3D8VA

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
479
structure length
478
Chain Sequence
MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title Structure and function of GlmU from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 173
structure length 478
sequence length 479
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3d8vA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3d8vA01
4IRPA 3I0GA 4IHFA 1LVWA 1FRWA 2YQSA 4JD0A 4FRHA 3ZLLA 1KWSA 3V0LA 4D11C 3MC4A 4NAIA 1WT1A 4FRMA 1H3MA 3E26A 3CKVA 2FY7A 4G3QA 4ASJA 2FFUA 1G95A 5FUHA 4HO5A 4EQYA 3MQGA 3R0SA 3SPTA 5IDSA 1O7QA 1KK4A 1JYKA 3E25A 1INJA 1KGTA 5CQNX 1H5TA 3MQHA 2O1FA 4N6BA 3V91A 1MR7A 3RMVA 2JCLA 5DEMA 1ZJ0A 2WVLA 3U2WA 5ADXV 4J18A 2NXVA 1OMZA 3OH3A 3CKQA 5AJNA 3VBNA 4LW3A 1QRMA 2X5SA 1QG8A 3K8EA 2ZU7A 1V83A 2YQHA 1INIA 4HOCA 1G3LA 3OUPA 3IGJA 2W0VA 2VS3A 1VZUA 3PNNA 4HUSA 4HO9A 3BSWA 4Y6NA 3BFPA 3NGWA 1GWVA 1H5SA 2QIVX 2MZBA 1FR8A 3CKOA 4P00A 1ZI4A 5HS2A 1FXOA 1R7VA 3T7MA 5AFUV 3PMOA 2QGIA 1IIMA 3Q4SA 1JVGA 4EA9A 2YQJA 3DJ4A 4IRQA 2AM5A 4HURA 2I7BA 1FG5N 2WVKA 1GWWA 4XWIA 1KHRA 2E3DA 3Q7UA 2VSIA 2QH5A 3P47A 2WAWA 1T3DA 2FYCB 3VBLA 3ZGFA 3I3XA 3GVDA 5DEPA 2YESA 1VGUA 1VGTA 1LL3A 1VZTA 4KNXA 5C3DA 2JCOA 1IINA 1VH3A 1MRLA 5CQMX 3P1BA 1R7XA 1HM9A 3V4EA 3SX7A 1R7YA 3OAMA 1ZJ2A 2X5ZA 3TV0A 3Q1XA 1YP4A 1VICA 4KC4A 4E75A 3SXEA 3TWDA 1LXAA 4Y7FA 4E6TA 4ECMA 3V0OA 1G97A 5DDTA 4FCEA 3PKQA 5FU0A 4AYLA 4KPZA 4FRAA 4NAKA 4IHGA 2FKOA 3FSYA 1I52A 1SS9A 3D5NA 4HO0A 4EAAA 1ZI5A 2DPWA 3KWCA 3R2WA 2ICXA 2PGVA 4UEGA 2WLDA 3IXCA 4ASYA 3U2XA 3OH1A 1FXJA 1ZJ1A 1JYLA 5EJZA 5C47A 1W57A 2RJ5A 1ZCUA 5E3RA 2P72A 3HJJA 3V8YA 1H7GA 1XHBA 3GOSA 1LZJA 1V84A 2Q4JA 5EIYA 1VH1A 3RSBA 1O23B 3I0IX 5JQQA 2XMHA 1TW5A 4B4BA 3TK8A 1SSMA 1XZ6A 3USQA 4LW6A 3CJ8A 1O7OA 2ICYA 4B5BA 1MP4A 1FGXA 1R7UA 1PZYB 2OI6A 1NMMB 4EA7A 3ST8A 3JTJA 3RMWA 4KC1A 3U0YA 1H7HA 1S4NA 2RJ9A 1E5KA 2VFZA 3VBPA 3Q80A 3F1XA 2FYAA 1FGGA 4CJ8A 4EGGA 3V0MA 1FOAA 1V67A 1ZI3A 3R5AA 3I0JA 4Y7TA 4Y63A 1KK5A 2VD4A 2FFVA 3CKJA 2RIYA 3TZTA 3C8VA 2RIJA 1R81A 3SXBA 3T57A 1O0RA 4IHHA 2AGDA 4KXOA 2AESA 1H5SD 1NQIB 3U0XA 5CQPA 3PKPA 5C8RA 3DK5A 2XATA 1LL0A 3I0DA 1ZJOA 3KIAA 1TVYA 1ZHJA 4KRVA 1V3WA 3NZ2A 3TIOA 4E79A 2AM3A 4GBPA 1YROB 3I0EA 1KRVA 4Y62A 5E3PA 4BQHA 4M9CA 2PX7A 3EH0A 3R8YA 3FSCA 1ON8A 2YC5A 4EEAA 1YP2A 2W0WA 3R5BA 1QGQA 4Y64A 2VS4A 3I0LA 1H7QA 4CVHA 2RIZA 3QVBA 2JCKA 1R82A 4DECA 2NPOA 3FWWA 2GGQA 3U2TA 4JISA 2AM4A 4DE7A 4M98A 1G8OA 1H5TB 1QRFA 1NWGB 2RJ8A 4J09A 4FRQA 3V0NA 2WLCA 1MP3A 1S4PA 4EEOA 2WLGA 1G2VA 2Y6PA 4P02A 2WEEA 3GUEA 3R1WA 5C4DA 1ZI1A 2O1HA 2Y4LA 1QGSA 3OH0A 1VZXA 2I5EA 2RIXA 5CQOA 4HO2A 1WT2A 4MNDA 1JVDA 3OKRA 4M2AA 3SX3A 3KWEA 4Y7GA 4EE4A 5FTSA 1H5SB 1MP5A 4H7OA 1LZ7A 3VBMA 4HO4A 3I3AA 2BO7A 4HO8A 3K8DA 2D0JA 1G93A 2WVMA 2XMEA 1EZIA 4B42A 1TDTA 1XATA 3D8VA 3TISA 4B3UA 1H4DA 2BO4A 1FO9A 2Z87A 4R37A 4N27A 1JV3A 5FYEA 2JF2A 1MC3A 2YQCA 2ZU8A 4KT7A 2YCMA 4HZDA 2X60A 5FU8A 2AE7A 2V0JA 3V8ZA 4FROA 2AECA 4KQLA 3JUJA 2APCA 1YP3A 1H5RA 1FWYA 2FYBA 3SXAA 1OMXA 4Y9XA 4G87A 1H4EA 1HM8A 1JV1A 1QWJA 1ZJ3A 4CJCA 4EVWA 1ZCYA 3SX5A 4B2WA 5BXCA 4BMAA 5IDTA 1HJJA 1NHEB 1NKHB 2BO8A 2TDTA 1HJLA 2Y4MA 4DDZA 1W77A 4MYOA 3I0KA 2BO6A 2RITA 3U2VA 2RJ7A 1THJA 5AFUU 4AA7A 2CU2A 2YC3A 1MR9A 1LZ0A 2RJ0A 2V0LA 3V0QA 2Y4KA 4YS8A 5CQLX 5L6VA 4EA8A 3SXCA 1QQ0A 4E1KA 5C4CA 5IFYA 1S80A 2A8UA 2OI5A 2XWNA 3BCVA 3V90A 1ZCTA 4N6AA 5CMFX 1Z90A 5EJ1A 4AYJA 3SXGA 1FO8A 4MZUA 2WGZA 3BXYA 3R5DA 2Z86A 4MFGA 2IC7A 3VBJA 5C3AA 3I0CA 2V0HA 5C3BA 3BSYA 4ARWA 3I0FA 2PGYA 4Y7UA 1V82A 2RJ4A 3CKNA 2GGOA 5C1HA 1R7TA 1ZDFA 2PA4A 3ECTA 3IOJA 4FQWA 2IU9A 4D48A 1QREA 1QRGA 2P6WA 3R3RA 2VSHA 3TDTA 1G9RA 3FOQA 5F42A 3IOIA 3EEVA 4FRLA 4HO6A 5DG3A 2RJ1A 1SSQA 3CU0A 4ZDQA 5C48A 2V0IA 3HL3A 5AJOA 3JQYA 4HZCA 3IOHA 2IU8A 4G3SA 1OCXA 1GX0A 1SSTA 3LW6A 3HSQA 2ZU9A 5CMHA 3OTMA 3R5CA 5AJPA 1KRUA 2V0KA 4G3PA 1FZWA 1GA8A 3USRA 5C38A 2VXMA 3EG4A 4R36A 2A8WA 4B4GA 4Y6UA 4MYBA 4KPXA 1WVCA 4FRPA 5J49A 1PZTA 3T7NA 2X65A 1LZIA 3SXDA 2P73A 1W55A 3FSBA 3ZGGA 1G0RA 2I5KA 3SRTA 1WT0A 1KGQA 2VXLA 2FYDB 4EEGA 2O1GA 1HV9A 3T7OA 3CGXA 1KK6A 4NANA 1KRRA 5FTVA 4ISXA 1FR9A 1TW1A 3ZLKA 2E8BA 3I0HA 1LL2A 1H4CA 2QKXA 3OH4A 4CJBA 1WSZA 3OTZA 1VGZA 2D7RA 1H5SC 3FTTA 3DUVA 3R3IA 2UX8A 2P2OA 2AQ9A 2WLFA 4M28A 2XWLA 5C1GA 3V0PA 2IUAA 1EYRA 1GQCA 2Y4JA 5E3QA 1KQAA 4EABA 3VNPA 5C4FA 1H7LA 4Y7VA 3SX8A 4HG6A 4R7PA 2OEFA 1GX4A 1H7EA 3JUKA 4N69A 4EE5A 1VPAA 1S4OA 2RJ6A 5C4BA 1VM8A 1G23A 5ADXU 1HM0A 3VBKA 1R80A 1J2ZA 3D98A 4K6RA 4FREA 1XHDA 3O3PA 3FSXA 4HO3A 1ZIZA 1K4VA 1TZFA 5CMJA 1NF5B 5FV9A 4KC2A 1QRLA 4EE3A 4M4KA 3OGZA 4AAWA 4KNRA 4DCLA 1H7FA 3OC9A 5C4EA 1G1LA 5DDVA 4B4MA 3OH2A 3FS8A 4D0ZA 2JF3A 3OW5A 2JCJA 2OI7A 1VGWA 4E6UA 4NALA 3ZF8A 3F1CA 5C1LA 5C36A 2D7IA 4FCUA 5C49A 3POLA 5L6SA 4HCQA 3OU9A 5I1FA 2AH9A 3BRKX 4B2XA 1ON6A 3BSSA 2VS5A 5CMIA 2WE9A 2WLEA 2XWMA 1ZDGA 4D11A 2OEGA 4D0TA 1GQ9A 1ZJPA 2VHEA 3DHOA 4M2BA 3F1YA 4M99A 3KWDA 3U2UA 1H7TA 1OQMB 5CMGX 4EEMA 2Y7AA 3EE5A 4FRDA 3TQDA 1H5RB 2QIAA 4FRBA 3VBIA 4L41C 4C2SA 1ZCVA 3N9WA 1WT3A 4AC3A 5U2KA
