3D8FA

Crystal structure of the human fe65-ptb1 domain with bound phosphate (trigonal crystal form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
127
Chain Sequence
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Crystal structure of the human Fe65-PTB1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 127
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3d8fA00
2YS3A 2YVCA 2UZSA 1V5PA 3SO6A 1ZSQA 2RVBB 3ULCA 2X18A 2VKIA 2D9XA 2AL6A 2ROVA 2J0MA 1MK7B 5J3QA 2YSZA 2Y8GA 2D4QA 2KGXB 5L81A 4A6FB 5D27A 1J19A 1NTYA 1QQGA 4A5KA 5LONB 1MAIA 3U8ZA 2DLWA 2P0HA 3FEHA 2DTCA 3HQCA 5CLLB 1MIXA 3DXCA 2DFKA 2D9VA 4HAVB 2EC1A 1MK9B 2XQNM 2RLOA 2CY5A 2JP2A 3PG7A 2W2XC 3AU5A 2LULA 3SV1A 1V5UA 4MY6A 1X05A 3VOQA 1X11A 4ZRKA 2D9ZA 2Z0QA 1FHWA 5HE2A 2Z0OA 1PLSA 4HATB 4K81A 5JHGA 2IYBA 2ELAA 3HW2B 3GYOA 4Y94A 2BCJA 5HE0A 2W2XD 1EF1A 3WA0A 1KI1B 4TKNA 4EMOA 3DXDA 4HDQA 2HTHB 3SUZA 1LW3A 4IOYX 1ZVRA 4D0NB 1LB1A 2KUPA 2R0DA 2E2XA 2QKLA 1AWEA 2M14A 4KHAA 3ULBA 1XR0B 2K2JA 2L1CA 4Z2NA 5JHHA 3MDBC 2K00A 2FJLA 4KAXB 2LKOA 2DX1A 2RUKB 2P0DA 4GMVA 3PVWA 1N3HA 2COAA 1RJ2A 5FI1A 1DDMA 3LJUX 3PVUA 4HAZB 3NSUA 3TW1A 3D8FA 1FAOA 2OTXA 2I1JA 1TJ6A 4YONA 3TVVA 1W1HA 1FGYA 4YL8A 2D9WA 2VRWB 2HE7A 3KRXA 1EVHA 1QC6A 3D8DA 3ZDTA 2RGNB 3TO1A 5C5BB 2P8VA 5D3YA 3O96A 1Z87A 4CHJA 4PNKA 4DBBA 2ROZB 1X86A 1FB8A 1UPQA 1MKEA 3CXBB 2J0KA 1I2HA 1PMSA 4DX90 1XX0A 1DYNA 2Q13A 3UZTA 1V89A 2GCJA 4NY0A 4P7IA 1U29A 4Z2MB 3TFMA 3IVFA 5DH9B 3RCPA 4HDOA 3P7ZA 4A6HA 1ZC4B 3X23A 4HAXB 2N23A 2I1KA 1GC7A 1UPRA 3ML4A 4IAPA 5J3TA 3PEGA 1XKEA 1KZ7A 2P0FA 1H10A 1Q67A 2LOXA 2LYDA 4HB3B 3VIAA 1H4RA 2R09A 3CIKA 4KHOA 4WJ7A 1XD4A 1W1GA 3A8PA 4F7GA 5C6RA 1V5MA 3OANA 3M1IB 5JP4A 3KRWA 4HB4B 5DIFB 4F7HA 3U7DA 1P3RA 4DXAB 4F7UP 1EGXA 2Y8FA 2DKPA 2N0YA 3QIJA 1U2BA 4K17A 1V88A 4GN1A 2D11A 2UVMA 2GCLA 3A98B 2DKQA 1BTKA 3P6AA 2LG1A 5CLQB 1BTNA 4K2PA 2COFA 1GC6A 1NI2A 3HK0A 3KSYA 3SYXA 2W2WA 4HB2B 4HAUB 2RNRB 2CAYA 1GG3A 3DXEA 4GZUA 1ZM0A 1W1DA 2YT0A 2AEHA 4GMXB 4C0AA 4EKUA 5DHAB 4A6FA 2M38A 1DBHA 1M7EA 1UNPA 4A6KA 1WGUA 3V5WA 2QKMA 4WSFA 5DI9B 5KQ4A 5JLJB 1ZC3B 4KHBB 1U5DA 3AJ4A 2EMTA 1SHCA 3WYFB 3N7CA 5J3YA 4BBKA 2YS5A 1PFJA 5HE1A 2Y7BA 4HAWB 5HE3A 3PSCA 2OQBA 3AU4A 4B6HA 3KY9A 5LOPB 3QWMA 1UEFA 3QBVB 3KZ1A 2ZPYA 2V76A 1RRPB 4ZRIA 1WJMA 2DHJA 2NMBA 1DDWA 2NZ8B 1NTVA 3BJIA 1U5GA 1XODA 2J59M 2YF0A 3ODWA 2J0JA 1BWNA 4GXBA 3FM8C 2ADZA 3D8EA 1U27A 1WG7A 2MDXA 1BAKA 2CY4A 2H7EA 3PVLA 5DHFB 1OMWA 2VSZA 2YS1A 2PZ1A 5C79A 4WVFB 2MKRA 4CHMA 3ZVRA 1WVHA 2GJYA 5KQ1A 2K2UA 2DA0A 2DHKA 1FHOA 3BINA 1SGHA 4K2OA 3TCAA 1XCGA 4GPTB 2ELBA 1E5WA 1ISNA 2DN6A 2CRFA 1IRSA 1U5FA 4CYEA 2L2IA 3SNHA 3PZDA 1MIZB 3FSSA 2YT1A 2H7DA 1WI1A 2KCJA 1TXDA 4MT7A 2COCA 1AQCA 1FGZA 1U5EA 1J0WA 2MWNB 3A8QA 2EJ8A 1Y19B 5FI0A 1Y5OA 5KCVA 2DYNA 2DYQA 3F0WA 3PP2A 1NU2A 2RSGA 2Z0PA 5D3WA 1P5TA 4NSWA 1I7AA 4HAYB 2DX5A 4ZRJA 1B55A 4EJNA 4PQ0A 1FHXA 4IFSA 4MK0A 1M7RA 3F5RA 2DHIA 5C5BA 4TYZA 4DX8A 2D2QA 1WJ1A 1MPHA 3MPXA 1X1GA 2I5CA 1FOEA 1TQZA 1KZGA 1DDVA 2IFSA 4KVGB 3ODXA 2UZRA 3ODOA 5D3XA 3GYPA 1K5DB 2CODA 2YRYA 1UNQA 4H8SA 2G35A 3G9WA 1UNRA 3T06A 2D10A 1DROA 4HB0B 2LOZA 2I5FA 1WGQA 2D9YA 1K5GB 2MFQA 1V61A 4XWXA 5EFXA 1EAZA 1P6SA 4HHVA 5C16A 2GS0A 5D3VA 1X1FA 5GOWB 2EMSA 1OY2A 4L6EA 1OQNA
