3D8MA

Crystal structure of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
b'TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein, Receptor binding protein
molecule tags Virus/viral protein
source organism Lactococcus phage tp901-1
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages
pubmed doi rcsb
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d8mA02
2BSEA 1ZRUA 3DA0A 3D8MA 4HEPA 3EJCA 2X53A 2F0CA 3U6XA 2WZPA 3HG0A 4IOSA 2BSDA 4HEMA
chains in the Genus database with same CATH superfamily
3LKOB 5GGTA 5F6HJ 4M1DL 1WK0A 4YDLC 2NYKA 3QWNA 1I8MA 4XO9A 1BBJB 1MW3A 3IXTB 5D5MA 2V3EA 5IOPA 3BISA 1Z66A 4Z7OB 1UGKA 5DZJA 2WN2A 4FDWA 1RQ5A 4G8GA 1IGTB 1BZEA 1HSAA 2V6HA 2OXGA 2DBLH 2CSPA 1F3JB 2FO8A 3D0VA 3GSXA 3Q0HA 5IVXB 1CTNA 1X9QA 1TF4A 1XD1A 3WKQA 3AZUA 2FB4H 4NHCL 4FX5A 1MQKH 2JE8A 1RLBA 3FT2A 1T5XB 3KH4A 4XP5L 5JQIB 3IPFA 2NY5H 3OJ2C 4MRBA 2XFXA 1Q72H 2WXGA 3ESMA 3NACL 4JRWA 4WO0A 4PM1A 3CMOH 3IDMA 1G7JB 3H2QA 3DMMD 1QW8A 3QNZB 2OXGB 1Q8MA 2YN3A 5ADPL 5LWYL 4ISVB 2WLYA 4M5ZH 4HLEA 3B2UD 4MXVF 2IBBA 4QHKI 4X7FC 2W65B 4P2AA 4CN6A 3GMOB 3DO4A 4U2ZA 3T4AA 1F58H 2I24N 2HVKA 2IFGA 3KYMB 4FNLL 3F64A 1CDGA 3QDJE 5HDQH 5FV2A 3SN6N 2YPVH 4DP0X 1Z9OA 5DSCA 5DZLA 3VFMA 2CUIA 3ARXA 1JGLL 2XACC 2YFOA 5HSFA 2GIXA 5C0EA 3Q05A 4LBAA 4PRIB 1QEWA 1BJ1H 2OI9B 2RJMA 5E24E 4FAAB 2CHXA 3VI4B 1QTSA 4F37K 4FMFA 4JFDD 4L8BB 2YQGA 4XP4H 3SQOL 2WIIA 3DRTB 1NEZG 3MRFA 4L1TA 1SYVA 1BFVL 4QHKJ 3TWCL 3P2BA 1JIBA 2NQDA 4OD1H 3LNEA 4LLYA 5I1KL 2Z6FA 4YHIB 2YQ2A 5BUAA 3T09A 2DBJA 3SGEI 2WNGA 1M1XB 2DIAA 3K2UL 2KT6A 2CMRH 4G43B 1DJXA 5DYOA 1M1XA 3CVHA 3WNPA 1QHQA 3C5SB 4TVUA 1KEMH 4G6FB 5CZVH 4IGBB 5EZOL 2YGQA 1XAUA 4CVXA 4U1SA 5AENA 1IM9D 1EXUA 1KCVL 1JDCA 2JCCF 3QIWD 1LK3H 1SYVB 4HKXB 3GBML 5C6TH 3ZKQD 5I8EB 4BSVB 2OMZA 1KEGH 3NRPA 3ZPDA 1AGEB 3K72B 3G6DH 5AW6B 1BBDH 4CC4C 1BVNP 5EZLA 5LB1A 3LKNA 2F19L 4CA4A 2FHFA 1T0MB 3MRBA 5F7HA 4E68A 1MFUA 5IF0A 1ASOA 4LHUB 4ORGB 2IOMA 3TONA 1E65A 4OIBA 4P5TA 5ANMB 4YEEA 5LN8A 1V8HA 3FB5B 2V8MA 3LHPH 4N3UA 1XCXA 4P5KB 5DEJA 3KMDA 1JZ5A 1JNLH 3P54A 3QQXA 3O9WD 5LO7A 1GGUA 2PYEA 3TPUB 2EILB 5A1AA 2Z4QB 3FTGA 1CD1B 3O45B 4UOZA 5FB8B 1ZDQA 3PY9A 3AQZA 5T5FL 1XGYH 5DO2D 3RGVD 1DDHB 4X6DB 5JOPE 5I8CB 1G5AA 3VXRD 2XDHA 3LXCA 4OLYL 5L4MA 1UG9A 4W9HC 5EBLA 5DQ9B 5K9KA 5FX3A 3LIZH 3RL1A 5H37G 3ZDYB 2GB2A 4M48H 4DKFH 4EN3D 4X6DF 3CXHJ 3DYPA 2WBJB 5T1JA 4JZOA 5KSBE 1CDYA 4HU8A 3DI2B 1JZDC 2MPVA 2XQYG 2R7EB 1BQUA 1VIWA 3JV4A 4P23C 5F9OL 3JV0A 2MHAB 4JHUA 3QUKB 4QOKD 3T0VA 1J1XL 4WDIA 5CJXA 2Q0ZX 4MJ4A 4XPBL 1PZ3A 1WITA 4M9OA 3TIEA 2Y23A 2FIKB 1PYWB 4AYBA 3VD5A 5EBLB 5K9KB 4HOZA 2IGFL 4QNPE 2BO0A 3WIFA 4AE1A 1CXIA 4N2AA 2BP0A 4F9LA 4H25B 1SXNA 5IROA 4NCC2 4QGTA 4QPEA 4R4ND 1XF3A 5I76B 1DQJB 4HJSA 2X6CA 5D96C 5EDXA 2IWKA 1IC7H 2A6JB 1DCEA 1UB6B 1U8MA 1WBXB 2XC8A 3AY2A 2AAVA 2AJVL 4PD4K 2A4EA 2I9TB 3CFBA 4ZAKC 4YMPA 2HLEB 4HJIA 3H7LA 3IJSA 5K59F 4J2XA 3EH1A 2JKJA 5IBLC 2A4ZA 1B0GB 1T6BX 2J4WH 2VR4A 3DXAD 4R4FH 4R8WH 2ZXDA 3K6FA 3AXIA 3TYFA 2AK4D 4M5TA 1CC3A 2BSTA 1FC1A 4XCNB 3DMMC 4ZOEA 4IMLA 1U9KA 2DD8H 1U8KA 4PJEF 4DAGH 2CA4A 5FUZL 2EDMA 1SHXA 3MLZH 3DV6B 4EEEA 4AL8L 4XHJC 2QPEB 4WI6A 3SKNB 4UM9B 2V5SA 2XFGB 3LPGA 3KR3H 3O3DA 4HUUB 4R2GD 4JFZL 2VR9A 4Z0BH 4BXSV 4NAMA 3VXMB 5D6DA 4WTXA 4HKBA 4PJ8D 3HS8A 4HUUA 4Y4HD 4UQ3B 3QFDB 3BWAB 1ETJA 2B4CH 3FB7A 1PKOA 2VN6A 4WW2A 4U1HA 4R97C 5EC2B 4PMEA 1QZNA 2P8PB 4DGIH 5JIHA 2DYSB 3V5DB 1QRNA 1WQVT 2YRLA 4F9PA 4YFEA 5IJVB 4BFFA 3MJ8A 3QG6A 4L1BA 1BBDL 3AWEA 1GSMA 3HTLX 2AEIT 4UM9A 5ESQA 5DDHA 4Z3IA 5J89A 4IGBA 1SDDA 2NOYA 3FO2B 4FA6A 1TVHA 3IYLW 4Y2NA 2ZWNA 3GD1C 4F7EB 1RZGA 1R9FA 1TVHB 2VL5B 1E6OL 2KH2B 1OK0A 4BZ2A 2OSLA 3WE6B 5JXAH 2XBTA 4ANXA 3RYMA 4XCYB 1I8KB 3UTSE 2QGDA 5AQ0A 2Q7YB 2J6EL 1SYSB 1IGMH 4LLAA 4TF4A 3TO4B 1AE6H 3VRJA 1EAOA 3UC0L 1JGIA 4Y16D 3NH7H 3HNTL 3LRSA 3QUML 3X1GA 4F92B 2GJ6E 4Z3JA 1F8TH 1SLVA 1C5DB 2FX7L 4FKEA 3TJPA 4YC2B 3GBLA 3MRNA 4XNXL 4D8OA 12E8L 4PV9A 2WWOA 43C9B 3B9EA 2XN0A 4MNGA 2R0ZL 3V4PL 3W38A 1AHWB 4NRZA 1F6LL 4MJ6A 1CICB 4L3AA 1BMZA 1NGQL 1S7TA 2V5TA 4IRSD 1JGDB 4J12A 5I6XB 1T66C 4L0PB 4NN5B 1SEQL 2Y3AA 1SN0A 4YR6B 5FYJU 3NESA 1BFTA 1CLZL 1XF4B 5I0VA 4N0UB 1TJIH 5DC4B 1WTGT 5KTEH 5AVZB 1LEIA 2RALA 4IDJH 1MFEH 1IAIM 1KJMA 3MRJB 4PV1C 3HN3A 5T3XE 4UI2A 1CXLA 1CI5A 5CMAB 1URIA 2R29H 4X6DE 4DEWA 4KVNH 5E00A 5I1JH 4QT5B 1IC7L 4ZUTA 4OTXH 2UXGA 3GEWB 2YEZA 3Q6FB 4ELMB 4MYWB 2YGVA 1RUMH 3RJOA 5HHPA 2W0LA 3HRZA 1ECZA 5D7JD 4Z5RB 4AH2B 1T80A 2X4TB 2X3CA 3O3BB 4JR9H 4LSPL 4OCXH 4ORZC 5MHSD 1S7UB 4NBYB 1KENH 4XN2A 3PWVB 4XRCB 1ZSHA 2NY1D 2BDNH 1C5CH 1PS3A 4HALA 1W0VB 4XPGL 3X13A 2B7DT 4C58B 4ZI8A 3QORC 4Z78A 3FO9B 1EHLL 1IBFA 5E5LA 2ZG3A 3C60D 4WUUB 4ATWA 2RQEA 3O6KH 3QQ9C 1DBML 2N4IA 4G8FB 4UM8A 3QQDB 3PHSA 3SPHA 3FTXA 4JVPA 5J11C 4X83A 4UIKH 3EYQD 3U0PB 4J4PD 3HFFA 4G8FA 5GRJH 1QD0A 5IHZB 1B4LA 1MHCA 3ARDB 2P5WD 1QASA 4FABL 4JDEA 3T6QC 5I1HH 1ZA6B 4TXVB 4NUPA 1OVZA 3FFCD 1N68A 3P9LB 3RZCA 3ARDA 1CPUA 1OW0C 2B77A 1YMMB 1X5ZA 2X1WL 4OIIL 