3D8FA

Crystal structure of the human fe65-ptb1 domain with bound phosphate (trigonal crystal form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
127
Chain Sequence
b'GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
total genus 32
structure length 127
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8fA00
4B6HA 4P7IA 4IOYX 3ZDTA 4HDOA 1OQNA 1J19A 5DHAB 4GZUA 4C0AA 5D27A 3M1IB 1FHXA 4WVFB 1ZM0A 2MFQA 1ZSQA 2LKOA 2I1JA 3A98B 5DH9B 1XX0A 1I2HA 4HAYB 2RLOA 5LONB 5D3YA 2YS3A 2D11A 2ROVA 2YT1A 1V5PA 1ZC4B 1V5UA 1FAOA 2EMSA 4K2OA 1MIXA 3SNHA 3WA0A 1XD4A 3BJIA 2DHKA 5DI9B 3U7DA 2N23A 2RVBB 1WJMA 2I5FA 1K5GB 2V76A 2YRYA 2AEHA 2HE7A 3A8QA 4HATB 2Q13A 1DROA 1UNRA 2D9YA 5KCVA 1GG3A 3WYFB 2Y7BA 3TVVA 1U5EA 1EF1A 1QQGA 3QBVB 5L81A 3KZ1A 5EFXA 4ZRKA 1FB8A 3U8ZA 4DX90 4GN1A 2QKMA 2K00A 4K81A 1XCGA 2LG1A 2CY4A 3T06A 4ZRJA 1V89A 5CLQB 4Z2NA 3ODXA 2K2JA 4XWXA 2UZSA 3RCPA 2GS0A 4L6EA 1QC6A 3ODWA 4HB4B 3FSSA 1DDWA 3TO1A 5D3VA 5CLLB 2MKRA 2P0DA 2D9WA 4KVGB 2JP2A 2CRFA 2GCLA 5D3XA 5HE2A 1FGZA 1KI1B 1X05A 1DBHA 1U27A 2Z0OA 2R09A 3F0WA 3D8EA 3KY9A 5JP4A 1X1FA 1SGHA 4HB3B 1NTYA 2DYQA 1LB1A 1UNQA 1MK9B 1NU2A 4NSWA 1KZ7A 5HE3A 4HAWB 1BTNA 2YS1A 3MDBC 3PG7A 2DYNA 2N0YA 5GOWB 3IVFA 2COCA 3HQCA 1N3HA 1V5MA 4WSFA 3VOQA 2KGXB 2DHIA 3ZVRA 1M7RA 1U5FA 1M7EA 3GYPA 3GYOA 2DKQA 3AJ4A 2NMBA 3CIKA 1PLSA 2L2IA 5JHGA 1H4RA 4A6FB 2YS5A 3TFMA 1WG7A 3KRWA 4GPTB 4D0NB 5C5BB 1ZC3B 3G9WA 2AL6A 2M14A 1TXDA 1W1DA 1ISNA 1FGYA 2OQBA 2J0JA 2RGNB 2Y8GA 4Z2MB 2M38A 3FEHA 2LOZA 4CHJA 1U29A 1NTVA 4F7HA 1PFJA 1Y19B 2DX5A 1TJ6A 4MY6A 4HAUB 2DN6A 3A8PA 3MPXA 4CHMA 4HDQA 4MT7A 4TYZA 1IRSA 2MDXA 1TQZA 2XQNM 3SYXA 3UZTA 3SUZA 1FHOA 4EMOA 1UEFA 4DXAB 2H7EA 1FOEA 2GJYA 2QKLA 2P0FA 3PZDA 3SV1A 4GMVA 2YSZA 1DDMA 2Y8FA 2RUKB 2D10A 1UPQA 2VSZA 3ULBA 1MPHA 2DA0A 3ODOA 1P6SA 4YONA 3LJUX 3PVLA 1OMWA 3V5WA 2YVCA 1AQCA 2IYBA 1B55A 2D4QA 2K2UA 1KZGA 2ELAA 5C6RA 4EJNA 2FJLA 3QWMA 1WGUA 1GC6A 3VIAA 5DIFB 3AU5A 2P8VA 2VRWB 4GXBA 1Y5OA 1E5WA 1LW3A 1WVHA 4DBBA 4HAXB 1X11A 2UZRA 2D9ZA 3DXEA 2YF0A 1XKEA 1RJ2A 2DX1A 3OANA 1WI1A 1BTKA 2ELBA 2J0KA 4MK0A 2LOXA 1FHWA 2I1KA 2CY5A 4KHOA 4PQ0A 1Q67A 1P5TA 2KCJA 2W2XD 3PP2A 3AU4A 2D2QA 1MKEA 1Z87A 3KRXA 3PVWA 2W2XC 2W2WA 4H8SA 1MIZB 1RRPB 4ZRIA 1K5DB 1GC7A 3PVUA 4A5KA 2UVMA 1EAZA 1W1HA 3ULCA 2MWNB 4PNKA 1NI2A 2CODA 3QIJA 3TW1A 2DLWA 5C79A 4CYEA 3SO6A 2COFA 2E2XA 3D8FA 2GCJA 3TCAA 5C16A 1UNPA 4HHVA 1P3RA 4GMXB 1J0WA 2PZ1A 2DKPA 2KUPA 1X1GA 4K17A 4A6FA 2G35A 3D8DA 1U2BA 3P7ZA 1DDVA 2DTCA 5J3QA 3CXBB 5FI1A 3F5RA 2VKIA 1WJ1A 3PSCA 2LULA 1X86A 3HK0A 2IFSA 3X23A 1PMSA 2EC1A 2ROZB 3P6AA 4KAXB 4HB2B 3HW2B 1EVHA 1BWNA 3DXCA 1U5GA 2CAYA 1SHCA 2DHJA 4EKUA 4KHAA 1WGQA 3FM8C 2Z0PA 2D9XA 2EJ8A 3NSUA 4IAPA 1AWEA 2Z0QA 4BBKA 4F7GA 4A6KA 3BINA 3DXDA 5J3TA 1I7AA 5DHFB 3ML4A 2I5CA 2J0MA 4WJ7A 3O96A 5J3YA 5JLJB 2X18A 5LOPB 2R0DA 2P0HA 3N7CA 4HAVB 2D9VA 2EMTA 4NY0A 1BAKA 1W1GA 1MAIA 2ADZA 1H10A 3KSYA 2NZ8B 1EGXA 4TKNA 1DYNA 5KQ1A 5D3WA 1UPRA 2HTHB 1XR0B 2LYDA 4DX8A 5KQ4A 4K2PA 5C5BA 1U5DA 2ZPYA 3PEGA 2BCJA 2RSGA 4F7UP 5HE1A 4YL8A 2J59M 2L1CA 4Y94A 5FI0A 4A6HA 1XODA 1V88A 5HE0A 1V61A 4KHBB 2DFKA 2YT0A 4HAZB 2H7DA 2COAA 1OY2A 2OTXA 4IFSA 5JHHA 2RNRB 4HB0B 1ZVRA 1MK7B