chains in the Genus database with same CATH superfamily
4IRPA 3I0GA 4IHFA 1LVWA 1FRWA 2YQSA 4JD0A 4FRHA 3ZLLA 1KWSA 3V0LA 4D11C 3MC4A 4NAIA 1WT1A 4FRMA 1H3MA 3E26A 3CKVA 2FY7A 4G3QA 4ASJA 2FFUA 1G95A 5FUHA 4HO5A 4EQYA 3MQGA 3R0SA 3SPTA 5IDSA 4FIYA 1O7QA 1KK4A 1JYKA 3E25A 1INJA 1KGTA 5CQNX 1H5TA 3MQHA 2O1FA 4N6BA 3V91A 1MR7A 3RMVA 2JCLA 5DEMA 1ZJ0A 2WVLA 3U2WA 5ADXV 4J18A 2NXVA 3OH3A 1OMZA 3CKQA 5AJNA 3VBNA 4LW3A 1QRMA 2X5SA 1QG8A 3K8EA 2ZU7A 1V83A 2YQHA 1INIA 4HOCA 1G3LA 3OUPA 3IGJA 2W0VA 2VS3A 1VZUA 3PNNA 4HUSA 4HO9A 3BSWA 4Y6NA 3BFPA 3NGWA 1GWVA 1H5SA 2QIVX 2MZBA 1FR8A 3CKOA 4P00A 1ZI4A 5HS2A 1FXOA 1R7VA 3T7MA 5AFUV 3PMOA 2QGIA 1IIMA 3Q4SA 1JVGA 4EA9A 2YQJA 3DJ4A 4IRQA 2AM5A 4HURA 2I7BA 1FG5N 2WVKA 1GWWA 4XWIA 1KHRA 2E3DA 3Q7UA 2VSIA 2QH5A 3P47A 2WAWA 1T3DA 2FYCB 3VBLA 3ZGFA 3I3XA 3GVDA 5DEPA 2YESA 1VGUA 1VGTA 1LL3A 4MIXA 1VZTA 4KNXA 5C3DA 2JCOA 1IINA 1VH3A 1MRLA 5CQMX 3P1BA 1R7XA 1HM9A 3V4EA 3SX7A 1R7YA 3OAMA 1ZJ2A 2X5ZA 3TV0A 3Q1XA 1YP4A 1VICA 4KC4A 4E75A 3SXEA 3TWDA 1LXAA 4Y7FA 4E6TA 4ECMA 3V0OA 1G97A 5DDTA 4FCEA 3PKQA 5FU0A 4AYLA 4KPZA 4FRAA 4NAKA 4IHGA 2FKOA 3FSYA 1I52A 1SS9A 3D5NA 4HO0A 4EAAA 1ZI5A 2DPWA 3KWCA 3R2WA 2ICXA 2PGVA 4UEGA 2WLDA 3IXCA 4ASYA 3GQ9A 3U2XA 3OH1A 1FXJA 1ZJ1A 1JYLA 5EJZA 5C47A 1W57A 2RJ5A 1ZCUA 5E3RA 2P72A 3HJJA 3V8YA 1H7GA 1XHBA 3GOSA 1LZJA 1V84A 2Q4JA 5EIYA 1VH1A 3RSBA 1O23B 3I0IX 5JQQA 2XMHA 1TW5A 4B4BA 3TK8A 1SSMA 1XZ6A 3USQA 4LW6A 3CJ8A 1O7OA 2ICYA 4B5BA 1MP4A 1FGXA 1R7UA 1PZYB 2OI6A 1NMMB 4EA7A 3ST8A 3JTJA 3RMWA 4KC1A 3U0YA 1H7HA 1S4NA 2RJ9A 1E5KA 2VFZA 3VBPA 3Q80A 3F1XA 2FYAA 1FGGA 4CJ8A 4EGGA 3V0MA 1FOAA 1V67A 1ZI3A 3R5AA 3I0JA 4Y7TA 4Y63A 1KK5A 2VD4A 2FFVA 3CKJA 2RIYA 3TZTA 3C8VA 2RIJA 1R81A 3SXBA 3T57A 1O0RA 4IHHA 2AGDA 4KXOA 2AESA 1H5SD 1NQIB 3U0XA 5CQPA 3PKPA 5C8RA 3DK5A 2XATA 1LL0A 3I0DA 1ZJOA 3KIAA 1TVYA 1ZHJA 4KRVA 1V3WA 3NZ2A 3TIOA 4E79A 2AM3A 4GBPA 1L0SA 1YROB 3I0EA 1KRVA 4Y62A 5E3PA 4BQHA 4M9CA 2PX7A 3EH0A 3R8YA 3FSCA 1ON8A 2YC5A 4EEAA 1YP2A 2W0WA 3R5BA 1QGQA 4Y64A 2VS4A 4O6MA 3I0LA 1H7QA 4CVHA 2RIZA 3QVBA 2JCKA 1R82A 4DECA 2NPOA 3FWWA 2GGQA 3U2TA 4JISA 2AM4A 5D91A 4M98A 4DE7A 1G8OA 1H5TB 1QRFA 1NWGB 2RJ8A 4J09A 4FRQA 3V0NA 2WLCA 1MP3A 1S4PA 4EEOA 2WLGA 1G2VA 2Y6PA 4P02A 2WEEA 3GUEA 3R1WA 5C4DA 1ZI1A 2O1HA 2Y4LA 3OH0A 1QGSA 1VZXA 2I5EA 2RIXA 5CQOA 4HO2A 1WT2A 4MNDA 1JVDA 3OKRA 4M2AA 3SX3A 1Z2FA 3KWEA 4Y7GA 4EE4A 5FTSA 1H5SB 1MP5A 4H7OA 1LZ7A 3VBMA 4HO4A 3I3AA 2BO7A 4HO8A 3K8DA 2D0JA 1G93A 2WVMA 2XMEA 1EZIA 4B42A 1TDTA 1XATA 3D8VA 3TISA 4B3UA 1H4DA 2BO4A 1FO9A 2Z87A 4R37A 4N27A 1JV3A 5FYEA 2JF2A 1MC3A 2YQCA 2ZU8A 4KT7A 2YCMA 4HZDA 2X60A 1N4IA 5FU8A 2AE7A 2V0JA 3V8ZA 4FROA 2AECA 4KQLA 3JUJA 2APCA 1YP3A 1H5RA 1FWYA 2FYBA 3SXAA 1OMXA 4Y9XA 4G87A 1H4EA 1HM8A 1JV1A 1QWJA 1ZJ3A 4CJCA 4EVWA 1ZCYA 3SX5A 4B2WA 5BXCA 4BMAA 5IDTA 1HJJA 1NHEB 1NKHB 2BO8A 2TDTA 1HJLA 2Y4MA 4DDZA 1W77A 4MYOA 3I0KA 2BO6A 2RITA 3U2VA 2RJ7A 1THJA 5AFUU 4AA7A 2CU2A 2YC3A 1MR9A 1LZ0A 2RJ0A 2V0LA 3V0QA 2Y4KA 4YS8A 5CQLX 5L6VA 4EA8A 3SXCA 1QQ0A 4E1KA 5C4CA 5IFYA 1EWWA 1S80A 2A8UA 2OI5A 2XWNA 3BCVA 3V90A 1ZCTA 4N6AA 5CMFX 1Z90A 5EJ1A 4AYJA 3SXGA 1FO8A 4MZUA 2WGZA 3BXYA 3R5DA 2Z86A 4MFGA 2IC7A 3VBJA 2J0BA 5C3AA 3I0CA 2V0HA 5C3BA 3BSYA 4ARWA 3I0FA 2PGYA 4Y7UA 1V82A 2RJ4A 3CKNA 2GGOA 5C1HA 1R7TA 1ZDFA 2PA4A 3ECTA 3IOJA 4FQWA 4O6NA 2IU9A 4D48A 1QREA 1QRGA 2P6WA 3R3RA 2VSHA 3TDTA 1G9RA 3FOQA 5F42A 3IOIA 3EEVA 4FRLA 4HO6A 5DG3A 2RJ1A 1SSQA 3CU0A 4ZDQA 5C48A 2V0IA 3HL3A 5AJOA 3JQYA 4HZCA 3IOHA 2IU8A 4G3SA 1OCXA 1GX0A 1SSTA 3LW6A 3HSQA 2ZU9A 5CMHA 3OTMA 3R5CA 5AJPA 1KRUA 2V0KA 4G3PA 1FZWA 1GA8A 3USRA 5C38A 2VXMA 3EG4A 4R36A 2A8WA 4B4GA 4Y6UA 4MYBA 4KPXA 1WVCA 4FRPA 5J49A 1PZTA 3T7NA 2X65A 1LZIA 3SXDA 2P73A 1W55A 3FSBA 3ZGGA 1G0RA 2I5KA 3SRTA 1WT0A 1KGQA 2VXLA 2FYDB 4EEGA 2O1GA 1HV9A 3GQ8A 4FIXA 3T7OA 3CGXA 1KK6A 4NANA 1KRRA 5FTVA 4ISXA 1FR9A 1TW1A 3ZLKA 2E8BA 3I0HA 1LL2A 3OH4A 2QKXA 1H4CA 4CJBA 1WSZA 3OTZA 1VGZA 2VK9A 2D7RA 