chains in the Genus database with same CATH superfamily
2KIGA 2YS3A 2YVCA 2UZSA 1V5PA 3SO6A 1ZSQA 2RVBB 3ULCA 2Z4DA 2X18A 2VKIA 2D9XA 2AL6A 2ROVA 2J0MA 3NWFA 1MK7B 5J3QA 2YSZA 2Y8GA 2D4QA 2KGXB 5L81A 4A6FB 5D27A 4QXAB 2YT2A 1J19A 1NTYA 1QQGA 4A5KA 5LONB 1MAIA 3U8ZA 2DLWA 2P0HA 3FEHA 2DTCA 3HQCA 5CLLB 1MIXA 3DXCA 3NWAA 2DFKA 4OT1A 2D9VA 4HAVB 2EC1A 3DCXA 1MK9B 2XQNM 2RLOA 2CY5A 2JP2A 3PG7A 2W2XC 3AU5A 2LULA 3SV1A 1V5UA 4MY6A 1X05A 3VOQA 4GOUA 1X11A 4ZRKA 2D9ZA 2Z0QA 1FHWA 4QJ3B 5HE2A 2Z0OA 4KHBA 1PLSA 4HATB 4K81A 5JHGA 2IYBA 2ELAA 3HW2B 3GYOA 4Y94A 2BCJA 5HE0A 2W2XD 1EF1A 3WA0A 1KI1B 4TKNA 4HSIA 4EMOA 3DXDA 4HDQA 2HTHB 4D6WA 3SUZA 1LW3A 4IOYX 1ZVRA 4D0NB 1LB1A 4QJ4B 2KUPA 2R0DA 2E2XA 2QKLA 1AWEA 2M14A 4KHAA 3ULBA 1XR0B 2K2JA 2L1CA 4Z2NA 5JHHA 3MDBC 5LG4B 2K00A 2FJLA 4KAXB 2LKOA 2DX1A 2RUKB 2P0DA 4GMVA 3PVWA 1N3HA 2COAA 2NBVA 2KUQA 1RJ2A 5FI1A 1DDMA 3LJUX 3PVUA 4HAZB 3NSUA 3TW1A 3D8FA 3HIEA 1FAOA 2OTXA 2I1JA 1TJ6A 4YONA 3TVVA 1W1HA 1FGYA 4YL8A 2D9WA 2VRWB 2HE7A 3KRXA 1EVHA 1QC6A 3D8DA 3ZDTA 2RGNB 3TO1A 5C5BB 2P8VA 5D3YA 3O96A 1Z87A 4CHJA 4PNKA 4DBBA 2ROZB 1X86A 1FB8A 1UPQA 1MKEA 3CXBB 2J0KA 1I2HA 1PMSA 4DX90 1XX0A 1DYNA 2Q13A 3UZTA 1V89A 2GCJA 4NY0A 4P7IA 1U29A 4Z2MB 3TFMA 3IVFA 5DH9B 3RCPA 4HDOA 3P7ZA 4A6HA 1ZC4B 3X23A 4HAXB 2N23A 2I1KA 1GC7A 1UPRA 3ML4A 4IAPA 5J3TA 3PEGA 1XKEA 1KZ7A 2P0FA 1H10A 1Q67A 2LOXA 2LYDA 4HB3B 5M4YB 3VIAA 1H4RA 3U12A 2R09A 3CIKA 4KHOA 1T77A 2ZKMX 4WJ7A 2K8EA 1XD4A 1W1GA 3A8PA 4F7GA 5C6RA 1V5MA 3OANA 3M1IB 3NW8A 5JP4A 3KRWA 4HB4B 5DIFB 4F7HA 3U7DA 1P3RA 4DXAB 4F7UP 1EGXA 2Y8FA 2DKPA 2N0YA 3QIJA 1U2BA 4K17A 1V88A 4GN1A 2D11A 2UVMA 2GCLA 3A98B 2DKQA 1BTKA 3P6AA 2LG1A 5CLQB 1MI1A 1BTNA 4K2PA 2COFA 1GC6A 1NI2A 3NWDA 3HK0A 3KSYA 3SYXA 2W2WA 4HB2B 4HAUB 2RNRB 2CAYA 1GG3A 3DXEA 4GZUA 1ZM0A 1W1DA 2YT0A 2FJUB 2AEHA 4GMXB 4C0AA 4EKUA 5DHAB 4A6FA 2M38A 1DBHA 1M7EA 1UNPA 4A6KA 1WGUA 3V5WA 4L1RA 2QKMA 4WSFA 5DI9B 5KQ4A 5JLJB 3B77A 1ZC3B 4KHBB 1U5DA 2Z13A 3AJ4A 2EMTA 5IRSA 1SHCA 3WYFB 3N7CA 5J3YA 4BBKA 2YS5A 1PFJA 5HE1A 2Y7BA 4HAWB 5HE3A 3PSCA 2OQBA 3AU4A 4B6HA 3KY9A 5LOPB 3QWMA 1UEFA 3QBVB 3KZ1A 2ZPYA 2V76A 1RRPB 4ZRIA 1WJMA 2DHJA 2NMBA 2Z59A 1DDWA 2NZ8B 1NTVA 3BJIA 1U5GA 1XODA 2J59M 2YF0A 3ODWA 2J0JA 1BWNA 4GXBA 3FM8C 2ADZA 3D8EA 1U27A 1WG7A 2MDXA 1BAKA 5I2MA 2CY4A 2H7EA 3PVLA 5DHFB 1OMWA 2VSZA 2YS1A 2PZ1A 5C79A 4WVFB 2MKRA 4CHMA 3ZVRA 1WVHA 2GJYA 5KQ1A 2K2UA 2DA0A 2DHKA 1FHOA 2KR0A 3BINA 1SGHA 4K2OA 4QJ5B 3TCAA 1XCGA 4GPTB 2ELBA 1E5WA 