLB 1BTNA 4HAYB 1E5WA 2YT1A 1FHWA 2CODA 1ISNA 3DXCA 2DKQA 4HDQA 3NSUA 3KY9A 3DXDA 5HE2A 4DX90 2RNRB 2QKLA 4K17A 1U5GA 1V5PA 4IOYX 1MAIA 1BTKA 2ELAA 1FB8A 1P3RA 3SNHA 2KCJA 1GC6A 4H8SA 3U7DA 1X11A 1J19A 2DTCA 2ZPYA 5KQ1A 2Z0PA 5C5BB 3AJ4A 1KZGA 3V5WA 1XCGA 2DN6A 2YS3A 5D3YA 1SHCA 5C6RA 2ADZA 2HE7A 4F7HA 2P0DA 1GG3A 2YS1A 1K5GB 2DFKA 2VSZA 2COAA 1X86A 2DA0A 2CY4A 1KZ7A 2YRYA 2Y8GA 3D8DA 2Q13A 2DHKA 1PMSA 5D3XA 2R09A 1U27A 1XR0B 2D2QA 4NSWA 5J3YA 2K2JA 2BCJA 2W2WA 1ZSQA 1WGUA 4CYEA 4A5KA 1I7AA 2J0KA 1MIXA 1WG7A 2YT0A 4DBBA 3ZVRA 1EF1A 5C79A 2DHIA 2EMTA 1BAKA 1DDWA 4GMXB 3SYXA 4Y94A 3MDBC 3KRWA 1TQZA 1NU2A 1V88A 3HW2B 5J3QA 2JP2A 1FHXA 2D9XA 2UVMA 3X23A 3GYPA 4KHOA 1DROA 4A6FB 2W2XC 3M1IB 1SGHA 1UNQA 1NTYA 1MPHA 3PP2A 1XD4A 1X1FA 1IRSA 3FSSA 1UPQA 2N23A 4KHBB 1K5DB 4DXAB 2ELBA 2COCA 4GN1A 1MK7B 1WI1A 3FM8C 1OMWA 4P7IA 1ZM0A 2AEHA 1V5MA 4ZRKA 2XQNM 2MFQA 3PG7A 2CAYA 1MK9B 4HHVA 3VOQA 2I1KA 1AQCA 1QC6A 1BWNA 3KSYA 4L6EA 1AWEA 4PNKA 3D8EA 2D9VA 3PSCA 4YL8A 1PFJA 3ULBA 2Z0OA 1EAZA 5DH9B 1DYNA 1RJ2A 1UNRA 2YVCA 2DYQA 2OTXA 2FJLA 2LOXA 2P8VA 2X18A 1W1GA 2UZSA 3HK0A 4DX8A 2DYNA 3PEGA 5DHFB 2M38A 1V61A 2LULA 5JHGA 4TKNA 3PVUA 1U5FA 2MDXA 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYZ A;  1UEF A;  2J0M A;  2RVB B;  3SV1 A;  3QIJ A;  1FGZ A;  3ODX A;  3OAN A;  4YON A;  2IFS A;  4GMV A;  3P6A A;  3WA0 A;  2PZ1 A;  1RRP B;  2EJ8 A;  2N0Y A;  1QQG A;  2KGX B;  3QWM A;  3BIN A;  2H7E A;  4BBK A;  1FAO A;  3D8F A;  2R0D A;  1KI1 B;  5GOW B;  2HTH B;  3IVF A;  1XKE A;  2J59 M;  4Z2N A;  4Z2M B;  4IAP A;  1M7E A;  2L1C A;  3WYF B;  1U5D A;  2G35 A;  2Y8F A;  5JHH A;  4IFS A;  2DHJ A;  2D9W A;  2DKP A;  2DLW A;  5HE3 A;  2MWN B;  3TO1 A;  1I2H A;  3TVV A;  4WVF B;  1ZC4 B;  2QKM A;  3AU4 A;  2NZ8 B;  1WVH A;  1U5E A;  3TFM A;  1DDM A;  2M14 A;  1X05 A;  2GCJ A;  1XX0 A;  5D27 A;  4XWX A;  3A98 B;  4MT7 A;  1J0W A;  4GPT B;  1V5U A;  1MKE A;  1LB1 A;  1H4R A;  2MKR A;  4C0A A;  3PZD A;  4HAT B;  2P0H A;  3P7Z A;  1Z87 A;  4ZRI A;  5JP4 A;  2OQB A;  3CXB B;  1V89 A;  4D0N B;  5C16 A;  4HB2 B;  3UZT A;  2LG1 