5D92A 1H5SC 3FTTA 3DUVA 3R3IA 3GQ7A 2P2OA 2UX8A 2AQ9A 2WLFA 4M28A 2XWLA 5C1GA 3V0PA 2IUAA 1EYRA 1GQCA 2Y4JA 5E3QA 1KQAA 4EABA 3VNPA 1M8NA 1H7LA 4Y7VA 3SX8A 5C4FA 2C0NA 4HG6A 4R7PA 2OEFA 1GX4A 1H7EA 3JUKA 4Q7CA 4N69A 4EE5A 1VPAA 1S4OA 2RJ6A 5C4BA 1VM8A 1G23A 5ADXU 1HM0A 3VBKA 1R80A 1J2ZA 3D98A 4K6RA 4FREA 1XHDA 3O3PA 3FSXA 4HO3A 1ZIZA 1K4VA 1TZFA 5CMJA 3GQAA 1NF5B 5FV9A 4KC2A 1QRLA 4EE3A 4M4KA 3OGZA 4AAWA 4KNRA 4DCLA 1H7FA 3OC9A 5C4EA 1G1LA 5DDVA 4B4MA 3OH2A 3FS8A 4D0ZA 2JF3A 3OW5A 2JCJA 2OI7A 1VGWA 4E6UA 4NALA 3ZF8A 3F1CA 5C1LA 5C36A 2D7IA 4FCUA 5C49A 3POLA 5L6SA 4HCQA 3OU9A 5I1FA 3SUCA 2AH9A 3BRKX 2J0AA 4B2XA 1ON6A 3BSSA 2VS5A 5CMIA 2WE9A 2WLEA 2XWMA 1ZDGA 4D11A 2OEGA 4D0TA 1GQ9A 1ZJPA 2VHEA 3DHOA 4M2BA 3F1YA 4M99A 3KWDA 3U2UA 1H7TA 1OQMB 5CMGX 4EEMA 2Y7AA 3EE5A 4FRDA 3TQDA 1H5RB 2QIAA 4FRBA 3VBIA 4L41C 4C2SA 1ZCVA 3N9WA 1WT3A 4AC3A 5U2KA
chains in the Genus database with same CATH topology
4IRPA 3I0GA 4IHFA 1LVWA 1FRWA 2YQSA 4JD0A 4FRHA 3ZLLA 1KWSA 3V0LA 4D11C 3MC4A 4NAIA 1WT1A 4FRMA 1H3MA 3E26A 3CKVA 2FY7A 4G3QA 4ASJA 2FFUA 1G95A 5FUHA 4HO5A 4EQYA 3MQGA 3R0SA 3SPTA 5IDSA 4FIYA 1O7QA 1KK4A 1JYKA 3E25A 1INJA 1KGTA 5CQNX 1H5TA 3MQHA 2O1FA 4N6BA 3V91A 1MR7A 3RMVA 2JCLA 5DEMA 1ZJ0A 2WVLA 3U2WA 5ADXV 4J18A 2NXVA 1OMZA 3OH3A 3CKQA 5AJNA 3VBNA 4LW3A 1QRMA 2X5SA 1QG8A 3K8EA 2ZU7A 1V83A 2YQHA 1INIA 4HOCA 1G3LA 3OUPA 3IGJA 2W0VA 2VS3A 1VZUA 3PNNA 4HUSA 4HO9A 3BSWA 4Y6NA 3BFPA 3NGWA 1GWVA 1H5SA 2QIVX 2MZBA 1FR8A 3CKOA 4P00A 1ZI4A 5HS2A 1FXOA 1R7VA 3T7MA 5AFUV 3PMOA 2QGIA 1IIMA 3Q4SA 1JVGA 4EA9A 2YQJA 3DJ4A 4IRQA 2AM5A 4HURA 2I7BA 1FG5N 2WVKA 1GWWA 4XWIA 1KHRA 2E3DA 3Q7UA 2VSIA 2QH5A 3P47A 2WAWA 1T3DA 2FYCB 3VBLA 3ZGFA 3I3XA 3GVDA 5DEPA 2YESA 1VGUA 1VGTA 1LL3A 4MIXA 1VZTA 4KNXA 5C3DA 2JCOA 1IINA 1VH3A 1MRLA 5CQMX 3P1BA 1R7XA 1HM9A 3V4EA 3SX7A 1R7YA 3OAMA 1ZJ2A 2X5ZA 3TV0A 3Q1XA 1YP4A 1VICA 4KC4A 4E75A 3SXEA 3TWDA 1LXAA 4Y7FA 4E6TA 4ECMA 3V0OA 1G97A 5DDTA 4FCEA 3PKQA 5FU0A 4AYLA 4KPZA 4FRAA 4NAKA 4IHGA 2FKOA 3FSYA 1I52A 1SS9A 3D5NA 4HO0A 4EAAA 1ZI5A 2DPWA 3KWCA 3R2WA 2ICXA 2PGVA 4UEGA 2WLDA 3IXCA 4ASYA 3U2XA 3OH1A 1FXJA 1ZJ1A 1JYLA 5EJZA 5C47A 1W57A 2RJ5A 1ZCUA 5E3RA 2P72A 3HJJA 3V8YA 1H7GA 1XHBA 3GOSA 1LZJA 1V84A 2Q4JA 5EIYA 1VH1A 3RSBA 1O23B 3I0IX 5JQQA 2XMHA 1TW5A 4B4BA 3TK8A 1SSMA 1XZ6A 3USQA 4LW6A 3CJ8A 1O7OA 2ICYA 4B5BA 1MP4A 1FGXA 1R7UA 1PZYB 2OI6A 1NMMB 4EA7A 3ST8A 3JTJA 3RMWA 4KC1A 3U0YA 1H7HA 1S4NA 2RJ9A 1E5KA 2VFZA 3VBPA 3Q80A 3F1XA 2FYAA 1FGGA 4CJ8A 4EGGA 3V0MA 1FOAA 1V67A 1ZI3A 3R5AA 3I0JA 4Y7TA 4Y63A 1KK5A 2VD4A 2FFVA 3CKJA 2RIYA 3TZTA 3C8VA 2RIJA 1R81A 3SXBA 3T57A 1O0RA 4IHHA 2AGDA 4KXOA 2AESA 1H5SD 1NQIB 3U0XA 5CQPA 3PKPA 5C8RA 3DK5A 2XATA 1LL0A 3I0DA 1ZJOA 3KIAA 1TVYA 1ZHJA 4KRVA 1V3WA 3NZ2A 3TIOA 4E79A 2AM3A 4GBPA 1YROB 3I0EA 1KRVA 4Y62A 5E3PA 4BQHA 4M9CA 2PX7A 3EH0A 3R8YA 3FSCA 1ON8A 2YC5A 4EEAA 1YP2A 2W0WA 3R5BA 1QGQA 4Y64A 2VS4A 4O6MA 3I0LA 1H7QA 4CVHA 2RIZA 3QVBA 2JCKA 1R82A 4DECA 2NPOA 3FWWA 2GGQA 3U2TA 4JISA 2AM4A 5D91A 4M98A 4DE7A 1G8OA 1H5TB 1QRFA 1NWGB 2RJ8A 4J09A 4FRQA 3V0NA 2WLCA 1MP3A 1S4PA 4EEOA 2WLGA 1G2VA 2Y6PA 4P02A 2WEEA 3GUEA 3R1WA 5C4DA 1ZI1A 2O1HA 2Y4LA 1QGSA 3OH0A 1VZXA 2I5EA 2RIXA 5CQOA 4HO2A 1WT2A 4MNDA 1JVDA 3OKRA 4M2AA 3SX3A 3KWEA 4Y7GA 4EE4A 5FTSA 1H5SB 1MP5A 4H7OA 1LZ7A 3VBMA 4HO4A 3I3AA 2BO7A 4HO8A 3K8DA 2D0JA 1G93A 2WVMA 2XMEA 1EZIA 4B42A 1TDTA 1XATA 3D8VA 3TISA 4B3UA 1H4DA 2BO4A 1FO9A 2Z87A 4R37A 4N27A 1JV3A 5FYEA 2JF2A 1MC3A 2YQCA 2ZU8A 4KT7A 2YCMA 4HZDA 2X60A 5FU8A 2AE7A 2V0JA 3V8ZA 4FROA 2AECA 4KQLA 3JUJA 2APCA 1YP3A 1H5RA 1FWYA 2FYBA 3SXAA 1OMXA 4Y9XA 4G87A 1H4EA 1HM8A 1JV1A 1QWJA 1ZJ3A 4CJCA 4EVWA 1ZCYA 3SX5A 4B2WA 5BXCA 4BMAA 5IDTA 1HJJA 1NHEB 1NKHB 2BO8A 2TDTA 1HJLA 2Y4MA 4DDZA 1W77A 4MYOA 3I0KA 2BO6A 2RITA 3U2VA 2RJ7A 1THJA 5AFUU 4AA7A 2CU2A 2YC3A 1MR9A 1LZ0A 2RJ0A 2V0LA 3V0QA 2Y4KA 4YS8A 5CQLX 5L6VA 4EA8A 3SXCA 1QQ0A 4E1KA 5C4CA 5IFYA 1S80A 2A8UA 2OI5A 2XWNA 3BCVA 3V90A 1ZCTA 4N6AA 5CMFX 1Z90A 5EJ1A 4AYJA 3SXGA 1FO8A 4MZUA 2WGZA 3BXYA 3R5DA 2Z86A 4MFGA 2IC7A 3VBJA 2J0BA 5C3AA 3I0CA 2V0HA 5C3BA 3BSYA 4ARWA 3I0FA 2PGYA 4Y7UA 1V82A 2RJ4A 3CKNA 2GGOA 5C1HA 1R7TA 1ZDFA 2PA4A 3ECTA 3IOJA 4FQWA 4O6NA 2IU9A 4D48A 1QREA 1QRGA 2P6WA 3R3RA 2VSHA 3TDTA 1G9RA 3FOQA 5F42A 3IOIA 3EEVA 4FRLA 4HO6A 5DG3A 2RJ1A 1SSQA 3CU0A 4ZDQA 5C48A 2V0IA 3HL3A 5AJOA 3JQYA 4HZCA 3IOHA 2IU8A 4G3SA 1OCXA 1GX0A 1SSTA 3LW6A 3HSQA 2ZU9A 5CMHA 3OTMA 3R5CA 5AJPA 1KRUA 2V0KA 4G3PA 1FZWA 1GA8A 3USRA 5C38A 2VXMA 3EG4A 4R36A 2A8WA 4B4GA 4Y6UA 4MYBA 4KPXA 