chains in the Genus database with same CATH superfamily
4B6HA 4P7IA 4IOYX 3ZDTA 4HDOA 1OQNA 1J19A 5DHAB 4GZUA 4C0AA 5D27A 3M1IB 1FHXA 3NWFA 4WVFB 1ZM0A 2MFQA 1ZSQA 2LKOA 2I1JA 3A98B 2Z14A 5DH9B 1XX0A 1I2HA 4HAYB 2Z13A 2RLOA 5LONB 5D3YA 2YS3A 2D11A 2ROVA 2YT1A 1V5PA 1ZC4B 1V5UA 1FAOA 2EMSA 4K2OA 1MIXA 3SNHA 3WA0A 1XD4A 3BJIA 2DHKA 5DI9B 3U7DA 2N23A 2RVBB 1WJMA 2I5FA 1K5GB 2V76A 2YRYA 2AEHA 2HE7A 3A8QA 4HATB 2Q13A 1DROA 1UNRA 2FJUB 4QJ4B 2D9YA 5KCVA 1GG3A 3WYFB 2Y7BA 3HSAA 3TVVA 1U5EA 1EF1A 1QQGA 3QBVB 5L81A 3KZ1A 5EFXA 4ZRKA 1FB8A 3U8ZA 4DX90 4GN1A 2QKMA 2K00A 4K81A 1XCGA 2LG1A 2CY4A 3T06A 4ZRJA 1V89A 5CLQB 4Z2NA 3ODXA 4KHBA 2K2JA 4XWXA 2UZSA 3RCPA 2GS0A 4L6EA 1QC6A 3ODWA 4HB4B 5IRSA 3FSSA 1DDWA 3TO1A 5D3VA 5CLLB 2MKRA 2P0DA 2D9WA 4KVGB 4QJ3B 2Z59A 2JP2A 2CRFA 2GCLA 5D3XA 5HE2A 1FGZA 1KI1B 1X05A 1DBHA 1U27A 2Z0OA 2R09A 3F0WA 3D8EA 3KY9A 5JP4A 1X1FA 1SGHA 4HB3B 1NTYA 2DYQA 1LB1A 1UNQA 1MK9B 1NU2A 4NSWA 1KZ7A 5HE3A 4HAWB 1BTNA 1ZYIA 2YS1A 3PG7A 3MDBC 4D6WA 2DYNA 2N0YA 5GOWB 3IVFA 2COCA 3HQCA 1N3HA 1V5MA 4WSFA 3VOQA 2KGXB 2DHIA 3ZVRA 1M7RA 2KUQA 1U5FA 1M7EA 3GYPA 3GYOA 2DKQA 3AJ4A 2NMBA 3NWDA 4CSQA 3CIKA 1PLSA 2L2IA 5JHGA 1H4RA 4A6FB 2YS5A 3TFMA 5M4YB 1WG7A 2K8EA 3KRWA 4GPTB 4D0NB 5C5BB 1ZC3B 3G9WA 4OT1A 2YT2A 2AL6A 2M14A 1TXDA 1W1DA 1ISNA 1FGYA 2OQBA 2J0JA 2RGNB 2Y8GA 4Z2MB 2M38A 3FEHA 2LOZA 4CHJA 1U29A 1NTVA 4F7HA 1PFJA 1Y19B 2DX5A 1TJ6A 4MY6A 4HAUB 2DN6A 3A8PA 3MPXA 4CHMA 4HDQA 4MT7A 4TYZA 1IRSA 2MDXA 2KIEA 1TQZA 2XQNM 3SYXA 3UZTA 3SUZA 1FHOA 4EMOA 1UEFA 4DXAB 2H7EA 4HSIA 1FOEA 2GJYA 2QKLA 2P0FA 3PZDA 3DCXA 3SV1A 4GMVA 2YSZA 1DDMA 2Y8FA 2RUKB 2D10A 4QXAB 1UPQA 2VSZA 3ULBA 1MPHA 5I2SA 2DA0A 3ODOA 3A58A 1P6SA 4YONA 3LJUX 3PVLA 1OMWA 3V5WA 2YVCA 1AQCA 2IYBA 2GUMA 1B55A 3U12A 2D4QA 2K2UA 1KZGA 2ELAA 5C6RA 4EJNA 2FJLA 3QWMA 1WGUA 1GC6A 3VIAA 5LG4B 5DIFB 3AU5A 2P8VA 2VRWB 4GXBA 1Y5OA 1E5WA 1LW3A 4QJ5B 1WVHA 4DBBA 4HAXB 1X11A 2UZRA 2D9ZA 3DXEA 2YF0A 1XKEA 1RJ2A 2DX1A 3OANA 1WI1A 1BTKA 2ELBA 2J0KA 4MK0A 3NWAA 2LOXA 2K49A 1FHWA 2I1KA 2CY5A 4KHOA 4PQ0A 4L1RA 1Q67A 1P5TA 2KCJA 3NW8A 2W2XD 3PP2A 3AU4A 2D2QA 1MKEA 1Z87A 3KRXA 3PVWA 2W2XC 2W2WA 2KIGA 4H8SA 1MIZB 1RRPB 4ZRIA 1K5DB 1GC7A 3PVUA 4A5KA 2UVMA 1EAZA 1W1HA 3ULCA 4GNKB 2MWNB 4PNKA 1NI2A 2CODA 3QIJA 3TW1A 3FVCA 2DLWA 5C79A 4CYEA 3SO6A 2COFA 2E2XA 3D8FA 2GCJA 3TCAA 5C16A 1UNPA 4HHVA 1MI1A 2ZKMX 1P3RA 1J0WA 4GMXB 2PZ1A 2DKPA 2KUPA 1X1GA 4K17A 4A6FA 2G35A 3D8DA 1U2BA 3P7ZA 1DDVA 2DTCA 5J3QA 3CXBB 5FI1A 3F5RA 2VKIA 1WJ1A 3PSCA 2LULA 1X86A 3HK0A 2IFSA 3X23A 