3D8MA

Crystal structure of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein, Receptor binding protein
publication title Crystal structure of a chimeric receptor binding protein constructed from two lactococcal phages
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Virus/viral protein
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d8mA02
1ZRUA 4HEPA 2X53A 3DA0A 4HEMA 2WZPA 3D8MA 2BSDA 3HG0A 3U6XA 2BSEA 2F0CA 4IOSA 3EJCA
chains in the Genus database with same CATH superfamily
2J2ZB 3VW3L 5B1JC 4Y5VB 3QJVB 3TURA 2KYIA 1GGIL 2VN3A 3MLYH 4GG8B 4TLTA 4XP4L 2YSSB 5FYKE 4RMRA 2XG5B 5I74B 3MLZH 3ARDA 2CLZA 5L88H 3BVXA 3NIGF 2F5AL 4BK4A 1AKJA 4E2OA 1U8CB 2YIHA 2YQGA 1GRWA 5C0EA 4MD4A 3BCDA 1ZPLA 4EI5B 3GWJA 6FABH 5ISZE 2Z93B 3QJUB 2DWSA 5FWRA 4I18B 2YR3A 4KTEH 2W95A 5C07E 2R2EA 3G6DH 4MX7A 1U42A 1ET8A 1XGQA 2BJMH 2XBDA 5AW7B 3EUUA 4AK2A 5AW8B 1J8RA 2QKSA 1I9IL 4DWHA 1CXKA 5E6YA 3Q8AA 2NY7L 3FFCD 4I77L 4EN3A 1NIEA 4Q8BA 2DOCA 1ZSDA 4LARL 3ILPA 1MJ7L 3BEVA 1P5UB 2ZCZA 4YPGB 4Z7VA 1EJOL 3BLKA 4C59B 3KPLA 4XE0A 4PJGF 4LLQA 1UXSB 4M62L 3WNPA 4UT6A 4FLHA 1NANH 5C0JA 4ZFQA 4N2EA 1X9QA 3QHTC 2GIMA 4AYSA 2BSCA 2Q3XA 4NP4H 5FC9A 4LLMB 5HVFB 1EZSA 4Q14A 4L5FH 5EB9A 3NCBB 2OMWB 2WD0A 3HCVA 3MBEC 1CD1A 1O9WA 3EYVA 3PL6D 3F58L 3KZ8A 1ZLEA 2QGDA 4MXWH 4QCIB 2DPKA 4ZUWB 1U93B 1LNUA 5I75C 4I9WE 2AXGA 4ZUTA 2OLDA 2F7QA 3HE6B 1BM7A 1P7KA 3CGTA 4N1EA 5EUOE 1F4AA 1JPGB 1LDPL 3SGJC 1X7QB 1R3JB 3UC2A 3ZQWA 4F33B 5C3TA 3IMVA 1AP2A 1QKZL 5JLZB 1RUKH 5IQNA 4P06A 2A4CA 3V6OC 3DX3A 3KW8A 2DN7A 2EUXA 3FCBA 3MGOA 3L1GA 1U21A 5AOZA 3S5LG 4WFHE 1CFTA 4X0KA 1P4BH 2IQ9L 3AXIA 2J1XA 1NCCH 3NSYA 5DHVB 1HC1A 3BQVA 4LHUA 3T8MA 1NKOA 2JKWA 5FOBB 1TEYA 1TG8A 2AABL 4MMZB 4KHXH 4X8XA 1KLGB 4MAYA 2UXFA 4YHMH 4FQCL 3QWNA 4ODSL 5SWZE 2EXWD 3QCUL 2Y72A 4HU2A 4H26A 2DEXX 1JFQL 3QZWB 2GUOA 4LGSB 3B7SA 3L9EA 3RWHB 4X99A 3HLAA 5I1JL 1DVFA 1HIMH 2FECI 2OKMA 3OAYK 3II1A 2G30A 1E3XA 3AU0A 4QGTA 5C0CD 5B22A 5A6IA 4TL4A 5CLZA 3QRGH 2NYYD 1AHKA 4YZWA 4G9FB 5IMOA 4KH9A 1XIWD 4ODWB 3K8MA 1MEXH 1R5VB 1SY6H 3D0LA 4PYHA 5H37A 1DQMH 3QW9A 5AVZB 1IL1A 3FO1A 3WSQH 1E65A 5A2FA 1TYRA 1FVCA 4QUOA 4N8CH 5D8JH 4FQIH 4CUCA 1GY1A 2J20A 1RZKC 2WWNA 3RRQA 5ISZA 1HL9A 4HBCH 4H1LB 4PGCB 3ZW3A 3LZFL 3T6WA 1MY5A 1MVFA 5IBLC 4ZMYA 1CZ8L 1MCRA 2IDQA 2Z0BA 2I9LB 3ISRA 5C07A 1LE9B 2Z35A 4K3EH 4MNQD 1BVLA 2D0FA 2X4UA 1MN4A 1VFMA 2EDOA 1A7OL 1BG1A 1UTDA 3NCJH 2IQAB 2V3DA 4R2GB 4YAQA 1P7QA 2K6YA 2FL5A 1JNHA 1Z0MA 1X7SA 3X1NA 3ARYA 3LH2H 5ACZA 1M56B 5I8OL 2NUPA 3BUYB 4JM4H 1LK3H 3L4XA 5JMOC 2R23A 4N2OA 3U30B 2V8LA 4FMKA 4K5NA 2EYTA 4JBSA 5BUGA 4XWOC 1P2CA 1ACXA 3LEVL 6TAAA 2FWUA 1BQLL 4ZDHA 1UD8A 5BQDA 4A7TA 4H7VA 3ECWA 3VX1A 1E7VA 2VUYA 4GP5B 3RZCB 5IM7A 3NZHH 1ERNA 4F58H 3V9EA 3WIIH 3QXUA 1TT6A 2OMXA 1TQVA 4HUVA 4RSYA 4KH2A 1E7UA 4NUGL 3LHAA 4KRNA 1NA8A 4HPOH 3A6CH 3NZSA 1OEZW 4OCYH 3GT6A 3HN8A 5HPOA 4UQIM 3Q5OA 2EE9A 3MNWA 1UUNA 3W11C 2R4SL 4NC2B 3MOQA 4GPVA 3O6KL 3T0EA 4LCCC 4WUKH 1PKQB 5ICZB 1BF5A 2R69L 4DFHA 1JXKA 2RCSL 3QEQB 3S36H 3V5HA 3UJIL 3C2SA 3VDCA 1R5IA 3EW3B 1GR7A 5JXEC 1K4DB 1KJ2B 1SXSA 1A8JH 3WD5L 4EO5A 4ELMF 4D3CL 2X44D 4O58L 5DUBB 1FVDA 2F54B 2PKDA 4M61B 4QO1A 2D03L 4GI9A 2Z7YA 5DFWH 4HSQA 5HHXH 2ICEB 5SWZA 5I66A 2E47A 2XTJB 4MYPA 2FJGB 3DLQR 3GXDA 3QPQC 3N3EA 3WKNA 5GS3A 4CSZA 3O6FD 3QHFH 1JGVH 1WD9A 4EKJA 4WHTB 2XRAL 1BVKB 4X80H 5KVFH 1N6VA 2IXQB 3GEFA 4PJCA 4LVHB 2AK1H 2ZCKH 1RKRA 1ANUA 3NABH 2VABA 1RZ8A 3MRDB 5HVHB 4M7KL 4JM2C 4Z8FH 1MNUH 5EBWB 4F7EB 2YMXL 1EUUA 4JCWA 1MFEL 4LP4A 1I7TA 4P2RE 1ZTXL 4FS0A 3DX8A 3OLDA 3W57A 3ZSSA 4HIIB 1L9QA 1GMEA 4EDWL 3SCMB 1MCQA 5D5MA 2C3VB 3LAFA 5BOPA 1WFIA 4BZ2H 4PGEA 4QRUB 4NB7A 4M48L 1I1CA 1UD3A 3QQDB 3CUPA 2YKLH 5FYKH 1PFCA 1L9RA 1JP5A 4PHXA 5FXCH 3HS8A 3L3JB 4RMSA 2DV6A 3P4MA 4EIGB 4A7GF 4ZSOA 3QZPA 3BH8B 1IGFL 4XNZB 4A38A 5FUZL 5HJ3A 1NCAL 2XACC 3OJ2C 3G7TA 2XN9B 3E6HB 1F5WA 4HUXB 2AFNA 3IFPB 4M00A 3RWCA 3LDBB 4FQQB 1TCMA 3VSTA 4GIPD 3S3CB 1RIUL 5ICXA 1E0OB 4UDUA 2E9IA 1JYWA 3L3HB 1JGUL 2QVTA 4X7TA 3VXMB 3BAEH 2EO7A 2ATKA 1ASPA 1B0WA 2WIIB 3VYNA 3Q3GA 3BH4A 2CHXA 4WWOA 3ZT5A 2ZXAA 1E28A 3G5VA 4KU1A 1XSIA 2ODHA 2WLNA 3AQYA 1KGUA 2OJEA 1PDKA 3ABKB 3ULVE 4Q9BA 3ZL4L 1KTLB 3X11B 4DNLA 5HHNA 1GSKA 1L3WA 3OSVA 2YGQA 2WYHA 3U7AA 5KYYB 5D1XB 2MQ3A 2MWCA 3RBGA 4C83B 2RMNA 4NDMA 4XMTA 2Y7MA 4YSCA 5JO5B 3GSXA 3QDGB 5JUEH 2GC4C 4KJWC 4WGVB 3S48A 5J3HC 4P46A 1XGTB 2UVFA 2HJLB 4BXVA 1FNAA 1EGJH 1B9KA 1CG9A 3IGAB 2R1XB 3SDYL 1N8ZB 4PW9A 1ICTA 3ATAA 4N2GA 4C56B 5FEBA 3EXJA 5BOJA 2LE9A 3L5WB 2G3ZA 5L9DH 4IBUA 2JF1A 5EEUA 4H8PA 4IRSC 3KPRB 3F85A 2WO2B 3NUKA 5BO0D 3RZCD 1LDSA 5ADPH 3GZQA 1JDDA 3QNXA 5E6IB 2VSDA 1NTDA 4G83A 2L7QA 1DR9A 1UXLA 2R9HD 3O3EB 1MSPA 4ONFH 1WWWX 2VQTA 3MJ8B 5HI4D 1M3JA 2ADIB 4IRJB 1M1XA 3VFMB 1JGLH 4NRZA 3FS9A 5E9DA 5F3BB 2ZYSA 2QQLL 1ECYA 1PG7H 2J25A 1EIBA 5FM5M 4NNPL 4L8BB 5CS7A 5F3HB 5I8CB 4O2CA 4FQXC 4Z3TA 4OD3L 2B2XH 4OQTA 1J8SA 1RUPH 1ZT1A 4ZS6C 3QARA 1AGEB 1MCOL 3VD3A 4FKEA 1JV2A 1EMTH 4WKXA 2OBGA 3GSVA 