1WVCA 4FRPA 5J49A 1PZTA 3T7NA 2X65A 1LZIA 3SXDA 2P73A 1W55A 3FSBA 3ZGGA 1G0RA 2I5KA 3SRTA 1WT0A 1KGQA 2VXLA 2FYDB 4EEGA 2O1GA 1HV9A 4FIXA 3T7OA 3CGXA 1KK6A 4NANA 1KRRA 5FTVA 4ISXA 1FR9A 1TW1A 3ZLKA 2E8BA 3I0HA 1LL2A 1H4CA 2QKXA 3OH4A 4CJBA 1WSZA 3OTZA 1VGZA 2VK9A 2D7RA 5D92A 1H5SC 3FTTA 3DUVA 3R3IA 2UX8A 2P2OA 2AQ9A 2WLFA 4M28A 2XWLA 5C1GA 3V0PA 2IUAA 1EYRA 1GQCA 2Y4JA 5E3QA 1KQAA 4EABA 3VNPA 5C4FA 1H7LA 4Y7VA 3SX8A 2C0NA 4HG6A 4R7PA 2OEFA 1GX4A 1H7EA 3JUKA 4Q7CA 4N69A 4EE5A 1VPAA 1S4OA 2RJ6A 5C4BA 1VM8A 1G23A 5ADXU 1HM0A 3VBKA 1R80A 1J2ZA 3D98A 4K6RA 4FREA 1XHDA 3O3PA 3FSXA 4HO3A 1ZIZA 1K4VA 1TZFA 5CMJA 1NF5B 5FV9A 4KC2A 1QRLA 4EE3A 4M4KA 3OGZA 4AAWA 4KNRA 4DCLA 1H7FA 3OC9A 5C4EA 1G1LA 5DDVA 4B4MA 3OH2A 3FS8A 4D0ZA 2JF3A 3OW5A 2JCJA 2OI7A 1VGWA 4E6UA 4NALA 3ZF8A 3F1CA 5C1LA 5C36A 2D7IA 4FCUA 5C49A 3POLA 5L6SA 4HCQA 3OU9A 5I1FA 2AH9A 3BRKX 2J0AA 4B2XA 1ON6A 3BSSA 2VS5A 5CMIA 2WE9A 2WLEA 2XWMA 1ZDGA 4D11A 2OEGA 4D0TA 1GQ9A 1ZJPA 2VHEA 3DHOA 4M2BA 3F1YA 4M99A 3KWDA 3U2UA 1H7TA 1OQMB 5CMGX 4EEMA 2Y7AA 3EE5A 4FRDA 3TQDA 1H5RB 2QIAA 4FRBA 3VBIA 4L41C 4C2SA 1ZCVA 3N9WA 1WT3A 4AC3A 5U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRP A;  3I0G A;  4IHF A;  1LVW A;  1FRW A;  2YQS A;  4JD0 A;  4FRH A;  3ZLL A;  1KWS A;  3V0L A;  4D11 C;  3MC4 A;  4NAI A;  1WT1 A;  4FRM A;  1H3M A;  3E26 A;  3CKV A;  2FY7 A;  4G3Q A;  4ASJ A;  2FFU A;  1G95 A;  5FUH A;  4HO5 A;  4EQY A;  3MQG A;  3R0S A;  3SPT A;  5IDS A;  1O7Q A;  1KK4 A;  1JYK A;  3E25 A;  1INJ A;  1KGT A;  5CQN X;  1H5T A;  3MQH A;  2O1F A;  4N6B A;  3V91 A;  1MR7 A;  3RMV A;  2JCL A;  5DEM A;  1ZJ0 A;  2WVL A;  3U2W A;  5ADX V;  4J18 A;  2NXV A;  1OMZ A;  3OH3 A;  3CKQ A;  5AJN A;  3VBN A;  4LW3 A;  1QRM A;  2X5S A;  1QG8 A;  3K8E A;  2ZU7 A;  1V83 A;  2YQH A;  1INI A;  4HOC A;  1G3L A;  3OUP A;  3IGJ A;  2W0V A;  2VS3 A;  1VZU A;  3PNN A;  4HUS A;  4HO9 A;  3BSW A;  4Y6N A;  3BFP A;  3NGW A;  1GWV A;  1H5S A;  2QIV X;  2MZB A;  1FR8 A;  3CKO A;  4P00 A;  1ZI4 A;  5HS2 A;  1FXO A;  1R7V A;  3T7M A;  5AFU V;  3PMO A;  2QGI A;  1IIM A;  3Q4S A;  1JVG A;  4EA9 A;  2YQJ A;  3DJ4 A;  4IRQ A;  2AM5 A;  4HUR A;  2I7B A;  1FG5 N;  2WVK A;  1GWW A;  4XWI A;  1KHR A;  2E3D A;  3Q7U A;  2VSI A;  2QH5 A;  3P47 A;  2WAW A;  1T3D A;  2FYC B;  3VBL A;  3ZGF A;  3I3X A;  3GVD A;  5DEP A;  2YES A;  1VGU A;  1VGT A;  1LL3 A;  1VZT A;  4KNX A;  5C3D A;  2JCO A;  1IIN A;  1VH3 A;  1MRL A;  5CQM X;  3P1B A;  1R7X A;  1HM9 A;  3V4E A;  3SX7 A;  1R7Y A;  3OAM A;  1ZJ2 A;  2X5Z A;  3TV0 A;  3Q1X A;  1YP4 A;  1VIC A;  4KC4 A;  4E75 A;  3SXE A;  3TWD A;  1LXA A;  4Y7F A;  4E6T A;  4ECM A;  3V0O A;  1G97 A;  5DDT A;  4FCE A;  3PKQ A;  5FU0 A;  4AYL A;  4KPZ A;  4FRA A;  4NAK A;  4IHG A;  2FKO A;  3FSY A;  1I52 A;  1SS9 A;  3D5N A;  4HO0 A;  4EAA A;  1ZI5 A;  2DPW A;  3KWC A;  3R2W A;  2ICX A;  2PGV A;  4UEG A;  2WLD A;  3IXC A;  4ASY A;  3U2X A;  3OH1 A;  1FXJ A;  1ZJ1 A;  1JYL A;  5EJZ A;  5C47 A;  1W57 A;  2RJ5 A;  1ZCU A;  5E3R A;  2P72 A;  3HJJ A;  3V8Y A;  1H7G A;  1XHB A;  3GOS A;  1LZJ A;  1V84 A;  2Q4J A;  5EIY A;  1VH1 A;  3RSB A;  1O23 B;  3I0I X;  5JQQ A;  2XMH A;  1TW5 A;  4B4B A;  3TK8 A;  1SSM A;  1XZ6 A;  3USQ A;  4LW6 A;  3CJ8 A;  1O7O A;  2ICY A;  4B5B A;  1MP4 A;  1FGX A;  1R7U A;  1PZY B;  2OI6 A;  1NMM B;  4EA7 A;  3ST8 A;  3JTJ A;  3RMW A;  4KC1 A;  3U0Y A;  1H7H A;  1S4N A;  2RJ9 A;  1E5K A;  2VFZ A;  3VBP A;  3Q80 A;  3F1X A;  2FYA A;  1FGG A;  4CJ8 A;  4EGG A;  3V0M A;  1FOA A;  1V67 A;  1ZI3 A;  3R5A A;  3I0J A;  4Y7T A;  4Y63 A;  1KK5 A;  2VD4 A;  2FFV A;  3CKJ A;  2RIY A;  3TZT A;  3C8V A;  2RIJ A;  1R81 A;  3SXB A;  3T57 A;  1O0R A;  4IHH A;  2AGD A;  4KXO A;  2AES A;  1H5S D;  1NQI B;  3U0X A;  5CQP A;  3PKP A;  5C8R A;  3DK5 A;  2XAT A;  1LL0 A;  3I0D A;  1ZJO A;  3KIA A;  1TVY A;  1ZHJ A;  4KRV A;  1V3W A;  3NZ2 A;  3TIO A;  4E79 A;  2AM3 A;  4GBP A;  1YRO B;  3I0E A;  1KRV A;  4Y62 A;  5E3P A;  4BQH A;  4M9C A;  2PX7 A;  3EH0 A;  3R8Y A;  3FSC A;  1ON8 A;  2YC5 A;  4EEA A;  1YP2 A;  2W0W A;  3R5B A;  1QGQ A;  4Y64 A;  2VS4 A;  3I0L A;  1H7Q A;  4CVH A;  2RIZ A;  3QVB A;  2JCK A;  1R82 A;  4DEC A;  2NPO A;  3FWW A;  2GGQ A;  3U2T A;  4JIS A;  2AM4 A;  4DE7 A;  4M98 A;  1G8O A;  1H5T B;  1QRF A;  1NWG B;  2RJ8 A;  4J09 A;  4FRQ A;  3V0N A;  2WLC A;  1MP3 A;  1S4P A;  4EEO A;  2WLG A;  1G2V A;  2Y6P A;  4P02 A;  2WEE A;  3GUE A;  3R1W A;  5C4D A;  1ZI1 A;  2O1H A;  2Y4L A;  1QGS A;  3OH0 A;  1VZX A;  2I5E