1ISNA 2DN6A 2CRFA 1IRSA 1U5FA 4CYEA 2L2IA 4GNKB 3SNHA 3PZDA 1MIZB 3FSSA 2YT1A 2H7DA 2K49A 1WI1A 2KCJA 1TXDA 4MT7A 3FVCA 1ZYIA 2COCA 2GUMA 1AQCA 1FGZA 1U5EA 1J0WA 2MWNB 3A8QA 2EJ8A 4OSNA 1Y19B 5FI0A 1Y5OA 3OHMB 5KCVA 2DYNA 2DYQA 3F0WA 3PP2A 3A58A 1NU2A 2RSGA 2Z0PA 5D3WA 1P5TA 4NSWA 1I7AA 4HAYB 2DX5A 4ZRJA 2KIEA 1B55A 4EJNA 4PQ0A 1FHXA 2R2YA 4IFSA 4MK0A 1M7RA 3F5RA 2DHIA 5C5BA 4TYZA 4DX8A 2D2QA 1WJ1A 1MPHA 3MPXA 1X1GA 2I5CA 1TQZA 1FOEA 1KZGA 1DDVA 2IFSA 4KVGB 3ODXA 2UZRA 3ODOA 5D3XA 4DIXA 3GYPA 1K5DB 3HSAA 2CODA 2YRYA 1UNQA 4H8SA 2RRFA 2G35A 3G9WA 1UNRA 3T06A 2D10A 1DROA 4HB0B 2LOZA 5I2SA 2I5FA 4CSQA 1WGQA 2D9YA 1K5GB 2MFQA 1V61A 4XWXA 5EFXA 1EAZA 1P6SA 4HHVA 5C16A 2Z14A 2GS0A 5D3VA 1X1FA 5GOWB 2EMSA 1OY2A 4L6EA 1OQNA
chains in the Genus database with same CATH topology
2YS3A 2YVCA 2UZSA 1V5PA 3SO6A 1ZSQA 2RVBB 3ULCA 2X18A 2VKIA 2D9XA 2AL6A 2ROVA 2J0MA 1MK7B 5J3QA 2YSZA 2Y8GA 2D4QA 2KGXB 5L81A 4A6FB 5D27A 1J19A 1NTYA 1QQGA 4A5KA 5LONB 1MAIA 3U8ZA 2DLWA 2P0HA 3FEHA 2DTCA 3HQCA 5CLLB 1MIXA 3DXCA 2DFKA 2D9VA 4HAVB 2EC1A 1MK9B 2XQNM 2RLOA 2CY5A 2JP2A 3PG7A 2W2XC 3AU5A 2LULA 3SV1A 1V5UA 4MY6A 1X05A 3VOQA 1X11A 4ZRKA 2D9ZA 2Z0QA 1FHWA 5HE2A 2Z0OA 1PLSA 4HATB 4K81A 5JHGA 2IYBA 2ELAA 3HW2B 3GYOA 4Y94A 2BCJA 5HE0A 2W2XD 1EF1A 3WA0A 1KI1B 4TKNA 4EMOA 3DXDA 4HDQA 2HTHB 3SUZA 1LW3A 4IOYX 1ZVRA 4D0NB 1LB1A 2KUPA 2R0DA 2E2XA 2QKLA 1AWEA 2M14A 4KHAA 3ULBA 1XR0B 2K2JA 2L1CA 4Z2NA 5JHHA 3MDBC 2K00A 2FJLA 4KAXB 2LKOA 2DX1A 2RUKB 2P0DA 4GMVA 3PVWA 1N3HA 2COAA 1RJ2A 5FI1A 1DDMA 3LJUX 3PVUA 4HAZB 3NSUA 3TW1A 3D8FA 1FAOA 2OTXA 2I1JA 1TJ6A 4YONA 3TVVA 1W1HA 1FGYA 4YL8A 2D9WA 2VRWB 2HE7A 3KRXA 1EVHA 1QC6A 3D8DA 3ZDTA 2RGNB 3TO1A 5C5BB 2P8VA 5D3YA 3O96A 1Z87A 4CHJA 4PNKA 4DBBA 2ROZB 1X86A 1FB8A 1UPQA 1MKEA 3CXBB 2J0KA 1I2HA 1PMSA 4DX90 1XX0A 1DYNA 2Q13A 3UZTA 1V89A 2GCJA 4NY0A 4P7IA 1U29A 4Z2MB 3TFMA 3IVFA 5DH9B 3RCPA 4HDOA 3P7ZA 4A6HA 1ZC4B 3X23A 4HAXB 2N23A 2I1KA 1GC7A 1UPRA 3ML4A 4IAPA 5J3TA 3PEGA 1XKEA 1KZ7A 2P0FA 1H10A 1Q67A 2LOXA 2LYDA 4HB3B 3VIAA 1H4RA 2R09A 3CIKA 4KHOA 4WJ7A 1XD4A 1W1GA 3A8PA 4F7GA 5C6RA 1V5MA 3OANA 3M1IB 5JP4A 3KRWA 4HB4B 5DIFB 4F7HA 3U7DA 1P3RA 4DXAB 4F7UP 1EGXA 2Y8FA 2DKPA 2N0YA 3QIJA 1U2BA 4K17A 1V88A 4GN1A 2D11A 2UVMA 2GCLA 3A98B 2DKQA 1BTKA 3P6AA 2LG1A 5CLQB 1BTNA 4K2PA 2COFA 1GC6A 1NI2A 3HK0A 3KSYA 3SYXA 2W2WA 4HB2B 4HAUB 2RNRB 2CAYA 1GG3A 3DXEA 4GZUA 1ZM0A 1W1DA 2YT0A 2AEHA 4GMXB 4C0AA 4EKUA 5DHAB 4A6FA 2M38A 1DBHA 1M7EA 1UNPA 4A6KA 1WGUA 3V5WA 2QKMA 4WSFA 5DI9B 5KQ4A 5JLJB 1ZC3B 4KHBB 1U5DA 3AJ4A 2EMTA 1SHCA 3WYFB 3N7CA 5J3YA 4BBKA 2YS5A 1PFJA 5HE1A 2Y7BA 4HAWB 5HE3A 3PSCA 2OQBA 3AU4A 4B6HA 3KY9A 5LOPB 3QWMA 1UEFA 3QBVB 3KZ1A 2ZPYA 2V76A 1RRPB 4ZRIA 1WJMA 2DHJA 2NMBA 1DDWA 2NZ8B 1NTVA 3BJIA 1U5GA 1XODA 2J59M 2YF0A 3ODWA 2J0JA 1BWNA 4GXBA 3FM8C 2ADZA 3D8EA 1U27A 1WG7A 2MDXA 1BAKA 2CY4A 2H7EA 3PVLA 5DHFB 1OMWA 