1U36A 4JO2H 2VDPH 5FYLH 5H94B 1LGVA 1I7ZA 3QG6B 3Q1SL 4XBGA 4I5BA 2P42B 3P3UA 5GGUA 4F7PA 1J5OH 2ZTBA 4NFCA 2O5ZH 4L3FA 5DQDL 1UC6A 4BH8B 4NHCH 4BSVB 1HTYA 2ZX7A 3D85D 4RGND 5CP7B 1DBBL 2P8PB 1ONQA 1IGTA 4AUUA 4MHHG 3WKQA 2OXGA 6PCYA 2ATPA 4XBPA 4N2HA 5JHDB 1EK3A 2EUZA 4X9YA 4QT5B 1PFOA 1ZA6B 4CDGC 4G3YH 5DEZA 1IARB 4AVHA 1WAAE 2NY6B 4GW4A 3GSQB 5BZDB 4KI5E 3PNRB 4XP5H 1HHGB 4CW1A 5DZVA 3L7FA 3FB6B 4XPAL 1YAIA 2W38A 1A2YA 2J88L 3T0VA 1F1AA 4X6DE 1QR4A 3L6FB 4XCCH 1RD6A 2IPTL 4LPTA 4OF7A 3WIAA 1MJUH 4D0BB 5HXMA 2V17H 4FKKA 5BRPA 1WIOA 4TMPA 3ZDXF 4PGZA 2AQTA 1NLBL 3HKFA 4HUWB 1WZAA 4PGBA 2OJ1A 3A6BH 2RD0A 4BUGA 3DTUB 2PTUA 1CB4A 5K9QG 3KYMB 1SEBA 4PRBB 5ETUB 3VWJA 3FU3A 1BQUA 1IC4H 2XFXA 2ZUXA 2ZUQC 1R3IL 1X9UA 1I1FA 2F1EA 5JW3L 3OKLA 4N0YL 4ZMOA 1CPUA 4JR9H 1NBYB 2H8PA 4X6CE 4X98A 3CAFA 1L0YA 3NBNA 1BZOA 4ZYKB 3FH7A 4JY6A 3QFDA 4GNKB 2ROXA 1NFDB 4LBEB 2VUKA 4PWIA 1NGXB 3DX9A 3BSGA 4RFNC 4QHLB 1FYTD 2WLYA 1S7QB 4NBZB 3OZLA 1OSPH 1FYHB 2Y36H 1HQ4A 3CLFH 2JKIS 3L9RA 3RKPA 5I0XA 2XA8L 1XMEB 5B7MA 3LZLA 3PWNB 1CGSL 4MNGA 4FXKA 3LCYA 2H0PA 3MODH 2Z7UA 1QR1A 3GHEL 4HIJA 4Y5XC 3QC5X 1ZTMA 1NGPH 4IU2A 1RURL 2UY7B 5CJQL 5TQ0H 3JVGA 1BA9A 3WN6A 3QDHA 2R0LH 3E8UH 4B9PA 3SDAB 1LO2H 4XVUC 1YEEH 4XPBL 1DBKL 12E8L 1WBXA 2X9ZA 1UCBH 2ARJQ 1WE5A 3D87B 3PWUB 5DRXB 5CSZB 1WZKA 4P4KC 2DQIL 2V5TA 1ASQA 2AEPL 2F74B 2X53A 5AW0B 4UTBH 4GP8B 4AWJC 2P5EB 2WWKO 2RFXB 3APNA 2BXYA 3TC9A 3JQOB 1Q9OA 4HIHB 5FHAL 1VPOL 5IB1B 2VR8A 2X10A 1ET7A 2CUHA 4B9YA 3V0JA 2UVEA 3PP4L 5T3XD 3OQ3B 5T1DL 3AS0A 5AWNH 4KZEH 4Z6AT 4ALAH 4B3VA 5K93A 4WV1C 5FAAA 3QJHA 2WBXA 2PPAA 1AXSA 3MTXA 3HRZA 4RRPM 3KXFA 1HNFA 3CDGB 4NKOA 3F7LA 5F96H 4FZ8L 5E4EC 2JB5H 3B1TA 1PLGH 3P2TA 3HNTH 5C7XH 2VLRA 5HHQA 3NIFF 4Y7MA 4NM8L 5FYJU 5GSRB 3UAAA 1A25A 4ODXA 2QT6A 2DZEA 4WFGE 5DMGC 4TM9A 2E3VA 2XQYG 3BWUF 1LEKA 3QRFM 1BIHA 4HX1A 4Y1AA 1EX0A 5FGRA 3BAKA 1G7LA 1EHXA 3BCFA 5I6OA 3TV3H 1T20A 4NNXA 3QDMA 3NCXA 2PYEA 4Q9CA 4QIRA 2JKNA 3SJVE 3O2VH 5F7MC 3FU7A 2EIDA 4Y5YC 3SD5A 5ECGA 5GJTH 4L8CB 4K3JH 3U46B 2BXZA 2QMKA 1IAKB 1Q9LA 1QSED 2BK8A 4YHOL 3PXLA 2EDLA 5CHNB 1HX0A 5E5LA 4NCC1 4OCXH 3RLSA 1RK0B 2FJSA 3LH8A 4UM8A 5BV7L 4P5MA 4CBZA 3MFFB 2XJLA 3HG5A 4G6JL 3R0NA 4K73A 1J0KA 1L7TH 1B4RA 3F7VB 1BZEA 2ZG1A 4PRHE 3KPSE 4MJID 4WTQA 2EIBA 4V1DA 4S11A 4LOFA 2CDGB 3P4NA 2PW2A 4ZUVB 3RWGB 4FG0A 5DU7A 2CXKA 4M8UA 4JKKA 5D6CA 2Y2TA 5I2IA 5KBPA 2H3XC 4B6ZA 5EIIB 4JPIB 1TTBA 1YEHL 3C8KA 2NCMA 4ZMAT 2ICWI 4HKJB 1K6QL 3C5ZD 4RESB 1W0WB 3ECBA 1RI8A 3IAPA 5IHLB 3ESPA 2BVQA 4FXGA 5AVYB 2CM5A 5B8CA 5EH1A 2ICWB 2AK4A 3K71B 3BKJL 2ESVB 4UIKH 1IBGH 2HG5B 4KRPC 5ESQB 3P1VA 3AREB 4GUPB 3RY6A 1JNJA 4EOWL 4RH4A 4CMMB 3TPUA 3QJRB 5ANMB 1PSKH 3VQ2C 4ZD3H 3GKWH 1CQKA 1GHFH 1MCWW 2V33A 2GAZA 3QDJB 4KQ3L 4UDTA 1MAML 3DX0A 3NFSL 1KACB 4R3SB 4WU7B 1YZZA 1BWMA 3QFJE 2JLLA 1NPJA 3FQ1A 3W81A 4F24A 4C58B 1A14L 3ARQA 1G6VK 4WTWA 2WXHA 4Y88A 2NY1B 3ZKXC 4DP0X 3KS0J 2E27L 4JCLA 1SYSA 5JR1L 1RQ5A 3GMPB 1JPEA 2FWSA 2FH8A 4ACPA 1SVBA 1AQMA 3A21A 1SXNA 4QHKI 1IM9D 1AJ7L 5EBLB 1NZRA 1J18A 5FECA 1FGNL 2WXLA 4ZW8A 5EWIH 3POHA 4DKEL 4UNTA 1DDHB 3KCPB 4DGYH 4QPEA 4NLAA 5HHME 4AGNA 3O8XC 4JFOA 4UZUA 3UTZB 5PAZA 1SDYA 4G8GB 4RIRB 4J3VA 4NQXA 3TYFB 1J9CT 1YEDB 5DVLA 4Y2OA 1BV8A 3IFOA 1T1ZB 1FZOA 1KGCE 3ZZSA 5IESH 1BGXL 5IW1A 2MNUA 3NCMA 4IIZA 3UXFA 4FMFA 3OB8A 1EJ8A 4AE0A 4DP1X 1TTUA 4KV5F 4PVLA 3MUGA 1UB5B 3VFTB 5DRNA 1DLHA 5I6NA 4PR5A 5T1KB 2ENSA 5T1MA 4OM1L 3D1MC 1RZPA 3DMMC 4ATWA 4FYSA 4B5ZA 1QTYT 2QTVA 3X3FL 2DIJA 4B7LA 4Q6IB 1IBHA 3OAZH 5LG6A 2BY2A 4LL1A 1SN5A 4FG2A 3BSZH 3CFTA 4QLWA 3T2NL 3UAFA 1ZHLB 1RPUA 3M45A 2JKJA 2ZOLA 1IAOA 4HT1L 4JANB 3AAZB 4R26L 3S96B 4DO5A 4ACTA 1FPTH 2C4FT 3VRJA 1UZ6F 5JW5A 3MBXL 4P05A 2NTFA 2UY6B 3I9GH 4Y16B 1SUHA 2YBRB 3X12A 1UH3A 2AJ3A 1EJ6A 1WK0A 5A40E 4R0LA 4APQB 5EEVA 4PLKC 3FQYA 4DN4L 4ANXA 2WCGA 5HYFA 1AC0A 1SMAA 4U1GC 2ZWZA 5CU5A 5D7EA 4OLWH 5D7LE 3R4RA 2FX7L 3GO1L 4NIYE 3OGOE 4JB9L 3MV7A 3BT0A 2DQDH 4UYPA 2R29A 4K7PH 3ATFA 4TN9A 2AXHA 4NI6A 1YPZF 2DM2A 2ZX9A 4YS4A 1TTRA 1CFVH 2M8XA 3X14A 3CFQA 3H3PL 3O2WL 2X6CA 4CU6A 3BD5A 4MQSB 4PLNC 1G5AA 2Z92B 1C16B 3EFOA 3ARBB 1J0IA 4ALAC 4N3UA 3Q01A 2AJSH 2R2HA 1IIIA 1P1ZA 4OTXL 1ZGLB 3P0YL 3NGBC 4QRRA 3GM0A 1A0QH 4D9QE 3APFA 2E4TA 1Y18A 5I16B 1DFBH 5HY9A 3LIUA 4NZTH 3HAEH 3UCRA 2OL3B 4FA6A 4FMVA 4X0NA 3C8DA 4X6BB 4L1LA 4GKSA 3V4VH 1XGYH 2PCFA 1O7DC 4IRZA 1D3CA 1QFUL 4JHAH 4YMPA 3G08B 1UB6B 2WVTA 1LP9E 1IILE 1T89A 1HVXA 3B7RL 3JTSA 4LKCA 3NJHA 4M93B 2NY5H 3IWUA 2BFVH 2MCPH 1DUZA 3IGUA 4JRXB 4AG4L 1YJDC 1MFBH 3M1BB 3C6LC 3DDFA 4U6XA 3HUJE 3ARED 3NCFB 3T77B 4U6YB 4JO4L 2D31A 3EOAB 3AU1A 1PU0A 1BYPA 3CC5A 2NNRA 4P57B 2P44B 5FCSH 2OZ4A 4JG1H 1SDDB 2OX5B 2JKSA 5E8PA 5GS1C 5IBLD 4M6MH 2YPLE 4IIQA 1HZHH 3QDJD 1SJVA 4FYRA 3HB3D 4YXLL 5AB0A 3QULA 3OZ9L 5I1DB 2JK5A 4PJ8B 2HFGH 2UZXB 4GLRI 5IHUL 1DBJH 3MV8A 2XWJA 1E4HA 2NT0A 3SGEH 2BHUA 3DVGB 3DVNA 1FCCA 4FTVA 2HRPH 5I1IH 5I30L 1CIUA 3QUXC 5CJXC 2DS4A 1BQ5A 4B0MM 2BY0A 2QEJA 4XO9A 5E1GA 3S4SB 1L5GB 3B5HA 3LSOB 