1PMSA 2EC1A 2NBVA 2ROZB 3P6AA 4KAXB 4HB2B 3HW2B 5I2MA 1EVHA 1BWNA 3DXCA 3B77A 1U5GA 2CAYA 1SHCA 2DHJA 4EKUA 4KHAA 1WGQA 3FM8C 2Z0PA 2D9XA 2EJ8A 3NSUA 4IAPA 1AWEA 2Z0QA 4BBKA 4F7GA 4A6KA 4GOUA 2KR0A 3BINA 3DXDA 5J3TA 1I7AA 5DHFB 3ML4A 3OHMB 2I5CA 2J0MA 4DIXA 4WJ7A 3O96A 5J3YA 5JLJB 2X18A 5LOPB 2R0DA 2P0HA 3N7CA 4HAVB 2D9VA 2EMTA 4NY0A 1BAKA 1W1GA 2RRFA 1MAIA 2ADZA 1H10A 3KSYA 2NZ8B 1EGXA 4TKNA 1DYNA 5KQ1A 5D3WA 1UPRA 2HTHB 1XR0B 2LYDA 4DX8A 5KQ4A 4K2PA 5C5BA 4OSNA 2R2YA 1U5DA 2ZPYA 3PEGA 2BCJA 2RSGA 4F7UP 5HE1A 4YL8A 2J59M 2L1CA 3HIEA 4Y94A 5FI0A 4A6HA 1XODA 1V88A 5HE0A 1V61A 4KHBB 2DFKA 2YT0A 2Z4DA 4HAZB 2H7DA 2COAA 1OY2A 2OTXA 4IFSA 5JHHA 2RNRB 1T77A 4HB0B 1ZVRA 1MK7B
chains in the Genus database with same CATH topology
4B6HA 4P7IA 4IOYX 3ZDTA 4HDOA 1OQNA 1J19A 5DHAB 4GZUA 4C0AA 5D27A 3M1IB 1FHXA 4WVFB 1ZM0A 2MFQA 1ZSQA 2LKOA 2I1JA 3A98B 5DH9B 1XX0A 1I2HA 4HAYB 2RLOA 5LONB 5D3YA 2YS3A 2D11A 2ROVA 2YT1A 1V5PA 1ZC4B 1V5UA 1FAOA 2EMSA 4K2OA 1MIXA 3SNHA 3WA0A 1XD4A 3BJIA 2DHKA 5DI9B 3U7DA 2N23A 2RVBB 1WJMA 2I5FA 1K5GB 2V76A 2YRYA 2AEHA 2HE7A 3A8QA 4HATB 2Q13A 1DROA 1UNRA 2D9YA 5KCVA 1GG3A 3WYFB 2Y7BA 3TVVA 1U5EA 1EF1A 1QQGA 3QBVB 5L81A 3KZ1A 5EFXA 4ZRKA 1FB8A 3U8ZA 4DX90 4GN1A 2QKMA 2K00A 4K81A 1XCGA 2LG1A 2CY4A 3T06A 4ZRJA 1V89A 5CLQB 4Z2NA 3ODXA 2K2JA 4XWXA 2UZSA 3RCPA 2GS0A 4L6EA 1QC6A 3ODWA 4HB4B 3FSSA 1DDWA 3TO1A 5D3VA 5CLLB 2MKRA 2P0DA 2D9WA 4KVGB 2JP2A 2CRFA 2GCLA 5D3XA 5HE2A 1FGZA 1KI1B 1X05A 1DBHA 1U27A 2Z0OA 2R09A 3F0WA 3D8EA 3KY9A 5JP4A 1X1FA 1SGHA 4HB3B 1NTYA 2DYQA 1LB1A 1UNQA 1MK9B 1NU2A 4NSWA 1KZ7A 5HE3A 4HAWB 1BTNA 2YS1A 3MDBC 3PG7A 2DYNA 2N0YA 5GOWB 3IVFA 2COCA 3HQCA 1N3HA 1V5MA 4WSFA 3VOQA 2KGXB 2DHIA 3ZVRA 1M7RA 1U5FA 1M7EA 3GYPA 3GYOA 2DKQA 3AJ4A 2NMBA 3CIKA 1PLSA 2L2IA 5JHGA 1H4RA 4A6FB 2YS5A 3TFMA 1WG7A 3KRWA 4GPTB 4D0NB 5C5BB 1ZC3B 3G9WA 2AL6A 2M14A 1TXDA 1W1DA 1ISNA 1FGYA 2OQBA 2J0JA 2RGNB 2Y8GA 4Z2MB 2M38A 3FEHA 2LOZA 4CHJA 1U29A 1NTVA 4F7HA 1PFJA 1Y19B 2DX5A 1TJ6A 4MY6A 4HAUB 2DN6A 3A8PA 3MPXA 4CHMA 4HDQA 4MT7A 4TYZA 1IRSA 2MDXA 1TQZA 2XQNM 3SYXA 3UZTA 3SUZA 1FHOA 4EMOA 1UEFA 4DXAB 2H7EA 1FOEA 2GJYA 2QKLA 2P0FA 3PZDA 3SV1A 4GMVA 2YSZA 1DDMA 2Y8FA 2RUKB 2D10A 1UPQA 2VSZA 3ULBA 1MPHA 2DA0A 3ODOA 1P6SA 4YONA 3LJUX 3PVLA 1OMWA 3V5WA 2YVCA 1AQCA 2IYBA 1B55A 2D4QA 2K2UA 1KZGA 2ELAA 5C6RA 4EJNA 2FJLA 3QWMA 1WGUA 1GC6A 3VIAA 5DIFB 3AU5A 2P8VA 2VRWB 4GXBA 1Y5OA 1E5WA 1LW3A 1WVHA 4DBBA 4HAXB 1X11A 2UZRA 2D9ZA 3DXEA 2YF0A 1XKEA 1RJ2A 2DX1A 3OANA 1WI1A 1BTKA 2ELBA 2J0KA 4MK0A 2LOXA 1FHWA 2I1KA 2CY5A 4KHOA 4PQ0A 1Q67A 1P5TA 2KCJA 2W2XD 3PP2A 3AU4A 2D2QA 1MKEA 1Z87A 3KRXA 3PVWA 2W2XC 2W2WA 4H8SA 1MIZB 1RRPB 4ZRIA 1K5DB 1GC7A 3PVUA 4A5KA 2UVMA 1EAZA 1W1HA 3ULCA 2MWNB 4PNKA 1NI2A 2CODA 3QIJA 3TW1A 2DLWA 5C79A 4CYEA 3SO6A 2COFA 2E2XA 3D8FA 2GCJA 3TCAA 5C16A 1UNPA 4HHVA 1P3RA 4GMXB 1J0WA 2PZ1A 2DKPA 2KUPA 