2VSZA 2YS1A 2PZ1A 5C79A 4WVFB 2MKRA 4CHMA 3ZVRA 1WVHA 2GJYA 5KQ1A 2K2UA 2DA0A 2DHKA 1FHOA 3BINA 1SGHA 4K2OA 3TCAA 1XCGA 4GPTB 2ELBA 1E5WA 1ISNA 2DN6A 2CRFA 1IRSA 1U5FA 4CYEA 2L2IA 3SNHA 3PZDA 1MIZB 3FSSA 2YT1A 2H7DA 1WI1A 2KCJA 1TXDA 4MT7A 2COCA 1AQCA 1FGZA 1U5EA 1J0WA 2MWNB 3A8QA 2EJ8A 1Y19B 5FI0A 1Y5OA 5KCVA 2DYNA 2DYQA 3F0WA 3PP2A 1NU2A 2RSGA 2Z0PA 5D3WA 1P5TA 4NSWA 1I7AA 4HAYB 2DX5A 4ZRJA 1B55A 4EJNA 4PQ0A 1FHXA 4IFSA 4MK0A 1M7RA 3F5RA 2DHIA 5C5BA 4TYZA 4DX8A 2D2QA 1WJ1A 1MPHA 3MPXA 1X1GA 2I5CA 1FOEA 1TQZA 1KZGA 1DDVA 2IFSA 4KVGB 3ODXA 2UZRA 3ODOA 5D3XA 3GYPA 1K5DB 2CODA 2YRYA 1UNQA 4H8SA 2G35A 3G9WA 1UNRA 3T06A 2D10A 1DROA 4HB0B 2LOZA 2I5FA 1WGQA 2D9YA 1K5GB 2MFQA 1V61A 4XWXA 5EFXA 1EAZA 1P6SA 4HHVA 5C16A 2GS0A 5D3VA 1X1FA 5GOWB 2EMSA 1OY2A 4L6EA 1OQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS3 A;  2YVC A;  2UZS A;  1V5P A;  3SO6 A;  1ZSQ A;  2RVB B;  3ULC A;  2X18 A;  2VKI A;  2D9X A;  2AL6 A;  2ROV A;  2J0M A;  1MK7 B;  5J3Q A;  2YSZ A;  2Y8G A;  2D4Q A;  2KGX B;  5L81 A;  4A6F B;  5D27 A;  1J19 A;  1NTY A;  1QQG A;  4A5K A;  5LON B;  1MAI A;  3U8Z A;  2DLW A;  2P0H A;  3FEH A;  2DTC A;  3HQC A;  5CLL B;  1MIX A;  3DXC A;  2DFK A;  2D9V A;  4HAV B;  2EC1 A;  1MK9 B;  2XQN M;  2RLO A;  2CY5 A;  2JP2 A;  3PG7 A;  2W2X C;  3AU5 A;  2LUL A;  3SV1 A;  1V5U A;  4MY6 A;  1X05 A;  3VOQ A;  1X11 A;  4ZRK A;  2D9Z A;  2Z0Q A;  1FHW A;  5HE2 A;  2Z0O A;  1PLS A;  4HAT B;  4K81 A;  5JHG A;  2IYB A;  2ELA A;  3HW2 B;  3GYO A;  4Y94 A;  2BCJ A;  5HE0 A;  2W2X D;  1EF1 A;  3WA0 A;  1KI1 B;  4TKN A;  4EMO A;  3DXD A;  4HDQ A;  2HTH B;  3SUZ A;  1LW3 A;  4IOY X;  1ZVR A;  4D0N B;  1LB1 A;  2KUP A;  2R0D A;  2E2X A;  2QKL A;  1AWE A;  2M14 A;  4KHA A;  3ULB A;  1XR0 B;  2K2J A;  2L1C A;  4Z2N A;  5JHH A;  3MDB C;  2K00 A;  2FJL A;  4KAX B;  2LKO A;  2DX1 A;  2RUK B;  2P0D A;  4GMV A;  3PVW A;  1N3H A;  2COA A;  1RJ2 A;  5FI1 A;  1DDM A;  3LJU X;  3PVU A;  4HAZ B;  3NSU A;  3TW1 A;  3D8F A;  1FAO A;  2OTX A;  2I1J A;  1TJ6 A;  4YON A;  3TVV A;  1W1H A;  1FGY A;  4YL8 A;  2D9W A;  2VRW B;  2HE7 A;  3KRX A;  1EVH A;  1QC6 A;  3D8D A;  3ZDT A;  2RGN B;  3TO1 A;  5C5B B;  2P8V A;  5D3Y A;  3O96 A;  1Z87 A;  4CHJ A;  4PNK A;  4DBB A;  2ROZ B;  1X86 A;  1FB8 A;  1UPQ A;  1MKE A;  3CXB B;  2J0K A;  1I2H A;  1PMS A;  4DX9 0;  1XX0 A;  1DYN A;  2Q13 A;  3UZT A;  1V89 A;  2GCJ A;  4NY0 A;  4P7I A;  1U29 A;  4Z2M B;  3TFM A;  3IVF A;  5DH9 B;  3RCP A;  4HDO A;  3P7Z A;  4A6H A;  1ZC4 B;  3X23 A;  4HAX B;  2N23 A;  2I1K A;  1GC7 A;  1UPR A;  3ML4 A;  4IAP A;  5J3T A;  3PEG A;  1XKE A;  1KZ7 A;  2P0F A;  1H10 A;  1Q67 A;  2LOX A;  2LYD A;  4HB3 B;  3VIA A;  1H4R A;  2R09 A;  3CIK A;  4KHO A;  4WJ7 A;  1XD4 A;  1W1G A;  3A8P A;  4F7G A;  5C6R A;  1V5M A;  3OAN A;  3M1I B;  5JP4 A;  3KRW A;  4HB4 B;  5DIF B;  4F7H A;  3U7D A;  1P3R A;  