4DOHB 3VD5A 5C71A 4N8VB 5I24A 1K3IA 2WV3A 1C5BL 2XHNA 2ADFL 1UM6L 1SXBA 4JM2F 4CA4A 3FL7A 3GI8L 3H85A 2XTLA 1QBAA 4H8VA 4N2DA 4MMXB 3FQUB 4N90D 5JOPE 4FE9A 2IH3B 3IDYB 5IEKB 3UZVA 3IKCA 4XVJH 3ZTDC 1C7TA 4ZW6A 1CGXA 1MIEH 2IDCA 1KLUA 4IOFD 4LE8A 4P5TC 4UAHA 5DJ6A 4D2NA 5BRZE 1K2DA 4XB3A 4PJ5B 2FYYB 3D08A 3EH1A 1O6SA 2O6DA 2NNCA 2IALA 3LZNA 3MR9B 3THMH 4N26A 3ZHFA 4DAGH 4DP4X 3LKNA 1TJMA 2H7WA 5GIRB 5FKAB 3C08H 3LKRA 5F6HJ 3WFEH 1YJDL 5D7LA 4U1LA 3VH8G 3KL5A 4O2EB 2OYKA 3AUWB 2QVKA 4YLCA 3CIQA 1MFMA 1VFUA 2JXMA 2WNWA 3CPLB 4L9LA 4X5RA 5DGQA 3W11D 1UXWB 3BUQA 2GCYB 3FH8A 4NP9A 4QAWA 1MW0A 4TYUA 3BESR 3E38A 5GRWA 3ILQC 1NOFA 2BVTA 3JV6B 4KAQL 2A6DA 3QRLA 5EZIL 5JXED 1ITCA 2WXJA 1DO6A 1CLCA 4PTUA 3V6BR 5LNGA 2DWXA 1JG9A 5DFVC 5F7EL 5HDBF 3AY4A 3MGTA 5L6YL 5I1CH 1HAWA 1TMCB 1A1NA 5TF1H 3MRNA 2K6ZA 5D9SA 3ULVL 4OZIA 2FRGP 3QPQD 3EJRA 5H37G 5F7DB 4OD1L 4AMKL 2I5YL 1HHIA 3BE1L 5BJTB 5KG9B 1M71B 4KNUA 2H1PH 2K4WA 5F0PB 4GKNA 2X38A 1GYVA 1UEYA 2UX7A 3RHWF 5K59E 4KDTA 5DUML 2HVKB 2GTWB 1OT4A 1JRHI 3EFFB 4UILL 2BNQD 2E0PA 4AV5A 1U8KA 1TDQA 4F7TA 2KPNA 4O02A 3RWEB 2Z1KA 1L9PA 4IHOB 1IT9L 3ATDA 3V4UL 2G4GA 2YQ2A 4MXVE 4JKMA 4YHNB 3O4OB 2V9UA 3WY2A 1G1YA 1A7QH 1KXTA 1MZYA 2IBBA 3K81A 1D5XB 3ES6A 3WKPA 1RLWA 2EVGA 4AIXA 2YGPA 1DEEA 3CH1A 1KC5L 3R1GH 4YHZH 4KROB 1Z9NA 2JTDA 4I89A 5EZLB 5JXAL 2IANA 2N7SA 4PLOB 3UTSD 2IADB 4HOXA 1QSFA 2J1WA 5BXFA 1T83C 5INDB 5CR1A 5D1QA 3EDJA 1ZGLP 2A9ML 4PG9B 5F1OB 2EIZB 3D50A 1KNOA 3T0DA 2IAAC 3LB6D 1SXZA 4QTFA 4PI2A 3WL9B 4KK6C 4OJAA 2K70A 4LSUH 4YDIH 4EF3A 5CJOL 1WUZA 2NXYB 3TT3H 4YNYB 1TETH 1H3VA 2E8ZA 3MLUH 2DBLH 3WN5B 3IETA 4W6XB 2D73A 4HALA 4AZ8A 1FIGH 1P69B 5CJ5A 4WW1A 3ARGD 2IBGA 1GYCA 3L4WA 3PABB 2CPUA 3II3A 4PJXB 1RZIA 3KDMA 3V7AE 5HDLA 5FV2A 4N2NA 3BDXA 3BFWA 5C97A 2WBJC 5DD1L 1AE6H 4QXTB 5F71A 4DGIL 4E36A 35C8H 4ZOAA 2R51A 1PX8A 1T0NB 3GD1C 3QZOA 3TVMA 3WJJA 5LGJB 3FMGH 3PWPD 1D5ZA 4Q9RH 3OMIB 2X40A 4WWPA 1QVOB 3NMEA 3MRQA 4QKXB 5I73B 2NW2A 4YDKH 5H35A 2V8MA 3ARXA 1WZLA 2ADJA 5FLVA 1YY9C 1JK8A 1E5CA 2HWZH 4JAMB 4KJWD 1MHCB 4RQQA 2B1AL 5J3HD 1DFXA 1AOZA 2IDUA 4ZMLA 2Q8BH 2EC9U 3CX2A 1RJLA 4KUZL 4AH2A 2MHAA 2HX8A 2NY5C 1CDCA 4MQ7B 5K5YA 4F3FA 4GQRA 2W80C 1GCYA 4IRSD 3RTQA 5ITFA 2ED6A 1K8IA 2XC8A 2VIRB 1ZT7A 3SYPA 5HGDA 2V5YA 1B4TA 4GOSA 4PWFA 3FT3B 4NAMA 5JDSB 5SWSE 1A3QA 1UKSA 3TH4T 4N9OB 4YK4C 3BO8A 3NRPA 4A55A 3J2PA 2VXVH 4BSJA 3DRTB 5TDOA 2R1WA 3DSFL 4F7MB 3LOWA 2ZOOA 5IR1B 3VB8A 3NSJA 1NCUA 2R7EB 3MNZB 3B9AA 4MA8H 1T22B 1X7TA 4NYLB 2FX9H 2OULB 3CCHB 2WJ7A 4FQXD 4R83A 4H88H 3RPBA 1YUKB 4KKRA 5HHVH 2I27N 3M1OA 3GYRA 3SYOA 4P2OC 4ZS6D 3M8OH 1H5BB 2IOOA 1DJWA 2NMSA 1YNTF 4OLXH 2MCMA 2Q8AL 2A9AA 4Y2LA 3IAGC 5GJSL 3VI3F 1YUHB 4E42B 1ZANH 1DTUA 1MRDH 3C6SB 3UC0L 1SVCP 4PJHB 2OTWB 4A6YH 3EOBB 3A4FA 3L1OL 3FTXA 4L3EA 4TSAL 2HUEA 3O9WA 3SE4C 3Q2VA 4YC2C 5SX5H 3KVQA 3WTVA 1U8CA 2NQ3A 3O6ML 4L4VE 4UCFA 4HLJA 5MHSE 4B9KC 3PDDA 2V2XA 3NH7H 3NFNB 1PNDA 4XAWH 2VLJA 4N0CC 4OF6A 1B3IA 4QTIH 1Y0LA 2V2TA 2EDEA 4HK0B 1LTXA 4UTAA 4AQ1B 5HGHB 3EHBD 2YAOA 5IZ7A 1U8JB 2HPOA 5DJYA 1KEGL 1G9NL 2E56A 3KWUA 3CLWA 4PM1A 2XJKA 3RIAK 3ABLB 4HFUL 2A74B 1ZK5A 3CZGA 3OKDB 4BA0A 1P5UA 2Z0UA 4XODA 3S88H 2AAAA 3WIFA 2BHYA 1ETA1 3WS6C 1YY8A 1VF5C 3BKMH 3D48R 1Z9MA 4UTCA 3TN0B 1I8LC 1XF3B 2BRQA 3DPBA 4YDJA 3ZTNL 4JFPB 4L3CA 3BGFB 4NQCD 1AG6A 1BAFH 4X7EC 4X4YB 3L2MA 3N42F 3ASOB 5LBSA 1LWRA 1IVLA 1D7FA 4HHWA 4UF7C 4Q4IA 5CZXC 1L3NA 4ZMZA 2AV7B 1EHLH 4ZMWA 4AQAB 5C0BB 1AYRA 3H8NA 4GAAA 4GQPH 4WDIB 3EF7A 1Z5HA 5J5EA 2VDQB 4WI0B 3H53A 2DKSA 5IEHA 4XP1H 1QMUA 4PD4K 4L4TE 5JW4Q 3ZBMA 2A38A 2YXVA 4ELDA 1VEOA 2AS5M 3VCLB 2OQJB 2GI7A 4AVJA 4PPTA 1F56A 4GXVH 4AYDC 5TH2A 4I0CC 4PV1C 1ID5I 4LLWA 1NUNB 1WTGT 1XF4A 3DO3A 2VGLM 4PRIB 3GRWA 4U2YA 4OJFH 3MRRA 2XPGB 5F7AA 4JPWH 3LD8B 1FO0A 2ARJB 4TNGA 3QORB 3SBWA 1MIMH 4NUJB 5EUOF 1XX9C 3CN1A 1BPVA 3LQZA 2VJ0A 5FOBA 5D7IE 2CJSA 5FYKD 1PPIA 1N5YH 4XNMA 4IGBB 3C87A 3VFWA 2CHDA 2BCKB 1V3JA 3ZYJA 4DTGH 1E4KA 1T2QL 1TVHB 1W8EA 3D69A 3GLEA 3QA3A 4ZFGH 1U8IA 1XCTB 3QI9C 1ETZA 1KIPB 1K3ZA 5E23A 4P4KD 4Z7NB 3MRMB 1R3HB 4HAFA 2ADGA 4KY1H 3K5SA 2OTUB 4DCQB 3D5OF 2OMUB 1ZJAA 4G9FA 4AYBA 4D8PA 5DLLA 3NSDA 4NJAL 4AEIL 3QXTA 1R5VA 1YNLH 5IV2A 2FBJH 4Z7UE 1G1CA 4L4VA 3NJIA 4PJGB 5DEGB 3PV6B 5FO9A 4CN1A 3WEXA 4JFTA 5ANHA 1TPXC 3DJSA 4YSTA 3AS1A 2CRIA 2Z4QB 3QIUB 3BVNA 1GW0A 4X4XA 3ZDZE 4H1LA 2CO6A 2NLJB 4MCZB 5DR5H 3LZOA 3Q2WA 2ZXQA 2I9LA 3SE3A 3Q05A 1KULA 1JF6A 1LE9A 2XLLA 5M7QA 2DQHH 4Y19B 2D3VA 3MLSL 3T65B 3IRPX 4IRZL 1VFAB 4XO8A 4BBWA 1EEYB 4EBQL 5D2NB 5H2BB 5TFSH 4I9WD 4WUUB 2WTRA 5AYTA 3VB9A 1NGQL 1AHWC 4MJ5B 4Z0BL 4PJBE 1OAXL 2Y7SA 5D2LE 1XB6A 3INUL 5EZPA 1WFUA 2EDXA 2PYFA 1KFAL 2X88A 1OGSA 4H44C 4HEPA 4HZLB 3VO0A 1T2XA 4K8RL 1EWHA 4JG0H 4OBRA 1QPXA 4QOKD 1EJFA 5J9PB 2BWIA 3MRPA 3PDOB 1CICA 2OP4L 1LM8V 3QUZD 4G2AA 2GJ6B 5EOQL 3PWVA 5SX5K 4NO0D 5D70L 1WRFA 1OGTA 4LHJB 1TQWA 3T1FA 1LEGB 3AQZA 4I3RL 2VDRB 4Y9EA 4NHUB 3R7QA 4DKFH 1M53A 3EJPA 3OKMB 3FQRA 1AR1C 5FYLD 3PS6A 3ZRCC 1HDMB 3VQLA 3G9VA 