1X1GA 4K17A 4A6FA 2G35A 3D8DA 1U2BA 3P7ZA 1DDVA 2DTCA 5J3QA 3CXBB 5FI1A 3F5RA 2VKIA 1WJ1A 3PSCA 2LULA 1X86A 3HK0A 2IFSA 3X23A 1PMSA 2EC1A 2ROZB 3P6AA 4KAXB 4HB2B 3HW2B 1EVHA 1BWNA 3DXCA 1U5GA 2CAYA 1SHCA 2DHJA 4EKUA 4KHAA 1WGQA 3FM8C 2Z0PA 2D9XA 2EJ8A 3NSUA 4IAPA 1AWEA 2Z0QA 4BBKA 4F7GA 4A6KA 3BINA 3DXDA 5J3TA 1I7AA 5DHFB 3ML4A 2I5CA 2J0MA 4WJ7A 3O96A 5J3YA 5JLJB 2X18A 5LOPB 2R0DA 2P0HA 3N7CA 4HAVB 2D9VA 2EMTA 4NY0A 1BAKA 1W1GA 1MAIA 2ADZA 1H10A 3KSYA 2NZ8B 1EGXA 4TKNA 1DYNA 5KQ1A 5D3WA 1UPRA 2HTHB 1XR0B 2LYDA 4DX8A 5KQ4A 4K2PA 5C5BA 1U5DA 2ZPYA 3PEGA 2BCJA 2RSGA 4F7UP 5HE1A 4YL8A 2J59M 2L1CA 4Y94A 5FI0A 4A6HA 1XODA 1V88A 5HE0A 1V61A 4KHBB 2DFKA 2YT0A 4HAZB 2H7DA 2COAA 1OY2A 2OTXA 4IFSA 5JHHA 2RNRB 4HB0B 1ZVRA 1MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6H A;  4P7I A;  4IOY X;  3ZDT A;  4HDO A;  1OQN A;  1J19 A;  5DHA B;  4GZU A;  4C0A A;  5D27 A;  3M1I B;  1FHX A;  4WVF B;  1ZM0 A;  2MFQ A;  1ZSQ A;  2LKO A;  2I1J A;  3A98 B;  5DH9 B;  1XX0 A;  1I2H A;  4HAY B;  2RLO A;  5LON B;  5D3Y A;  2YS3 A;  2D11 A;  2ROV A;  2YT1 A;  1V5P A;  1ZC4 B;  1V5U A;  1FAO A;  2EMS A;  4K2O A;  1MIX A;  3SNH A;  3WA0 A;  1XD4 A;  3BJI A;  2DHK A;  5DI9 B;  3U7D A;  2N23 A;  2RVB B;  1WJM A;  2I5F A;  1K5G B;  2V76 A;  2YRY A;  2AEH A;  2HE7 A;  3A8Q A;  4HAT B;  2Q13 A;  1DRO A;  1UNR A;  2D9Y A;  5KCV A;  1GG3 A;  3WYF B;  2Y7B A;  3TVV A;  1U5E A;  1EF1 A;  1QQG A;  3QBV B;  5L81 A;  3KZ1 A;  5EFX A;  4ZRK A;  1FB8 A;  3U8Z A;  4DX9 0;  4GN1 A;  2QKM A;  2K00 A;  4K81 A;  1XCG A;  2LG1 A;  2CY4 A;  3T06 A;  4ZRJ A;  1V89 A;  5CLQ B;  4Z2N A;  3ODX A;  2K2J A;  4XWX A;  2UZS A;  3RCP A;  2GS0 A;  4L6E A;  1QC6 A;  3ODW A;  4HB4 B;  3FSS A;  1DDW A;  3TO1 A;  5D3V A;  5CLL B;  2MKR A;  2P0D A;  2D9W A;  4KVG B;  2JP2 A;  2CRF A;  2GCL A;  5D3X A;  5HE2 A;  1FGZ A;  1KI1 B;  1X05 A;  1DBH A;  1U27 A;  2Z0O A;  2R09 A;  3F0W A;  3D8E A;  3KY9 A;  5JP4 A;  1X1F A;  1SGH A;  4HB3 B;  1NTY A;  2DYQ A;  1LB1 A;  1UNQ A;  1MK9 B;  1NU2 A;  4NSW A;  1KZ7 A;  5HE3 A;  4HAW B;  1BTN A;  2YS1 A;  3MDB C;  3PG7 A;  2DYN A;  2N0Y A;  5GOW B;  3IVF A;  2COC A;  3HQC A;  1N3H A;  1V5M A;  4WSF A;  3VOQ A;  2KGX B;  2DHI A;  3ZVR A;  1M7R A;  1U5F A;  1M7E A;  3GYP A;  3GYO A;  2DKQ A;  3AJ4 A;  2NMB A;  3CIK A;  1PLS A;  2L2I A;  5JHG A;  1H4R A;  4A6F B;  2YS5 A;  3TFM A;  1WG7 A;  3KRW A;  4GPT B;  4D0N B;  5C5B B;  1ZC3 B;  3G9W A;  2AL6 A;  2M14 A;  1TXD A;  1W1D A;  1ISN A;  1FGY A;  2OQB A;  2J0J A;  2RGN B;  2Y8G A;  4Z2M B;  2M38 A;  3FEH A;  2LOZ A;  4CHJ A;  1U29 A;  1NTV A;  4F7H A;  1PFJ A;  1Y19 B;  2DX5 A;  1TJ6 A;  4MY6 A;  4HAU B;  2DN6 A;  3A8P A;  3MPX A;  4CHM A;  4HDQ A;  4MT7 A;  4TYZ A;  1IRS A;  2MDX A;  1TQZ A;  2XQN M;  3SYX A;  3UZT A;  3SUZ A;  1FHO A;  4EMO A;  1UEF A;  4DXA B;  2H7E A;  1FOE A;  