4DXA B;  4F7U P;  1EGX A;  2Y8F A;  2DKP A;  2N0Y A;  3QIJ A;  1U2B A;  4K17 A;  1V88 A;  4GN1 A;  2D11 A;  2UVM A;  2GCL A;  3A98 B;  2DKQ A;  1BTK A;  3P6A A;  2LG1 A;  5CLQ B;  1BTN A;  4K2P A;  2COF A;  1GC6 A;  1NI2 A;  3HK0 A;  3KSY A;  3SYX A;  2W2W A;  4HB2 B;  4HAU B;  2RNR B;  2CAY A;  1GG3 A;  3DXE A;  4GZU A;  1ZM0 A;  1W1D A;  2YT0 A;  2AEH A;  4GMX B;  4C0A A;  4EKU A;  5DHA B;  4A6F A;  2M38 A;  1DBH A;  1M7E A;  1UNP A;  4A6K A;  1WGU A;  3V5W A;  2QKM A;  4WSF A;  5DI9 B;  5KQ4 A;  5JLJ B;  1ZC3 B;  4KHB B;  1U5D A;  3AJ4 A;  2EMT A;  1SHC A;  3WYF B;  3N7C A;  5J3Y A;  4BBK A;  2YS5 A;  1PFJ A;  5HE1 A;  2Y7B A;  4HAW B;  5HE3 A;  3PSC A;  2OQB A;  3AU4 A;  4B6H A;  3KY9 A;  5LOP B;  3QWM A;  1UEF A;  3QBV B;  3KZ1 A;  2ZPY A;  2V76 A;  1RRP B;  4ZRI A;  1WJM A;  2DHJ A;  2NMB A;  1DDW A;  2NZ8 B;  1NTV A;  3BJI A;  1U5G A;  1XOD A;  2J59 M;  2YF0 A;  3ODW A;  2J0J A;  1BWN A;  4GXB A;  3FM8 C;  2ADZ A;  3D8E A;  1U27 A;  1WG7 A;  2MDX A;  1BAK A;  2CY4 A;  2H7E A;  3PVL A;  5DHF B;  1OMW A;  2VSZ A;  2YS1 A;  2PZ1 A;  5C79 A;  4WVF B;  2MKR A;  4CHM A;  3ZVR A;  1WVH A;  2GJY A;  5KQ1 A;  2K2U A;  2DA0 A;  2DHK A;  1FHO A;  3BIN A;  1SGH A;  4K2O A;  3TCA A;  1XCG A;  4GPT B;  2ELB A;  1E5W A;  1ISN A;  2DN6 A;  2CRF A;  1IRS A;  1U5F A;  4CYE A;  2L2I A;  3SNH A;  3PZD A;  1MIZ B;  3FSS A;  2YT1 A;  2H7D A;  1WI1 A;  2KCJ A;  1TXD A;  4MT7 A;  2COC A;  1AQC A;  1FGZ A;  1U5E A;  1J0W A;  2MWN B;  3A8Q A;  2EJ8 A;  1Y19 B;  5FI0 A;  1Y5O A;  5KCV A;  2DYN A;  2DYQ A;  3F0W A;  3PP2 A;  1NU2 A;  2RSG A;  2Z0P A;  5D3W A;  1P5T A;  4NSW A;  1I7A A;  4HAY B;  2DX5 A;  4ZRJ A;  1B55 A;  4EJN A;  4PQ0 A;  1FHX A;  4IFS A;  4MK0 A;  1M7R A;  3F5R A;  2DHI A;  5C5B A;  4TYZ A;  4DX8 A;  2D2Q A;  1WJ1 A;  1MPH A;  3MPX A;  1X1G A;  2I5C A;  1FOE A;  1TQZ A;  1KZG A;  1DDV A;  2IFS A;  4KVG B;  3ODX A;  2UZR A;  3ODO A;  5D3X A;  3GYP A;  1K5D B;  2COD A;  2YRY A;  1UNQ A;  4H8S A;  2G35 A;  3G9W A;  1UNR A;  3T06 A;  2D10 A;  1DRO A;  4HB0 B;  2LOZ A;  2I5F A;  1WGQ A;  2D9Y A;  1K5G B;  2MFQ A;  1V61 A;  4XWX A;  5EFX A;  1EAZ A;  1P6S A;  4HHV A;  5C16 A;  2GS0 A;  5D3V A;  1X1F A;  5GOW B;  2EMS A;  1OY2 A;  4L6E A;  1OQN A; 
#chains in the Genus database with same CATH topology
 2KIG A;  2YS3 A;  2YVC A;  2UZS A;  1V5P A;  3SO6 A;  1ZSQ A;  2RVB B;  3ULC A;  2Z4D A;  2X18 A;  2VKI A;  2D9X A;  2AL6 A;  2ROV A;  2J0M A;  3NWF A;  1MK7 B;  5J3Q A;  2YSZ A;  2Y8G A;  2D4Q A;  2KGX B;  5L81 A;  4A6F B;  5D27 A;  4QXA B;  2YT2 A;  1J19 A;  1NTY A;  1QQG A;  4A5K A;  5LON B;  1MAI A;  3U8Z A;  2DLW A;  2P0H A;  3FEH A;  2DTC A;  3HQC A;  5CLL B;  1MIX A;  3DXC A;  3NWA A;  2DFK A;  4OT1 A;  2D9V A;  4HAV B;  2EC1 A;  3DCX A;  1MK9 B;  2XQN M;  2RLO A;  2CY5 A;  2JP2 A;  3PG7 A;  2W2X C;  3AU5 A;  2LUL A;  