1CDJA 1CTMA 4X8GA 2XNAA 1F45A 3RVXD 2P8MA 3N44B 3NOIA 3RGHA 3K6NA 3LZQA 3U82B 4NNYA 3BVDB 1DQJA 1VJSA 4GEIA 1KJ2A 2Q1EA 3ZUNC 2NY4B 5D7IA 4KRPD 3QXVA 1OSZA 4LPUA 2QVFB 2ZG3A 5DURD 1PIFA 2X2IA 2Y5EA 4P59L 2A3TA 1KBBA 2Y69B 5C2BH 3P30H 4R90H 2NPLX 2FJGA 2H32B 4KKQA 4XWOD 1IZKA 5KN5A 4MWFB 1CYXA 5KTEL 2O5XH 3RUGB 1P84J 3C09B 1TOXA 3EGXA 3L45A 1OCWH 4N8PA 1BVKA 1SYVA 2IXQA 2FCBA 4M9OA 2BNUA 1GGCL 1KTKE 4MA1C 2BDNL 4LL9A 1T04B 4K9EL 2B3IA 1D5IH 3FOLB 4MZ3A 5KBKA 2P80D 1QASA 2D7OA 3VFUA 4LIQE 5K39B 3ZUCA 2ZWNA 2WMPB 2KLTA 5HYEA 3OMAB 3Q48A 4F7EA 5KUKA 2RB8A 1RFDL 4X5XA 3CSYB 3WY3A 3HMXL 2WWKT 2VZOA 3MJ9H 3OAUL 3K6SA 4YBLB 4K94L 4N6QA 3VRLE 2CRZA 1VADA 2Q86B 2WANA 4IDJH 2WXOA 4OKVA 5D7KE 4Y0GA 5J89A 1FFPA 3DUUA 5HDRA 5KSAB 1PG7W 3O8XD 2GBUA 3U1SL 4WRLA 4QY8B 3EGSA 2WY3B 2MKWA 3IB4A 2OXHB 2R56L 3HW7A 3QUKB 4HYTB 4NQEB 2GK0A 1XHHA 3W2DH 3SDDA 3KGTA 4YHLL 4KUCF 1E4JA 3KYKH 1MKFA 3FSVA 4TVUA 1F58H 1M6UA 4QXWA 1E8WA 2C9XA 2DIEA 3FC8A 3HZ3A 3JUYA 4Y4FB 4DK3A 5CNHA 3BRDA 3ARSA 1AY1L 3DMMD 3LPGA 1J5HA 5LAXB 4IOSA 5IY5B 2N0MA 4JRYB 3KCWA 2ZWKA 3K1DA 1G84A 2DQJL 4K7FA 1LEIA 1XGUB 4OVUA 4FGMA 4PJFB 3DJ9A 2FX8L 4KK8C 3O3UN 4UMSA 1DN2A 2Y06H 3CDZB 4AVKA 1MFCH 3QIWC 3SO3B 4IKNA 3EO9L 4GQ9L 4TNWF 3L3KA 3ZOAA 4AYFB 1P1VA 2G75B 4GRMB 3HAEG 4ELMB 5L7XH 3B4NA 4WZ9A 3VRIB 1WBYA 3V0HA 1S8DA 4JVPA 4PLKD 4UIMB 3EKCA 5D1XA 5KZCB 2A6JB 3UTOA 4NIKB 2KMWA 1VACB 1IB5A 3D2UB 4ZTOL 3UYPB 2A83B 4WTXA 3KBHE 1V54B 1IGML 3QCVL 5IROA 2IAMC 1XGTA 1XTLA 2XZZA 1KPVB 3ULVF 2Y7QA 3FB8A 3OM3B 1WG3A 5EC1B 3U2IA 5C0RH 4KMTH 1H8SA 4P5KA 4U1HB 5I9QC 4U6VL 4PJ9C 2K45A 1GGYA 2XZAH 3ARFA 3KPRA 3HLKA 2VXSH 2O93L 4NOFA 3OX8B 1AD0B 3FFOA 3RJDA 3CFBA 5JA9A 1U91A 1TJIH 5B1BB 4L37B 1TZAA 4KUCD 5CIPA 1QP1A 1VFBA 1GGUA 4IRJA 2X6MA 1G7QB 5F3BA 3U0PB 3S5LB 1SLWA 1TXKA 2EDRA 1HXMB 2YQ3A 5DFAA 4P5RA 1QFHA 2NDFA 2HKHH 1LLAA 1ZS8A 1VENA 1FLRL 2VC2B 4HEMA 3VI4E 4UT6H 4JFDA 5AKTA 4LCWE 3TA3A 3SPVB 2IMNA 4S10A 1TJHH 3UJJL 2X7LA 3N1PC 2AJUH 1IC7L 3GXPA 2A5UA 2CGZA 4R84A 1CBJA 4W9CC 5IB4A 3ECVA 1AS6A 3RWJA 1KMGA 1CF1A 2C4XA 2VDKH 4FZEH 3M17B 4HHAA 4XPTH 5AEAA 4BSVA 3W0WB 1B0GA 3F5WA 5JPNA 5CP7A 5CEZE 4YDVA 5J13C 3C12A 1DBKH 5EU6E 4XNYH 2AEWA 3HA0A 2GITB 4L0YA 1BLNB 2D2OA 3IVKA 4DQOL 5JHDA 3FUDA 3NAAH 2C1OA 5EF2A 4GSDH 4TSBL 3DROB 4HS3B 3V4VB 2BINA 4OJEH 1WFMA 1NBZA 3OR6B 4IK7A 5K1VA 5EN3A 2R4RL 5D71H 3O0RH 4A7QA 1Q0XH 3FBKA 3EYSL 3F7YA 3DXAE 3RIFF 2QQKH 1H0DA 4LFHG 2J1KA 2FATL 4KZCA 5A43C 4WCYL 3IMRA 4P5TD 2O72A 1WAAF 4KI5F 4BELD 1XCXA 4KXZI 5T5FA 1IQDA 3CVHA 1KYUA 1EPFA 3AT8A 1TQBB 1UM4L 2NY0C 4L8SB 5DVOA 3U2SB 1RSYA 5DWUH 1DUYB 4JVWA 5DUPH 1LYQA 3PGDB 4WSGA 5IKCA 1UOKA 1F4YL 3IYLW 4X6DF 1KBVA 1A9BB 4UTAL 4NZRH 3I6LE 2FEDC 1RP9A 1MCNA 2KT6A 1MLBB 1NBYA 2ICWJ 1I9RL 4G43B 4N2LA 3L7EB 1F4XL 4LBEA 4JRYD 4PJ6A 4NQDE 3TBYA 4W4OC 3QNZB 2Q2LA 5CCKH 1EEQA 3ILQD 2EZ0C 1EVTC 2FJUB 1I8MB 4WAFA 1TTGA 3GJFB 2R0KH 5F9JB 3WTSA 2CKBA 1YMMD 3AQDA 2ZXEB 4X6CF 1OGAD 3WTWA 1E8ZA 1F00I 3PWNA 4LRIC 4WNQB 4TF4A 5LXGH 5I1GL 1NIFA 1DL7H 5IQ9A 1J9SA 1U0QA 3CFEA 3FCSA 1N2RB 1V3LA 5GZOA 3G9AB 2ZSVB 3E6FB 3SODB 5HYJA 2DL2A 4KVNL 5CWSB 5KBNC 3VD0A 3U9UB 3NT0A 3D3VB 4YE0A 5J12C 3OR7A 1OWWA 3IU3A 4FN0A 3HVNA 4GFXA 3VI4A 3OF6D 2R0WH 3PWUA 1FP5A 5CSZA 4WJG3 5DT1L 3KPMA 2CZNA 4LCWA 3W39B 3IJ8A 4JFHD 4XCFL 2V0AA 2EH8L 4RMTA 4QHKJ 2P5EA 3DPDA 3U4EA 3N41B 5F2FA 1CMOA 3GRWL 4F37K 3BDBA 3TZVC 3LRSB 1I1AB 4Z7AA 5IB1A 3BQUC 1BQHB 3HG1A 3V5DB 1UH2A 5DHYA 3UAEA 1E9OA 1NFKA 1MW3A 2SEBA 4Y4HA 4FFYH 5AZ2H 1CE1L 3PF2A 4H20H 4MZRA 4YX2H 3UPRB 1Z32X 4YIQA 1PZBA 3V0GA 1QRNB 5EG6C 1IBBA 3TPKA 3O4LE 2HT3D 2CAKA 1KIUA 2GI0A 3ZDXB 3NJGA 2BZ7A 2CCVA 2NY3C 2TSAA 1QHPA 5E99H 4FCAA 1U2HA 4HKXB 1RULL 4U1MA 3C60C 1A7PH 3PFQA 1FN4A 4BFBD 3CBKB 4LPVA 4ZAKD 3HE7A 1YEFL 1PIGA 5E6SB 4LK4A 3SOBL 2WSKA 1P4IL 2YARA 4HF5L 3ULSB 1D7DA 3B7UX 1QLFB 1T4KB 1UA6L 4L8CA 2A9DA 4F2MB 3MV9D 1NEUA 3K6FA 3H3BC 1OB1B 3EYQD 1OM3L 4BKLB 4W9LC 5AAWA 3TESA 4LKXB 3LHPL 5FHBH 4HCRH 3CXFA 4R8WL 2QV4A 1IEBB 1JF5A 5E5MB 1OV8A 3MFFA 1U92A 4GINA 5MI0C 1QFWI 3ARUA 3I74A 3WEBA 1AQDA 4EN3C 2OMVA 5GHWL 4I0PC 3U7YH 2N56A 2OJZH 2G5UA 2MPAH 4OZFA 5M94B 1YY9D 3S3JA 1KCSH 2IH9A 3K46A 2FWOB 1NFIA 4JREB 1BIIA 5EU3B 4DKTA 1UASA 4PRAB 3QXWA 4JPQA 4NQDA 1DJIA 1U8OB 4POZC 2WUBL 2HVBA 2WNXA 1AZVA 4FEMA 5L2KB 4D9LH 3H0TB 5MENE 2R1YA 3JWDC 4PP2B 2L7JA 2C7FA 1OF2B 3S2CA 1PX3A 4PRNB 1U8QB 3CFDA 4AC2A 4RFEA 3EUDA 3MRHA 3IRCA 3JWOL 5JPMB 2KZ1B 4LXFA 4TSCL 3O3DA 2ICWA 4PJEA 3Q13A 3LIZL 3ILEA 5F97E 4HJJL 4HWEL 1NC2D 3QIBB 3VNYA 5KYWA 4GBXB 1YAZA 4E9QA 4DN3L 3V0WH 2KLSA 1TYEB 2VL4A 1BJ8A 1BFOB 4WJ5A 3UG3A 3WNJA 5FO8A 3BZEB 1WPCA 5AUMA 1HNYA 4LSRL 3MKGA 5CEXB 3AXHA 1CDIA 4MD5A 5CGMA 1NCTA 1OHZA 5EZOH 1JHKL 4MSWB 5B21A 3SSGA 3K80A 4M8QB 3NIFB 3QHZH 3QQ4A 3BC9A 4KNSA 3MREA 3JV0A 4ORGB 5L4IA 4MS8C 1N0LA 3V0VB 1H8OA 3S36X 2MEJB 3PQYB 4WFGD 4I3SL 3U0WL 2A6IA 3CBRA 1H9VA 2AQ1A 1OSEA 3S97C 1AO7D 2ENQA 5CAYB 3UTTE 3P0YH 1I8KA 2F18A 2VDNH 2YEZA 1AIFB 1UQSB 2ZYRA 3T6XA 5T3ZE 4LSSL 2FUQA 3SDXA 1FAIH 6CGTA 1S7XA 