2GJY A;  2QKL A;  2P0F A;  3PZD A;  3SV1 A;  4GMV A;  2YSZ A;  1DDM A;  2Y8F A;  2RUK B;  2D10 A;  1UPQ A;  2VSZ A;  3ULB A;  1MPH A;  2DA0 A;  3ODO A;  1P6S A;  4YON A;  3LJU X;  3PVL A;  1OMW A;  3V5W A;  2YVC A;  1AQC A;  2IYB A;  1B55 A;  2D4Q A;  2K2U A;  1KZG A;  2ELA A;  5C6R A;  4EJN A;  2FJL A;  3QWM A;  1WGU A;  1GC6 A;  3VIA A;  5DIF B;  3AU5 A;  2P8V A;  2VRW B;  4GXB A;  1Y5O A;  1E5W A;  1LW3 A;  1WVH A;  4DBB A;  4HAX B;  1X11 A;  2UZR A;  2D9Z A;  3DXE A;  2YF0 A;  1XKE A;  1RJ2 A;  2DX1 A;  3OAN A;  1WI1 A;  1BTK A;  2ELB A;  2J0K A;  4MK0 A;  2LOX A;  1FHW A;  2I1K A;  2CY5 A;  4KHO A;  4PQ0 A;  1Q67 A;  1P5T A;  2KCJ A;  2W2X D;  3PP2 A;  3AU4 A;  2D2Q A;  1MKE A;  1Z87 A;  3KRX A;  3PVW A;  2W2X C;  2W2W A;  4H8S A;  1MIZ B;  1RRP B;  4ZRI A;  1K5D B;  1GC7 A;  3PVU A;  4A5K A;  2UVM A;  1EAZ A;  1W1H A;  3ULC A;  2MWN B;  4PNK A;  1NI2 A;  2COD A;  3QIJ A;  3TW1 A;  2DLW A;  5C79 A;  4CYE A;  3SO6 A;  2COF A;  2E2X A;  3D8F A;  2GCJ A;  3TCA A;  5C16 A;  1UNP A;  4HHV A;  1P3R A;  4GMX B;  1J0W A;  2PZ1 A;  2DKP A;  2KUP A;  1X1G A;  4K17 A;  4A6F A;  2G35 A;  3D8D A;  1U2B A;  3P7Z A;  1DDV A;  2DTC A;  5J3Q A;  3CXB B;  5FI1 A;  3F5R A;  2VKI A;  1WJ1 A;  3PSC A;  2LUL A;  1X86 A;  3HK0 A;  2IFS A;  3X23 A;  1PMS A;  2EC1 A;  2ROZ B;  3P6A A;  4KAX B;  4HB2 B;  3HW2 B;  1EVH A;  1BWN A;  3DXC A;  1U5G A;  2CAY A;  1SHC A;  2DHJ A;  4EKU A;  4KHA A;  1WGQ A;  3FM8 C;  2Z0P A;  2D9X A;  2EJ8 A;  3NSU A;  4IAP A;  1AWE A;  2Z0Q A;  4BBK A;  4F7G A;  4A6K A;  3BIN A;  3DXD A;  5J3T A;  1I7A A;  5DHF B;  3ML4 A;  2I5C A;  2J0M A;  4WJ7 A;  3O96 A;  5J3Y A;  5JLJ B;  2X18 A;  5LOP B;  2R0D A;  2P0H A;  3N7C A;  4HAV B;  2D9V A;  2EMT A;  4NY0 A;  1BAK A;  1W1G A;  1MAI A;  2ADZ A;  1H10 A;  3KSY A;  2NZ8 B;  1EGX A;  4TKN A;  1DYN A;  5KQ1 A;  5D3W A;  1UPR A;  2HTH B;  1XR0 B;  2LYD A;  4DX8 A;  5KQ4 A;  4K2P A;  5C5B A;  1U5D A;  2ZPY A;  3PEG A;  2BCJ A;  2RSG A;  4F7U P;  5HE1 A;  4YL8 A;  2J59 M;  2L1C A;  4Y94 A;  5FI0 A;  4A6H A;  1XOD A;  1V88 A;  5HE0 A;  1V61 A;  4KHB B;  2DFK A;  2YT0 A;  4HAZ B;  2H7D A;  2COA A;  1OY2 A;  2OTX A;  4IFS A;  5JHH A;  2RNR B;  4HB0 B;  1ZVR A;  1MK7 B; 
#chains in the Genus database with same CATH topology
 4B6H A;  4P7I A;  4IOY X;  3ZDT A;  4HDO A;  1OQN A;  1J19 A;  5DHA B;  4GZU A;  4C0A A;  5D27 A;  3M1I B;  1FHX A;  3NWF A;  4WVF B;  1ZM0 A;  2MFQ A;  1ZSQ A;  2LKO A;  2I1J A;  3A98 B;  2Z14 A;  5DH9 B;  1XX0 A;  1I2H A;  4HAY B;  2Z13 A;  2RLO A;  5LON B;  5D3Y A;  2YS3 A;  2D11 A;  2ROV A;  2YT1 A;  1V5P A;  1ZC4 B;  1V5U A;  1FAO A;  2EMS A;  4K2O A;  1MIX A;  3SNH A;  3WA0 A;  1XD4 A;  3BJI A;  2DHK A;  5DI9 B;  3U7D A;  2N23 A;  2RVB B;  1WJM A;  2I5F A;  1K5G B;  2V76 A;  2YRY A;  2AEH A;  2HE7 A;  3A8Q A;  4HAT B;  2Q13 A;  1DRO A;  1UNR