A;  2RIX A;  5CQO A;  4HO2 A;  1WT2 A;  4MND A;  1JVD A;  3OKR A;  4M2A A;  3SX3 A;  3KWE A;  4Y7G A;  4EE4 A;  5FTS A;  1H5S B;  1MP5 A;  4H7O A;  1LZ7 A;  3VBM A;  4HO4 A;  3I3A A;  2BO7 A;  4HO8 A;  3K8D A;  2D0J A;  1G93 A;  2WVM A;  2XME A;  1EZI A;  4B42 A;  1TDT A;  1XAT A;  3D8V A;  3TIS A;  4B3U A;  1H4D A;  2BO4 A;  1FO9 A;  2Z87 A;  4R37 A;  4N27 A;  1JV3 A;  5FYE A;  2JF2 A;  1MC3 A;  2YQC A;  2ZU8 A;  4KT7 A;  2YCM A;  4HZD A;  2X60 A;  5FU8 A;  2AE7 A;  2V0J A;  3V8Z A;  4FRO A;  2AEC A;  4KQL A;  3JUJ A;  2APC A;  1YP3 A;  1H5R A;  1FWY A;  2FYB A;  3SXA A;  1OMX A;  4Y9X A;  4G87 A;  1H4E A;  1HM8 A;  1JV1 A;  1QWJ A;  1ZJ3 A;  4CJC A;  4EVW A;  1ZCY A;  3SX5 A;  4B2W A;  5BXC A;  4BMA A;  5IDT A;  1HJJ A;  1NHE B;  1NKH B;  2BO8 A;  2TDT A;  1HJL A;  2Y4M A;  4DDZ A;  1W77 A;  4MYO A;  3I0K A;  2BO6 A;  2RIT A;  3U2V A;  2RJ7 A;  1THJ A;  5AFU U;  4AA7 A;  2CU2 A;  2YC3 A;  1MR9 A;  1LZ0 A;  2RJ0 A;  2V0L A;  3V0Q A;  2Y4K A;  4YS8 A;  5CQL X;  5L6V A;  4EA8 A;  3SXC A;  1QQ0 A;  4E1K A;  5C4C A;  5IFY A;  1S80 A;  2A8U A;  2OI5 A;  2XWN A;  3BCV A;  3V90 A;  1ZCT A;  4N6A A;  5CMF X;  1Z90 A;  5EJ1 A;  4AYJ A;  3SXG A;  1FO8 A;  4MZU A;  2WGZ A;  3BXY A;  3R5D A;  2Z86 A;  4MFG A;  2IC7 A;  3VBJ A;  5C3A A;  3I0C A;  2V0H A;  5C3B A;  3BSY A;  4ARW A;  3I0F A;  2PGY A;  4Y7U A;  1V82 A;  2RJ4 A;  3CKN A;  2GGO A;  5C1H A;  1R7T A;  1ZDF A;  2PA4 A;  3ECT A;  3IOJ A;  4FQW A;  2IU9 A;  4D48 A;  1QRE A;  1QRG A;  2P6W A;  3R3R A;  2VSH A;  3TDT A;  1G9R A;  3FOQ A;  5F42 A;  3IOI A;  3EEV A;  4FRL A;  4HO6 A;  5DG3 A;  2RJ1 A;  1SSQ A;  3CU0 A;  4ZDQ A;  5C48 A;  2V0I A;  3HL3 A;  5AJO A;  3JQY A;  4HZC A;  3IOH A;  2IU8 A;  4G3S A;  1OCX A;  1GX0 A;  1SST A;  3LW6 A;  3HSQ A;  2ZU9 A;  5CMH A;  3OTM A;  3R5C A;  5AJP A;  1KRU A;  2V0K A;  4G3P A;  1FZW A;  1GA8 A;  3USR A;  5C38 A;  2VXM A;  3EG4 A;  4R36 A;  2A8W A;  4B4G A;  4Y6U A;  4MYB A;  4KPX A;  1WVC A;  4FRP A;  5J49 A;  1PZT A;  3T7N A;  2X65 A;  1LZI A;  3SXD A;  2P73 A;  1W55 A;  3FSB A;  3ZGG A;  1G0R A;  2I5K A;  3SRT A;  1WT0 A;  1KGQ A;  2VXL A;  2FYD B;  4EEG A;  2O1G A;  1HV9 A;  3T7O A;  3CGX A;  1KK6 A;  4NAN A;  1KRR A;  5FTV A;  4ISX A;  1FR9 A;  1TW1 A;  3ZLK A;  2E8B A;  3I0H A;  1LL2 A;  1H4C A;  2QKX A;  3OH4 A;  4CJB A;  1WSZ A;  3OTZ A;  1VGZ A;  2D7R A;  1H5S C;  3FTT A;  3DUV A;  3R3I A;  2UX8 A;  2P2O A;  2AQ9 A;  2WLF A;  4M28 A;  2XWL A;  5C1G A;  3V0P A;  2IUA A;  1EYR A;  1GQC A;  2Y4J A;  5E3Q A;  1KQA A;  4EAB A;  3VNP A;  5C4F A;  1H7L A;  4Y7V A;  3SX8 A;  4HG6 A;  4R7P A;  2OEF A;  1GX4 A;  1H7E A;  3JUK A;  4N69 A;  4EE5 A;  1VPA A;  1S4O A;  2RJ6 A;  5C4B A;  1VM8 A;  1G23 A;  5ADX U;  1HM0 A;  3VBK A;  1R80 A;  1J2Z A;  3D98 A;  4K6R A;  4FRE A;  1XHD A;  3O3P A;  3FSX A;  4HO3 A;  1ZIZ A;  1K4V A;  1TZF A;  5CMJ A;  1NF5 B;  5FV9 A;  4KC2 A;  1QRL A;  4EE3 A;  4M4K A;  3OGZ A;  4AAW A;  4KNR A;  4DCL A;  1H7F A;  3OC9 A;  5C4E A;  1G1L A;  5DDV A;  4B4M A;  3OH2 A;  3FS8 A;  4D0Z A;  2JF3 A;  3OW5 A;  2JCJ A;  2OI7 A;  1VGW A;  4E6U A;  4NAL A;  3ZF8 A;  3F1C A;  5C1L A;  5C36 A;  2D7I A;  4FCU A;  5C49 A;  3POL A;  5L6S A;  4HCQ A;  3OU9 A;  5I1F A;  2AH9 A;  3BRK X;  4B2X A;  1ON6 A;  3BSS A;  2VS5 A;  5CMI A;  2WE9 A;  2WLE A;  2XWM A;  1ZDG A;  4D11 A;  2OEG A;  4D0T A;  1GQ9 A;  1ZJP A;  2VHE A;  3DHO A;  4M2B A;  3F1Y A;  4M99 A;  3KWD A;  3U2U A;  1H7T A;  1OQM B;  5CMG X;  4EEM A;  2Y7A A;  3EE5 A;  4FRD A;  3TQD A;  1H5R B;  2QIA A;  4FRB A;  3VBI A;  4L41 C;  4C2S A;  1ZCV A;  3N9W A;  1WT3 A;  4AC3 A;  5U2K A; 
#chains in the Genus database with same CATH topology
 4IRP A;  3I0G A;  4IHF A;  1LVW A;  1FRW A;  2YQS A;  4JD0 A;  4FRH A;  3ZLL A;  1KWS A;  3V0L A;  4D11 C;  3MC4 A;  4NAI A;  1WT1 A;  4FRM A;  1H3M A;  3E26 A;  3CKV A;  2FY7 A;  4G3Q A;  4ASJ A;  2FFU A;  1G95 A;  5FUH A;  4HO5 A;  4EQY A;  3MQG A;  3R0S A;  3SPT A;  5IDS A;  4FIY A;  1O7Q A;  1KK4 A;  1JYK A;  3E25 A;  1INJ A;  1KGT A;  5CQN X;  1H5T A;  3MQH A;  2O1F A;  4N6B A;  3V91 A;  1MR7 A;  3RMV A;  2JCL A;  5DEM A;  1ZJ0 A;  2WVL A;  3U2W A;  5ADX V;  4J18 A;  2NXV A;  3OH3 A;  1OMZ A;  3CKQ A;  5AJN A;  3VBN A;  4LW3 A;  1QRM A;  2X5S A;  1QG8 A;  3K8E A;  2ZU7 A;  1V83 A;  2YQH A;  1INI A;  4HOC A;  1G3L A;  3OUP A;  3IGJ A;  2W0V A;  2VS3 A;  1VZU A;  3PNN A;  4HUS A;  4HO9 A;  3BSW A;  4Y6N A;  3BFP A;  3NGW A;  1GWV A;  1H5S A;  2QIV X;  2MZB A;  1FR8 A;  