4OLZL 1FGVL 3TCLB 3RVUD 4N0CD 3M7FB 5FO7B 2IFFH 3CPUA 4K0OA 3BZ4A 4CVXA 4G8GA 3P0VL 4ES8A 1JPST 1YEDA 3JWDL 2BSTA 4GSQA 2FB4L 5F89A 1BF2A 5BVJA 1MHPH 5C0DB 2DMBA 5CCGE 4MHHI 2BVPB 3VXOA 4M1GH 3PWJB 1BQKA 4NI3A 4LDOB 5HSFA 4PB0H 1KGYE 4O5LL 5HGBA 3FYEB 3I9AA 3QNYA 1NAMA 3L5IA 4GRLC 4ZXBC 4WHDA 2PUQT 3QWRA 2X70B 4BFOA 3KVPA 3VG0L 4Q6IA 1MXGA 3KD4A 3MNVA 3RAJL 1QI4A 5EU5B 2H26A 3ARTA 3CHRA 3IJHA 3V6FA 4N1CA 2WLLA 4M43H 1ODUA 2NSMA 2ZP9A 5CZXD 3ZHKA 3WEAA 2ZUWA 1JWSA 1KIQB 3OHXC 3OKYA 3SE8L 3A23A 5T33L 2W9DL 2ADYA 2PNDA 4G42B 2YBRA 4I2XE 4BFGA 4FG6D 3DETC 4OQTH 2VLKE 5IMKB 3T6VA 5K9QI 2LTQC 3P9LB 2YA1A 4JDEA 3BPOC 3LKQA 1R3LB 1SM3H 4JDZB 3EADA 3F7RA 3UABA 4LLVA 2NX5B 4H2AA 4MMYA 2AXFA 3GI8H 4MA7H 5C0FB 5I1LB 5MENA 2DAVA 3P3SA 2G5BB 1IGCH 4JL2A 2X4NB 3QFJD 2BSSA 5IHZA 4NO5B 4GKOA 3CVBA 3Q7JA 2QPFA 2HMIC 1RK1A 1ZHBA 1NCOA 4OZGE 5TPWL 1INQA 3IT8D 2Z92A 3FNKA 2BS8A 2JVUA 4DP9X 1XXFC 3ARBA 3P9MA 1N64L 4G6AD 5DC4B 1Q9KB 5F0MB 1SLVA 2X1OA 1MFVA 3ERXA 1Q0EA 4Y2DA 5DEFA 4LT7A 2PO6D 2ISDA 5DXWA 3U83A 1UATA 2M26A 5CKGA 4UQ2A 5CGTA 4NZ8A 2W5PA 4KX7A 4GUQA 2YXMA 3N50A 2ICES 1TENA 4GRWH 4PV9B 4AJWA 5E8EB 3U1PA 4RAUB 5MERA 1MHHA 2IGTA 4X6BA 3RWIB 1PD1A 1MNNA 4KKBC 2IPKB 5LGHH 2EXTA 3T71A 3SBRA 4MTMA 1NCHA 3RVTC 4YHPA 2AF2A 4BKTC 1KGCD 3TNNB 4FNSA 1TF4A 1KB9K 1KENH 4TULL 5JW4R 3U7WL 1T5WB 5E8NB 3GDBA 1AH1A 2EABA 1OQOA 1G87A 3I02A 5FFGA 1YG9A 4F5CA 4H8WL 4JFQA 3HMWH 2BMKB 1Q4NX 1QLEL 2DYSB 3T77A 5C9JB 4HFWA 3V52L 3V7AG 1BD2D 4LSQL 1VERA 3KEDA 1PG7X 2HFEB 5ALCL 3VWKA 4F9PC 4QGYA 1S9WB 1LP9F 3FO0L 3ECQA 2DQGH 4X4ME 3TFBA 5DMIH 2NCEA 2CHZA 2J56A 3S3PA 4DW2H 5I1DA 4Z3IA 1KLFA 3MV01 4JG9A 2VN4A 2UZXA 4RRPG 3O3BA 4ZS7H 5DJ8B 1UT9A 1SGKA 3DVGA 3HUJF 2APBA 4S1DC 3MI6A 2WLZA 2YZ8A 2KHAA 5GZND 4LIQL 5EIVA 4MAZA 4G1MA 3WKYA 5ESVA 3Q8BA 1L5GA 2I9TA 4JFFB 4IU3B 4FQHB 3K2UL 4N8VA 4A2GA 3LS5H 1J8HA 3H3KA 5J6HB 4HIEB 3OKNA 4PRDB 4ESKA 3MCKA 2F5BH 2OM5A 1YPZB 3MRIA 4OM0L 2IH3A 5GRJL 3SY0B 1UA7A 4TKWA 3VMPA 3NJNA 3MRLA 2CDFA 3VGEA 4QDGA 3ISWA 1OY3B 4LLDB 3LEXA 4PJ5A 2P7TB 3MRGB 4OY9A 4WWKA 1QABA 4UM9D 4XH2B 2ERJB 32C2A 3NRFA 2F7IA 2P24B 1R24A 1L6PA 1S7RB 2GTZA 1T6BX 4UBDC 3KW7A 5HHOB 4AYID 3TWCL 4O2EA 1HSBB 1BZ7B 3L3GA 1JZ5A 3U9PH 4KHTH 5F70A 1AR1D 1M1SA 2Z31B 1MREH 2N7BA 2XWTA 3IDGB 4ANUA 3HI5H 4EUPA 2V37A 5I1AA 3HNVH 3V55A 2GCYA 2WLIB 3DUSB 1GJUA 5D7JD 3B7TA 4NKQB 4ABWA 1E4XL 3TBVB 2D7TL 3WCYA 4XVSH 2JIXD 1PS3A 2L7EA 1A7BA 2W60B 5J1SC 4HS6B 4GKZA 4CC0A 3LQAC 5T1JA 1PF3A 3NJVA 5FUCE 3KM2A 4YSSA 4OR1A 4FRWA 3VA6A 1EDQA 1F8TL 5T5FL 4RISL 3MACL 4WJKB 2NNFA 1N5AA 5E6RB 1T03L 4OAWA 3GTTA 4OGAC 5BJTA 3FTWA 3QDAA 5KG9A 1I3RB 2WSDA 3RGVB 4UYQA 1S9YA 4AQEB 4WY7L 2J5WA 5ALBL 1RUAL 2D7MA 3HG3A 1XAKA 5LNDA 2QR0B 3I50L 1BJ1J 4RX4A 2DQUH 2HVKA 3BPLC 4AEHL 3QR0A 4E0RB 1QWUA 1P7BA 4XOBA 3WHXA 3EFFA 2KKQA 3V4PH 1TZIB 1YDPA 3B2VL 4EIZC 4POYA 3BT2L 4GB9A 5DRWA 5AG8A 5J1AA 3RWEA 4N0UB 4RNRA 4IHOA 2O5YL 4QRQA 4DO4A 2X4PB 4YHNA 4NRXA 4TVPH 3FHQA 1N9PA 1OCOB 2YC1B 4YXHH 2CKBL 3E7JA 2N7AA 3H9HA 5IBUB 3Q2NA 3WJLA 3KMDA 3IGLA 3MZGB 3RL1B 4JM2B 5K59F 3S8GB 4PVNA 2QLVB 4XXDA 4BINA 5C09B 4LEXL 4TQEH 2R8SH 1E6OH 3V4LA 1Q0YH 2QKIA 2YGVA 4JFZL 1YC7A 4X4MA 3WTYA 3PIQB 2C3XA 2Y7LA 5B1AB 4FABL 2RGSA 1K8DA 4MXVF 4PG9A 5IFAH 1NCNA 1PAMA 1O6VA 1SJMA 3BUBA 4GMTL 4ELKB 3EJZC 1WUNT 1JF1B 3TBTB 1AHMA 4FHJA 4HIXH 1U58A 3D4ZA 1UWYA 2QQQA 1MCLA 3LQAL 3VXQA 4JMNA 1X5MA 4YNYA 5DO8A 2E4FA 4KQ4H 1QBMH 3WG7B 4OI7A 3I6KB 4IS6A 2X4OA 5G4MA 5F7WC 4LCIH 4DGUA 4AUYA 3X1FA 3VGAC 4PJXA 3TNMB 2YD4A 4X9BA 4KK8D 1WHOA 3P73A 4L8DA 4PGDB 2CH8A 4GAYB 1UKQA 4HAKA 3UGXA 2CBOA 2YOAA 4JUSA 4L3AA 3B6SB 5FS5A 2WB1A 4ZZKA 4LSTH 4APXA 3N9GH 5IHWA 2CR3A 2Q2EB 1NCDL 4BHUI 2JKLA 3SQOH 5CEZL 5HDBB 2R2CA 4QRSB 1L9OA 3EZ8A 2XY2A 4PJIB 2W0LA 1RMFH 4J8RB 5BS0B 5EFIA 1T2JA 2IDTA 4JRFA 3U36B 2C7UB 2DM4A 4C57C 4RZCB 2IAMD 3ELQA 3O11B 4WNJA 4X5WA 3H9SD 4S1QH 1JE6A 4YGVB 1JZ7A 3GSNA 3K0WA 3VG9C 3VM7A 3FONB 5HGAB 4TRPH 4FLSA 3LN5A 4PCSA 4J6IA 4PJ9D 3B9DA 4MQ7A 3FRPB 5LB1A 2E9WA 5PCYA 5ILTL 5GS0L 4JN1H 1JK9B 3KLAA 5C08E 4ORZC 1O5PA 2VIRA 3BRGC 1CJYA 4ODTH 5BVPL 2L04A 1NC4A 2KQMA 5JDSA 5ID1B 3FQTA 1IM3D 1FE8H 3RWDB 3TONA 1MHEB 3ESUF 3G6JE 4LPCA 4WO4B 2Y23A 3VXUE 2YGOA 2F1BA 4WEBL 5IR1A 5MEQA 1UA3A 2R7EA 3EFDL 4NYLA 1T22A 2Z65C 3QJOA 1WD8A 2GT9A 4TXVB 2JJUA 5TDPA 5BMFL 5HHPA 2GEEA 2Y1VA 1AI1H 3X3GH 1F4WH 3B9KD 4M03A 4WU5B 5JOFA 1E90A 2YK1H 3ARDB 1DVQA 2CLZB 1SRDA 4U0QB 5D96C 2DIBA 1E4WL 3WO4C 3CVIL 5EF0A 1AKJB 1YUHA 1QO3A 3C6SA 1INDH 3KYAA 4XN2A 5C0EB 3MNDA 4MD4B 4OZHE 3AG2B 3EOBA 2Y5TB 1CGVA 3ZMRA 3D18A 2O5NA 1J1OL 3Q2CA 2XXCB 1MCWM 4PRPE 4E5XA 2F19H 2WVSA 2BP0A 4N9GA 1HN1A 4ZBJA 1JZEA 3CN3A 4WW2A 1DLFL 1C5CL 4MX7B 2GB2A 5C6PB 5JORA 4QJ3B 2XPZA 4XMKL 1WT5C 2GJZA 4LRNH 4LSPL 5LDUA 4PWJA 3BWSA 3Q5TA 4AZUA 3EO1B 4D0DA 1AGBA 5I6KA 1HHJA 3D12B 4U1JA 1RZFL 3IS0X 3DARA 1ZSDB 4L1DA 5HGHA 1KN2H 1JNLH 1SN0A 2J8OA 3BEVB 3ILPB 2R29H 5AENA 1TUPA 4Z7VB 2X4RB 3ZHLA 5DK0A 3KPLB 2UXGA 4LLQB 4PIRF 5FWQA 1TNMA 3L5XH 2KUTA 4U6TA 1GZHC 3VXRD 5C0JB 