A;  2FJU B;  4QJ4 B;  2D9Y A;  5KCV A;  1GG3 A;  3WYF B;  2Y7B A;  3HSA A;  3TVV A;  1U5E A;  1EF1 A;  1QQG A;  3QBV B;  5L81 A;  3KZ1 A;  5EFX A;  4ZRK A;  1FB8 A;  3U8Z A;  4DX9 0;  4GN1 A;  2QKM A;  2K00 A;  4K81 A;  1XCG A;  2LG1 A;  2CY4 A;  3T06 A;  4ZRJ A;  1V89 A;  5CLQ B;  4Z2N A;  3ODX A;  4KHB A;  2K2J A;  4XWX A;  2UZS A;  3RCP A;  2GS0 A;  4L6E A;  1QC6 A;  3ODW A;  4HB4 B;  5IRS A;  3FSS A;  1DDW A;  3TO1 A;  5D3V A;  5CLL B;  2MKR A;  2P0D A;  2D9W A;  4KVG B;  4QJ3 B;  2Z59 A;  2JP2 A;  2CRF A;  2GCL A;  5D3X A;  5HE2 A;  1FGZ A;  1KI1 B;  1X05 A;  1DBH A;  1U27 A;  2Z0O A;  2R09 A;  3F0W A;  3D8E A;  3KY9 A;  5JP4 A;  1X1F A;  1SGH A;  4HB3 B;  1NTY A;  2DYQ A;  1LB1 A;  1UNQ A;  1MK9 B;  1NU2 A;  4NSW A;  1KZ7 A;  5HE3 A;  4HAW B;  1BTN A;  1ZYI A;  2YS1 A;  3PG7 A;  3MDB C;  4D6W A;  2DYN A;  2N0Y A;  5GOW B;  3IVF A;  2COC A;  3HQC A;  1N3H A;  1V5M A;  4WSF A;  3VOQ A;  2KGX B;  2DHI A;  3ZVR A;  1M7R A;  2KUQ A;  1U5F A;  1M7E A;  3GYP A;  3GYO A;  2DKQ A;  3AJ4 A;  2NMB A;  3NWD A;  4CSQ A;  3CIK A;  1PLS A;  2L2I A;  5JHG A;  1H4R A;  4A6F B;  2YS5 A;  3TFM A;  5M4Y B;  1WG7 A;  2K8E A;  3KRW A;  4GPT B;  4D0N B;  5C5B B;  1ZC3 B;  3G9W A;  4OT1 A;  2YT2 A;  2AL6 A;  2M14 A;  1TXD A;  1W1D A;  1ISN A;  1FGY A;  2OQB A;  2J0J A;  2RGN B;  2Y8G A;  4Z2M B;  2M38 A;  3FEH A;  2LOZ A;  4CHJ A;  1U29 A;  1NTV A;  4F7H A;  1PFJ A;  1Y19 B;  2DX5 A;  1TJ6 A;  4MY6 A;  4HAU B;  2DN6 A;  3A8P A;  3MPX A;  4CHM A;  4HDQ A;  4MT7 A;  4TYZ A;  1IRS A;  2MDX A;  2KIE A;  1TQZ A;  2XQN M;  3SYX A;  3UZT A;  3SUZ A;  1FHO A;  4EMO A;  1UEF A;  4DXA B;  2H7E A;  4HSI A;  1FOE A;  2GJY A;  2QKL A;  2P0F A;  3PZD A;  3DCX A;  3SV1 A;  4GMV A;  2YSZ A;  1DDM A;  2Y8F A;  2RUK B;  2D10 A;  4QXA B;  1UPQ A;  2VSZ A;  3ULB A;  1MPH A;  5I2S A;  2DA0 A;  3ODO A;  3A58 A;  1P6S A;  4YON A;  3LJU X;  3PVL A;  1OMW A;  3V5W A;  2YVC A;  1AQC A;  2IYB A;  2GUM A;  1B55 A;  3U12 A;  2D4Q A;  2K2U A;  1KZG A;  2ELA A;  5C6R A;  4EJN A;  2FJL A;  3QWM A;  1WGU A;  1GC6 A;  3VIA A;  5LG4 B;  5DIF B;  3AU5 A;  2P8V A;  2VRW B;  4GXB A;  1Y5O A;  1E5W A;  1LW3 A;  4QJ5 B;  1WVH A;  4DBB A;  4HAX B;  1X11 A;  2UZR A;  2D9Z A;  3DXE A;  2YF0 A;  1XKE A;  1RJ2 A;  2DX1 A;  3OAN A;  1WI1 A;  1BTK A;  2ELB A;  2J0K A;  4MK0 A;  3NWA A;  2LOX A;  2K49 A;  1FHW A;  2I1K A;  2CY5 A;  4KHO A;  4PQ0 A;  4L1R A;  1Q67 A;  1P5T A;  2KCJ A;  3NW8 A;  2W2X D;  3PP2 A;  3AU4 A;  2D2Q A;  1MKE A;  1Z87 A;  3KRX A;  3PVW A;  2W2X C;  2W2W A;  2KIG A;  4H8S A;  1MIZ B;  1RRP B;  4ZRI A;  1K5D B;  1GC7 A;  3PVU A;  4A5K A;  2UVM A;  1EAZ A;  1W1H A;  3ULC A;  4GNK B;  2MWN B;  4PNK A;  1NI2 A;  2COD A;  3QIJ A;  3TW1 A;  3FVC A;  2DLW A;  5C79 A;  4CYE A;  3SO6 A;  2COF A;  2E2X A;  3D8F A;  2GCJ A;  3TCA A;  5C16 A;  1UNP A;  4HHV A;  