5CZXD 3TVMD 1COBA 4F7CB 3R19A 1NCDL 1SOKA 2IAMB 3ESVF 1R3IH 3KPMB 1XR8A 3H0TA 4QXGL 4XAKD 3DV4A 3GJFH 4DVBB 3O3EA 4PJ9C 5T5NF 5CINH 1QRND 2YPKB 4I0PB 5FHAL 1FPTL 3POHA 2VC2H 1BHGA 1A0QH 2HRLA 2IIJA 2OXHA 3FRUB 3PGDB 3L5WB 1QRNB 4BZYA 4TPRH 2IBZY 4XHJD 1H8OA 3P9LA 3RZCB 3ORJA 3QIUB 2DBLL 4MNQD 3GXNA 1E6JL 5D7SL 2BOBA 5JR1L 3ZHDA 4L48A 3RDTA 1HVXA 3ZE0B 3ATBA 2FJHA 3FAWA 5J6HB 2Z31D 3MA7B 3D3VE 4Z7VF 5J7CC 1E5YA 2GSMB 2NRDA 5I0YA 2FJHB 5LVEA 1FCCA 4JZNA 2FL5B 1JWMA 5ICYB 2RFXB 3CIAA 1B0RA 5DJCB 3O3EB 3HFMH 5F3BB 5GGUA 4TSAL 5MEQA 1G7MA 5E8EA 4YSQA 3WJLC 1ZS8B 3EUUA 5KVFL 2I7SA 3L9RA 3WO3B 2JQAA 3V9EA 2ZWYA 4A7VA 4AQ1C 4PJXA 4UM9D 1K4DB 3UAEA 3TH3T 3WKML 5B38G 2ZWSA 2DW5A 3GK8L 2Q1EA 3RDTB 2OP4L 4I0CC 4KXAA 5E5RB 3FQRA 3V7MA 3S2AA 3ZMNA 3HMXA 4XCFH 4NO2B 1B6DA 1AZBA 1ZA3B 3I6GA 1A7BA 1I7TB 1TZGH 3THML 4IBLT 3MJGX 1S5HB 1U8CA 2MNWA 4LPWA 2I69A 4G3YH 5I74C 4U4IA 3EH5B 1A14L 5D1XC 4MAUH 2NY7H 4EI6A 4RGND 1T5WA 4YN3A 2CK0L 2FIRT 1QLRA 3MRMA 3SE6A 2P7TB 5K1VA 4MJIA 1ZVYA 4MNQA 3T3PF 4X42A 2WM0A 2EE2A 5SWZA 1ZRUA 4OW6A 1EAJA 4S1DD 3P4MA 4YXHL 4JZJA 2YBGA 4H8WC 3OWRA 4NP4L 1NEPA 5HI5D 3V0IA 5SX5K 4S1SH 3IPEA 4KXBA 1IQWL 2IBZX 2DWSA 2DWDB 5F0PB 2WJ5A 3HRZB 4BYHA 2F6AA 5I1LA 3IE4A 1GGBH 1T83C 2VAAB 3H9SD 2ZXEB 3ULVH 4MJIB 2CA3A 5ILTH 2DJSA 1CJYA 3K2UH 2J56A 2NY3B 4RX4A 2CBTA 2ERJC 1Q9OB 4G9DB 1D6VL 3JZ7A 3TIDA 4DKTA 1QPXA 3G6AB 3G9VA 3FSWA 4X6EA 5C09B 1NC4A 4ZXBB 3CZFB 5IW6B 2FBOJ 3VI4F 2GC4C 2R56H 4HVBA 2MCPL 5AW1B 3T0BA 2OTUA 1SJEB 3B8SA 3OHMB 4LCWD 1BF8A 3ECBA 1UKSA 4N0YL 4ZO6A 1MH5A 3BT0A 4ZJ9A 2G4GA 5MI0B 1FVCB 1EH9A 4Z3TA 5CEZE 4G9FE 4KK9C 2CDGA 4F80A 2DWTA 2Z7WA 2G3ZA 5SX5H 3BKCL 4G5AA 4WFGE 3BEWB 1HSBB 3RG1C 3V8OA 2V0AA 1GZQB 4QRPA 3PV6B 3ZUNC 3KPOB 1XIWA 4Z23A 4HK0B 4OZHF 2APSA 4XO5A 3CZEA 3ZDWA 4OLVL 2WLLB 4QKTA 1XTLA 3INUH 3I3EA 1Z5HA 2Z8RA 2VLJE 3BH4A 2EVGA 3N1FC 3AU0A 1OPOA 3F62A 2NSXA 5IK3A 3SE4A 3U7WH 1SMDA 4RAVB 5D7JA 3V4PH 3CVDA 3CDZA 4KK8C 3G5VA 3VTAA 2B5IB 3X11A 5F0MB 4AV4A 5KBNC 4N2MA 5IVNA 5HTSA 2YGNA 3L3JB 5JDSB 3PP4H 1UVQB 4EJ1C 1C8QA 3F7PC 1TLMA 2NYZA 4FQPA 4LDOB 4GMTL 3RNQB 2AC0A 4Y1AB 4LIQL 2G30A 2Q9OA 2OXHB 2PF6A 1FF5A 1MFMA 4JUSA 3H3BC 3IU4L 1ETA1 5IBLD 1FYHB 3BLBA 2QDVA 1SJMA 2GFBA 3ETTA 1KYFA 2YOCA 3Q01A 3QULB 4PWEA 5DQJB 5B39G 4IGBC 3RB5A 4FNTA 3BHBB 1WLHA 3PP3H 2WAQA 2OMBA 4KK6D 3T04D 1E5ZA 3BZFB 1P1ZA 3G08B 1F18A 4IRSA 2YC1B 2PTUA 2VJ0A 2R69L 5E7BA 2O72A 3JWOH 2JKLA 4ISVA 1YECL 1KPUA 3HZYB 3UO1H 2HWZL 5T1MB 1IGFH 4LPUA 1J9QA 2DQCH 1LNUB 3N2JA 4LPTA 1KJ2L 4JFUA 2DYPB 3RILA 3TA3D 4U31A 2K6ZA 5IQ7L 5I2IA 2NY0D 5DLMH 3BZ5A 5D6DC 3Q5YA 2MNJB 1AXTL 1Z9MA 3R1GL 1MCEA 1DDTA 2K9UA 2GIYA 3HI1A 2E7DA 4TOYL 3KNBB 1BXAA 4BQCA 1NGYB 3L9YA 1S9VA 5F97E 4P2RB 1JL8A 4LLMB 5CP7B 4U1LA 4J8QA 2OZNA 2XIDA 5CWSB 1WBZB 2UZPA 4QHNB 5AKTA 3LRKA 1IEHA 1II4E 2DJ4A 1JXKA 4LLVB 1ZLEA 2A2QT 2XV0A 2H7WA 2W5PA 4LFHD 4DCQA 2IDCA 2IH1B 1B2WL 1MHEB 3QUHA 1DQML 4XXWC 3RVTC 4AQ1A 1R5WA 4K23L 2R0WL 1OOWA 3VA6A 1QHOA 1HS6A 2AW2A 3L6FB 3QXWA 3SBRA 2MEJB 2HVJB 3NPZB 4NJ9L 2NZ9C 1H3UA 5EORH 5L88L 2RACA 2WBWB 3CHPA 1B9KA 1EO8L 3KL5A 4X8GA 1X9RA 2VDQH 2VJXA 4YOKA 3WBDA 4HJGA 1WRFA 5KZCB 4MBOA 4F9LC 2C7UB 4XNMB 5I0ZA 2CRIA 4MLIA 3MV8A 2ZXAA 4P05A 5FKPB 4HCRA 1OAKH 5GSRB 3L2MA 2QHRH 3B3IA 3BPLC 3FUFA 5LLIC 5ERWA 1HHGB 2H6UA 4NN7C 2NT0A 2GJ6B 2P9RA 1YUHA 1RMFL 2VW6A 3NT0A 4G43A 4PJAB 3MXWH 1F6AB 4OLVH 1FGNH 3BPNC 4PYGA 2QGCA 1V54B 3OAYK 2CIIA 4OBSA 2K3TA 4B27A 3UAJC 4KV5E 2CNZA 2ZXQA 4ODWB 3GB7A 1GGCH 3BVWA 3GEFA 2B1HH 1XB3A 2WO4A 4DGUA 1BQLL 5DK2B 1ZTXL 1NCNA 1ZE3H 4YDZA 1ZIAA 2EADA 2WO2B 4JY6B 4X4KA 3VW3H 4LLYB 4MCYB 2A38A 3TTYA 2NY5L 1KY7A 1W15A 3WXWH 4JFEE 2YXVA 1SHWA 3ET9F 1NGWB 1SN2A 2H6PB 3KBPA 3LS5L 4G7YH 4NSKB 4XPHL 2WKLA 3JVGC 5ICZB 5CCHE 3OGCA 4HCIA 1YPZF 4UZSA 1K85A 43CAB 3ML9A 1MVYA 3CFIC 3QORA 1QRNE 3FQ2A 5K39A 2X9WA 1P7HL 5IWLA 2EDWA 4HXAL 4K5LA 1AZRA 1SM3H 3EUDA 5KYYA 5HDRA 3BLKA 3L3OA 1ID2A 4JVUA 4F8TA 4P46D 4Q6IB 3KPNA 4EKJA 2WBKA 4ZMYA 5GSVB 3QULA 4ALAC 5AYUL 1MDTA 2WBJA 1DVFA 3GS4A 4HPYH 1E4XI 4GNKB 3IAPA 5IQ7H 4X6CB 5KYNA 4EN3A 1G7JA 2OZ4H 5CILL 5FGCE 3R18A 4AKOA 5C2UB 4X6CA 4ANKA 4Q4EA 1DVTA 5CJ5A 1IGTA 4PY7A 1H5BB 1T4KB 3JUYA 5I16A 3SY0A 4FEMA 2P8LB 3O6FB 5KYUA 1K6QH 2FWUA 1DSFL 2PYFB 3UFIA 5D1ZA 2VDLB 5C0DA 4FADA 3ATAA 1QX1A 3HLAB 2Q5BA 2VDRB 4BE5A 1F4WH 2BNUB 2K6YA 4FQQA 1RPQA 4L0ZA 1KENL 1CGXA 1DVFB 3D08A 1XCWA 2V9TA 3RU8H 5AB9A 3JYBA 3ZTJH 3HI1B 3BUPA 3MLSH 4FCHA 3G6JF 4X0NA 2HFGL 1OQOA 4UNTA 5BOPA 1MUJB 3BZEB 3AS3A 5C8JB 3X3FL 1DJWA 3BAEL 2Z31C 4P59L 1MQ8A 2H2SC 2VXVH 4PFEA 1JJUA 3EYSL 4FNRA 4PJEA 3VFGL 4C56E 2C26A 4L29A 1MRFH 2Q20A 2P47B 2KMWA 4NO0D 1P7QB 4YL4A 5F88B 5E99L 2BSRA 2GT9A 1A7OL 3CPUA 3E0GA 4HUWB 3Q43A 5DD6A 1KGJA 3U7WL 5A2JH 4TVPD 1CD0A 5H4YA 3CVHH 3OKDA 5CLTA 4OLZH 4AKPA 3O8XA 2FD6H 1CR9H 1XF3B 3QIWB 2HVJA 3B4NA 1MWAH 3GPEA 4FXGC 3B2MA 1MY5A 5K93A 5F71A 2RTTA 3ZL4L 4EO5A 1DN2A 5IQ9B 5GJSH 3HUJF 1JZ6A 5EG6C 4Z8FH 4QAWA 4M1GH 4V1DA 4UT7L 4ZTPL 1GGYA 3HC4L 3TA3B 4JFXB 3BUYB 4YHOH 3MYJB 3KGUA 2LAGB 