4JRLA 1AQKL 2XWEA 3UZQA 2E74C 4P9HH 5KYUA 2HTKC 2EDWA 2ZXWB 4MNQE 5AKRA 3Q6FA 4TNFA 3KLSA 4A04A 2OMZB 2ZUUA 1WEJL 1ZT4B 3FFCA 1FL3A 3HCVB 4XPHH 1L4IA 1BZQK 1CD1B 3FUKA 5C09D 3EYVB 2VDKB 5C0AD 3RPIA 3WI9A 1Z2KA 3QJZA 3QUYC 2WP3O 3NJJA 1FHGA 1LNUB 3UP6A 4F92B 1TU2A 3GBML 1IKFL 3N0AA 2AXGB 1IFHL 2NY0D 1DZ0A 3T4AA 1RVFL 2VSKB 1P7KB 3CX5J 4RGOL 1W72L 2XV0A 2D9QB 2FEDD 1HH6A 2LU5A 4UNUA 3GBNH 2NNAB 5E2TH 1AP2B 3TIEA 4BZ1A 4GY4A 1Z9PA 3TV8A 2QZ5A 3HC4H 2QVMA 3IMWA 4XI5C 5DC9B 1LQBC 2EDNA 3WLBA 1GAFL 3OJVC 4Z0BH 1TJGL 1YECH 2E7DA 2VN5A 3EBIA 3MGOB 5IVXE 1KYDA 2XV6B 1CFTB 1H3GA 4X0KB 3EH5B 4M4RA 4KJYB 4BFKA 4LHUB 4M9PA 3JYBA 4UZGA 4UOQA 4K8RH 4ODVH 3UDWC 3CFUA 4A2MA 1XBRA 4HPYH 5FGBA 5JHLA 4A68A 4QI3A 3AQXA 4V33A 3VI3B 1CWVA 2OZ4H 4MAYB 4PN6A 2LR4A 1ZLDA 3QORA 4B9ZA 2GC7C 4P2CG 2JB6A 4RFNB 3GXUB 2FSEA 4H26B 3VDAA 3KJ4C 3WFBH 3US1A 3G6JA 5IWLA 1KFGA 3M7OA 4G6FD 4G7YH 4V2BA 4Y8AA 2JWYA 3HLAB 4X99B 1SOSA 5I1KH 1DVFB 1Q90A 4NRYA 1MCBA 5E4OA 3RVVC 1ZAGA 1UM5L 2B5IB 1TVHA 3LS4L 4JE4B 4B60A 1XCTA 4UAOC 5E2WH 2AKRA 1FV1A 1KIPA 4HLZH 5IMOB 4K7PX 5CSBA 5AOJA 3K6IA 5I19L 1WYJA 4FXGC 5D7IF 4XNQB 3LRLA 2FE0A 3G04A 3L3OC 2A9NH 3GLAA 2AMGA 1IL1B 2ARWA 3FO1B 3J8F7 3ESMA 2FR4A 4GUOA 3MN8A 5CN3A 4QMEA 4H25B 5FGCB 5ISZB 1XGZA 5BV7B 3GMNA 5C0CA 3KDPB 1G9HA 1S7UA 3GBEA 1RERA 2X3BA 3TO4C 5C07B 2QPUA 1FORH 2MJWA 4MJ4A 3SYQA 2Z35B 1GS7A 1JTPA 4OI9A 1XIWA 4CU8A 1BVLB 1IRAY 3GS0A 3N42B 2NY3D 4HH8A 1XTMA 4L0ZA 4MCZA 4Q0XL 1NCGA 4YAQB 1JCVA 2B0SH 1X5LA 3M46A 2FL5B 5KSVA 1NM9A 1JNHB 3C60D 1TO5A 4WI2A 4XMPH 4Y19A 4XVTH 4HDIB 1KZYA 2NUPB 4Z7UF 5E8DH 2VM3A 2G4EA 3V79C 1G9MH 1XF2B 3ARDD 2XWRA 3UGEA 3QAZC 3T2LA 1P2CB 1NDTA 3DBXB 4HWBA 1AKJD 3ZDZF 3SKJH 1OP3H 4MASA 4ZDHB 2CNZA 2DH3A 3DJRA 4L4TD 1NL0L 2CJUL 5JOEA 2ZIDA 1NIDA 2YJLA 1OAZH 5IM7B 5A2CA 1A9VA 3QPKA 2B8OT 5T3ZL 5AB2A 4M1DL 1C7SA 5KJRL 2YOCA 3A4AA 4MNHA 2OMXB 4ZPVA 4HUVB 1N7ML 3MNMA 2NT1A 3QCTH 1XH2A 1A22B 5LXVA 1AZCA 1CTOA 2YMTA 4EN3D 2G5RA 3P11H 4I0PD 5KANG 1D6EA 4GH7B 4I9XA 4PJBF 1ZRUA 4F15C 5D2LF 4Z95H 5LBVA 5I6XB 1HL4A 3T0EB 3BIKA 4O02H 2Z8RA 4POZD 3BD3A 5E08L 1CDYA 2DQJH 3GNMH 4HS8L 4AIZA 3V5HB 5D1ZC 3GIZH 1E8YA 3D25B 1MUJA 4HK3N 1CLZH 2VH5L 3VSUA 1MCCA 2P5WD 2ITEA 1QNZH 1VFOA 2WGXA 1FVDB 4JMXA 5IB3A 4WFED 5SWZB 5I66B 1S9KC 3T2OA 1Z3GL 4LOUC 1HCYA 4PB9H 5DHDA 1RCYA 1FZJA 4XXCA 2IG2L 4HQQL 4PJAE 4G5ZH 5TQ2H 3WXWH 3BOVA 1TQUA 1A6TA 2H32A 2FHBA 1JVOA 2M83A 1IAIH 2FBOJ 4N0FA 1BDYA 1QZNA 5I1IL 4GS7C 2VABB 1RZ8B 2VR5A 3VMNA 3W9DA 1V27A 2AITA 1HK6A 4NUPA 5E95B 1DCLA 4PUBL 4OF5A 3OLEA 3BP5B 1CGWA 2MNJB 1UD6A 2FGWL 1I7TB 4J3TA 1LMIA 1Z9SA 3DX8B 1EO8H 2JLPA 4QHMA 2WMPA 5AOKA 1ET5A 1PKOA 1RIVH 5D5MB 2PXYC 4UT9L 2EINB 2GFBA 4NKIH 1P6WA 3QUMH 5K1NA 1EZVX 4MBOA 1MQKH 3CUPB 2Z9TA 1R0AH 4GIAA 3MUJA 4YXKH 2X1WL 3GGWA 5ITBL 2ITCA 4WEMB 5D72H 5EU7C 5B7FA 5IJCC 4JO1H 5GGVY 4HJ0C 4QY8A 1TEGA 1KB3A 1RIHH 4ZSOB 3S35H 2AI0H 1U3HA 2EEXA 1AFVH 1JN6B 4U7MA 3RWCB 2F54E 2WYTA 2ZAIA 4JX0A 3VRLF 2DM3A 2K3TA 4FL4B 1AXIB 4NGHH 4S1RH 1IKOP 3B83A 1RP8A 3VE0B 4EKXA 3MQIA 3BKCL 4I13B 1LO3H 2AZAA 4RGNE 1DQDH 1IKNC 4GRLD 4ZXBD 1TVDA 2ATKB 2AGJL 2W0FA 4JE0A 3Q3GB 3CQPA 1X4XA 1E28B 3G5VB 4YEEA 1NCWL 2BZDA 4OGYL 4Q56A 1F90H 2OJEB 3NJFA 4P9MH 1NEZG 3TEUA 4GAJL 2CD0A 5FUOH 3AWFA 2X05A 4NXKA 4YHIB 4GJTB 3AT0A 3CFIC 3SPIA 1KB5A 1ACYL 2AAVA 4NDMB 4ZO7A 1OAUH 4K9JA 3SBPA 3GSXB 4AYFA 4OI8A 4JFXA 1P7QD 3DETD 3VRIA 4TSBH 3NJMA 1HEJC 1BHGA 4P46B 4I8DA 2NY2B 4OLUH 5FUCC 4JNXA 1CG9B 5BQ7A 4M6NH 3F6LA 2CGRL 1WZ1L 4MYWB 4ICXA 4I88A 1XBDA 3UMTA 3FT2A 2C3HA 1YNKH 4F9LC 2XDHA 3BP6A 2FQDA 3CV5A 1SXAA 3MOAH 4F27A 4N25A 1C08B 1R46A 1SOXA 2F8OA 3QNXB 4U1HA 5F9OL 2HMID 5EMYA 1NEPA 2NXZC 2XN9E 2ZCLH 1OP3K 1ZSHA 1D5MA 2YBGA 2E7HA 5E9DB 3C6EA 3OJDB 2CA3A 4PJAA 3WAKA 1AD0A 5F8RC 5I1EL 1UJ3A 3QZLA 1N70A 4IHBA 4KRMB 4PCTA 1SJHB 5IQ7L 1FYTE 1W8NA 4O2CB 1QBLL 4XNUH 3B37A 1O6TA 4NN5C 3S5LA 1ZT1B 5D7KD 4KX9A 5DD6B 2JJSA 1BQRA 4LB8A 3NGBB 2M1KA 4KKBD 5HJGA 4G11A 4NT6B 3ZE2B 5DZAA 2HJKA 3GSVB 1O9ZA 2JTYA 2MTPA 3EOTL 1I7ZB 3BSHA 3ZQ9A 3GSNL 4XBGB 4I5BB 4E41D 2BIIA 5GGUB 4A7GA 4F7PB 1CBVL 3SPVA 1D9KA 3ZRFC 5MEPA 5C6TL 2Y1AA 3BW9A 3CQQA 3QDGE 3UO1H 3MOBL 3IJSB 1Y6KR 4AKPA 5LBSH 2W0PA 3Q6GH 5LLIC 2PABA 1WCBA 1KJVB 3K1KC 1IGTB 3VI4F 4OLYH 2OXGB 3HZMA 3CLEL 2ATPB 4BWWA 4XBPB 4TOYH 1KY7A 1XWVA 4XOEA 4WK4B 1VESA 3RY4A 2EO9A 2GITA 5A3ID 1OARL 1IV8A 3MLRL 2BERA 1WFJA 4MZ2A 5FGSA 3K4ZA 4XCFH 4ZX6A 3BPNC 4UV7L 4CW1B 3L7FB 3RL2A 3D85A 2B20A 5TD4A 5I5IA 3PREA 3GRWH 5EORL 1A2YB 2EC9T 1XCQB 4J28A 5HYSA 4NM4L 2EDBA 4OLVH 4KGJA 7TAAA 2KS0A 3GZOA 1FO0H 1S9XA 1J0HA 3FT4A 2ZXGA 1P53A 5DJCA 1KELL 5L2JB 1XL6A 2ZYHA 4PGBB 5D1QC 2WUCH 5CLXA 3V0EA 3LRGA 1SEBB 4ECNA 1HE8A 3VWJB 1DQKA 1GGTA 1FSKC 3QUHA 4GI6A 2DMCA 1DVTA 2XFXB 3PL6C 3FCUB 3D4CA 4J3SA 1XSOA 3OKLB 4MBRA 2DTML 3LN9A 3VFPA 4B9FA 3VX0A 2AQPA 3B2UC 3IDXH 4ZMQA 2JELH 4X98B 1V10A 2ZICA 2YD6A 3U2SA 4L8SA 4M7ZC 2P8LA 3QFDB 4RA3A 2IEPA 5G4NA 5ABZA 1CI3M 1UOLA 1S9VA 3DX9B 4S1SL 4XP9L 4R5TA 4YSUA 5FV1L 3U6RA 3QBTB 1Z7JA 2CM6A 1MJ8L 1E6JL 