A;  4KHA A;  1N3H A;  4K2P A;  4CHM A;  2RLO A;  1U2B A;  4MK0 A;  5FI0 A;  1NI2 A;  1M7R A;  3PVL A;  2GJY A;  2L2I A;  2RGN B;  3A8Q A;  2D4Q A;  2NMB A;  5EFX A;  1WJ1 A;  5HE1 A;  4A6H A;  2AL6 A;  2DX5 A;  2J0J A;  3F5R A;  2LYD A;  5JLJ B;  4HAV B;  2RUK B;  3GYO A;  1PLS A;  3T06 A;  1H10 A;  4K2O A;  2ROZ B;  3G9W A;  1WGQ A;  4GZU A;  4HB0 B;  1Q67 A;  2ROV A;  3HQC A;  4HAZ B;  3KZ1 A;  5KQ4 A;  2V76 A;  2YF0 A;  5DI9 B;  1XOD A;  4HAW B;  3U8Z A;  3ZDT A;  4B6H A;  4HB4 B;  1B55 A;  5J3T A;  5D3W A;  1NTV A;  1ZC3 B;  5LOP B;  2I1J A;  4WJ7 A;  2D9Y A;  1X1G A;  2RSG A;  4F7U P;  2I5C A;  2GCL A;  3N7C A;  4ZRJ A;  4MY6 A;  2K00 A;  4CHJ A;  1ZVR A;  3TW1 A;  1P5T A;  2EC1 A;  1DDV A;  1TXD A;  3DXE A;  1OY2 A;  1LW3 A;  2YS5 A;  1U29 A;  4HAU B;  2VRW B;  1DBH A;  2EMS A;  1EGX A;  2H7D A;  4HDO A;  2CRF A;  1FOE A;  3PVW A;  3FEH A;  3TCA A;  3SUZ A;  3RCP A;  3VIA A;  2D9Z A;  2Z0Q A;  2LKO A;  4A6F A;  3AU5 A;  4GXB A;  5FI1 A;  3MPX A;  2YSZ A;  1W1D A;  3O96 A;  1UNP A;  4KVG B;  1TJ6 A;  3LJU X;  1GC7 A;  2VKI A;  3ODW A;  1P6S A;  2W2X D;  4A6K A;  4KAX B;  3BJI A;  1Y5O A;  1OQN A;  1W1H A;  2D11 A;  4NY0 A;  2KUP A;  3A8P A;  1Y19 B;  2P0F A;  3ULC A;  2COF A;  2D10 A;  5KCV A;  5DHA B;  5D3V A;  1EVH A;  2UZR A;  4F7G A;  4HB3 B;  4EJN A;  4HAX B;  4EKU A;  3QBV B;  5CLQ B;  5DIF B;  5HE0 A;  2CY5 A;  2LOZ A;  2GS0 A;  5C5B A;  2I5F A;  3KRX A;  4PQ0 A;  3F0W A;  2DX1 A;  2IYB A;  2K2U A;  5LON B;  3ML4 A;  3SO6 A;  2Y7B A;  4K81 A;  1FHO A;  1FGY A;  1MIZ B;  1WJM A;  5L81 A;  4EMO A;  4WSF A;  1UPR A;  3ODO A;  2E2X A;  5CLL B;  1BTN A;  4HAY B;  1E5W A;  2YT1 A;  1FHW A;  2COD A;  1ISN A;  3DXC A;  2DKQ A;  4HDQ A;  3NSU A;  3KY9 A;  3DXD A;  5HE2 A;  4DX9 0;  2RNR B;  2QKL A;  4K17 A;  1U5G A;  1V5P A;  4IOY X;  1MAI A;  1BTK A;  2ELA A;  1FB8 A;  1P3R A;  3SNH A;  2KCJ A;  1GC6 A;  4H8S A;  3U7D A;  1X11 A;  1J19 A;  2DTC A;  2ZPY A;  5KQ1 A;  2Z0P A;  5C5B B;  3AJ4 A;  1KZG A;  3V5W A;  1XCG A;  2DN6 A;  2YS3 A;  5D3Y A;  1SHC A;  5C6R A;  2ADZ A;  2HE7 A;  4F7H A;  