3CBRA 3BP5A 3OMNB 3KXFA 3ZKXC 4DK3A 2IPTL 2NUPB 1F11A 1O9WA 3ZDXB 1EZSA 5BRZA 2VKXA 2R83A 4XGZB 2BS71 1DANU 3IFNH 3L4XA 4A67A 3CPLA 3QNYA 3NG5A 3UL4A 4M93C 4JRYB 5KVDL 1TFHA 1OT2A 3V95A 1KXHA 3PS6A 1KGUA 2DQUL 5JW4Q 1OB1A 4JFXA 4BFIB 4IQHA 4UDTB 5LCVL 4O58H 3GXFA 3ZGIA 5DVOA 4DF9A 2JV6A 2Z4QA 3DPBA 3FTGB 4S0SD 2CKNA 2J55A 3TBVA 4GP8B 4PI0A 3K80A 4G7VL 4OZIB 1XF2B 5ICXA 4A2LA 4U1MB 4JN1L 3TVMA 3VXOB 2BSBA 1AD9B 4WENB 4QOKB 2OJZH 3D69A 1O6TA 2J8UA 3KM2A 3PREA 5C0CB 2F58H 4NBZB 5AVSB 1HXKA 4KHTH 3AREC 4MKTA 5AW2B 4EVNB 2Z91B 3TWYA 3ARFA 3OGCB 3H3PL 3F7YA 4BSJA 1TZGL 3HS0A 4X4XA 4XZ4A 1HE7A 3NACH 1E9QB 5CCKL 5TH2B 4A6YA 4APQC 2RBLA 4WTWA 2B16A 3MJ7B 4RFEA 1DBJL 3VFRB 1K6QL 3S3SA 4YXLH 3SD5A 1UWEL 1JBJA 1YDPB 4F8NA 2YMOA 3SDDA 1YSOA 4MDIB 3RNKB 1N6VA 1OTSC 2V7NA 3CSBA 5E4AA 3HPLB 2DMBA 5GS2D 1UZ8A 3W9EB 2EH8H 1JXGA 4AZ8B 4QRTA 5A40E 4YK4B 2AEQH 4BZ2H 1KY6A 2IALB 3WL9A 4L9LB 3HS0B 5I8KH 5FM5M 4I89A 3PWVA 4PW4A 1N7ML 2XQBL 2AP2A 3QSKB 3B43A 4GSUA 2YBRA 3TH2T 1TYRA 4NQCB 1LQBC 3HS0C 2CBMA 4L9LC 3DX2A 5EO1A 4WF7A 4BINA 4Q9BA 4P46B 1SXBA 1FDLH 4YR6A 2GEQA 5KG9A 4Y8AA 3LTVA 5B38A 2R1YA 2ID5A 3EJYC 2Y4SA 2JK5A 2DQJH 3Q9PA 3BAJA 3FK3A 3OSKA 1MFDH 1X7QB 1GVIA 3BCDA 3CVIH 3Q8FA 4YSPA 3ZL2A 1ZHBB 3SKNA 3OAZH 5GS0C 4HWBL 1J8HD 4Z7VB 4PVNA 4I3GA 2XCMC 4P99A 4S0TD 1IO4C 3G6JE 2IPKA 2R1WB 3MBED 2NMSA 4P5TC 4X5WA 3GKZA 1TEYA 2FLRT 3HZVB 2YN5A 2PNDA 2NXZD 4OLXL 4TLSA 4RMTA 1NWPA 3B56A 3D0LA 3HVDA 3MRGB 4XE0A 1YEWA 3DTUB 3IRCA 4FULA 2H2SD 3DOSB 1PSKL 3X1EA 2AQTA 5DD3H 1WBYB 4NQEE 3V0FA 3D48R 3H9HA 2H2PD 2VCOA 1QSFB 3FCGA 4F57H 2QVIA 3WDJA 1W2KT 3OPUA 2F74A 3RIFF 2C3WA 5D8JL 2EDDA 2IMMA 4NCDA 8FABA 1F2XK 3FBQA 3EJUA 4OZ4B 3EZJB 3BAXA 2HTLC 4LARL 4F7TA 4HBCH 3QR1A 5BOJA 5JXED 4UDUB 1PW3A 5KANG 4E5XG 1T0NA 3LHPL 4F2MB 2W9EH 1RLWA 3GDBA 3QDAA 2EYSB 3DGGA 4X80H 4LHUG 4G6FD 2NX5D 3MREA 5HGGS 2YOAA 1BG1A 3MCKA 3TBTA 2VOTA 4XAWL 4M00A 4JDEB 2X89D 1BM7A 4FFVC 5T1LA 1AR2A 5C0CD 4MLSA 4M5ZL 4IBZA 3S34L 3HE7D 3DHUA 4J3SA 4YWGH 2IGTA 2KDGA 2WUCH 4GI6A 4WW1A 3ULSA 2AVFA 3UO1L 2I60L 2NYYD 3DK2A 1U8LB 43C9A 3CD4A 4LAQL 4UDUA 2ZE0A 4YGVA 4QXWA 5IGXL 4UQBA 1R3HA 2XNAB 4RFNC 5GGUB 4L4TE 2B2XH 4KVNL 1KG0B 4JHAL 2H9GB 1U3NA 3BW9B 4K3HA 2ARJQ 1R17A 1T1WB 2WLHA 4PJDE 2MMXA 2IXQA 2VLRA 2WXOA 3CX5K 2Q8AH 2X9XA 4ADIA 4L4JA 1KUMA 3I9AA 1IBHA 1UADC 1J5IA 2EDEA 2XWCA 4QRAA 3QWRD 4GKSA 1F3RB 4FFTA 1A6WH 1RP8A 2H32B 4PQXA 3O8XD 4WHYH 3AQXA 1L6PA 5EU5A 3CIQA 4DW2L 4WFED 4XP4L 4A6YB 2BWIA 5KAQG 2XZCH 3GTVA 4Z1PA 2B4CL 4JO1H 2RD0A 3MV9D 4KC3B 5F7EH 2ICWB 5KJRH 4N0CD 1DEEB 3FUDA 2DLHA 2J25A 2GABA 4TSCL 4JN2A 4Z7NB 1TCRB 2FD6L 1GTNA 2QZ5A 3ES6B 2E7CA 2AJYH 4QLWA 1M7XA 3WIIL 2I5YH 1ULVA 3DECA 5ICUA 5MP6H 1G4RA 3QXTA 2N56A 5C6PB 3ARED 3QIBD 2BERA 5FOBB 1DVFC 1E4XL 4OZIF 2P5WA 1INQB 1ORQA 2BY0A 4JO2H 4CC1A 1ESOA 3EXLA 2FGZA 4G6KL 1A25A 1IBGL 1VENA 2W88A 3OQRA 2Y5TB 2P5WB 2OSWA 4V2BA 1Z6JT 3GIZH 1ACCA 4FFYA 2BNRD 4D9RD 4J3OH 1AR1B 3FQNA 3MUUA 1NA8A 3OG6B 3ABZA 1AOZA 2F53E 3IFNL 1X4YA 4YPJA 4TSBL 4Y1SA 3QUYD 5IKCB 1MCWM 32C2A 4GKZB 3SGKA 3VXPA 3L16A 5IT2L 4OVUA 3HE6C 2E6QA 4WWID 1YO4A 4CBPA 5GZNC 1OGAB 2JF1A 2X6UA 3P3UA 3BEWA 4CMMA 4LKCA 1C12A 3MLUH 1FGNL 4RRPG 2BCMA 3U4BL 2K6WA 4NENB 3JQOB 3QJHB 2YJQA 3W39B 4EPSA 3US1A 5EUOF 4GINA 1TKWB 1J9SA 1QR1B 1XXDC 2K8MA 2MNUA 3L08A 1HH6A 1OLLA 2FAUA 1ZD6A 1P4BL 2XWZA 1BM3L 2D3NA 4XNUH 4LRNH 5FK9B 4RAVA 5D7JB 5PCYA 5DJZB 4X5WB 1JK9B 4GBXC 1HJBC 4BZ1H 2ADYA 2YMXL 2CLZA 4QRRA 4MMXA 1W72A 3TCXA 1KTLA 3QC6X 3QYMA 2ZKWA 3LXBA 3D39E 2LTQC 3JSSA 4H1LB 2NY4C 1WS8A 3VX1A 1NGXB 3I02B 4G9FD 4GSDL 3F5WA 2D7QA 2ATPB 1SF5A 1ZSDB 1JPGA 1NOFA 2O61A 3VB9A 1Q94B 5DLLA 4PJ5E 4BFOA 1R5IB 4RDQG 3N9GL 5KVGH 1JV5B 3FO1A 4BFEA 3FCTA 4EZMA 1HT6A 3C6SA 4Q14A 2JIXB 3EH2A 1Q94A 3HUJA 4HGMA 4WJG3 4K94H 4L8DA 3WS6C 4AL8C 1HH9A 1YYMH 1JWMB 2EICA 4PPTA 4FQJH 1SDYA 2AQ3A 2BVTA 5JORA 3RY4A 3NSFA 1AGFA 4JM2D 4JMNA 4HEPG 4AGOA 4MA1C 4ZTEA 1D9KD 1FAIH 1UH4A 4GUPB 1KIUA 1U41A 1RIVL 2UXVA 3BH8A 3OGOE 1GMEA 2DH2A 4O2EA 2UY6A 3GJFK 5KSAC 2GI0A 4FCAA 4XXWA 2IC2A 4EUPH 5F1KC 4NHUA 5DI8A 1G9MH 5IK3B 2VLLB 2Z3FA 3QI9C 1XSJA 3PNWA 4TTDC 2GI7A 4U6VH 1PZDA 5DFVD 1JNNL 3KNBA 1JNHA 5I18L 1A6ZB 4M7KH 3U4EA 2JJTA 4DN4H 4Z7NE 3ZQWA 5IVXE 1BZQK 1LE5B 4BSWA 2X4NA 4AMKL 1OAYL 4PGBB 4N2IA 4PSRA 3W37A 3VU2A 3IVKA 1TZHB 1LE5A 1QABA 5E8EB 2YUZA 2HFGH 3T4YA 2HXAA 5CJQH 1GKEA 5ITBL 1DBJH 4TQ8A 5L2KD 4BELD 1T7ZA 4H26A 1Z9NA 2C1OA 1P2CB 1FIGL 4R3SB 5EU5B 2XV6B 3EYSH 1MCNA 3MLYH 4XNZC 1NSNL 1KN2H 1NIAA 3GMRA 2DLFL 4ODVH 2CJUL 3HE7A 1RUPH 4JMXA 4PGJA 5C0NC 3FSOA 1A64A 1E5AA 1MG2C 2HUEA 2X1OA 2YD7A 2XYCA 1IC4H 3LNIA 4LDEB 4PLNC 5IR1A 2X89A 4UQAA 1RVFH 1EVTC 3A21A 4AKQA 1AKJB 2P80D 1N3NB 3U83A 1ZVHA 2C7UA 2VRQA 4XNMA 4O02B 4NM4H 5HY9B 1UTDA 2WXMA 4MCMA 4HWZB 4RGNB 5EZIL 4UIMB 1P6WA 4Z7UB 3NVQA 1RUKH 5AAWA 3AS0A 3U2JA 1DBMH 2AQNA 4HLJA 3DGCR 4Z8FL 2PN5A 5JO5B 4FP8H 5DJXB 4WU5A 1NMBH 3GSNB 3KPQB 1AGBB 1JPSH 3BGFC 2AJ3A 1ZHNB 3EHBC 4JW3A 4K4KA 4NN6B 4BH7A 4E9SA 1B3IA 1X44A 4H2AA 5F1IA 4CMHC 5JQ6H 