1MI1 A;  2ZKM X;  1P3R A;  1J0W A;  4GMX B;  2PZ1 A;  2DKP A;  2KUP A;  1X1G A;  4K17 A;  4A6F A;  2G35 A;  3D8D A;  1U2B A;  3P7Z A;  1DDV A;  2DTC A;  5J3Q A;  3CXB B;  5FI1 A;  3F5R A;  2VKI A;  1WJ1 A;  3PSC A;  2LUL A;  1X86 A;  3HK0 A;  2IFS A;  3X23 A;  1PMS A;  2EC1 A;  2NBV A;  2ROZ B;  3P6A A;  4KAX B;  4HB2 B;  3HW2 B;  5I2M A;  1EVH A;  1BWN A;  3DXC A;  3B77 A;  1U5G A;  2CAY A;  1SHC A;  2DHJ A;  4EKU A;  4KHA A;  1WGQ A;  3FM8 C;  2Z0P A;  2D9X A;  2EJ8 A;  3NSU A;  4IAP A;  1AWE A;  2Z0Q A;  4BBK A;  4F7G A;  4A6K A;  4GOU A;  2KR0 A;  3BIN A;  3DXD A;  5J3T A;  1I7A A;  5DHF B;  3ML4 A;  3OHM B;  2I5C A;  2J0M A;  4DIX A;  4WJ7 A;  3O96 A;  5J3Y A;  5JLJ B;  2X18 A;  5LOP B;  2R0D A;  2P0H A;  3N7C A;  4HAV B;  2D9V A;  2EMT A;  4NY0 A;  1BAK A;  1W1G A;  2RRF A;  1MAI A;  2ADZ A;  1H10 A;  3KSY A;  2NZ8 B;  1EGX A;  4TKN A;  1DYN A;  5KQ1 A;  5D3W A;  1UPR A;  2HTH B;  1XR0 B;  2LYD A;  4DX8 A;  5KQ4 A;  4K2P A;  5C5B A;  4OSN A;  2R2Y A;  1U5D A;  2ZPY A;  3PEG A;  2BCJ A;  2RSG A;  4F7U P;  5HE1 A;  4YL8 A;  2J59 M;  2L1C A;  3HIE A;  4Y94 A;  5FI0 A;  4A6H A;  1XOD A;  1V88 A;  5HE0 A;  1V61 A;  4KHB B;  2DFK A;  2YT0 A;  2Z4D A;  4HAZ B;  2H7D A;  2COA A;  1OY2 A;  2OTX A;  4IFS A;  5JHH A;  2RNR B;  1T77 A;  4HB0 B;  1ZVR A;  1MK7 B; 
#chains in the Genus database with same CATH homology
 4B6H A;  4P7I A;  4IOY X;  3ZDT A;  4HDO A;  1OQN A;  1J19 A;  5DHA B;  4GZU A;  4C0A A;  5D27 A;  3M1I B;  1FHX A;  4WVF B;  1ZM0 A;  2MFQ A;  1ZSQ A;  2LKO A;  2I1J A;  3A98 B;  5DH9 B;  1XX0 A;  1I2H A;  4HAY B;  2RLO A;  5LON B;  5D3Y A;  2YS3 A;  2D11 A;  2ROV A;  2YT1 A;  1V5P A;  1ZC4 B;  1V5U A;  1FAO A;  2EMS A;  4K2O A;  1MIX A;  3SNH A;  3WA0 A;  1XD4 A;  3BJI A;  2DHK A;  5DI9 B;  3U7D A;  2N23 A;  2RVB B;  1WJM A;  2I5F A;  1K5G B;  2V76 A;  2YRY A;  2AEH A;  2HE7 A;  3A8Q A;  4HAT B;  2Q13 A;  1DRO A;  1UNR A;  2D9Y A;  5KCV A;  1GG3 A;  3WYF B;  2Y7B A;  3TVV A;  1U5E A;  1EF1 A;  1QQG A;  3QBV B;  5L81 A;  3KZ1 A;  5EFX A;  4ZRK A;  1FB8 A;  3U8Z A;  4DX9 0;  4GN1 A;  2QKM A;  2K00 A;  4K81 A;  1XCG A;  2LG1 A;  2CY4 A;  3T06 A;  4ZRJ A;  1V89 A;  5CLQ B;  4Z2N A;  3ODX A;  2K2J A;  4XWX A;  2UZS A;  3RCP A;  2GS0 A;  4L6E A;  1QC6 A;  3ODW A;  4HB4 B;  3FSS A;  1DDW A;  3TO1 A;  5D3V A;  5CLL B;  2MKR A;  2P0D A;  2D9W A;  4KVG B;  2JP2 A;  2CRF A;  2GCL A;  5D3X A;  5HE2 A;  1FGZ A;  1KI1 B;  1X05 A;  1DBH A;  1U27 A;  2Z0O A;  2R09 A;  3F0W A;  3D8E A;  3KY9 A;  5JP4 A;  1X1F A;  1SGH A;  4HB3 B;  1NTY A;  2DYQ A;  1LB1 A;  1UNQ A;  1MK9 B;  1NU2 A;  4NSW A;  1KZ7 A;  5HE3 A;  4HAW B;  1BTN A;  2YS1 A;  3MDB C;  3PG7 A;  2DYN A;  2N0Y A;  5GOW B;  3IVF A;  2COC A;  3HQC A;  1N3H A;  1V5M A;  4WSF A;  3VOQ A;  2KGX B;  2DHI A;  3ZVR A;  1M7R A;  1U5F A;  1M7E A;  3GYP A;  3GYO A;  