2P0D A;  1GG3 A;  2YS1 A;  1K5G B;  2DFK A;  2VSZ A;  2COA A;  1X86 A;  2DA0 A;  2CY4 A;  1KZ7 A;  2YRY A;  2Y8G A;  3D8D A;  2Q13 A;  2DHK A;  1PMS A;  5D3X A;  2R09 A;  1U27 A;  1XR0 B;  2D2Q A;  4NSW A;  5J3Y A;  2K2J A;  2BCJ A;  2W2W A;  1ZSQ A;  1WGU A;  4CYE A;  4A5K A;  1I7A A;  2J0K A;  1MIX A;  1WG7 A;  2YT0 A;  4DBB A;  3ZVR A;  1EF1 A;  5C79 A;  2DHI A;  2EMT A;  1BAK A;  1DDW A;  4GMX B;  3SYX A;  4Y94 A;  3MDB C;  3KRW A;  1TQZ A;  1NU2 A;  1V88 A;  3HW2 B;  5J3Q A;  2JP2 A;  1FHX A;  2D9X A;  2UVM A;  3X23 A;  3GYP A;  4KHO A;  1DRO A;  4A6F B;  2W2X C;  3M1I B;  1SGH A;  1UNQ A;  1NTY A;  1MPH A;  3PP2 A;  1XD4 A;  1X1F A;  1IRS A;  3FSS A;  1UPQ A;  2N23 A;  4KHB B;  1K5D B;  4DXA B;  2ELB A;  2COC A;  4GN1 A;  1MK7 B;  1WI1 A;  3FM8 C;  1OMW A;  4P7I A;  1ZM0 A;  2AEH A;  1V5M A;  4ZRK A;  2XQN M;  2MFQ A;  3PG7 A;  2CAY A;  1MK9 B;  4HHV A;  3VOQ A;  2I1K A;  1AQC A;  1QC6 A;  1BWN A;  3KSY A;  4L6E A;  1AWE A;  4PNK A;  3D8E A;  2D9V A;  3PSC A;  4YL8 A;  1PFJ A;  3ULB A;  2Z0O A;  1EAZ A;  5DH9 B;  1DYN A;  1RJ2 A;  1UNR A;  2YVC A;  2DYQ A;  2OTX A;  2FJL A;  2LOX A;  2P8V A;  2X18 A;  1W1G A;  2UZS A;  3HK0 A;  4DX8 A;  2DYN A;  3PEG A;  5DHF B;  2M38 A;  1V61 A;  2LUL A;  5JHG A;  4TKN A;  3PVU A;  1U5F A;  2MDX A;  3CIK A; 
#chains in the Genus database with same CATH topology
 4CSQ A;  4TYZ A;  1UEF A;  2K49 A;  2J0M A;  2RVB B;  1MI1 A;  3SV1 A;  3QIJ A;  1FGZ A;  3ODX A;  5I2M A;  3OAN A;  4KHB A;  4YON A;  2IFS A;  4GMV A;  3P6A A;  3WA0 A;  2PZ1 A;  1RRP B;  2EJ8 A;  2N0Y A;  1QQG A;  2KGX B;  3QWM A;  3BIN A;  2H7E A;  4BBK A;  1FAO A;  3D8F A;  4HSI A;  2R0D A;  1KI1 B;  2NBV A;  5GOW B;  2HTH B;  3IVF A;  1XKE A;  2J59 M;  4Z2N A;  4Z2M B;  4IAP A;  1M7E A;  2L1C A;  3WYF B;  1U5D A;  2G35 A;  2Y8F A;  5JHH A;  2KIE A;  4QJ3 B;  2K8E A;  4IFS A;  2DHJ A;  2D9W A;  2DKP A;  2DLW A;  5HE3 A;  2MWN B;  3TO1 A;  1I2H A;  3TVV A;  4WVF B;  4OT1 A;  1ZC4 B;  2QKM A;  3AU4 A;  2KR0 A;  2NZ8 B;  1WVH A;  1U5E A;  3TFM A;  1DDM A;  2M14 A;  1X05 A;  2GCJ A;  1XX0 A;  5D27 