4OV5B 4PJBE 2G60H 1T04A 3VG0H 4AZUA 5TF0A 3A22A 4A2FA 3QXAA 4LEXH 2YRZA 4IIQB 4UAOC 1KWKA 2SEBB 2UZXA 3U48A 1MLCA 5T5FA 3GKWH 1IAMA 1HHHB 2NY1B 4ONGL 5EOQH 3L17A 4FXKB 4PJAF 5MENA 3LPWA 3EOAB 3WNKA 1FL3B 3GXTA 2VWEE 3PV6A 4MMYA 2I07A 2GQHA 3HB3D 3SYPA 3TPKA 3WS3B 2I07B 1LL1A 1CFSB 4JKLA 1G7IA 2DN7A 1EXGA 1F4XH 1WA1X 2V9UA 4WV1A 4YSUA 4E41A 3THMH 1JRHH 1HZKA 4I85A 3F12B 4AI7A 4PRPA 5L4JA 1PG7X 3BP7A 3Q1SH 2H3XC 3NSCA 4N90D 3GI8L 4IYKA 3RWDB 4H8VA 4G7VH 3KYOA 4NKMA 4ABWA 1EXUB 1KXVC 1NAML 2VRKA 4HKXA 1O7VA 43CAA 1V27A 4Y5YC 1NLBH 1FAKT 4MMXB 5D6CA 3EYQC 2CO3A 2IWGA 2WB7A 2JJVA 1AGEA 2WTRA 1NCGA 1ZOXA 1RFDH 1XVSA 3RHWK 2FCBA 5KSBF 1JYXA 1AQKL 3J2PA 1EANA 5F9WC 3M7FB 2H1XA 1RURL 3DK0A 5F7EL 2CKBL 3UGXA 4A2EA 4BV1A 1PKQE 3PGCA 2DQHL 2CLRB 2DEXX 3V6OE 1T89C 3WTYA 2DI8A 3D51A 3IDXH 2TRYA 5L2JB 3QBTB 3AFLA 3RP1A 2QPUA 2IANE 4QXVA 5FYLH 1X4ZA 4JZJC 3KYKL 1OE2A 3K8LA 3MBEC 1A1NA 2DQIH 3SDDD 3JTSB 5TFSL 1VGEH 2PXYC 2ERJB 2ZXWB 3LRHA 5LGJA 5DD5L 5DQ9A 3D18A 1AO7E 1ZXKA 4JPVL 4ZFZA 4C47A 3STBA 5KSUB 4DP4X 3ZHFA 4W9FC 3LKOA 1JOIA 2PLTA 3RTQC 4DZ8B 3VD3A 4FZ8H 4ELMF 3M88A 1UXSA 3KW7A 3NJIA 3QEGL 2VC2B 4JJ5A 4NZJA 4K5MA 4ADGA 3UABA 5I16B 3IF1B 5HGHA 2Q7NA 1E40A 3D12B 3VXTB 3A6BL 3EF7A 4OZFA 3C6LB 5SWQA 1J05A 2X0UA 3DVIA 4H8WH 5F6IC 4BWTA 4G6MH 4ZT1A 1G6VK 3VXSA 3DYMA 1T5XA 2FBJL 5JXEC 1RIUL 1M7IA 5JHAA 2KPNA 1HE8A 3V0VB 4OF5A 2EC9T 3PJNA 2R2EB 1CLOL 2GVYA 1R34A 3ILEA 2MPAH 3CX5J 4HKJB 3LNFA 1LO2H 2XBDA 3AAZA 3KPSA 3STLA 3A6CL 4OLWH 1NGYA 2YSSB 4KZEH 1WVZA 3EOTH 3OR6A 2FX9H 5AOLA 2WC7A 4M6NL 1MFCH 2L7QA 2XWTA 3TBWB 2BZCA 2YSSA 1L3WA 2AJZB 4GO8A 5E4EB 1DQDL 3PJSA 1YNLH 5FFGA 2ZOUA 4Z7OF 2IDQA 4M3JA 1CG9A 5HXMA 5HDBB 1SQ2N 5D2LA 2FECI 3RDTC 3DVNA 4TLKA 1F41A 2NX5E 5TDOB 1QKZH 5EFIA 4DCQB 3ZRSA 1H3TA 3GI9H 3F7KA 4PGEB 3VXRE 1MF2L 1Y6KR 3CH1B 5E9DA 1OPGH 2VR3A 4IKKA 3PFUA 1V3KA 3QNYB 3FFDB 3Q8CA 3G5XB 4JQXC 4PGCB 4LIQE 4X2UA 4GRLD 1PQZA 3FYIB 2A6JA 1MSPA 2KPWA 1UCBH 2GSIB 4D3CH 1J12A 5IESL 2W9EL 2R4SH 4HXBH 3SOBH 3KYMA 2CKBA 1N19A 4PVMA 1PLCA 4U4BA 4CSZA 2HLAB 4Z3FA 2HMIC 4J23A 2EAEA 3RZCC 4LRNL 1U93A 3SDXE 1WCBA 1N5YH 2EKJA 2ZSVA 3RHWF 4H8QA 3EYFB 3ETBJ 4JO4L 2CPUA 5HGAA 1ACZA 4JFHE 4E9WA 5KVEL 1JYVA 2CU9A 4LLQB 4RZCB 3WFHB 4EIUA 4LP8A 3PHOB 4KRPB 4KHXH 5H94B 3ZE2F 4G3YL 1Z5LB 1XGRA 3K71A 4MAUL 4KJQC 1BZ7A 3ARWA 4P3DA 2OMYB 3NSYA 3ECVA 5ADPH 5LWYH 3HC3H 3ARGC 1KPRB 3C6LC 4LZKA 3ZL1A 4A7GA 3U82B 3QPQC 2NNAB 4AYGA 4LP4A 4U3SB 4K8RC 4Z7QF 4ACTA 3EGSA 3FFCA 3RTLA 1DVSA 3T77B 2X44D 4K5NA 3RTQB 4QRTB 1YNTF 2R7EA 3NZHH 2BP8A 3BDBA 1ACXA 2YAQA 1LDSA 1PIFA 4DP6X 1QQDA 1JWUB 1CWVA 2XG5B 5IMLA 3IEAA 1FHGA 1T2XA 2H3NB 3BAWA 1SMOA 2NNXA 4K15A 4XBEH 2QELA 3VFGH 2E7LC 1EZVY 1A7PL 4OJAA 3T0EE 1AKPA 2OW6A 1ZLUK 3KVDD 3NPSC 4ICWA 5J06A 2VUYA 4H8UA 3FRPG 3LDBB 6PCYA 4K07A 4IKNA 4OF7A 5BMFH 4N0UA 3X1FA 2VDMB 5E0QA 4CC0A 2J73A 3VD0A 4RAUA 3UTTA 1OZUA 2X4QB 4WWKB 1FZJB 2YA1A 4PRPD 2EKSA 5DD1L 3STZB 5JPMA 2CHWA 5DHYA 2EKSB 2UY7B 3DURB 5SWSA 2F7PA 4YNYA 3DIFB 1NINA 1U0QA 3TN0D 1AQ8A 4LXFA 4PJXF 5AKRA 5GGVL 3DURA 3BZ4B 1O9ZA 4HZLA 4ICXA 1UZ8B 1LO3H 3DXAE 4B0MB 1P4IH 3WIHL 4IBUA 4BCXA 3B5TA 3NN8B 4DUWA 1MHHA 2WQ8A 3GRBA 1MF2H 4FJ6A 4AY0A 3BGMB 5GIRB 1A6AA 1DFXA 1UM5L 2Z0UA 3V9CA 4EUPB 4ZK8A 5I76A 4OFYD 3UPRA 2NZ1A 1CVRA 3LQAC 4KX7A 2PUQT 3KPTA 1IM3B 4L1SA 5DWUH 3TXAA 4BZ1L 1RK0B 3HKZA 2ZNXA 3M45A 1NBZA 4NNPH 3QCUH 4XGZA 2YEZB 5FGCB 4PRBA 3HE6A 3P40A 3EO0B 4AC2A 2EC9U 2X4SA 35C8H 2PW2A 1L9QA 4GXFA 5AOZA 1MVUB 4AH2A 2HTKC 4DO5A 1JGEA 2EDTA 1YN7B 3RIAK 3IJHA 5DMYA 2PW2B 1VJSA 3LZQA 2PW1B 1MVUA 4CW1A 4EXPX 4XRCA 2JCCB 4FQCH 1IVLA 1I8LA 4HPHA 4Q9RH 1JD7A 4E0RB 3KYKH 3MXVL 1ZGLB 2H4EA 4R8WL 1KB9K 3FTVA 1A9VA 1U8NA 1JFHA 3FQYA 2W92A 1HQ4A 1NIDA 4M62H 2J8HA 4FTDA 1A5FH 3VJ6B 3HBQA 3KCWA 4PIBA 4KXCA 1WGOA 4W6XB 1Z9SB 4BQBA 4CW1B 2IXQB 3TZVC 4F15C 1DLFL 1FL6A 5HI4C 4LLQA 1ND0B 4QTHA 1MFBH 2KYIA 4C56A 3BO8A 1BD2E 3C5ZA 2CD0A 3DUSB 2EXTA 4XP1H 1FJ1B 5E2TL 3FCUB 1AXSA 1CIUA 3A3YB 5J3HC 4GUQA 4AMKH 3CDGA 5ACZB 4HUCA 1FFOB 1RIUH 4J28A 3VGDA 2IQ9L 1D2OA 1OSPH 3ZU8A 1IAOA 4OZHB 4JQXA 1MKFA 3H4HA 3IS0X 4MA8L 3N6YA 4N25A 5DHXB 5ACZA 1IL1B 2B1OA 3RVXD 2JCCE 1R1CA 2GUOB 3NIGB 4XP6L 3FT9A 4GRLB 3FB8A 3LEXB 3CFQA 3L1OL 3LRLA 4NJ9H 5CP3H 1DCLA 1NMAH 5KEZA 5EU6A 3N1QC 4ZMXA 1JGVH 2CIKB 3GUFA 1MWAB 3PQYB 3ZDZB 3MTRA 4L4VA 1PIGA 2C4FT 4CNIB 1AFVL 2DKSA 4WUKH 3NJKA 3HS9A 2KC0A 1MZZA 1IAII 5HJ3A 1XMWA 1UC6A 3VYPA 1XGZA 2A7BA 3AXLA 3GZKA 4YZFE 4AGLA 1RK1B 3N40P 4JPIB 5JXAL 1I3RB 1S5HA 2RCSH 1U8CB 1X5JA 3EADA 1I1AC 2FL5A 2IADA 3IK2A 3MKGA 4UILL 3S7GA 5I6LA 5I6PA 1N64H 5HHPB 1RCYA 1FA4A 4N8UA 2NPLX 2IEPA 3KBEA 1GY2A 4KKRA 4OUUB 1AGDB 2OSYA 5DRNB 5L8KB 1YEEL 3FOMB 3G5YA 1FYTB 4MA7L 3QQ4A 1YN6A 4RDQF 2NXZB 1JDDA 4KI5C 3EO1A 1CE1L 3NCFB 3ZO0A 1NGZB 2W9DL 1F6FB 3KL3A 5FWRA 4F33A 2Q10A 2CUMA 2Y07L 3GXIA 4TVPE 4W81A 3V2AR 2CO7A 1GGTA 4X6CE 4EI5D 2B15A 2VDNH 5E00B 4P06A 3BIBX 4EI5B 2CALA 4LARH 2BZDA 4L1HA 4DQAA 1DFBL 4NNPL 4YO0B 3ZRFC 2R29A 1JZ8A 2NLJA 2W60A 5GQBA 1PCSA 4FFWD 3WXWL 5DRXB 3GRWL 