3CKO A;  4P00 A;  1ZI4 A;  5HS2 A;  1FXO A;  1R7V A;  3T7M A;  5AFU V;  3PMO A;  2QGI A;  1IIM A;  3Q4S A;  1JVG A;  4EA9 A;  2YQJ A;  3DJ4 A;  4IRQ A;  2AM5 A;  4HUR A;  2I7B A;  1FG5 N;  2WVK A;  1GWW A;  4XWI A;  1KHR A;  2E3D A;  3Q7U A;  2VSI A;  2QH5 A;  3P47 A;  2WAW A;  1T3D A;  2FYC B;  3VBL A;  3ZGF A;  3I3X A;  3GVD A;  5DEP A;  2YES A;  1VGU A;  1VGT A;  1LL3 A;  4MIX A;  1VZT A;  4KNX A;  5C3D A;  2JCO A;  1IIN A;  1VH3 A;  1MRL A;  5CQM X;  3P1B A;  1R7X A;  1HM9 A;  3V4E A;  3SX7 A;  1R7Y A;  3OAM A;  1ZJ2 A;  2X5Z A;  3TV0 A;  3Q1X A;  1YP4 A;  1VIC A;  4KC4 A;  4E75 A;  3SXE A;  3TWD A;  1LXA A;  4Y7F A;  4E6T A;  4ECM A;  3V0O A;  1G97 A;  5DDT A;  4FCE A;  3PKQ A;  5FU0 A;  4AYL A;  4KPZ A;  4FRA A;  4NAK A;  4IHG A;  2FKO A;  3FSY A;  1I52 A;  1SS9 A;  3D5N A;  4HO0 A;  4EAA A;  1ZI5 A;  2DPW A;  3KWC A;  3R2W A;  2ICX A;  2PGV A;  4UEG A;  2WLD A;  3IXC A;  4ASY A;  3GQ9 A;  3U2X A;  3OH1 A;  1FXJ A;  1ZJ1 A;  1JYL A;  5EJZ A;  5C47 A;  1W57 A;  2RJ5 A;  1ZCU A;  5E3R A;  2P72 A;  3HJJ A;  3V8Y A;  1H7G A;  1XHB A;  3GOS A;  1LZJ A;  1V84 A;  2Q4J A;  5EIY A;  1VH1 A;  3RSB A;  1O23 B;  3I0I X;  5JQQ A;  2XMH A;  1TW5 A;  4B4B A;  3TK8 A;  1SSM A;  1XZ6 A;  3USQ A;  4LW6 A;  3CJ8 A;  1O7O A;  2ICY A;  4B5B A;  1MP4 A;  1FGX A;  1R7U A;  1PZY B;  2OI6 A;  1NMM B;  4EA7 A;  3ST8 A;  3JTJ A;  3RMW A;  4KC1 A;  3U0Y A;  1H7H A;  1S4N A;  2RJ9 A;  1E5K A;  2VFZ A;  3VBP A;  3Q80 A;  3F1X A;  2FYA A;  1FGG A;  4CJ8 A;  4EGG A;  3V0M A;  1FOA A;  1V67 A;  1ZI3 A;  3R5A A;  3I0J A;  4Y7T A;  4Y63 A;  1KK5 A;  2VD4 A;  2FFV A;  3CKJ A;  2RIY A;  3TZT A;  3C8V A;  2RIJ A;  1R81 A;  3SXB A;  3T57 A;  1O0R A;  4IHH A;  2AGD A;  4KXO A;  2AES A;  1H5S D;  1NQI B;  3U0X A;  5CQP A;  3PKP A;  5C8R A;  3DK5 A;  2XAT A;  1LL0 A;  3I0D A;  1ZJO A;  3KIA A;  1TVY A;  1ZHJ A;  4KRV A;  1V3W A;  3NZ2 A;  3TIO A;  4E79 A;  2AM3 A;  4GBP A;  1L0S A;  1YRO B;  3I0E A;  1KRV A;  4Y62 A;  5E3P A;  4BQH A;  4M9C A;  2PX7 A;  3EH0 A;  3R8Y A;  3FSC A;  1ON8 A;  2YC5 A;  4EEA A;  1YP2 A;  2W0W A;  3R5B A;  1QGQ A;  4Y64 A;  2VS4 A;  4O6M A;  3I0L A;  1H7Q A;  4CVH A;  2RIZ A;  3QVB A;  2JCK A;  1R82 A;  4DEC A;  2NPO A;  3FWW A;  2GGQ A;  3U2T A;  4JIS A;  2AM4 A;  5D91 A;  4M98 A;  4DE7 A;  1G8O A;  1H5T B;  1QRF A;  1NWG B;  2RJ8 A;  4J09 A;  4FRQ A;  3V0N A;  2WLC A;  1MP3 A;  1S4P A;  4EEO A;  2WLG A;  1G2V A;  2Y6P A;  4P02 A;  2WEE A;  3GUE A;  3R1W A;  5C4D A;  1ZI1 A;  2O1H A;  2Y4L A;  3OH0 A;  1QGS A;  1VZX A;  2I5E A;  2RIX A;  5CQO A;  4HO2 A;  1WT2 A;  4MND A;  1JVD A;  3OKR A;  4M2A A;  3SX3 A;  1Z2F A;  3KWE A;  4Y7G A;  4EE4 A;  5FTS A;  1H5S B;  1MP5 A;  4H7O A;  1LZ7 A;  3VBM A;  4HO4 A;  3I3A A;  2BO7 A;  4HO8 A;  3K8D A;  2D0J A;  1G93 A;  2WVM A;  2XME A;  1EZI A;  4B42 A;  1TDT A;  1XAT A;  3D8V A;  3TIS A;  4B3U A;  1H4D A;  2BO4 A;  1FO9 A;  2Z87 A;  4R37 A;  4N27 A;  1JV3 A;  5FYE A;  2JF2 A;  1MC3 A;  2YQC A;  2ZU8 A;  4KT7 A;  2YCM A;  4HZD A;  2X60 A;  1N4I A;  5FU8 A;  2AE7 A;  2V0J A;  3V8Z A;  4FRO A;  2AEC A;  4KQL A;  3JUJ A;  2APC A;  1YP3 A;  1H5R A;  1FWY A;  2FYB A;  3SXA A;  1OMX A;  4Y9X A;  4G87 A;  1H4E A;  1HM8 A;  1JV1 A;  1QWJ A;  1ZJ3 A;  4CJC A;  4EVW A;  1ZCY A;  3SX5 A;  4B2W A;  5BXC A;  4BMA A;  5IDT A;  1HJJ A;  1NHE B;  1NKH B;  2BO8 A;  2TDT A;  1HJL A;  2Y4M A;  4DDZ A;  1W77 A;  4MYO A;  3I0K A;  2BO6 A;  2RIT A;  3U2V A;  2RJ7 A;  1THJ A;  5AFU U;  4AA7 A;  2CU2 A;  2YC3 A;  1MR9 A;  1LZ0 A;  2RJ0 A;  2V0L A;  3V0Q A;  2Y4K A;  4YS8 A;  5CQL X;  5L6V A;  4EA8 A;  3SXC A;  1QQ0 A;  4E1K A;  5C4C A;  5IFY A;  1EWW A;  1S80 A;  2A8U A;  2OI5 A;  2XWN A;  3BCV A;  3V90 A;  1ZCT A;  4N6A A;  5CMF X;  1Z90 A;  5EJ1 A;  4AYJ A;  3SXG A;  1FO8 A;  4MZU A;  2WGZ A;  3BXY A;  3R5D A;  2Z86 A;  4MFG A;  2IC7 A;  3VBJ A;  2J0B A;  5C3A A;  3I0C A;  2V0H A;  5C3B A;  3BSY A;  4ARW A;  3I0F A;  2PGY A;  4Y7U A;  1V82 A;  2RJ4 A;  3CKN A;  2GGO A;  5C1H A;  1R7T A;  1ZDF A;  2PA4 A;  3ECT A;  3IOJ A;  4FQW A;  4O6N A;  2IU9 A;  4D48 A;  1QRE A;  1QRG A;  2P6W A;  3R3R A;  2VSH A;  3TDT A;  1G9R A;  3FOQ A;  5F42 A;  3IOI A;  3EEV A;  4FRL A;  4HO6 A;  5DG3 A;  2RJ1 A;  1SSQ A;  3CU0 A;  4ZDQ A;  5C48 A;  2V0I A;  3HL3 A;  5AJO A;  3JQY A;  4HZC A;  3IOH A;  2IU8 A;  4G3S A;  1OCX A;  1GX0 A;  1SST A;  3LW6 A;  3HSQ A;  2ZU9 A;  5CMH A;  3OTM A;  3R5C A;  5AJP A;  1KRU A;  2V0K A;  4G3P A;  1FZW A;  1GA8 A;  3USR A;  5C38 