1RUQL 2IPUK 4HJGA 2H5UA 5IB2A 2VXTH 4PCKA 3EJSA 3TLRA 2GBVA 3ZKQD 3SDCC 5HVWA 3NEXA 2EEAA 4MNGB 1NPUA 3IXAA 3GJFA 4XBEH 1QR1B 3TVMC 4W68A 2D0HA 5F9JA 3QPXH 4JQIA 1KCUH 3KYOA 2XWXA 4IU2B 4H1LH 4JKPH 1U33A 2E6QA 3KGUA 4ZMXA 4PVBA 1K9TA 4H0HB 1UZ8B 2X1QA 2EEFA 1UZGA 3A67L 1UT2A 1O9VA 1FYTA 4OGAD 5CZVL 1WBXB 2I32A 2DLIA 4WWID 4Z0XA 1S3KL 3DIDA 2XIBA 3E6FA 1UUSA 1XV8A 2X12A 5J06A 3RA7L 4F1SA 5IIEA 2YD5A 4MLIA 3H56A 3D3VA 4HWNA 2RALA 2HLFD 2EE2A 3B9EA 4NZFA 5D6DC 2ZX8A 5IJKA 1E9PA 1HQRB 1DVYA 2J8HA 5ADOH 1OAKL 1Q9OB 1I4FA 5DZPA 1NMCB 2LU3A 2VMEA 1Y7VA 3H6AA 4OSUL 4HBQA 1S3RA 2A73B 2YLHA 1TVBA 3KR3L 4LU5H 3QJHB 1NFDE 1AXSB 5E9DD 3HRZB 1OE1A 4XPFH 1UD5A 3F2LA 3KXFB 4NKOB 4ZO6A 2JJTA 1R1CA 2A0LC 3MLVH 3NA9L 2JNZA 5HHQB 2VLRB 4NAJA 2YQBA 5BO1H 2WNKA 2YA0A 1QRNA 1C12A 3NESA 7CGTA 4HX1B 2E9BA 4Y1AB 1YQVL 3HN3A 1G7LB 1USZA 5JQ6H 3PXJA 3EJZD 1F0LA 1T20B 1AS8A 3QDMB 2XZCH 5F93C 4J3UA 4HKXA 5HTSA 3WUWG 4Y5VC 2H0JA 2X2YA 3FU7B 3CVDA 4X6DB 1F11A 2ZP0T 2H1XA 3VGGA 5AW2B 1JNNL 4EI0A 1J1XH 1T21B 4HD5A 1Q9LB 4UQDA 3WKMH 1KJ2H 4UV4L 1S7VA 5DZOA 1ADQL 3ULSA 4B9CA 4EI5C 5I0YA 5L8JB 4UM8B 1XZWA 4XB8A 1DVZA 4F2MA 5IP4A 3TH2T 3GFUA 1OB1A 5IFJA 5DHEA 1U6AL 4I18C 1H8NA 3BHBB 1ORSB 4FFZA 3RDTA 3M86A 3L17A 1DSFH 1UVQA 5KVEH 3U25A 5ERWA 2F53A 3BX7C 1IEBA 3UEQA 3P4NB 1CE6A 4ONGL 2NZ9D 2PW2B 2ZPKH 3DHPA 5D6CB 1QSEA 5I2IB 1IE5A 3AITA 5IBTH 1P5UC 1KCVL 2APXA 4JPKL 3C8KB 5JNYA 4HMDA 3PGFL 3ECBB 1DBAH 3UJTL 4OZ4A 1YYML 3DGDA 5GRVK 1Z9OA 1D5BA 3QG7L 2BVQB 2VZ1A 4Q9QL 3ULUH 4MJIA 5B8CB 5IUCA 2AK4B 3T04D 1AXTH 1KTJA 2YO3A 4LSVL 2CJTA 2HG0A 1A3RH 1YYCA 5SX4I 5AVUB 3VWJD 4JDTH 5JPMA 2BCMA 2W1NA 1FG2B 1EXGA 4RDQG 5E2JA 1DVUA 1FFOB 5BZWA 2JJVA 3TPUB 1CDUA 4BQ9A 1MH5A 2GAZB 4UDTB 3O6FC 3QIBA 1OE3A 3C5ZA 3V6ZA 1WIPA 1X4YA 2J4WL 3HE6C 4GBXA 4X5PA 5LN4A 2WLMA 3TF4A 1RJYB 1A7NH 2IF7A 4LCYB 4OFKA 5FM4A 3ZIYA 1WJ3A 2B39A 1CF8L 5CINH 1BM3L 3X13A 3U4AA 1P9MC 2AQ2A 2DEWX 4G72B 3MUUA 1NCBL 1SYSB 2WWOA 3QZBA 1HOCA 1HCFX 3SE9L 2OYPA 1EO5A 4N1HB 2XXMB 3FAWA 3SBWC 1R33A 4FG4A 5FECB 2BHZA 4ZW5A 3SB3A 5CP3A 1IGYB 4N2FA 4XP6L 3H9YA 4MMZC 3PHQA 3ME0A 4P2OB 5E94B 4QKTA 1FBIL 3LMJL 1EANA 4JFED 5B1JA 4NQXB 3CXDL 2QDVA 4Y2OB 5J1TC 3IFOB 1BAGA 1H3UA 1FZOB 3TCLA 2W8CA 4YSQA 4PW4A 5IW1B 3UYRH 2RQEA 3I85A 4NO2A 1XR8A 1NMAL 3QE5A 2PCPA 4MAUL 1I9JH 4ODHH 2H3NA 4EZLA 4ZQTA 2QSCL 1DLHB 5DRNB 1HEZA 4ERSH 2DQFA 4JY5H 1JVLA 4PR5B 1IC1A 1FJ1A 1XF5A 3QEGL 3H6JA 3SJVB 5C0DA 2EIMB 3MSPA 4O9HH 1RPKA 4G59C 4DP6X 2VDMH 5DLMH 1GJIA 1JHTA 3QDJE 5GGVL 4QRFA 1UWEL 1BXUA 1VKXA 5T1LD 4CC4C 5AW6B 1KOAA 2ZOLB 2W9LA 1I82A 4KTDH 3CU7A 3VXSD 3VRJB 3BYYA 3WMPA 5JW5B 2W92A 2NTFB 4Z7QB 4PRHB 2WXRA 3WLWC 3X12B 2AJ3B 1BVOA 1GYWA 3JT0A 4R0LB 4JFWA 4NQSA 1XAUA 3CTTA 5EEYA 3CWGA 1MCKA 1KIQA 1OCZB 4XMLH 1UURA 4ZFFA 3ZYZA 1L0XA 4R2GC 3QDMD 2PYED 4HLZG 4N90E 5A16A 4TQPA 2LQRA 3MV7B 2BIHA 1DE4A 2C1PA 1Y6MR 3P9LA 2DLFL 2BWQA 4MRBA 3U30C 4XI5D 3MBEA 5E7BA 3K2UH 1O75A 4LNRA 1KV7A 3KPNA 2NX5A 5F44A 5DVMA 3S0PA 1C1EL 4G80B 4TVPD 2CUAA 4LQFH 1TFPA 4XZUB 5IMMB 5B39G 2X4NA 4DVRL 1JPFA 3RZCC 2CO4A 4PBXA 5G5DA 4BZYA 2R2HB 1JDCA 4W70A 1P1ZB 1INEH 3SGJA 1EAJA 4GP4B 1U8HB 2YD2A 3TBBA 3VJ6A 1G7MB 3HI6L 1H3WM 1Y18B 4V1DD 2CPCA 4MA3A 2FNWA 4RLDA 5HY9B 4YUEH 1KB5L 2DWEA 2OYMA 3FQ4A 4IBYA 3CMOH 1B9ZA 2VDOL 2AJZA 4KXBA 4P2QD 3V6OA 1BFVL 5FW7A 3BZ5A 1KCRH 3MU3A 4GKSB 3RVVD 3T0BA 1MFAL 4E5XG 1RZ7H 2PCFB 2XG4A 3GF8A 4M3HA 1T80A 2VRAA 3ZZLA 4Y2NA 2YUVA 4U33A 1LMKA 4PV9A 4M3JA 4XC3L 4A2LA 4OZGF 4NC1E 4YQXL 1D7CA 3NCYP 4QF1A 1CFMA 1BEYL 4HV8A 1KBGH 1W16A 3ZYIA 2AEQL 4M1CC 3DJZA 3CZSA 3JTSB 4LKCB 1OOAA 2ZUSA 4NWUL 1DUZB 3K4AA 5E5RB 3N91A 5LCVA 4AL8C 2X6UA 2YFNA 1MI5D 2KLRA 4U6XB 3TNNA 3H42L 3C5JA 3QI9B 2BNRD 2BIPA 4MCMA 4WHYH 3FQWB 2IH1B 5HHMB 1X6LA 3CC5B 3FB5A 2B1HH 2ICEC 3BZDA 2XTJC 3H55A 3CVHH 3O2DA 5TE4H 4IIQB 4RGNC 2X4QA 4TQ8A 3KYNB 4G8EB 4UINH 4FQLH 2GVYA 2BNQE 2JK5B 3G5YB 4POUB 3U4KA 2DQTL 3DKHA 3MUHL 4J12A 4YHKL 1ZLSH 3EZJB 3MV8B 2XWJB 4RDQF 4XNXL 2LLNA 4LVHC 5FCUL 1S9WA 3DVNB 1EAPA 1DDTA 1UYWL 3FUMA 4X6FA 4FP8H 1ROWA 3U6XS 1A6UL 1MRFH 1QNIA 2XBZA 4L5FE 3SPHA 1JIBA 1OHQA 2ZJSL 1G7JB 3RU8H 4E9YA 3VD2A 3ULUC 4DERA 4OGXH 3L08A 4JKLA 4OT1H 4X2UA 1QX1A 2DQCL 2ZWSA 3J07A 5E1HB 3BRFA 1IFGA 5DJ6B 4JFYA 3SCMC 3EBAA 2XQYA 2X6BA 2ZF9A 4JZJB 1O6SB 2IALB 2DQEH 3NACL 3LKNB 5DHXB 1NLDH 1WISA 4PMFA 5CILL 1D6VH 3OXSA 3QUGA 3LKRB 4FQ2H 3SGDI 4GMTH 5K9KA 1DBML 3OGCA 4G8AC 2WP3T 2QZQA 2YXFA 2Z1PA 4KVCL 4U1LB 5D7LB 4AL8L 4CU7A 4XNZC 4XH2A 1FDLH 3HC0A 4XWGL 2DWYA 2JXMB 4QXUH 1S7RA 2X4SB 4L9LB 3LDBC 2AXWA 2GABA 3U0TA 2YAQA 1MCPL 1DEDA 1N4XH 5IB5A 1RU9H 1CYWA 3CK0L 4WVRA 5DJ2A 1A4AA 2Z31A 5D1ZD 2A6DB 2TSBA 2FSDA 3IDGA 2AJXL 3MXVH 4OIIL 1KXHA 1MPAH 1I3UA 3PWPE 4PTUB 5DC0A 1V7NL 2ZNXA 3OHMB 4YFLF 1OPGH 3MGTB 5L0QB 5GRUH 1KTCA 1DSYA 2YD7A 2CMRL 1A1NB 3I2CL 3MRNB 5GGQL 1QEWA 5D9SB 4OZIB 2B4CH 4YL9A 3WMQA 4M6OL 1JGEB 3P9WB 1JAEA 3LV3A 1HHIB 5KUMA 1EHAA 4LCCA 2WQUA 4DOHE 2VQ4A 2KDGA 3OQRA 4GKNB 3RPKA 3PJLA 2I7OA 1I85C 2WVUA 5JXEA 2FIRT 2BHFA 4FNLH 1MCDA 5AAMC 