A;  4XWX A;  3A98 B;  4MT7 A;  1J0W A;  1MKE A;  1V5U A;  2KIG A;  4GPT B;  1LB1 A;  1H4R A;  2MKR A;  4C0A A;  3PZD A;  4HAT B;  2P0H A;  3P7Z A;  1Z87 A;  4ZRI A;  5JP4 A;  2OQB A;  3CXB B;  1V89 A;  2RRF A;  4D0N B;  5C16 A;  4HB2 B;  3UZT A;  2LG1 A;  4KHA A;  1N3H A;  4K2P A;  4CHM A;  2RLO A;  1U2B A;  3OHM B;  4MK0 A;  5FI0 A;  1NI2 A;  1M7R A;  3PVL A;  2GJY A;  2L2I A;  2RGN B;  3A8Q A;  2D4Q A;  2NMB A;  5EFX A;  1WJ1 A;  5HE1 A;  4A6H A;  2AL6 A;  2DX5 A;  2J0J A;  3F5R A;  2LYD A;  5JLJ B;  4HAV B;  2RUK B;  3GYO A;  1PLS A;  3T06 A;  1H10 A;  4K2O A;  2ROZ B;  3G9W A;  1WGQ A;  4GZU A;  4HB0 B;  1Q67 A;  2ROV A;  3HQC A;  3HIE A;  4HAZ B;  3KZ1 A;  4DIX A;  5KQ4 A;  2V76 A;  2YF0 A;  5DI9 B;  1XOD A;  4HAW B;  3U8Z A;  3ZDT A;  4B6H A;  4HB4 B;  1B55 A;  5J3T A;  5D3W A;  3B77 A;  1NTV A;  1ZC3 B;  5LOP B;  3DCX A;  2I1J A;  3HSA A;  4WJ7 A;  2D9Y A;  1X1G A;  2RSG A;  4F7U P;  2I5C A;  2GCL A;  3N7C A;  4ZRJ A;  4MY6 A;  5I2S A;  2K00 A;  4CHJ A;  1ZVR A;  3TW1 A;  1P5T A;  2EC1 A;  1DDV A;  1TXD A;  3DXE A;  3NW8 A;  1OY2 A;  3FVC A;  1LW3 A;  2YS5 A;  1U29 A;  4HAU B;  2VRW B;  1DBH A;  2EMS A;  1EGX A;  2H7D A;  4HDO A;  2CRF A;  1FOE A;  3PVW A;  3FEH A;  3TCA A;  3SUZ A;  3RCP A;  3VIA A;  2D9Z A;  2Z0Q A;  2LKO A;  4A6F A;  3AU5 A;  4GXB A;  5FI1 A;  3MPX A;  2YSZ A;  1W1D A;  3O96 A;  1UNP A;  4KVG B;  1TJ6 A;  3LJU X;  4GOU A;  1GC7 A;  2Z14 A;  2VKI A;  3ODW A;  1P6S A;  2W2X D;  4A6K A;  3NWA A;  4KAX B;  4QJ4 B;  3BJI A;  1Y5O A;  1OQN A;  1W1H A;  2D11 A;  4NY0 A;  2KUP A;  3A8P A;  1Y19 B;  2P0F A;  3ULC A;  2COF A;  2D10 A;  5KCV A;  5DHA B;  5D3V A;  1EVH A;  2UZR A;  4F7G A;  4D6W A;  4HB3 B;  4EJN A;  4HAX B;  4EKU A;  3QBV B;  5CLQ B;  5DIF B;  5HE0 A;  2CY5 A;  2LOZ A;  2GS0 A;  5C5B A;  2I5F A;  3KRX A;  4PQ0 A;  3A58 A;  3F0W A;  2DX1 A;  2IYB A;  2K2U A;  5LON B;  3ML4 A;  3SO6 A;  2Y7B A;  4K81 A;  1FHO A;  1FGY A;  1MIZ B;  1WJM A;  5L81 A;  4EMO A;  4WSF A;  1UPR A;  3ODO A;  5M4Y B;  2E2X A;  5CLL B;  1BTN A;  4HAY B;  1E5W A;  2YT1 A;  1FHW A;  2COD A;  