The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
149
|
structure length |
149
|
Chain Sequence |
b'TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages
pubmed doi rcsb |
| molecule keywords |
Baseplate protein, Receptor binding protein
|
| source organism |
Lactococcus phage tp901-1
|
| molecule tags |
Virus/viral protein
|
| total genus |
27
|
| structure length |
149
|
| sequence length |
149
|
| ec nomenclature | |
| pdb deposition date | 2008-05-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18338 | BppL_N | Lower baseplate protein N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like |