1B2YA 4F8QA 2BOBA 3RGVA 4MKMA 2EDKA 2C3WA 4R97C 5C0IA 4FYTA 5AYQA 1U8KB 1NWPA 1VEPA 4F7TB 4O02B 1Q72H 4PH8A 1IJNA 2XETA 3BJ91 5I1HH 1DJSA 2PPDA 2VQ1A 3F65A 5FA4A 2QR0A 5KS9E 1EERB 1KXTB 2EYRA 4FFVC 4W9IC 2DLTA 3HUJB 4TQIA 1DEEB 2BRRH 3CH1B 4FLQA 5FB8A 4QRRD 1S2EA 2N59A 3LKSA 5E6IC 2PXYD 2IANB 4JQIL 1MJJB 1P84K 1QSFB 3QVAA 5E00A 3D4GA 1MCFA 4HXBH 2EICA 1H6EA 4K3DL 1SJEA 4IRJC 4L2LA 2FO8A 4JM2A 1KNOB 5AYUL 3BGMA 1FF5A 3REVA 3EH4B 2XI9A 2OYLA 4HJ0D 2VXUH 1LE5A 2NNXA 4DF9A 1SLXA 4NSKA 5CD3A 1ZE3H 4PW3A 3WTUA 3WJMA 5KW9H 3HZKA 3GPSA 4NN7B 3ZDYE 3IETB 3TBTA 1GGBL 3Q8FA 4H0LC 4RGMB 5F1SA 3UTSA 5I18L 4WW1B 5DS8B 1LO5A 1J1PL 3VGFA 3N85H 1RZIB 1OTTC 4HZ1A 5DMJB 1B0IA 1S5IH 4WW2F 3MJWA 4HXAH 3I3EA 1N0XH 4JFSA 5BRZB 2HT4D 3TNMA 1TO4A 1WTLA 2HKAA 4J3OC 3SZ6A 5LWYH 5J6GA 4H40A 4UNVA 3FBQA 2DDQL 1D5ZB 1F3JA 3NCWA 4U1NB 4PI0A 3MV8D 3MRQB 3T3ME 5DDHA 4HG4K 5KJ7E 4FTVD 2ADJB 2IDSA 1JK8B 4TPRL 3MRBA 3QAQA 4JJHA 4RQQB 2NY6C 4ZTPH 4YWGL 1P6AB 3T09A 5DD0H 5BS0A 5GGTH 3WUZA 3QIWB 1RJLB 2C7UA 4AH2B 2VITB 3VD4A 2PCXA 4KKAD 4NQCE 2MHAB 1A4BA 1CLOH 4KPHL 4F3FB 3PWPA 3RTQB 1J7VR 4BWUA 4KOCA 3G5XB 1ZT7B 1EAQA 2JI1A 5HGAA 1A1MA 1QI5A 4XO5A 5HGDB 3TM6A 5KVFE 4OV6F 5CBEB 5JHAA 4I0KA 4AIOA 6PAZA 3BO8B 4JO3L 2IO5A 4JY4A 4KK5C 3B8SA 1YEJL 3GI9L 3QISA 4IYKA 5TDOB 1AANA 2R1WB 4FFZL 2VRQA 2QQNL 5ID1A 1R9FA 4FQ1H 3TFKC 4IRSA 5E56A 3ML8A 4Y4KB 2GPZA 3INOA 1NAMH 3JWNH 4XPGH 5GS2D 3WFCL 5KS9A 5LQBL 4BSWA 4Z5RA 3BISA 1QFWL 2A2QT 4TLUA 4DVBA 1WGVA 1CD9B 3UAJC 3MCLH 4WU5A 4L3EB 1UWFA 2YJQA 1QOKA 3O9WB 3D39D 4EIBA 3G6JF 2GG1A 3AABA 2DLGA 1VCBC 3IFLL 2EIKB 3VFOB 1ZVSB 2AVFA 4FQXA 4E68A 4Q89A 2V2XB 2Y5TA 3LKPA 3L2NA 5I15H 3IE4A 3QZWG 5GZOC 3VFGH 1U8PA 1ZLVH 4U3XA 2VLJB 1I1YB 2YPVH 5JYLA 4NBYB 1Y0LB 1JERA 4IJ3B 5MP6H 2R15A 3SDAC 5K9JL 2V2TB 3PXHA 4K23L 1KWGA 4OD2A 3AWGA 4DZBB 3L5JA 4JKWA 1KEMH 4NKMA 1B2WL 5DJYB 1A5FH 3FCTA 1EZLA 2XY1A 3EO1A 1JHLH 3L95A 1GVIA 3FF8A 4OZHF 1EEZA 3P2DA 4XXWC 5ACLA 3C9NB 4HGWB 1DQIA 1NGWB 1UWGL 3R06B 4QHPA 5CN1A 2X4RA 2WZPA 3WIFB 3S98A 1YY8B 1V7ML 9PCYA 2MMXA 3DPBB 3GBLA 5CN2A 4YDJB 5K9OA 5TF0A 4RMVA 2H9GA 3BWAA 4L3CB 2IWEA 1OAQH 1PYWB 2IAND 3BDYH 1BOGB 3H2QA 1L9SA 3NCEB 2B4CC 4QRPA 2PWDA 1TZOA 5D1QD 4L05A 2ATAA 3CFCL 2OMZA 5E6ZA 3QO0A 1ZT4A 1A6VL 1KGXA 3PLYA 1L0PA 15C8H 4DUVA 2QHLA 3O6LL 4J27A 4QXGL 4AM0A 4BFFA 3KWWA 4YBHA 4H13C 3B2UD 5IEHB 1KN4H 3FULA 4J3BA 3PGCA 4PJHE 4XVOA 2OL3H 5C08D 1X5XA 2PP9A 3GZKA 2W88A 3BJLA 1B6DA 3PFUA 1BBDH 1NOLA 1CIDA 2VZSA 5TH2B 4BQBA 2NNAA 4FI8A 3NQKA 4BDVA 1N3NA 4LLWB 1CL7L 1KGIA 1XF4B 3VGHA 3CZNA 2EJ1A 1J9RA 4QOKE 1BOYA 4ZK8A 3U48A 3VXUD 5EDSA 1MLCA 4MQTB 5ABAA 3MRRB 4CSSA 4ISVA 4CN4A 2MNWA 3LEYL 2CO2A 1GS6X 4ZODA 5BOZG 5I71B 1NKGA 2DQ6A 1FO0B 3SDCD 3WNLA 3EYUL 4KJYA 4A2FA 1F3DJ 5SWSB 1YNTA 2BLFA 2VL5A 2CDEA 3LQZB 3TVMD 4XC1L 2HRHA 1QI3A 3PHSA 3EAKA 3VH8A 3FN0L 3VI3A 3WYRA 1G43A 4ABQA 1HZKA 1JZHA 4XNMB 1I75A 2F58L 3VFWB 2MQGA 2G60L 2AQRA 5FYLE 4L48A 5IVXF 4HH9A 3D69B 3QA3B 5DMKB 1U8IB 1ZE3C 5DJXB 5DS2A 5F9WB 1ETZB 2MH4A 1NBVH 1CXIA 4OCWL 4ODUB 1QSVA 4PRPD 1HWGB 2ADGB 1CU4L 4U49A 1CCZA 4HWZA 2VAJA 3VD9A 4BZ2A 1VAHA 4GLRH 4AJVA 3AWEA 3D4YA 4Y5XA 3KJ6H 1ZEAL 3RTQD 4AMXA 4D8PB 2J12B 5IOKA 2A77H 1MZZA 5TE6H 1FNEA 4XNQA 1GA2A 3DWTA 2IBZX 5IV2B 4CJ0A 4HUKB 4L4VB 4M5YH 2PR4L 5AW9B 5INCA 5FO9B 3JYCA 2FYVA 3WEXB 1XFPA 3AREC 3D2TA 4H25A 1XB3A 3LPWA 3BVNB 4X4XB 3QP3A 5DJDA 2YRPA 2A0LD 2OZNA 5HYSG 2CO6B 5J0BA 2NQCA 1YYLL 1WFOA 5JIKA 3MRJA 2OPCA 4LAQH 3M6DA 4O00A 4PRIE 3L13A 3HB3C 3ZE1B 2ODIA 1XL4A 2VAAA 5B7EA 1B0RA 2JKXA 4GEJA 3OKKA 4IEFA 5GISL 3EYOA 3TTSA 1NMBH 1U3NA 1FRGL 4RWYH 3ZR5A 4IKJA 2NY1C 4F91B 4EUPH 3SPGA 4WV1A 1JPTL 2X0UA 4HDIA 4HD9A 2WTRB 2VISA 4NN6B 1XF2A 4W93A 3DBXA 5LCVL 2BW5A 2G2NA 4IBTA 1QFPA 2NYKA 1REIA 2PYFB 5C7XL 4EI5D 5EUKA 4DUXA 43C9A 3VFRA 4Z7NE 1KUMA 2VLJD 2ZKWA 4QAMB 4IOFC 3MRPB 3O2DL 3HNSH 1CICB 4N87A 2Y4SA 2L4OA 5E2UH 3DIFA 3PWVB 1LO0L 3GLDA 1AGCA 2E8YA 1OGTB 2PPEA 4AV0A 3T1FB 3HC3H 4Y5YA 4ETQB 1T0MA 2BY1A 4LLUB 5EUOA 5C8JA 5DO2C 4N2MA 3NZ8B 3BGAA 1ZLVK 3VFSA 1PEZA 2WZAA 3FQRB 2EDQA 4K07A 5HI3C 4K2UH 1RZKL 4IQHA 4OFIA 5DD3H 4MCYA 2Y24A 4MS6A 2Q87A 2D7NA 1N59B 3ARWA 3P3RA 3IDIA 4QOKA 5D93B 3WO3B 4YDLB 3AGVA 2XNAB 25C8L 2P8MB 3JSSA 4DGVH 2W07A 4RVBA 1WQVT 1JRHH 3D7PA 3D25A 1HYRC 4NNYB 4NO0A 3ZE0B 3MLWH 1DQJB 3IM1A 3TIDA 1G1OA 4B96A 5D7IB 2ORBL 4NC1C 1OSZB 3RNKA 5KVGH 2TAAA 2X2HA 4RAVA 2DD8L 2Y3NA 4FQPA 4Y16C 4OCSL 2AJVL 3FF7A 3KPQA 4Y9FA 1I7RA 4APQC 4Y9BA 5KN5B 3C8HA 3HE6D 3IDJA 2B9BA 2WKGA 1IBDA 3EJYC 5E4IA 3ZKMC 3EGXB 1PMYA 2GJJA 1SYVB 2HKFL 4M7JL 2CGRH 4R7NB 2BNUB 3ZGHA 2CK0L 5F72S 2QPEB 1XT5A 5GRYA 1KIRB 3VFUB 1CGYA 2ZWYA 4Q2ZA 4M7LL 1D2OA 2X89D 3GM8A 2YD0A 3FFDB 5FW8A 4UU9A 1EDHA 3BP5A 3MRCA 1ED3B 4X5XB 1RJZA 3NTCH 3ZQXA 4E9LA 3K6SB 4Z7UB 3TYGH 4ABVA 4PJAF 3CFJA 1VADB 4CMHB 4CKQA 1IQWH 3NYKA 1NAKH 2ZKHH 3HG0A 4OKVB 1PBYA 5IT2L 3ZDZB 4YO0A 1FFPB 2WKOF 3DUUB 1N6QH 1O7DE 4AENA 4ODBD 2EH7H 3EGSB 3MLYL 1MRCH 3F12A 1EXUB 3ESNA 4UT7H 2BH0A 3TT1H 2GK0B 3SHSA 3MLZL 3LB6C 3SDDB 5L88L 1DP0A