A;  2VXM A;  3EG4 A;  4R36 A;  2A8W A;  4B4G A;  4Y6U A;  4MYB A;  4KPX A;  1WVC A;  4FRP A;  5J49 A;  1PZT A;  3T7N A;  2X65 A;  1LZI A;  3SXD A;  2P73 A;  1W55 A;  3FSB A;  3ZGG A;  1G0R A;  2I5K A;  3SRT A;  1WT0 A;  1KGQ A;  2VXL A;  2FYD B;  4EEG A;  2O1G A;  1HV9 A;  3GQ8 A;  4FIX A;  3T7O A;  3CGX A;  1KK6 A;  4NAN A;  1KRR A;  5FTV A;  4ISX A;  1FR9 A;  1TW1 A;  3ZLK A;  2E8B A;  3I0H A;  1LL2 A;  3OH4 A;  2QKX A;  1H4C A;  4CJB A;  1WSZ A;  3OTZ A;  1VGZ A;  2VK9 A;  2D7R A;  5D92 A;  1H5S C;  3FTT A;  3DUV A;  3R3I A;  3GQ7 A;  2P2O A;  2UX8 A;  2AQ9 A;  2WLF A;  4M28 A;  2XWL A;  5C1G A;  3V0P A;  2IUA A;  1EYR A;  1GQC A;  2Y4J A;  5E3Q A;  1KQA A;  4EAB A;  3VNP A;  1M8N A;  1H7L A;  4Y7V A;  3SX8 A;  5C4F A;  2C0N A;  4HG6 A;  4R7P A;  2OEF A;  1GX4 A;  1H7E A;  3JUK A;  4Q7C A;  4N69 A;  4EE5 A;  1VPA A;  1S4O A;  2RJ6 A;  5C4B A;  1VM8 A;  1G23 A;  5ADX U;  1HM0 A;  3VBK A;  1R80 A;  1J2Z A;  3D98 A;  4K6R A;  4FRE A;  1XHD A;  3O3P A;  3FSX A;  4HO3 A;  1ZIZ A;  1K4V A;  1TZF A;  5CMJ A;  3GQA A;  1NF5 B;  5FV9 A;  4KC2 A;  1QRL A;  4EE3 A;  4M4K A;  3OGZ A;  4AAW A;  4KNR A;  4DCL A;  1H7F A;  3OC9 A;  5C4E A;  1G1L A;  5DDV A;  4B4M A;  3OH2 A;  3FS8 A;  4D0Z A;  2JF3 A;  3OW5 A;  2JCJ A;  2OI7 A;  1VGW A;  4E6U A;  4NAL A;  3ZF8 A;  3F1C A;  5C1L A;  5C36 A;  2D7I A;  4FCU A;  5C49 A;  3POL A;  5L6S A;  4HCQ A;  3OU9 A;  5I1F A;  3SUC A;  2AH9 A;  3BRK X;  2J0A A;  4B2X A;  1ON6 A;  3BSS A;  2VS5 A;  5CMI A;  2WE9 A;  2WLE A;  2XWM A;  1ZDG A;  4D11 A;  2OEG A;  4D0T A;  1GQ9 A;  1ZJP A;  2VHE A;  3DHO A;  4M2B A;  3F1Y A;  4M99 A;  3KWD A;  3U2U A;  1H7T A;  1OQM B;  5CMG X;  4EEM A;  2Y7A A;  3EE5 A;  4FRD A;  3TQD A;  1H5R B;  2QIA A;  4FRB A;  3VBI A;  4L41 C;  4C2S A;  1ZCV A;  3N9W A;  1WT3 A;  4AC3 A;  5U2K A; 
#chains in the Genus database with same CATH homology
 4IRP A;  3I0G A;  4IHF A;  1LVW A;  1FRW A;  2YQS A;  4JD0 A;  4FRH A;  3ZLL A;  1KWS A;  3V0L A;  4D11 C;  3MC4 A;  4NAI A;  1WT1 A;  4FRM A;  1H3M A;  3E26 A;  3CKV A;  2FY7 A;  4G3Q A;  4ASJ A;  2FFU A;  1G95 A;  5FUH A;  4HO5 A;  4EQY A;  3MQG A;  3R0S A;  3SPT A;  5IDS A;  4FIY A;  1O7Q A;  1KK4 A;  1JYK A;  3E25 A;  1INJ A;  1KGT A;  5CQN X;  1H5T A;  3MQH A;  2O1F A;  4N6B A;  3V91 A;  1MR7 A;  3RMV A;  2JCL A;  5DEM A;  1ZJ0 A;  2WVL A;  3U2W A;  5ADX V;  4J18 A;  2NXV A;  1OMZ A;  3OH3 A;  3CKQ A;  5AJN A;  3VBN A;  4LW3 A;  1QRM A;  2X5S A;  1QG8 A;  3K8E A;  2ZU7 A;  1V83 A;  2YQH A;  1INI A;  4HOC A;  1G3L A;  3OUP A;  3IGJ A;  2W0V A;  2VS3 A;  1VZU A;  3PNN A;  4HUS A;  4HO9 A;  3BSW A;  4Y6N A;  3BFP A;  3NGW A;  1GWV A;  1H5S A;  2QIV X;  2MZB A;  1FR8 A;  3CKO A;  4P00 A;  1ZI4 A;  5HS2 A;  1FXO A;  1R7V A;  3T7M A;  5AFU V;  3PMO A;  2QGI A;  1IIM A;  3Q4S A;  1JVG A;  4EA9 A;  2YQJ A;  3DJ4 A;  4IRQ A;  2AM5 A;  4HUR A;  2I7B A;  1FG5 N;  2WVK A;  1GWW A;  4XWI A;  1KHR A;  2E3D A;  3Q7U A;  2VSI A;  2QH5 A;  3P47 A;  2WAW A;  1T3D A;  2FYC B;  3VBL A;  3ZGF A;  3I3X A;  3GVD A;  5DEP A;  2YES A;  1VGU A;  1VGT A;  1LL3 A;  4MIX A;  1VZT A;  4KNX A;  5C3D A;  2JCO A;  1IIN A;  1VH3 A;  1MRL A;  5CQM X;  3P1B A;  1R7X A;  1HM9 A;  3V4E A;  3SX7 A;  1R7Y A;  3OAM A;  1ZJ2 A;  2X5Z A;  3TV0 A;  3Q1X A;  1YP4 A;  1VIC A;  4KC4 A;  4E75 A;  3SXE A;  3TWD A;  1LXA A;  4Y7F A;  4E6T A;  4ECM A;  3V0O A;  1G97 A;  5DDT A;  4FCE A;  3PKQ A;  5FU0 A;  4AYL A;  4KPZ A;  4FRA A;  4NAK A;  4IHG A;  2FKO A;  3FSY A;  1I52 A;  1SS9 A;  3D5N A;  4HO0 A;  4EAA A;  1ZI5 A;  2DPW A;  3KWC A;  3R2W A;  2ICX A;  2PGV A;  4UEG A;  2WLD A;  3IXC A;  4ASY A;  3U2X A;  3OH1 A;  1FXJ A;  1ZJ1 A;  1JYL A;  5EJZ A;  5C47 A;  1W57 A;  2RJ5 A;  1ZCU A;  5E3R A;  2P72 A;  3HJJ A;  3V8Y A;  1H7G A;  1XHB A;  3GOS A;  1LZJ A;  1V84 A;  2Q4J A;  5EIY A;  1VH1 A;  3RSB A;  1O23 B;  3I0I X;  5JQQ A;  2XMH A;  1TW5 A;  4B4B A;  3TK8 A;  1SSM A;  1XZ6 A;  3USQ A;  4LW6 A;  3CJ8 A;  1O7O A;  2ICY A;  4B5B A;  1MP4 A;  1FGX A;  1R7U A;  1PZY B;  2OI6 A;  1NMM B;  4EA7 A;  3ST8 A;  3JTJ A;  3RMW A;  4KC1 A;  3U0Y A;  1H7H A;  1S4N A;  2RJ9 A;  1E5K A;  2VFZ A;  3VBP A;  3Q80 A;  3F1X A;  2FYA A;  1FGG A;  4CJ8 A;  4EGG A;  3V0M A;  1FOA A;  1V67 A;  1ZI3 A;  3R5A A;  3I0J A;  4Y7T A;  4Y63 A;  1KK5 A;  2VD4 A;  2FFV A;  3CKJ A;  2RIY A;  3TZT A;  3C8V A;  2RIJ A;  1R81 A;  3SXB A;  3T57 A;  1O0R A;  4IHH A;  2AGD A;  4KXO A;  2AES A;  1H5S D;  1NQI B;  3U0X A;  5CQP A;  3PKP A;  5C8R A;  