3SV1 A;  1V5U A;  4MY6 A;  1X05 A;  3VOQ A;  4GOU A;  1X11 A;  4ZRK A;  2D9Z A;  2Z0Q A;  1FHW A;  4QJ3 B;  5HE2 A;  2Z0O A;  4KHB A;  1PLS A;  4HAT B;  4K81 A;  5JHG A;  2IYB A;  2ELA A;  3HW2 B;  3GYO A;  4Y94 A;  2BCJ A;  5HE0 A;  2W2X D;  1EF1 A;  3WA0 A;  1KI1 B;  4TKN A;  4HSI A;  4EMO A;  3DXD A;  4HDQ A;  2HTH B;  4D6W A;  3SUZ A;  1LW3 A;  4IOY X;  1ZVR A;  4D0N B;  1LB1 A;  4QJ4 B;  2KUP A;  2R0D A;  2E2X A;  2QKL A;  1AWE A;  2M14 A;  4KHA A;  3ULB A;  1XR0 B;  2K2J A;  2L1C A;  4Z2N A;  5JHH A;  3MDB C;  5LG4 B;  2K00 A;  2FJL A;  4KAX B;  2LKO A;  2DX1 A;  2RUK B;  2P0D A;  4GMV A;  3PVW A;  1N3H A;  2COA A;  2NBV A;  2KUQ A;  1RJ2 A;  5FI1 A;  1DDM A;  3LJU X;  3PVU A;  4HAZ B;  3NSU A;  3TW1 A;  3D8F A;  3HIE A;  1FAO A;  2OTX A;  2I1J A;  1TJ6 A;  4YON A;  3TVV A;  1W1H A;  1FGY A;  4YL8 A;  2D9W A;  2VRW B;  2HE7 A;  3KRX A;  1EVH A;  1QC6 A;  3D8D A;  3ZDT A;  2RGN B;  3TO1 A;  5C5B B;  2P8V A;  5D3Y A;  3O96 A;  1Z87 A;  4CHJ A;  4PNK A;  4DBB A;  2ROZ B;  1X86 A;  1FB8 A;  1UPQ A;  1MKE A;  3CXB B;  2J0K A;  1I2H A;  1PMS A;  4DX9 0;  1XX0 A;  1DYN A;  2Q13 A;  3UZT A;  1V89 A;  2GCJ A;  4NY0 A;  4P7I A;  1U29 A;  4Z2M B;  3TFM A;  3IVF A;  5DH9 B;  3RCP A;  4HDO A;  3P7Z A;  4A6H A;  1ZC4 B;  3X23 A;  4HAX B;  2N23 A;  2I1K A;  1GC7 A;  1UPR A;  3ML4 A;  4IAP A;  5J3T A;  3PEG A;  1XKE A;  1KZ7 A;  2P0F A;  1H10 A;  1Q67 A;  2LOX A;  2LYD A;  4HB3 B;  5M4Y B;  3VIA A;  1H4R A;  3U12 A;  2R09 A;  3CIK A;  4KHO A;  1T77 A;  2ZKM X;  4WJ7 A;  2K8E A;  1XD4 A;  1W1G A;  3A8P A;  4F7G A;  5C6R A;  1V5M A;  3OAN A;  3M1I B;  3NW8 A;  5JP4 A;  3KRW A;  4HB4 B;  5DIF B;  4F7H A;  3U7D A;  1P3R A;  4DXA B;  4F7U P;  1EGX A;  2Y8F A;  2DKP A;  2N0Y A;  3QIJ A;  1U2B A;  4K17 A;  1V88 A;  4GN1 A;  2D11 A;  2UVM A;  2GCL A;  3A98 B;  2DKQ A;  1BTK A;  3P6A A;  2LG1 A;  5CLQ B;  1MI1 A;  1BTN A;  4K2P A;  2COF A;  1GC6 A;  1NI2 A;  3NWD A;  3HK0 A;  3KSY A;  3SYX A;  2W2W A;  4HB2 B;  4HAU B;  2RNR B;  2CAY A;  1GG3 A;  3DXE A;  4GZU A;  1ZM0 A;  1W1D A;  2YT0 A;  2FJU B;  2AEH A;  4GMX B;  4C0A A;  4EKU A;  5DHA B;  4A6F A;  2M38 A;  1DBH A;  1M7E A;  1UNP A;  4A6K A;  1WGU A;  3V5W A;  4L1R A;  2QKM A;  4WSF A;  5DI9 B;  5KQ4 A;  5JLJ B;  3B77 A;  1ZC3 B;  4KHB B;  1U5D A;  2Z13 A;  3AJ4 A;  2EMT A;  5IRS A;  1SHC A;  3WYF B;  3N7C A;  5J3Y A;  4BBK A;  2YS5 A;  1PFJ A;  5HE1 A;  2Y7B A;  4HAW B;  5HE3 A;  3PSC A;  2OQB A;  3AU4 A;  4B6H A;  3KY9 A;  5LOP B;  3QWM A;  1UEF A;  3QBV B;  3KZ1 A;  2ZPY A;  2V76 A;  1RRP B;  4ZRI A;  1WJM A;  2DHJ A;  2NMB A;  2Z59 A;  1DDW A;  2NZ8 B;  1NTV A;  3BJI A;  1U5G A;  1XOD A;  2J59 M;  2YF0 A;  3ODW A;  2J0J A;  1BWN A;  4GXB A;  3FM8 C;  2ADZ A;  3D8E A;  1U27 A;  1WG7 A;  2MDX A;  1BAK A;  5I2M A;  2CY4 A;  2H7E A;  3PVL A;  5DHF B;  1OMW A;  2VSZ A;  2YS1 A;  