2DKQ A;  3AJ4 A;  2NMB A;  3CIK A;  1PLS A;  2L2I A;  5JHG A;  1H4R A;  4A6F B;  2YS5 A;  3TFM A;  1WG7 A;  3KRW A;  4GPT B;  4D0N B;  5C5B B;  1ZC3 B;  3G9W A;  2AL6 A;  2M14 A;  1TXD A;  1W1D A;  1ISN A;  1FGY A;  2OQB A;  2J0J A;  2RGN B;  2Y8G A;  4Z2M B;  2M38 A;  3FEH A;  2LOZ A;  4CHJ A;  1U29 A;  1NTV A;  4F7H A;  1PFJ A;  1Y19 B;  2DX5 A;  1TJ6 A;  4MY6 A;  4HAU B;  2DN6 A;  3A8P A;  3MPX A;  4CHM A;  4HDQ A;  4MT7 A;  4TYZ A;  1IRS A;  2MDX A;  1TQZ A;  2XQN M;  3SYX A;  3UZT A;  3SUZ A;  1FHO A;  4EMO A;  1UEF A;  4DXA B;  2H7E A;  1FOE A;  2GJY A;  2QKL A;  2P0F A;  3PZD A;  3SV1 A;  4GMV A;  2YSZ A;  1DDM A;  2Y8F A;  2RUK B;  2D10 A;  1UPQ A;  2VSZ A;  3ULB A;  1MPH A;  2DA0 A;  3ODO A;  1P6S A;  4YON A;  3LJU X;  3PVL A;  1OMW A;  3V5W A;  2YVC A;  1AQC A;  2IYB A;  1B55 A;  2D4Q A;  2K2U A;  1KZG A;  2ELA A;  5C6R A;  4EJN A;  2FJL A;  3QWM A;  1WGU A;  1GC6 A;  3VIA A;  5DIF B;  3AU5 A;  2P8V A;  2VRW B;  4GXB A;  1Y5O A;  1E5W A;  1LW3 A;  1WVH A;  4DBB A;  4HAX B;  1X11 A;  2UZR A;  2D9Z A;  3DXE A;  2YF0 A;  1XKE A;  1RJ2 A;  2DX1 A;  3OAN A;  1WI1 A;  1BTK A;  2ELB A;  2J0K A;  4MK0 A;  2LOX A;  1FHW A;  2I1K A;  2CY5 A;  4KHO A;  4PQ0 A;  1Q67 A;  1P5T A;  2KCJ A;  2W2X D;  3PP2 A;  3AU4 A;  2D2Q A;  1MKE A;  1Z87 A;  3KRX A;  3PVW A;  2W2X C;  2W2W A;  4H8S A;  1MIZ B;  1RRP B;  4ZRI A;  1K5D B;  1GC7 A;  3PVU A;  4A5K A;  2UVM A;  1EAZ A;  1W1H A;  3ULC A;  2MWN B;  4PNK A;  1NI2 A;  2COD A;  3QIJ A;  3TW1 A;  2DLW A;  5C79 A;  4CYE A;  3SO6 A;  2COF A;  2E2X A;  3D8F A;  2GCJ A;  3TCA A;  5C16 A;  1UNP A;  4HHV A;  1P3R A;  4GMX B;  1J0W A;  2PZ1 A;  2DKP A;  2KUP A;  1X1G A;  4K17 A;  4A6F A;  2G35 A;  3D8D A;  1U2B A;  3P7Z A;  1DDV A;  2DTC A;  5J3Q A;  3CXB B;  5FI1 A;  3F5R A;  2VKI A;  1WJ1 A;  3PSC A;  2LUL A;  1X86 A;  3HK0 A;  2IFS A;  3X23 A;  1PMS A;  2EC1 A;  2ROZ B;  3P6A A;  4KAX B;  4HB2 B;  3HW2 B;  1EVH A;  1BWN A;  3DXC A;  1U5G A;  2CAY A;  1SHC A;  2DHJ A;  4EKU A;  4KHA A;  1WGQ A;  3FM8 C;  2Z0P A;  2D9X A;  2EJ8 A;  3NSU A;  4IAP A;  1AWE A;  2Z0Q A;  4BBK A;  4F7G A;  4A6K A;  3BIN A;  3DXD A;  5J3T A;  1I7A A;  5DHF B;  3ML4 A;  2I5C A;  2J0M A;  4WJ7 A;  3O96 A;  5J3Y A;  5JLJ B;  2X18 A;  5LOP B;  2R0D A;  2P0H A;  3N7C A;  4HAV B;  2D9V A;  2EMT A;  4NY0 A;  1BAK A;  1W1G A;  1MAI A;  2ADZ A;  1H10 A;  3KSY A;  2NZ8 B;  1EGX A;  4TKN A;  1DYN A;  5KQ1 A;  5D3W A;  1UPR A;  2HTH B;  1XR0 B;  2LYD A;  4DX8 A;  5KQ4 A;  4K2P A;  5C5B A;  1U5D A;  2ZPY A;  3PEG A;  2BCJ A;  2RSG A;  4F7U P;  5HE1 A;  4YL8 A;  2J59 M;  2L1C A;  4Y94 A;  5FI0 A;  4A6H A;  1XOD A;  1V88 A;  5HE0 A;  1V61 A;  4KHB B;  2DFK A;  2YT0 A;  4HAZ B;  2H7D A;  2COA A;  1OY2 A;  2OTX A;  4IFS A;  5JHH A;  2RNR B;  4HB0 B;  1ZVR A;  1MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...