1ISN A;  3DXC A;  4QJ5 B;  2DKQ A;  4HDQ A;  2GUM A;  3NSU A;  3KY9 A;  3DXD A;  3NWD A;  5HE2 A;  4DX9 0;  2RNR B;  2QKL A;  4K17 A;  1U5G A;  1V5P A;  2Z59 A;  4IOY X;  1MAI A;  2YT2 A;  1BTK A;  2ELA A;  1FB8 A;  1P3R A;  3SNH A;  2KCJ A;  1GC6 A;  4H8S A;  3U7D A;  1X11 A;  1J19 A;  2DTC A;  2ZPY A;  5KQ1 A;  2Z0P A;  5C5B B;  3AJ4 A;  1KZG A;  3V5W A;  1XCG A;  2DN6 A;  2YS3 A;  5D3Y A;  1SHC A;  5C6R A;  2ADZ A;  2HE7 A;  4F7H A;  2P0D A;  1GG3 A;  2YS1 A;  1K5G B;  2DFK A;  2VSZ A;  2COA A;  1X86 A;  2DA0 A;  2CY4 A;  4OSN A;  1KZ7 A;  2YRY A;  2Y8G A;  3D8D A;  2Q13 A;  2DHK A;  1PMS A;  5D3X A;  2R09 A;  1U27 A;  1XR0 B;  2D2Q A;  4NSW A;  5J3Y A;  2K2J A;  2BCJ A;  2W2W A;  1ZSQ A;  1WGU A;  4CYE A;  4A5K A;  1I7A A;  2J0K A;  1MIX A;  1WG7 A;  2YT0 A;  4DBB A;  3ZVR A;  5LG4 B;  1EF1 A;  5C79 A;  2DHI A;  2EMT A;  2R2Y A;  1BAK A;  1DDW A;  4GMX B;  3SYX A;  4Y94 A;  1T77 A;  3MDB C;  3NWF A;  3KRW A;  1TQZ A;  1NU2 A;  1V88 A;  3HW2 B;  5J3Q A;  2JP2 A;  1FHX A;  2D9X A;  2UVM A;  3X23 A;  3GYP A;  4KHO A;  1DRO A;  3U12 A;  4A6F B;  2Z13 A;  2W2X C;  3M1I B;  1SGH A;  4L1R A;  1UNQ A;  1NTY A;  1MPH A;  3PP2 A;  1XD4 A;  1X1F A;  1IRS A;  3FSS A;  4GNK B;  1UPQ A;  2N23 A;  4KHB B;  1K5D B;  2Z4D A;  4DXA B;  2ELB A;  2COC A;  4GN1 A;  1MK7 B;  1WI1 A;  3FM8 C;  1OMW A;  4P7I A;  1ZM0 A;  4QXA B;  2AEH A;  1V5M A;  4ZRK A;  2ZKM X;  2XQN M;  2MFQ A;  3PG7 A;  2CAY A;  1MK9 B;  4HHV A;  3VOQ A;  2I1K A;  1AQC A;  1QC6 A;  1BWN A;  3KSY A;  4L6E A;  1AWE A;  4PNK A;  3D8E A;  2D9V A;  3PSC A;  4YL8 A;  1PFJ A;  3ULB A;  2Z0O A;  1EAZ A;  1ZYI A;  5DH9 B;  1DYN A;  1RJ2 A;  1UNR A;  2YVC A;  2DYQ A;  2OTX A;  2FJL A;  2KUQ A;  2LOX A;  2P8V A;  2X18 A;  1W1G A;  2UZS A;  2FJU B;  3HK0 A;  4DX8 A;  2DYN A;  3PEG A;  5DHF B;  2M38 A;  1V61 A;  2LUL A;  5JHG A;  4TKN A;  3PVU A;  1U5F A;  2MDX A;  5IRS A;  3CIK A; 
#chains in the Genus database with same CATH homology