1XBDA 4Y7OC 2DQ6A 2XKNA 4OCRH 3OV6A 1NGZA 1I75A 1D7FA 4HFWB 5E9DE 3C9NA 3FF7A 4NQUA 4KGLA 1AXIB 4AK2A 5LKNA 1CBJA 4LPYA 4ODXB 3QUMA 4N4YB 3BXNB 3UX9B 1B2YA 1M53A 2ZUUA 4PRBB 5F0LB 5I75C 1LEKB 1W72B 3SGJA 1MAMH 3H1ZA 2ETWA 3DSNB 1J18A 3AU1A 3WN5A 3ZR6A 5HYQB 1G9NH 1Q38A 3L1EA 4ONHB 5HYJD 3QJQB 1ETZB 4OB5H 1TQBC 3DOSA 4YFDB 1Q9OA 1NCCH 5B7MA 4UV4H 1NM4A 1W9XA 5D71H 3QIUA 1BFSA 3P2DA 4LHQB 3S98A 3AMLA 1RZFL 2RA1A 2OTUB 4WW1B 3G5VB 5BUGA 4LFHG 3T8XA 5I1AA 3K2IA 5DI8B 3UYRH 1NDMA 4O9HL 2VNCA 5EOCJ 2AZUA 3T8XB 4NP4H 4WTZG 5F72S 3UBHA 1G1KA 1MW1A 3IFPB 2EDRA 3KDMA 1RHHA 4MAYC 3V4PA 3UBXG 3L4CA 2XRAH 1FQ9C 4ZFFA 2BC4B 4ZUUA 1GYUA 3MACH 3GHPA 1ADQL 4QRPB 4YHKL 2NX5B 4QHPA 4K7PH 1SY6H 4EIBA 4OGYL 1JMXA 4OIIH 4XODA 4C4KO 4FN0A 4Q0XL 3SD2A 1UWEH 2DS4A 2YXFA 3ZMEA 1T3FB 5D1QB 2H26B 1FJ1A 2BWQA 4DP1X 3CFNA 3L3GB 5CEYB 3GT6A 4XMKH 3KCPA 2OKMA 4XMPL 3DJRA 3SYOA 3VWJB 2BS9A 2J2ZB 5MEPB 3T6XA 3ZDYE 2R2BB 5DJ6A 4NAJA 1S5IL 1A3ZA 1M2VB 3QZWB 3VWJA 3RGBA 4ZNEE 3GLAA 3L2LA 5IFAH 3DO7A 2Y2WA 5FFOA 5C0BA 5JDSA 1CDCA 4JFDA 4IU2B 5FGBC 3V6OA 3MDJA 4D7BA 2F08A 3QGVA 1FNAA 3CK0L 3ZX1A 3U79A 4JPSA 5F7KC 3A6CH 3MRKA 5F8RC 3WJJA 4DKEH 1PX8A 4JUTA 4OLUL 2E7MA 4ODSL 1YPZA 3TNMB 4PJXB 2NY2B 4RGNE 4R3SA 4BKLB 2EEXA 3E1F1 3M7OA 3MRCB 3TV3L 4KMTH 3ASNB 3BHBA 5FW6A 1I8LC 5GRJL 3SKUD 4GUOA 2HFFB 3L5JA 2ZP0T 5DJCA 3OLIA 4PJFE 5ADOL 1UOLA 2V33A 3F2LA 4O5LL 3HG5A 1ERNA 2OLDA 1DBKH 6FABL 2XZZA 3IE9A 1PEWA 3GMPB 1TQCC 2VN3A 4WI8A 1LMKA 2J6WA 4QRUA 5D1QC 3ZIYA 2WSKA 4IK6A 4UB0H 4IMKA 3SCMB 1G9EA 4D0BB 4MZRA 1ZCRA 1AACA 1NCBL 4X6BA 4FTVB 4Z77B 2LVCA 5I73C 1YA5A 3RFZA 4ZXBA 4X5XA 4ZW8A 5IGXH 1M1SA 1QLEH 5AKVA 3WDHA 5HHQB 4D0CB 2OJEA 1ORSB 7PCYA 1R3KB 5SV3A 2VN4A 2ATKA 4NNYB 4A7QA 2DWEB 1NGQH 4P2QA 1NOLA 1UOVA 4CBZA 1ED3A 3L5IA 4LCIL 1KCRL 4ZD3H 5K9QI 1YZZA 3L5XL 4PWGA 2VE6B 4JREC 5C0AE 4AW7A 4JO4H 2CPCA 4X6CF 1ZGLP 4LOUC 1A6WL 4DESA 3V4VH 1CVSC 3DSFL 1ML0A 2KHAA 1VCBC 4JQIA 1CFSA 4R4BA 1MFEL 1E3FA 3D85D 1KT2B 1RIHH 2H3KA 2EE6A 2HSIA 1ETB1 2GBAA 3D85B 5DFAA 1AI1L 2WB1A 3FZUC 1UT9A 5KVFH 3CZFA 5IW6A 2FGWL 2JFCA 1CK0H 4JO5A 2ZCLH 3KD4A 3RWGB 1QBML 5I75B 2R8SL 2LAAA 4RNRB 1MLCB 2KI6A 1WIPA 3HW7A 1T66D 3N85H 2G9HA 3MOAL 2WP3O 2ICCA 1JNNH 1KGXA 2QR0B 1AG0A 5MEOA 2ROYA 2FHBA 3Q2LA 2LGNA 5I15L 1A4AA 3MJ9H 1SF3A 4ODTH 5CZKA 1IBDA 4NQVB 1NFDE 4PJHB 5FHBH 4L0YA 4M8VA 4MXQC 1A1NB 1WWBX 4XMTA 3OKNA 3TTSA 1G84A 3LKNB 2WZ6A 2LTQB 3FFCE 4KO7A 3RVUD 1BBJA 2QJDA 3EOYG 3NCJL 2F2HA 3SQRA 2R0WH 5FLVA 4GXVH 3F12A 4ABQA 3TL5A 1YUKB 2XXGA 5JW4N 1JERA 1UA6L 1P4UA 4YVUA 3H42H 4BQ8A 4PJIB 2AXJA 3KEDA 3SDYH 2A99A 1R75A 2ICEA 1FDLL 1A02N 1I4FB 1MRCH 2UX6A 1FYTE 3EJRA 4Q6IA 3HAEG 2VXQL 5LGKA 4AQZA 1N6UA 3D18B 2YLHA 4QLRA 5CR8A 4QD2E 5F7FA 1OAQH 1BD2D 3KE0A 1MFAH 4F27A 4GG6E 4NO3A 3U0TA 5A2IH 4TSCH 1U92A 1IKOP 1RSFA 2Y07H 1UXSB 5D1QA 4L3EB 1JS4A 3LEVH 3E2HB 1ZK9A 4L05A 2V5MA 3QRLA 2BMKA 1ZLSL 1NGWA 1VF5C 4MDJB 4MS8D 3LKSB 3NA9H 3DO3A 4U1LB 3MXWL 4GKOA 4R0LC 1LILA 5I6OA 4AGNA 1J1OH 3T3PB 5AD0A 1K3IA 4WDIB 2JKIS 3KLAA 2X2JA 2MSPA 2YARA 1T7VA 2BNUA 4FQQB 3CMOL 3VGGA 5D2LB 5A6MA 1ET7A 4HWEH 4PJ5A 1R5WB 1A9EB 3K2MC 4ZX5A 4D7PA 4QXUH 5GS2H 3EDKA 4NIYE 2VQ1A 1CTOA 1G6RA 4WFEE 4DAGL 3MGTA 5HPMA 1N0LB 1E9OB 3B5HA 4FJYA 4UINL 5J0BA 4V1DD 2LOEA 3CGTA 3U9PL 5GXBB 4OD3L 4XOBA 1JZ3A 2EUXA 4K9EC 1I7ZB 4P9HH 3EFOB 4CSSA 2XTLA 5AZUA 3N1MC 5D7LE 1RULH 3MV7E 2ICWI 3MJ6A 3P77B 4HV8B 3ZKSD 5IB3B 1E5BA 4J3WA 3EBIA 1EDHA 2HVKB 4G83A 3US9A 5AG9A 3NUKA 3IBOA 5DJYA 3TA3C 1MCFA 4MTMA 1BZ8A 5AW9B 3UYRL 4WU5B 4E41B 5F7DB 5E6IA 4WKZA 3WEMA 2B1AL 3OR6B 2J88H 1R3KA 3T2PA 4DZBA 1LO0L 1PD0A 4HUVA 4LEOB 3C75A 3CVHB 1I7ZA 3VSUA 3ULUF 2BVYA 1FI8C 5AW8B 1K5WA 1JHKL 4MYPA 5KVGL 1MHEA 5BRZB 1FL3A 4KJPD 3MLWH 3LN9A 3ZTCC 1Z5LA 2GPZA 1QFWI 3FUHA 3GLDA 4G11A 4BK4A 1V55B 1TTUA 3MUJA 4Y2DB 1DUZB 1OCRB 2E9JA 2FATL 3MA9H 3QEHB 5CN2A 2WY3B 1JD9A 3MJ9L 1QSZA 4ALAH 1W6WA 1S4IA 3OB8A 1IGML 2Z31B 4PRHD 1I3GL 3PGFH 3SZ6A 3VQLA 4YDNA 5E70A 5IF0B 4XPAL 5IQ9A 5T8IA 4XHQA 1U8HA 4OQ1A 1E8YA 5ICZA 2IQ9H 3FUKA 3N91A 4JGUA 4I9WD 2D0HA 3NCJH 4HIPA 3M8OH 2PXYB 3GIVB 5I8EA 2AJYL 1M57B 3B9KD 3QFJB 1EHNA 4QYOB 1AQHA 3WNLA 3QNFA 2A6DA 1MELA 1HHGA 4HIXH 3JTSA 3DETC 2FLBT 1QPPA 4ZRGA 5IFHL 1KIPB 4JY6A 5A2FA 2DMCA 2XJKA 4NKDB 3QJFA 1BQHA 3SE9L 4CKQA 3H3KA 2WD0A 4WJ5B 3DJTA 4NO0B 5DRWA 4R0LB 1RJLB 3L45A 1FLTX 4X98A 3VRJB 4LLDB 4ODWA 2BCKB 3K8MA 2JIXD 2IBGA 1S7XA 1TYJA 4NFDA 1CFTA 4MZ2A 5JHDD 3TYGL 1N64L 1C08A 3NEOA 1DQLL 1CZ8L 7TAAA 2X10A 4OFIA 5IB4B 1IEBA 2I9LB 2PKDA 5C0DB 2VB5A 4HUXA 3QO1A 2P5EE 2WXPA 4XVSH 1WAEA 5FB8A 3QEQE 4RWYL 1BQHB 5JPNA 4MB5A 3ZE1F 3PABB 3V7AE 2CJ3A 1E6OH 3O41B 4UTAA 1XH3A 5IP4A 3WTUA 2ODIA 5IOPB 1PEZA 3WJMB 2F7OA 3V5HB 4KKZA 1V7MH 4W4NA 2IALA 4P2QD 3CC5B 4JG0H 3SE4C 4LSRL 1Z0MA 1OPGL 1QI4A 4WV1C 1I1FB 1MCRA 2PPCA 4X9BA 3O6LL 2F9BT 3TF7C 3SE8H 3T6WA 1OAXH 1Q1JL 1KB5A 4JDVA 5EO1B 1GPOL 3MJ7A 2BP0B 3CU1A 2XTJB 4HZLB 3MCYA 2ENPA 1Z32X 3DVGA 5AW5B 5EZPA 3K6SA 1PYWA 5ESAA 3RNKA 4FA7B 2XQ0A 2N1TE 2C9UA 3QZPA 5FYJH 4HIHB 5CU5A 3ALXA 3C87A 3B9KA 3K7UA 1B0IA 3VMNA 2FWLB 4FQLH 1CN4A 3O3AB 1VKXB 2CXKA 1J0ZA 4F58L 4UNUA 4UQ2B 4RFOL 1KXQE 4JDTL 1C7SA 2WIMA 4XVTH 4PB9L 3T65A 5ID1A 2VDML 3FHEA 4YPGB 1TOXA 2E56A 5BO0D 2HT2D 2BJMH 3C5ZC 3DVNB 2DAVA 2E9BA 4ZSOA 5BRPA 2YAEA 4K5OA 4Z0XA 3ZBMA 4EOWH 4IRJC 2WWKO 4RMBA 3BZEA 3ALWA 3K1DA 2WTPA 1FO0A 1FC2D 1F00I 3QRGL 5ALCH 4M29A 1FVEB 4BK5C 1OGAE 5C92A 4NCC1 4ELKA 1X5GA 3Q5TA 4MWFA 3QG6B 4AT6A 3MLVH 4JFEA 2PR9A 3VXQA 3LD8B 3HHRB 4JG9A 3CCHB 1B6UA 3DX7A 4M1CD 4WO4C 5IM7A 3CLEH 3KJ4B 2OMYA 4I88A 2FGWH 1QP1A 5DZOA 4HZAA 4X5LA 5I6MA 3L2NA 3R06B 3KXFB 3M8OL 5C3TA 1IGJB 1OGTA 1SY6L 3O81A 4K3DL 5CIPA 5A2LH 4C83B 4H0GA 4NNXB 1LO2L 5EU3A 5C2BL 5LNGA 3W3BA 2XPGA 3ZRCC 4NO5B 1OWWA 3DMMB 3NCCB 5FCSH 1HKLH 3FRUA 2HLFC 4PJDA 2IAND 3HLKA 1B4JL 3E1ZA 5HYJE 3BFQG 2EVHA 1GHFL 1EO8H 1WUZA 4W1TA 4KZ0A 4DH2A 4YZFF 1RJYB 3BP5B 3WAKA 3HCVA 2NSMA 1WUNT 5H94A 2CE6A 4Y9FA 5KSAB 4HS6A 4Z7AA 4NS0A 5BV7H 5IFAL 4OI8A 2AITA 3GBNH 4IJTA 2VN5A 5KSAA 1IGJA 1OGTB 4C83A 4XTRD 4Y19A 2VO8A 3L4WA 1KIPA 4HOWA 4YLCA 5FYKE 3T0EA 2AMUA 4X0KA 2ITCB 4UT6L 3MREB 4PJDB 3MNZA 4Y9EA 4XBGA 2X6BA 4NQEB 1Q0XH 1RKRA 3MNDA 4PGDA 5EC1A 4U6YA 4F2EA 3DXAB 3E38A 3WS6A 4HEMA 5DD0H 1IGCL 3LMJL 1FN4B 2E27L 2CBQA 3M07A 4HF5H 1YNTA 4WWOA 1KNOB 1AXSB 4YXHH 4NX0A 3FPYA 4Y16C 1T4WA 4NIKB 3ULSB 3WNIA 3NCXA 4AEHH 2Z93A 4ZUVB 1YMHA 2K4WA 4A2HA 2F5BL 5TH2A 5IB4A 3I6GB 2EXSA 2Q76A 4N5ED 4PJ9A 4KDWA 1E67A 1KG0A 1P9MC 4HBCL 2R4RH 2EO7A 2OR8A 3W0WB 4EI6B 4GBXA 5I1EL 4BK8A 1JGDA 4ZW3A 1WAAE 3DXAA 2FQFA 4GW4B 3U1SH 1EHAA 5E6RB 4XVJH 3UAJD 2WKOF 4L5FH 4J1UA 4RMWA 4Z6AT 2IFFH 4P2OC 2X4QA 2NDGA 4HWEL 1DHKA 2PTTB 4NDMB 5FKAB 5GPRA 4JZJB 4KAQH 1L7IH 2NNFA 4UNIA 1NKOA 2Q76B 5INCB 5CMAA 3VRIB 5GS0L 3MA9L 4K7FB 4CN1A 4L1LA 5DFTA 2I60H 3GS7A 3WJJC 4KK5D 1I31A 5C0AD 2JSFA 4EN3C 3OZ9L 4XVTL 3INOA 4KQ3L 4HSCX 5E8DH 2O93L 4WI0B 2BJML 2D0GA 1UACH 5CBAA 5HVHC 4LLUA 5D7LA 1KGYE 2CUAA 4P23D 1JCVA 3VE0A 2R1YB 3H9HB 3DHJA 3LYRA 3P0YL 3LEYH 2AJVH 1JPST 3VAEA 3PDOB 1T21B 4NLHA 1J9RA 5C7XL 1N5YL 2XX0A 1T1XA 1DSFH 2GBTA 3H55A 4HIXL 4ZUTB 2NY3C 3ILQD 2XVBA 4UTBL 1BQ5A 2P24B 5DZVA 2L3BA 5EEWA 2CCVA 1GL4B 2FQEA 2OL3A 3F3HA 3HRZC 2H47C 3IU3B 3O4OC 4E41E 1B88A 1P5UB 1FE8H 4M8UA 5KG9B 2AJSL 5KJRL 3U6RA 2YUWA 1IBYA 5DC2A 4RA3A 4MA8H 4JANB 3IGKA 3QXDA 5GJTH 1QUNB 3HC3L 3RLSA 5JA8B 1T21A 4Y16B 5KN5B 4MQ7A 4Q89A 1UCTA 2DV6A 4LMQI 4X7DC 3CHOA 2UX7A 3EH3B 4BM7A 1IC1A 3LVTA 5GS0D 3BX7C 4E5XA 1D5ZB 4RWYH 2JKWA 2YAHA 5EN2B 5AWNL 5TDPA 3FO0H 4PJBA 1IL1A 1P9MA 1WZ1H 3PGDA 2GJJA 3FMGL 4NPJA 4MZIA 4XWGH 4DGVL 3WMPA 3W81A 1I9IL 2BWDA 3P0VH 3D6GA 4OR1A 3P11H 4OLWL 4AQAB 4ONFH 2WW8A 1XX9C 1MW2A 3VD4A 4G6JH 2FZ3B 1S9WB 4ZS7H 3OBAA 3FU8A 1YPZB 3HBGA 3WEBA 2BX5A 3FO2A 1AS7A 5IQOA 4WHTB 1P7BA 1ZXQA 4GJTB 3QDJB 4JFYA 1UFUA 3KWVA 2HFFA 2LW3A 3VYOA 2FJGA 4NERA 4JQIL 4HGWB 2OSLB 5C0CE 3WIAA 2BIOA 4GQRA 1AGFB 4M8RA 2ZYSA 5DQDL 3AW5A 5GGRY 4ABVA 1KBWA 3A67L 5L4IA 2VZSA 4LSDA 3CG8A 4CVUA 3KJ4C 3NH7L 1Q9LA 5GGVH 4B96A 3HKFA 2B0SH 4EQ2A 4B3VA 3BSZA 4Y9BA 3LS4H 3ZHLA 2H6OA 2Z9TA 1XF1A 1M6UA 1F86A 4YIQB 1RZIB 1WFJA 5CFAA 3GRWH 5J56B 1BXVA 1UT1A 4YHMH 1L9PA 2ITFA 1KTKE 1IZKA 3CLWA 3DJSA 3NIDB 1FRGH 2AZAA 4F9PC 3OKKA 3PWJA 5GRVK 2NTFB 1RK1A 4NZUL 3ZTNH 1EJFA 4N0RA 4FYTA 3UJJL 3AY4C 1DEEA 3R8QA 3CFCH 1KIRA 3V4LA 1ZKAA 2V2TB 1ZTXE 4XN8A 3RX9A 1K4DA 4KHTL 4GW4A 3SKJL 5A7EA 3HG1D 3QZLA 4DW2H 1Z3GH 1MN4A 3L4ZA 4YIQA 4J3XA 4YHZH 3D8MA 4F3FA 4XMLH 4R4BB 1SJHA 3NDYE 4BK5A 2EVJA 2OQJB 4A7UA 1JGLH 5AW3B 5JOFA 3QXAB 2P5PA 2SODB 5KANI 3BPCB 1SGKA 3QUGA 4JQVA 1EWHA 1N9PA 1ZV5A 2K1MA 1OGSA 3ML8A 4IRSC 5BJTB 4G80A 4QXTB 1NFIA 1TQVA 4GO9A 1GC1L 2ENQA 4DPCX 2C9XA 3IMWA 3UCRA 1T5WB 4IBTA 1ZV9A 2O6FA 4N0FB 3VXPB 1FSKB 2AANA 4FHKA 4XN1A 1SXAA 2NR6D 1J88A 2W60B 2NLJB 5FUCE 1AFVH 3GJEA 4LKCB 1YUHB 1YEIL 3GUTB 1QWNA 4EMZA 1CF1A 4UV7H 2OQJA 4RRPM 3L3DB 1P53A 2X4OB 4WLCA 1ORSA 2XWRA 4TQEH 4Y19E 5CBEB 4ODXA 3SBWA 4HUMB 2YGPA 5F2FA 3O3UN 5D7JC 4DJMA 2GTZA 4Y4FB 3F7RA 3TT3L 3NABH 5EO9B 4EBQL 2LU7A 1OZTG 4JO3H 4PJIA 2WQVA 3DOIA 4M61A 1A4CA 5CFHA 3NRFA 2VQUA 3PWLA 1MHCB 1WD9A 3UEZA 2PWEA 3WS3A 4M8QA 4U1KA 5CEZD 4HHAA 2YK1H 3QJXA 4F24A 5DUBB 2C9AA 3COOA 3ZKMD 3WUWB 3T2QA 4Z7IA 3PP4L 3ARYA 2CDGB 3RWGA 4KJYA 1B4JH 3FO1B 2M8XA 4O02H 4R83A 4QXGH 5F7BA 1AGCA 4LB8A 5C08B 2CAKA 2FDBP 3UTSD 1MCPL 3EJTA 5E8PA 2VDRL 4BQ9A 1N59B 1HSBA 3HN5A 3MLTB 4BSWB 4EIZC 4JKPL 4N0YH 4XC3L 1AC0A 5D2NC 4OBRA 1U58B 2XVKA 4CN4A 1LP9F 4AVHA 1HU8A 3KLAB 2J1YA 2VWEC 4N28A 2VMJA 1XZ0A 4NQTA 2Y1AA 2LLLA 3Q2VA 4OLYH 3B37A 4ZOAA 2NY4D 1S7VA 4XPTL 1SBSL 2Z1PA 3LIZL 4GRWH 1HH9B 1PAZA 3HG1A 2YKLL 3VXRB 5LGYA 5HPMB 4HLZG 4LSSL 3QZNA 1S7RA 4WCYL 3EYOB 3LZRA 2D2OA 5DJAB 5EWIL 2R15A 3B2VH 1TSHA 5DJDB 1JVOA 5HGBA 4APXB 1A7OH 1U8OA 2XXCB 3V52L 3P0YH 2TAAA 2Z8WC 3MGOA 3GHEH 4PWFA 3S96A 3DYOA 4MCZB 3IDNB 4L3EE 5H35B 5I9QB 5LN4A 4S2SB 3VFTA 3N5AA 4DZ8A 1JI2A 4PVBA 2JNZA 2ZUWA 4LCUB 4NYLA 3PAYA 3EFFB 2OAAA 4AG4H 1CL7H 2AKRB 1AR1D 4JFQB 3IFOB 2YUXA 4J39A 4NXSA 5TE7L 1QACA 1AI1H 4Y2OB 5AD0B 3SYAA 4JRLA 1A6VL 3C2SA 2Q8AL 1L0XA 