2PZ1 A;  5C79 A;  4WVF B;  2MKR A;  4CHM A;  3ZVR A;  1WVH A;  2GJY A;  5KQ1 A;  2K2U A;  2DA0 A;  2DHK A;  1FHO A;  2KR0 A;  3BIN A;  1SGH A;  4K2O A;  4QJ5 B;  3TCA A;  1XCG A;  4GPT B;  2ELB A;  1E5W A;  1ISN A;  2DN6 A;  2CRF A;  1IRS A;  1U5F A;  4CYE A;  2L2I A;  4GNK B;  3SNH A;  3PZD A;  1MIZ B;  3FSS A;  2YT1 A;  2H7D A;  2K49 A;  1WI1 A;  2KCJ A;  1TXD A;  4MT7 A;  3FVC A;  1ZYI A;  2COC A;  2GUM A;  1AQC A;  1FGZ A;  1U5E A;  1J0W A;  2MWN B;  3A8Q A;  2EJ8 A;  4OSN A;  1Y19 B;  5FI0 A;  1Y5O A;  3OHM B;  5KCV A;  2DYN A;  2DYQ A;  3F0W A;  3PP2 A;  3A58 A;  1NU2 A;  2RSG A;  2Z0P A;  5D3W A;  1P5T A;  4NSW A;  1I7A A;  4HAY B;  2DX5 A;  4ZRJ A;  2KIE A;  1B55 A;  4EJN A;  4PQ0 A;  1FHX A;  2R2Y A;  4IFS A;  4MK0 A;  1M7R A;  3F5R A;  2DHI A;  5C5B A;  4TYZ A;  4DX8 A;  2D2Q A;  1WJ1 A;  1MPH A;  3MPX A;  1X1G A;  2I5C A;  1TQZ A;  1FOE A;  1KZG A;  1DDV A;  2IFS A;  4KVG B;  3ODX A;  2UZR A;  3ODO A;  5D3X A;  4DIX A;  3GYP A;  1K5D B;  3HSA A;  2COD A;  2YRY A;  1UNQ A;  4H8S A;  2RRF A;  2G35 A;  3G9W A;  1UNR A;  3T06 A;  2D10 A;  1DRO A;  4HB0 B;  2LOZ A;  5I2S A;  2I5F A;  4CSQ A;  1WGQ A;  2D9Y A;  1K5G B;  2MFQ A;  1V61 A;  4XWX A;  5EFX A;  1EAZ A;  1P6S A;  4HHV A;  5C16 A;  2Z14 A;  2GS0 A;  5D3V A;  1X1F A;  5GOW B;  2EMS A;  1OY2 A;  4L6E A;  1OQN A; 
#chains in the Genus database with same CATH homology
 2YS3 A;  2YVC A;  2UZS A;  1V5P A;  3SO6 A;  1ZSQ A;  2RVB B;  3ULC A;  2X18 A;  2VKI A;  2D9X A;  2AL6 A;  2ROV A;  2J0M A;  1MK7 B;  5J3Q A;  2YSZ A;  2Y8G A;  2D4Q A;  2KGX B;  5L81 A;  4A6F B;  5D27 A;  1J19 A;  1NTY A;  1QQG A;  4A5K A;  5LON B;  1MAI A;  3U8Z A;  2DLW A;  2P0H A;  3FEH A;  2DTC A;  3HQC A;  5CLL B;  1MIX A;  3DXC A;  2DFK A;  2D9V A;  4HAV B;  2EC1 A;  1MK9 B;  2XQN M;  2RLO A;  2CY5 A;  2JP2 A;  3PG7 A;  2W2X C;  3AU5 A;  2LUL A;  3SV1 A;  1V5U A;  4MY6 A;  1X05 A;  3VOQ A;  1X11 A;  4ZRK A;  2D9Z A;  2Z0Q A;  1FHW A;  5HE2 A;  2Z0O A;  1PLS A;  4HAT B;  4K81 A;  5JHG A;  2IYB A;  2ELA A;  3HW2 B;  3GYO A;  4Y94 A;  2BCJ A;  5HE0 A;  2W2X D;  1EF1 A;  3WA0 A;  1KI1 B;  4TKN A;  4EMO A;  3DXD A;  4HDQ A;  2HTH B;  3SUZ A;  1LW3 A;  4IOY X;  1ZVR A;  4D0N B;  1LB1 A;  2KUP A;  2R0D A;  2E2X A;  2QKL A;  1AWE A;  2M14 A;  4KHA A;  3ULB A;  1XR0 B;  2K2J A;  2L1C A;  4Z2N A;  5JHH A;  3MDB C;  2K00 A;  2FJL A;  4KAX B;  2LKO A;  2DX1 A;  2RUK B;  2P0D A;  4GMV A;  3PVW A;  1N3H A;  2COA A;  1RJ2 A;  5FI1 A;  1DDM A;  3LJU X;  3PVU A;  4HAZ B;  3NSU A;  3TW1 A;  3D8F A;  1FAO A;  2OTX A;  2I1J A;  1TJ6 A;  4YON A;  3TVV A;  1W1H A;  1FGY A;  4YL8 A;  2D9W A;  2VRW B;  2HE7 A;  3KRX A;  1EVH A;  1QC6 A;  3D8D A;  3ZDT A;  2RGN B;  3TO1 A;  5C5B B;  2P8V A;  5D3Y A;  3O96 A;  1Z87 A;  4CHJ A;  4PNK A;  4DBB A;  2ROZ B;  1X86 A;  1FB8 A;  1UPQ A;  1MKE A;  3CXB B;  2J0K A;  1I2H