3DK5 A;  2XAT A;  1LL0 A;  3I0D A;  1ZJO A;  3KIA A;  1TVY A;  1ZHJ A;  4KRV A;  1V3W A;  3NZ2 A;  3TIO A;  4E79 A;  2AM3 A;  4GBP A;  1YRO B;  3I0E A;  1KRV A;  4Y62 A;  5E3P A;  4BQH A;  4M9C A;  2PX7 A;  3EH0 A;  3R8Y A;  3FSC A;  1ON8 A;  2YC5 A;  4EEA A;  1YP2 A;  2W0W A;  3R5B A;  1QGQ A;  4Y64 A;  2VS4 A;  4O6M A;  3I0L A;  1H7Q A;  4CVH A;  2RIZ A;  3QVB A;  2JCK A;  1R82 A;  4DEC A;  2NPO A;  3FWW A;  2GGQ A;  3U2T A;  4JIS A;  2AM4 A;  5D91 A;  4M98 A;  4DE7 A;  1G8O A;  1H5T B;  1QRF A;  1NWG B;  2RJ8 A;  4J09 A;  4FRQ A;  3V0N A;  2WLC A;  1MP3 A;  1S4P A;  4EEO A;  2WLG A;  1G2V A;  2Y6P A;  4P02 A;  2WEE A;  3GUE A;  3R1W A;  5C4D A;  1ZI1 A;  2O1H A;  2Y4L A;  1QGS A;  3OH0 A;  1VZX A;  2I5E A;  2RIX A;  5CQO A;  4HO2 A;  1WT2 A;  4MND A;  1JVD A;  3OKR A;  4M2A A;  3SX3 A;  3KWE A;  4Y7G A;  4EE4 A;  5FTS A;  1H5S B;  1MP5 A;  4H7O A;  1LZ7 A;  3VBM A;  4HO4 A;  3I3A A;  2BO7 A;  4HO8 A;  3K8D A;  2D0J A;  1G93 A;  2WVM A;  2XME A;  1EZI A;  4B42 A;  1TDT A;  1XAT A;  3D8V A;  3TIS A;  4B3U A;  1H4D A;  2BO4 A;  1FO9 A;  2Z87 A;  4R37 A;  4N27 A;  1JV3 A;  5FYE A;  2JF2 A;  1MC3 A;  2YQC A;  2ZU8 A;  4KT7 A;  2YCM A;  4HZD A;  2X60 A;  5FU8 A;  2AE7 A;  2V0J A;  3V8Z A;  4FRO A;  2AEC A;  4KQL A;  3JUJ A;  2APC A;  1YP3 A;  1H5R A;  1FWY A;  2FYB A;  3SXA A;  1OMX A;  4Y9X A;  4G87 A;  1H4E A;  1HM8 A;  1JV1 A;  1QWJ A;  1ZJ3 A;  4CJC A;  4EVW A;  1ZCY A;  3SX5 A;  4B2W A;  5BXC A;  4BMA A;  5IDT A;  1HJJ A;  1NHE B;  1NKH B;  2BO8 A;  2TDT A;  1HJL A;  2Y4M A;  4DDZ A;  1W77 A;  4MYO A;  3I0K A;  2BO6 A;  2RIT A;  3U2V A;  2RJ7 A;  1THJ A;  5AFU U;  4AA7 A;  2CU2 A;  2YC3 A;  1MR9 A;  1LZ0 A;  2RJ0 A;  2V0L A;  3V0Q A;  2Y4K A;  4YS8 A;  5CQL X;  5L6V A;  4EA8 A;  3SXC A;  1QQ0 A;  4E1K A;  5C4C A;  5IFY A;  1S80 A;  2A8U A;  2OI5 A;  2XWN A;  3BCV A;  3V90 A;  1ZCT A;  4N6A A;  5CMF X;  1Z90 A;  5EJ1 A;  4AYJ A;  3SXG A;  1FO8 A;  4MZU A;  2WGZ A;  3BXY A;  3R5D A;  2Z86 A;  4MFG A;  2IC7 A;  3VBJ A;  2J0B A;  5C3A A;  3I0C A;  2V0H A;  5C3B A;  3BSY A;  4ARW A;  3I0F A;  2PGY A;  4Y7U A;  1V82 A;  2RJ4 A;  3CKN A;  2GGO A;  5C1H A;  1R7T A;  1ZDF A;  2PA4 A;  3ECT A;  3IOJ A;  4FQW A;  4O6N A;  2IU9 A;  4D48 A;  1QRE A;  1QRG A;  2P6W A;  3R3R A;  2VSH A;  3TDT A;  1G9R A;  3FOQ A;  5F42 A;  3IOI A;  3EEV A;  4FRL A;  4HO6 A;  5DG3 A;  2RJ1 A;  1SSQ A;  3CU0 A;  4ZDQ A;  5C48 A;  2V0I A;  3HL3 A;  5AJO A;  3JQY A;  4HZC A;  3IOH A;  2IU8 A;  4G3S A;  1OCX A;  1GX0 A;  1SST A;  3LW6 A;  3HSQ A;  2ZU9 A;  5CMH A;  3OTM A;  3R5C A;  5AJP A;  1KRU A;  2V0K A;  4G3P A;  1FZW A;  1GA8 A;  3USR A;  5C38 A;  2VXM A;  3EG4 A;  4R36 A;  2A8W A;  4B4G A;  4Y6U A;  4MYB A;  4KPX A;  1WVC A;  4FRP A;  5J49 A;  1PZT A;  3T7N A;  2X65 A;  1LZI A;  3SXD A;  2P73 A;  1W55 A;  3FSB A;  3ZGG A;  1G0R A;  2I5K A;  3SRT A;  1WT0 A;  1KGQ A;  2VXL A;  2FYD B;  4EEG A;  2O1G A;  1HV9 A;  4FIX A;  3T7O A;  3CGX A;  1KK6 A;  4NAN A;  1KRR A;  5FTV A;  4ISX A;  1FR9 A;  1TW1 A;  3ZLK A;  2E8B A;  3I0H A;  1LL2 A;  1H4C A;  2QKX A;  3OH4 A;  4CJB A;  1WSZ A;  3OTZ A;  1VGZ A;  2VK9 A;  2D7R A;  5D92 A;  1H5S C;  3FTT A;  3DUV A;  3R3I A;  2UX8 A;  2P2O A;  2AQ9 A;  2WLF A;  4M28 A;  2XWL A;  5C1G A;  3V0P A;  2IUA A;  1EYR A;  1GQC A;  2Y4J A;  5E3Q A;  1KQA A;  4EAB A;  3VNP A;  5C4F A;  1H7L A;  4Y7V A;  3SX8 A;  2C0N A;  4HG6 A;  4R7P A;  2OEF A;  1GX4 A;  1H7E A;  3JUK A;  4Q7C A;  4N69 A;  4EE5 A;  1VPA A;  1S4O A;  2RJ6 A;  5C4B A;  1VM8 A;  1G23 A;  5ADX U;  1HM0 A;  3VBK A;  1R80 A;  1J2Z A;  3D98 A;  4K6R A;  4FRE A;  1XHD A;  3O3P A;  3FSX A;  4HO3 A;  1ZIZ A;  1K4V A;  1TZF A;  5CMJ A;  1NF5 B;  5FV9 A;  4KC2 A;  1QRL A;  4EE3 A;  4M4K A;  3OGZ A;  4AAW A;  4KNR A;  4DCL A;  1H7F A;  3OC9 A;  5C4E A;  1G1L A;  5DDV A;  4B4M A;  3OH2 A;  3FS8 A;  4D0Z A;  2JF3 A;  3OW5 A;  2JCJ A;  2OI7 A;  1VGW A;  4E6U A;  4NAL A;  3ZF8 A;  3F1C A;  5C1L A;  5C36 A;  2D7I A;  4FCU A;  5C49 A;  3POL A;  5L6S A;  4HCQ A;  3OU9 A;  5I1F A;  2AH9 A;  3BRK X;  2J0A A;  4B2X A;  1ON6 A;  3BSS A;  2VS5 A;  5CMI A;  2WE9 A;  2WLE A;  2XWM A;  1ZDG A;  4D11 A;  2OEG A;  4D0T A;  1GQ9 A;  1ZJP A;  2VHE A;  3DHO A;  4M2B A;  3F1Y A;  4M99 A;  3KWD A;  3U2U A;  1H7T A;  1OQM B;  5CMG X;  4EEM A;  2Y7A A;  3EE5 A;  4FRD A;  3TQD A;  1H5R B;  2QIA A;  4FRB A;  3VBI A;  4L41 C;  4C2S A;  1ZCV A;  3N9W A;  1WT3 A;  4AC3 A;  5U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...