5DTFB 4FFZH 1L7IL 3KPLA 1A21A 4FYSA 3FU6A 4A63A 4KKQA 3G5WA 2WIIB 3DRTA 2NQ3A 4QRRE 4GY4A 2ZG1A 2ZUQC 3AG1B 5AB1A 4F2FA 1EJOL 2APFA 4GG8B 5D2LF 1ZV2A 1TZIB 5DJ0B 2VDQL 3TT1L 4KQ3H 3U7YH 4Q97A 3STLB 1D5BA 2Z31A 4KRMB 1DL7H 2OYKA 3BP6A 1XV8A 3VDBA 2VDLL 3RX7A 3D25B 3W11C 5D1XD 1CQYA 4IBYA 3MOBH 1F5WA 5GSRA 5I24A 1E7VA 2VN7A 3B3IB 4C59B 1VZHA 3BCFA 1XSIA 2J20A 2L8AA 4NGHL 4OLUH 3QB7C 3QFJE 3QYNA 3HMXH 1Z0NA 1A1MA 4B97A 2HX9A 2AVGA 4JE0A 1ONQA 2VDNB 1MRCL 2UXFA 4NUQA 1G94A 4N9GA 4GG6B 4S1QL 1TEFA 2LHAA 5HGAB 1KT2A 3QAZB 3VFOA 4JFVA 4PJ8B 3MRQA 4RVBA 2MPAL 3GO1L 1EMTH 4LOFA 4YSAA 2FWSA 1QBLH 4OCSH 1A6UL 3CSYA 4MCNA 4PRDB 4P5TB 5ANMA 3QFJA 1BJ1J 4URTB 5AZEH 2G9HB 3VW3L 5AAPA 4GSXA 3LV3A 3BD4A 1XB8A 4OGAC 1E27B 4X7TB 3BDXA 4XPFL 3WI9A 5AOKA 1XCQA 3G5ZA 1IB5A 1M7DB 5EO0A 5HVGB 4P23B 2KZBA 1AZNA 4HFUL 4DGVH 2QKIA 3S8GB 1OK8A 1HQRB 1L9RA 3QAQA 4PJ7A 1GAFH 2QLVB 1TR7A 4PLOB 3NQIA 3DBXA 3PLYA 2V5RA 1P7KA 2FB4L 4NHCH 3VQMA 4XMVA 4C55A 5K33A 1KBGH 1JTPA 1LTXA 2MCAA 2E75C 2YD3A 1TEGA 5I1DB 2WZAA 1BX2A 1EHLH 3QORB 2DL9A 4LQFL 4NUMA 1I4FA 3DX3A 1WAAF 2YKKA 1A3LH 4HXBL 2VLJA 5ADOH 2WQXA 3FH8A 1RURH 1QFHA 1FZMA 1FHNA 4F20A 3PAVA 3NAAH 4ZFZB 4LGRB 4PD4J 3GSOB 3WIFB 1BPVA 3NCYP 4Y5VB 4FHJA 1RUQL 2IV8A 1GYVA 2WQSA 3T77A 1B9ZA 2WJ7A 4LQ1A 1SXZA 4MD4A 5LUMA 2CJSA 5E5UB 1TO5A 2AI0L 4N8CH 4AV5A 4QKXB 2R69H 2V9QA 1SVBA 2A9MH 3QJOA 1HTYA 4MD4B 2ZOKA 5D72L 5JHLH 1JVKA 1U21A 4EF3A 3GS0A 1JN6A 4OZFB 4MNGE 5DJDA 4NQCA 1BFOA 5HDQL 1WHPA 2Y6TE 2W1NA 3GC3A 3MGOB 4AYFB 4KVCH 1C5BH 3L81A 4R7DA 4R5VA 3EH4B 4EDXA 5L2KE 3P2TA 1PY9A 1USQA 3BVNB 4QTIL 3FONA 5J13C 5ENWB 2VXSH 5HHVL 2AXWA 1UB6A 1BGXH 5BXFB 4M7KL 4PCTA 2DYRB 2WN3A 3O2DA 3RDJA 1DQVA 2Y22A 2X2HA 2HT3C 3VI3E 1IIIA 2Z7ZA 3BUYA 2E4FA 1JF1B 1NBZB 3DX7B 5FEBA 1N8ZB 4LASH 2AFNA 2YK1L 2R2EA 1TQCB 1JYNA 5AW0B 3IN0A 2NXYC 1RH8A 2GJRA 4N3TA 1WCBB 2V2XB 2X0VA 4TTDD 5JUEL 4KQ4H 1KCKA 3UAAA 5GISL 1KFGA 5B39A 1T1ZB 1IC5L 4KRNA 3WLBB 4QO1A 4QTFA 4H8PA 2DM2A 4MQXC 1TPXC 1KCUH 1UWGL 1EXHA 3H6JA 1E90A 3BKYH 1FNGB 1XSKA 2FX8L 3PJSB 4HAKA 4QO1B 5D2LE 2AGJL 5AWNH 4LEOA 1I3VA 1XCTB 4L29B 3K1KC 2WUCL 3K6NA 2GSIA 4FLHA 4HUNB 2ZX9A 4L2LA 1OT1A 5LJYH 2FK9A 3DPBB 2UWEB 1RAMA 4X9YA 1G1CA 4ZSOB 4LF3A 1UXMA 4G8IA 3QEQD 2UWEA 4K2UH 4Y2DA 1MG3C 2WYZA 1P6AB 2NY2D 3QIWC 5B39B 5DVKA 4WTZA 1ZLVH 4OUOA 4Z18A 4NUGH 1F6AA 3WTSA 1MHPH 3FH7A 4C56B 1FNGA 4K0OA 4K3JH 5I28A 1INEL 1TJIL 2QFPA 2QEJA 1BAFL 4OJDH 3V4VB 3UZVB 4PG9B 2KKQA 4G8GD 2GC7C 4E0RA 4NBXB 3QDMA 2E5EA 2F8IA 5D8JH 4BFKA 3UO8B 2A74C 1E8XA 3DLQR 4AUYA 4NQCD 3QDMB 2WP3T 3TV8A 4QRBA 4F5CA 3L3KB 4P04A 4H0HB 2J8UB 1G5GA 3PL6D 3AC0A 4RWHA 5BVPL 1T1WA 3CN2A 3DA0A 1U2CA 1NUNB 2AABL 4FRWA 1QEXA 1XF2A 3S4SA 4BDVB 1S9KC 5A6LA 1T0MA 3JUZA 3BGAA 3MRBB 3CSGA 5F9OH 1GS6X 4PLKD 3UZVA 4KXDA 1D9KA 2KBGA 2HRHA 5DEFB 7CGTA 2OS7A 2QMJA 1KXTB 3HZMA 2QZQA 2E9WA 3QDGD 2WBXA 4FQCL 1FH2A 1KB5B 3TESA 1SBSH 4Y4FD 2ZOTA 4F58H 2C3XA 5AW4B 2H3NA 2E6PA 5BS0B 5D9SA 3N06B 3QUXB 4HUXB 3MX0A 3CVBA 3MRDB 1IX2A 4NZDA 3OHXC 4QRSA 5DEGA 4H25A 2R9HD 5BVJA 5DMIH 1DSYA 2ZOWA 1UH3A 1OALA 3TO4A 4U0QB 2XXMB 2ADIB 4OFKA 1NCIA 1A6AB 1JZEA 2J1WA 5B1KA 4EUPA 1PZ5B 5JOPD 3ULVC 1KSRA 2X53A 2EYRA 4J3BA 1S7QA 5A43C 3VRIA 5DUPL 4QHUA 3QHTC 3GJFB 5ID1B 3AXLB 3KWWB 3WN5C 2OMNA 3DX6B 4PAZA 1OLZA 3D87B 2X05A 4P49A 3ARFC 2X12A 3NGBB 3RJQB 3DX6A 2X4TA 4E36A 1ILSA 3IT8D 3D4GA 3ETBF 1FPTH 1KJ3L 3AQYA 4WWKA 3WO4C 4HA1A 3CFEA 2GY5A 4YLQT 5G2NA 5C08E 4LO9A 1CGUA 3MPCA 3IAGC 2PTTA 4NDMA 1NCDH 1RJCA 1Z5YD 3CFEB 3FO9A 1WV7T 1XGPB 3N9GH 5SWSB 3QUZA 2WWMD 1HIML 4N2LA 3V6BR 3PGFL 3P02A 3W82A 2BIMA 1A8JH 4ANWA 3Q6FA 4K7PY 5LG6A 4PB0L 2F53B 1INDL 3IFLH 1LO3L 5I74B 1DJZA 1IGIH 3HE6B 4JFTA 3FHAA 3GHBH 3HHSB 2O6PA 3ZL4H 1KTDA 5D7IA 1U8KB 2G2NA 3HOGA 3ECQA 3U30B 5MEND 4XX1E 3I9GH 1FNSL 4UF7C 4UTAL 5IFHH 5AAMC 1OE1A 3LXAA 2R23B 5JOEA 2BFVL 2FSEA 2G9KA 2Q8BL 3INUL 1VFUA 4TNVF 1NPUA 1GSKA 2PP8A 2R23A 4D9RE 5IM7B 4JHBA 1BAFH 4OI9A 5HYSA 1YY8B 3QJSB 4YSDA 4QJ4B 3IU3A 5C9KA 1NJ9A 4XAWH 3T0EB 3KVPA 4LP5A 3PL6A 1I1AA 2V8LA 1EHKB 4IKJA 4OLEA 1A14H 4ODHL 4HC1A 2CDFB 2AV7B 4HIEA 4XPFH 1JGUL 1F8TL 3ESOA 3GWJA 4ZPTB 2CIKA 1OP3H 4JGNA 2ZWLT 3ESPA 1OB1B 4LSSH 1YMMA 3MJWA 4H88L 5KW9L 2G2PA 3PF2A 4JFFB 4H1LH 3KLKA 2QADC 3MRNB 4NQSB 4JHAH 3NK3A 4XBPA 5H37A 3WN6A 3EGXA 1KEML 2WKGA 1DLHB 1OTUC 3H6AA 4H0IA 1GAFL 1XGUB 4MMZA 1CICA 1Z1WA 3DGGB 3ZE2E 3VFSA 3N55A 2YPKA 1TTRA 1DVXA 4ZMQA 3TVMB 3VXOA 3LH2H 5E6YA 3KLLA 4U1GC 2BC4A 1L0QA 2EH7H 2JTYA 2NXYB 3T4YB 1BCIA 2CHDA 3P4NA 1FZOB 4RGMC 2X4RA 3GLZA 3X1BA 3OAWA 3O11B 3LRSB 4BFNA 3EJQA 3CSPA 4DFIA 3ARDC 4PJ5D 2YD4A 4TOYH 1JUFA 1R3HB 2XNAA 2XOTA 5AVWB 3EW3B 4XMZA 1BPLB 2EXWC 4NP9A 3WNJA 4DGYL 3FL7A 5DUJA 5FPIA 1T7XA 2ZWKA 5J13B 3GSNL 1SFHA 5BJTA 1BVZA 4QRSB 1AZVA 2COQA 5AYQA 1TDQA 3ARUA 3P3RA 2E59A 4LLUB 4AQ8A 1DO5A 5BQ7A 1BVLA 1KFAH 2HJFB 3II2A 3O6MH 3WCYA 4U6TA 4XWOC 3FOMA 3G5YB 5I17A 3ALPA 1A5FL 1BVLB 2HJFA 3DHMA 5L9DL 5EIQA 4YBLC 5BRZE 3II3A 4AIZA 5C09A 1F4YL 1J8KA 2ED7A 1E4JA 3DNKA 3H9SE 3HC0A 5T1KB 4JPQA 4W4OA 4BFIA 