 4TYZ A;  1UEF A;  2J0M A;  2RVB B;  3SV1 A;  3QIJ A;  1FGZ A;  3ODX A;  3OAN A;  4YON A;  2IFS A;  4GMV A;  3P6A A;  3WA0 A;  2PZ1 A;  1RRP B;  2EJ8 A;  2N0Y A;  1QQG A;  2KGX B;  3QWM A;  3BIN A;  2H7E A;  4BBK A;  1FAO A;  3D8F A;  2R0D A;  1KI1 B;  5GOW B;  2HTH B;  3IVF A;  1XKE A;  2J59 M;  4Z2N A;  4Z2M B;  4IAP A;  1M7E A;  2L1C A;  3WYF B;  1U5D A;  2G35 A;  2Y8F A;  5JHH A;  4IFS A;  2DHJ A;  2D9W A;  2DKP A;  2DLW A;  5HE3 A;  2MWN B;  3TO1 A;  1I2H A;  3TVV A;  4WVF B;  1ZC4 B;  2QKM A;  3AU4 A;  2NZ8 B;  1WVH A;  1U5E A;  3TFM A;  1DDM A;  2M14 A;  1X05 A;  2GCJ A;  1XX0 A;  5D27 A;  4XWX A;  3A98 B;  4MT7 A;  1J0W A;  4GPT B;  1V5U A;  1MKE A;  1LB1 A;  1H4R A;  2MKR A;  4C0A A;  3PZD A;  4HAT B;  2P0H A;  3P7Z A;  1Z87 A;  4ZRI A;  5JP4 A;  2OQB A;  3CXB B;  1V89 A;  4D0N B;  5C16 A;  4HB2 B;  3UZT A;  2LG1 A;  4KHA A;  1N3H A;  4K2P A;  4CHM A;  2RLO A;  1U2B A;  4MK0 A;  5FI0 A;  1NI2 A;  1M7R A;  3PVL A;  2GJY A;  2L2I A;  2RGN B;  3A8Q A;  2D4Q A;  2NMB A;  5EFX A;  1WJ1 A;  5HE1 A;  4A6H A;  2AL6 A;  2DX5 A;  2J0J A;  3F5R A;  2LYD A;  5JLJ B;  4HAV B;  2RUK B;  3GYO A;  1PLS A;  3T06 A;  1H10 A;  4K2O A;  2ROZ B;  3G9W A;  1WGQ A;  4GZU A;  4HB0 B;  1Q67 A;  2ROV A;  3HQC A;  4HAZ B;  3KZ1 A;  5KQ4 A;  2V76 A;  2YF0 A;  5DI9 B;  1XOD A;  4HAW B;  3U8Z A;  3ZDT A;  4B6H A;  4HB4 B;  1B55 A;  5J3T A;  5D3W A;  1NTV A;  1ZC3 B;  5LOP B;  2I1J A;  4WJ7 A;  2D9Y A;  1X1G A;  2RSG A;  4F7U P;  2I5C A;  2GCL A;  3N7C A;  4ZRJ A;  4MY6 A;  2K00 A;  4CHJ A;  1ZVR A;  3TW1 A;  1P5T A;  2EC1 A;  1DDV A;  1TXD A;  3DXE A;  1OY2 A;  1LW3 A;  2YS5 A;  1U29 A;  4HAU B;  2VRW B;  1DBH A;  2EMS A;  1EGX A;  2H7D A;  4HDO A;  2CRF A;  1FOE A;  3PVW A;  3FEH A;  3TCA A;  3SUZ A;  3RCP A;  3VIA A;  2D9Z A;  2Z0Q A;  2LKO A;  4A6F A;  3AU5 A;  4GXB A;  5FI1 A;  3MPX A;  2YSZ A;  1W1D A;  3O96 A;  1UNP A;  4KVG B;  1TJ6 A;  3LJU X;  1GC7 A;  2VKI A;  3ODW A;  1P6S A;  2W2X D;  4A6K A;  4KAX B;  3BJI A;  1Y5O A;  1OQN A;  1W1H A;  2D11 A;  4NY0 A;  2KUP A;  3A8P A;  1Y19 B;  2P0F A;  3ULC A;  2COF A;  2D10 A;  5KCV A;  5DHA B;  5D3V A;  1EVH A;  2UZR A;  4F7G A;  4HB3 B;  4EJN A;  4HAX B;  4EKU A;  3QBV B;  5CLQ B;  5DIF B;  5HE0 A;  2CY5 A;  2LOZ A;  2GS0 A;  5C5B A;  2I5F A;  3KRX A;  4PQ0 A;  3F0W A;  2DX1 A;  2IYB A;  2K2U A;  5LON B;  3ML4 A;  3SO6 A;  2Y7B A;  4K81 A;  1FHO A;  1FGY A;  1MIZ B;  1WJM A;  5L81 A;  4EMO A;  4WSF A;  1UPR A;  3ODO A;  2E2X A;  5CLL B;  1BTN A;  4HAY B;  1E5W A;  2YT1 A;  1FHW A;  2COD A;  1ISN A;  3DXC A;  2DKQ A;  4HDQ A;  3NSU A;  3KY9 A;  3DXD A;  5HE2 A;  4DX9 0;  2RNR B;  2QKL A;  4K17 A;  1U5G A;  1V5P A;  4IOY X;  1MAI A;  1BTK A;  2ELA A;  1FB8 A;  1P3R A;  3SNH A;  2KCJ A;  1GC6 A;  4H8S A;  3U7D A;  1X11 A;  1J19 A;  2DTC A;  2ZPY A;  5KQ1 A;  2Z0P A;  5C5B B;  3AJ4 A;  1KZG A;  3V5W A;  1XCG A;  2DN6 A;  2YS3 A;  5D3Y A;  1SHC A;  5C6R A;  2ADZ A;  2HE7 A;  4F7H A;  2P0D A;  1GG3 A;  2YS1 A;  1K5G B;  2DFK A;  2VSZ A;  2COA A;  1X86 A;  2DA0 A;  2CY4 A;  1KZ7 A;  2YRY A;  2Y8G A;  3D8D A;  2Q13 A;  2DHK A;  1PMS A;  5D3X A;  2R09 A;  1U27 A;  1XR0 B;  2D2Q A;  4NSW A;  5J3Y A;  2K2J A;  2BCJ A;  2W2W A;  1ZSQ A;  1WGU A;  4CYE A;  4A5K A;  1I7A A;  2J0K A;  1MIX A;  1WG7 A;  2YT0 A;  4DBB A;  3ZVR A;  1EF1 A;  5C79 A;  2DHI A;  2EMT A;  1BAK A;  1DDW A;  4GMX B;  3SYX A;  4Y94 A;  3MDB C;  3KRW A;  1TQZ A;  1NU2 A;  1V88 A;  3HW2 B;  5J3Q A;  2JP2 A;  1FHX A;  2D9X A;  2UVM A;  3X23 A;  3GYP A;  4KHO A;  1DRO A;  4A6F B;  2W2X C;  3M1I B;  1SGH A;  1UNQ A;  1NTY A;  1MPH A;  3PP2 A;  1XD4 A;  1X1F A;  1IRS A;  3FSS A;  1UPQ A;  2N23 A;  4KHB B;  1K5D B;  4DXA B;  2ELB A;  2COC A;  4GN1 A;  1MK7 B;  1WI1 A;  3FM8 C;  1OMW A;  4P7I A;  1ZM0 A;  2AEH A;  1V5M A;  4ZRK A;  2XQN M;  2MFQ A;  3PG7 A;  2CAY A;  1MK9 B;  4HHV A;  3VOQ A;  2I1K A;  1AQC A;  1QC6 A;  1BWN A;  3KSY A;  4L6E A;  1AWE A;  4PNK A;  3D8E A;  2D9V A;  3PSC A;  4YL8 A;  1PFJ A;  3ULB A;  2Z0O A;  1EAZ A;  5DH9 B;  1DYN A;  1RJ2 A;  1UNR A;  2YVC A;  2DYQ A;  2OTX A;  2FJL A;  2LOX A;  2P8V A;  2X18 A;  1W1G A;  2UZS A;  3HK0 A;  4DX8 A;  2DYN A;  3PEG A;  5DHF B;  2M38 A;  1V61 A;  2LUL A;  5JHG A;  4TKN A;  3PVU A;  1U5F A;  2MDX A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...