A;  1PMS A;  4DX9 0;  1XX0 A;  1DYN A;  2Q13 A;  3UZT A;  1V89 A;  2GCJ A;  4NY0 A;  4P7I A;  1U29 A;  4Z2M B;  3TFM A;  3IVF A;  5DH9 B;  3RCP A;  4HDO A;  3P7Z A;  4A6H A;  1ZC4 B;  3X23 A;  4HAX B;  2N23 A;  2I1K A;  1GC7 A;  1UPR A;  3ML4 A;  4IAP A;  5J3T A;  3PEG A;  1XKE A;  1KZ7 A;  2P0F A;  1H10 A;  1Q67 A;  2LOX A;  2LYD A;  4HB3 B;  3VIA A;  1H4R A;  2R09 A;  3CIK A;  4KHO A;  4WJ7 A;  1XD4 A;  1W1G A;  3A8P A;  4F7G A;  5C6R A;  1V5M A;  3OAN A;  3M1I B;  5JP4 A;  3KRW A;  4HB4 B;  5DIF B;  4F7H A;  3U7D A;  1P3R A;  4DXA B;  4F7U P;  1EGX A;  2Y8F A;  2DKP A;  2N0Y A;  3QIJ A;  1U2B A;  4K17 A;  1V88 A;  4GN1 A;  2D11 A;  2UVM A;  2GCL A;  3A98 B;  2DKQ A;  1BTK A;  3P6A A;  2LG1 A;  5CLQ B;  1BTN A;  4K2P A;  2COF A;  1GC6 A;  1NI2 A;  3HK0 A;  3KSY A;  3SYX A;  2W2W A;  4HB2 B;  4HAU B;  2RNR B;  2CAY A;  1GG3 A;  3DXE A;  4GZU A;  1ZM0 A;  1W1D A;  2YT0 A;  2AEH A;  4GMX B;  4C0A A;  4EKU A;  5DHA B;  4A6F A;  2M38 A;  1DBH A;  1M7E A;  1UNP A;  4A6K A;  1WGU A;  3V5W A;  2QKM A;  4WSF A;  5DI9 B;  5KQ4 A;  5JLJ B;  1ZC3 B;  4KHB B;  1U5D A;  3AJ4 A;  2EMT A;  1SHC A;  3WYF B;  3N7C A;  5J3Y A;  4BBK A;  2YS5 A;  1PFJ A;  5HE1 A;  2Y7B A;  4HAW B;  5HE3 A;  3PSC A;  2OQB A;  3AU4 A;  4B6H A;  3KY9 A;  5LOP B;  3QWM A;  1UEF A;  3QBV B;  3KZ1 A;  2ZPY A;  2V76 A;  1RRP B;  4ZRI A;  1WJM A;  2DHJ A;  2NMB A;  1DDW A;  2NZ8 B;  1NTV A;  3BJI A;  1U5G A;  1XOD A;  2J59 M;  2YF0 A;  3ODW A;  2J0J A;  1BWN A;  4GXB A;  3FM8 C;  2ADZ A;  3D8E A;  1U27 A;  1WG7 A;  2MDX A;  1BAK A;  2CY4 A;  2H7E A;  3PVL A;  5DHF B;  1OMW A;  2VSZ A;  2YS1 A;  2PZ1 A;  5C79 A;  4WVF B;  2MKR A;  4CHM A;  3ZVR A;  1WVH A;  2GJY A;  5KQ1 A;  2K2U A;  2DA0 A;  2DHK A;  1FHO A;  3BIN A;  1SGH A;  4K2O A;  3TCA A;  1XCG A;  4GPT B;  2ELB A;  1E5W A;  1ISN A;  2DN6 A;  2CRF A;  1IRS A;  1U5F A;  4CYE A;  2L2I A;  3SNH A;  3PZD A;  1MIZ B;  3FSS A;  2YT1 A;  2H7D A;  1WI1 A;  2KCJ A;  1TXD A;  4MT7 A;  2COC A;  1AQC A;  1FGZ A;  1U5E A;  1J0W A;  2MWN B;  3A8Q A;  2EJ8 A;  1Y19 B;  5FI0 A;  1Y5O A;  5KCV A;  2DYN A;  2DYQ A;  3F0W A;  3PP2 A;  1NU2 A;  2RSG A;  2Z0P A;  5D3W A;  1P5T A;  4NSW A;  1I7A A;  4HAY B;  2DX5 A;  4ZRJ A;  1B55 A;  4EJN A;  4PQ0 A;  1FHX A;  4IFS A;  4MK0 A;  1M7R A;  3F5R A;  2DHI A;  5C5B A;  4TYZ A;  4DX8 A;  2D2Q A;  1WJ1 A;  1MPH A;  3MPX A;  1X1G A;  2I5C A;  1FOE A;  1TQZ A;  1KZG A;  1DDV A;  2IFS A;  4KVG B;  3ODX A;  2UZR A;  3ODO A;  5D3X A;  3GYP A;  1K5D B;  2COD A;  2YRY A;  1UNQ A;  4H8S A;  2G35 A;  3G9W A;  1UNR A;  3T06 A;  2D10 A;  1DRO A;  4HB0 B;  2LOZ A;  2I5F A;  1WGQ A;  2D9Y A;  1K5G B;  2MFQ A;  1V61 A;  4XWX A;  5EFX A;  1EAZ A;  1P6S A;  4HHV A;  5C16 A;  2GS0 A;  5D3V A;  1X1F A;  5GOW B;  2EMS A;  1OY2 A;  4L6E A;  1OQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...