2G0LA 2ZUTA 1XGTB 4PY8J 1NWOA 2FR4A 3H7BA 2P49B 5L88H 3PWNA 4WHCA 3NYKA 5G5DB 3KLHD 3RB7A 2ZXBA 4TN9A 4K8RD 1NMCB 3CXDL 3QUZD 1SOXA 5LXGH 3ZN6A 1MCJA 1A47A 2EZ0D 2KLRA 4WIQA 4FABH 2I7OA 3GSQB 3G6AA 2EDBA 4R7NB 1UD8A 3LIZA 4DK6A 4ES9A 3HHMA 2DLIA 3O4LE 3Q2WA 2F53D 2DICA 5CHNA 4XNUL 1FFPA 3L3DA 4XXDB 4NWUL 5EF2A 3CX2A 3LZFL 4NENA 3HC0B 3FAXA 1QR4A 5DJZA 5J57B 3H4FA 1M3JA 2NNRA 3ARFD 3D3VA 5JQ6L 3FUNA 3T1FA 4PJGF 4ZUSA 2JJSC 5CINL 2CJTA 3S5LB 1DANT 3BKMH 3WSQL 1BEXA 1A7NL 2KQNA 4WK4B 5DRXA 2UYLA 2VE6A 2VLJD 1ZDSA 3U6RB 2JKXA 5TFSH 1JHLH 1Q4NX 3J8F7 4PWJA 3GJEB 3RGVB 4AUUA 1JG9A 2DKMA 4XXDA 3G04A 3BD5A 3GGWB 5FO9A 3TCLA 1XZ0B 4XN7A 5E4OA 2QSTA 2E6JA 2VL4A 3TO4C 3G04B 4TNFA 5FAAA 1S7VB 4YDVB 3K91A 1RZJL 3BVXA 5FDWA 3LS5H 1PVHA 4Q9QL 2IOIA 1URLA 4M43H 1XXFC 4L8DB 2E7LA 2O6DA 6CGTA 5MEQB 3RPIB 1T0PB 1U3JA 4J6RL 2DL2A 4DIXA 3HG4A 1GW0A 3QS3A 4HK0A 3SE3A 3WKMH 4XAKE 1ADQA 3H9SA 1Q90A 2VLLA 4F5CE 4HIEB 2VR5A 4LBEA 1D5RA 2GJ6D 5J8OA 4NUJA 1G6RL 2NXYD 4U0RB 4KRPC 5BVPH 3RPKA 1JNHB 3C6SB 4NKQB 4RSVA 3OLEA 4UU9B 3I75B 2AJSH 2ZOLA 1DE4B 4P2RE 5F96H 4LLMA 5CP7A 5T3ZD 4X5PA 5EBWA 3D30A 2MQ0A 3EFDL 3EO9L 3FTYA 3LH8A 4F7MA 3SB3A 5ABDE 4Y1AE 3U4EB 2VXTH 1ZVNA 3Q5OA 1HOCA 1NCUA 4J3OC 1CIDA 2OJ1A 4FQJL 1XBRA 2VT0A 4ODVL 1AC6A 4XMPH 4FNSA 4NYLB 1PJWA 4FTVD 5CD5C 4CADA 3O6ML 1LYQA 3GSNA 4P2RA 1KJVA 4LSQL 3NCMA 2OCJA 4Y4KA 1NANH 3ARSA 4G8GB 2OJEB 3I3DA 4U1IA 3T0ED 3X14B 3E8UL 4I77H 2Q6WA 4ZSOE 3VB8A 2F54A 4QHNA 2VQTA 3BKJH 3MRHA 1PZUB 1OAZH 3B1UA 3MNWA 1ED3B 1MOEA 4JKMA 1R4XA 2CG9X 4U0RC 1C9SA 4FQ2L 1MCBA 2DYPA 4HV8A 4OIAA 2EE9A 2IO5A 4GAGL 4XP9H 4G6KH 4FFYH 1HWGB 3WKPA 2EACA 5IQNA 1FE8L 4X6BB 1CE6B 1JXFA 1GOGA 5D1XE 1NCOA 1E4WL 4FQ1L 4OLZL 4X4ZA 2QVFB 1E9OA 3PU7A 2GCYA 4XO4A 2XLLA 5DJ8A 1QEWB 5A3IC 4M7JL 5JYMA 4PRIE 2OL3H 4UILH 3H7BB 3LZFH 3TBCA 1RU9L 3T1WA 32C2B 2L7EA 2UZIL 3RWDA 2C9SA 1DBAH 1U95B 1ROWA 1ZAGA 4WSJA 2HKHH 3BN9D 3MBWB 1UB5B 2HLAA 1ZANH 3NIGE 1IFHL 4OCYL 1G0YR 3P3TA 3ZQXA 4LCYA 3EOAA 1DUZA 1MREH 1WEJH 1V5JA 4PB0H 2PCPA 2OPCA 3HB3C 1A6PA 4Q2ZB 5J11B 5CEXB 4PRDA 3V0HA 1B3JA 1J8HA 1MI5E 4WI9A 5J1TC 4WI4A 1AJ7L 4G82A 1G0XA 3B5GA 2AQPA 3LV3B 1T20B 3WGVB 3CFDA 3MV8B 3MV7B 2IQAA 5C0IA 2P52A 4IM8A 2GKIA 3EGDB 4OSUH 1HZLA 4IEFB 2EYTB 2Y25A 3Q3GB 3L3OB 1A1MB 1MCWW 1BJMA 4U7SA 1IKNA 3U1SL 3S35H 2QDWA 4RQQB 1YJDH 3EYUH 5KYWB 3CVCA 1A1OB 2L7UA 1V7NH 4PRNB 4NQXB 2A9DA 2WZPD 1SMAA 4U1NB 3IXTA 5D5MB 3GMLA 3IDXL 4HK3J 1KC5L 1R5IA 2LR4A 3GSOA 2F1EA 4JFSA 1ILUA 4GBXD 4QEGA 1KIQA 2WNWA 5KVEH 2QR0A 2XYBA 3D9AH 5KYYB 4PJ7E 3F6JA 1CFVL 3GSWA 1M2OA 4Z3HA 5IVZB 2ZG2A 1WZKA 1H5BA 1T4KA 2W0PA 4HH9B 4DNLA 1YEGH 4UYQA 4HJ0D 1KCWA 1FRGL 4Y89A 2PCXA 3GZPA 2IPUG 4Q56A 1XCQB 3G5ZB 1A65A 2PTVA 5IW1A 2VC2L 1F4YH 3HZKA 3GINA 4JCMA 5DU7A 2VITB 4W9IC 5IY5B 3US0A 3TH4T 1J7VR 4RESB 1J05B 3VSVA 2VERN 1AHWC 1J0KA 1VERA 1F4AA 1MW0A 2FJUB 3IDGB 3IF1A 4JDVB 3TWCH 5GRUH 1IGYA 5CGTA 2LVEA 3QFJD 2WLIA 5BZDB 4GAYB 3HFML 1GIGH 4QJ5B 2R8SH 2P28B 3D33A 5LG1A 1N8ZA 2LU3A 1D5XA 4XC1H 3RZWA 5GJSL 3B34A 1MCSA 3P69A 5BO1H 4UQIM 2BMKB 3TBYB 3V0VA 2HRGA 4G2AA 3VFTB 5H35A 3LCYA 3VCLA 3AG2B 2VAJA 4JZOB 2Z35A 1RUPL 3K4DA 1HXYA 1HHKB 4S1QH 5EZOH 1HCZA 3RU8L 3CDFA 1EFXB 1S5IH 3BGFB 3EHBB 1H9DA 1TQTA 1PKQA 2ZX7A 5IVOA 3MNWB 2X41A 5E8NB 5FUZH 1HNYA 4ZFOL 4JPWH 4X99B 1BECA 2CO6B 1AO7B 1AS8A 1VADA 4RGNC 5C0FB 1VHPA 1ZT1A 3CH1A 5E9DB 3WFCH 3ULVE 4OD2A 1I8IB 3FTSA 4J8RA 1CZ8H 3E9UA 4JFDE 2B9AA 3OKDB 2RB8A 3CQQA 1LLAA 4M5YH 4RA0C 4N9OB 3PWUA 4C56D 3SDCC 4HOMA 2HH0L 3T0EC 5HVWA 1UENA 1EPFA 1F2QA 1I9RH 2A5UA 1EDQA 2XY1A 3WENA 4D9LL 2R0ZH 4DGIL 2HT4C 3O4LA 3MYJA 4Z7WE 4PRPE 1U8PA 5I1IH 3N1GC 3T4AB 1E8WA 2YPLD 3Q8EA 3V4VA 1XGYL 1U95A 1XH0A 5EB9A 2PR4H 4JRXD 1WGVA 2MH4A 2WXLA 3V10A 3T65B 4NJAL 5D4IA 3OD3A 1SLWA 3RUGB 3EYFA 2VZVA 2C1PA 2K70A 4F1SA 1A3RL 2C4XA 3AB0B 2VLKD 4OSUL 5PAZA 1HFUA 1CL7L 3QCVL 2QMKA 4O00A 4ZS6C 4XP6H 3S5LG 2LU4A 3MRRB 4G7YL 3MJ8B 3S37H 4NO0A 4YDKH 5ALBL 3A6OA 4FNUA 4O51B 1DQTA 5LCVA 3EF4A 4GAJL 3U9UA 4AM0B 4MWFB 1DP0A 1IAIL 5DT1H 1J1XH 2UVFA 1KCRH 3BE1L 4HC1H 1TQUA 2FE0A 3KYOB 4NKMB 4WO4A 2WVSA 5F1OB 3UTQB 3QJTB 4J3TA 1EJOH 2EYTA 2YKLH 4B9GA 1TSRA 5LCVH 1XMEB 3HR6A 4DP5X 1GCFA 4N68A 2Y0SA 3MHZA 5LAXA 3GFUA 3CU7A 4NOFA 4D94A 4NQXA 2GUOA 3JTTA 4U6YB 2ZXCA 1KN4H 4O51A 4E9XA 1CK0L 1VEPA 4S0HA 1DN0A 3FOLB 2Y7LA 2BP8B 3O9WB 2V9RA 2YXWA 3T9WA 1AZZC 3O6KL 4TNGA 3VRLF 2L0DA 3DBXB 4RAUB 3BH9B 5AZ2H 2P8LA 3O6FA 4LT7A 5B1CA 5GGQH 2PCFA 4AYMC 1HL5A 1PD1A 2BP3A 1GYWA 2NY4B 5EU7E 2XX1A 2Q86B 2VDNL 5HHXH 3EJZD 4GYBA 4KXZH 4D9QD 5KS9F 3HVNA 2BXZA 4PLJD 2BNQA 5E94A 2EQDA 3RWEB 3JTTB 4QOKE 3CLFH 4P46A 3QG7L 3OPZH 4U6XA 3PABA 5C2BH 1S2EA 4W9DC 3ME0A 1F97A 4KNUA 1PX3A 2BOCB 4FJZA 3UACA 3PWPB 1P69B 2QVKA 3A6BH 3IGAA 4RCAA 3LIUA 2B59A 4HKZB 2QBWA 2CK2A 3CC5A 4PJ6A 5DD3L 3VXTA 3CUPA 3AS1A 4UOJA 2CO7B 1C5CL 4P4KC 3L7EB 5B1JC 4IKLA 4C4UA 2BNQB 4N20A 4DWHA 2NY0C 4YHYB 1WJ3A 2PPEA 3GBNL 3W5NA 2BY1A 1MAML 3BPOC 5FOJA 1J5OL 3QZMA 2E9IA 4PJIE 5B38B 1NAKL 5CBAB 3BIKB 2A9NL 4TSAH 5ABAA 1S6NA 4NZRH 1HNGA