3D8VA

Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
479
structure length
478
Chain Sequence
b'MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of GlmU from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule keywords Bifunctional protein glmU
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 173
structure length 478
sequence length 479
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3d8vA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3d8vA01
1W55A 4D0TA 3OU9A 5CQNX 1GX4A 3SX8A 3SPTA 3D98A 1WSZA 3O3PA 5EJZA 3KWCA 1ZDFA 4EGGA 3DHOA 1SSTA 5U2KA 2FYBA 2WEEA 1W77A 1GQCA 1R7VA 2OI6A 4E1KA 1T3DA 1LVWA 5DDVA 1GWWA 2I5EA 5C49A 1WT3A 1KK5A 4FCEA 1MP4A 4KPZA 1OMZA 1NMMB 4FRLA 2AM5A 5CQLX 3V8YA 1ZJ2A 2BO8A 1GWVA 2W0VA 2IUAA 3BFPA 2IU8A 2RITA 1WVCA 1ZI4A 5E3QA 5CQMX 1SS9A 4H7OA 4FREA 3PMOA 4L41C 4Y7FA 2O1HA 2QGIA 2A8UA 4CJCA 3KIAA 3IOJA 2GGQA 1QRFA 4HUSA 2VS5A 1KRUA 1MC3A 4G3SA 2AESA 1R81A 4Y7UA 1HV9A 3R5BA 3ZLKA 2CU2A 5C48A 1PZYB 1JYKA 3V0OA 1JYLA 2V0IA 3VBPA 3FOQA 4E79A 4KT7A 4CJ8A 4EA9A 1FR9A 1R7YA 1KGTA 1G8OA 4B4MA 4B2XA 4FQWA 4FRQA 3K8EA 3VNPA 4HO9A 3V0PA 3VBKA 2YESA 3R1WA 1E5KA 1VICA 5C38A 1NHEB 3IOIA 3CU0A 3F1XA 4Y7TA 2I5KA 1MP3A 1R7TA 3FSBA 3VBLA 2XWLA 1VGUA 2Z86A 4EE4A 3VBJA 4D0ZA 5ADXU 3USQA 2JF3A 3FTTA 4EEOA 3I3AA 2AM4A 4UEGA 1V84A 4N6AA 3V0QA 3TQDA 1VM8A 1TDTA 1I52A 1NKHB 2WVMA 3JUJA 4NAKA 3HSQA 2RJ9A 1YP4A 4KPXA 1ON6A 1QREA 2RJ7A 1KRRA 4CJBA 4ISXA 3CJ8A 4MNDA 3MQGA 1NWGB 3V0MA 3K8DA 3OTZA 3T57A 4EE5A 4HO3A 1FRWA 2OEFA 1ZJ1A 2X60A 2TDTA 5C4CA 2AQ9A 2GGOA 3U2UA 3TISA 4AC3A 4M99A 3T7OA 1H5RA 1VZXA 4KRVA 1XATA 5FYEA 3EEVA 1G9RA 1VGZA 5BXCA 5E3PA 2FY7A 2DPWA 5CMJA 1S80A 3DK5A 3GUEA 1H5TA 1ZDGA 1H5SC 4AAWA 1H5SA 3TWDA 3SX5A 3I3XA 1LL2A 4R36A 2O1GA 1ZJPA 4LW6A 3ZGGA 1KWSA 4KNRA 1SSQA 3CKQA 1H5SB 3OGZA 2YC3A 1G0RA 4EA8A 1H3MA 2WAWA 1WT1A 4E6TA 1LZ0A 4EA7A 1ZCUA 2Z87A 3EH0A 4M28A 3V4EA 1H4EA 4YS8A 3NZ2A 3I0GA 2X5ZA 4DECA 1V3WA 1FOAA 3R8YA 5FU8A 2X65A 4D11C 4D11A 1KQAA 4EE3A 4FRMA 1S4OA 2P6WA 4Y6UA 5AFUV 4J18A 1ON8A 5C36A 5HS2A 1LZJA 3HJJA 1ZI3A 3BRKX 4KQLA 3N9WA 4EEGA 4FRAA 3ZLLA 3TZTA 2XMHA 1ZJ0A 4NANA 3OH4A 2V0HA 3Q80A 5I1FA 3SX7A 4ECMA 5C4DA 1VH3A 4HO5A 2QKXA 5C1GA 3I0IX 1FXOA 4XWIA 4EEMA 3U2TA 1XHBA 3U0YA 1FGGA 4MFGA 2PGVA 2JF2A 3SX3A 3FSCA 1LL3A 3R3RA 1J2ZA 1G93A 2JCKA 1HM8A 2YCMA 3I0JA 5EJ1A 2E8BA 1H7FA 4B5BA 1VZUA 4B42A 4K6RA 1QG8A 2FFUA 3DUVA 5FTSA 3V91A 2FYCB 1SSMA 4AYLA 2X5SA 5AJNA 1G97A 1W57A 4NAIA 4Y7GA 3TIOA 1PZTA 3SXAA 3FSYA 1G23A 2ICXA 3U2XA 4MYBA 3OKRA 3SXEA 3D8VA 3TV0A 5L6VA 4IHHA 1FZWA 1OMXA 1TZFA 1MRLA 3Q1XA 2Y4JA 1LZ7A 3FSXA 2VHEA 3GVDA 2RJ1A 3V90A 4HG6A 2WLCA 3I0LA 4KC4A 1O7QA 1FXJA 2UX8A 4HCQA 3BXYA 3F1YA 2OI7A 3I0EA 4JISA 3FS8A 1YROB 3USRA 4ASYA 2Y6PA 3PNNA 4MZUA 1YP2A 4G3QA 4IRPA 2D7RA 1THJA 4HZDA 1FO8A 4EQYA 4HOCA 1ZJ3A 2WVKA 3MQHA 3IGJA 1TW5A 2P72A 1QRGA 3E26A 3D5NA 4M2BA 4G87A 4ASJA 2YQSA 3CKVA 3TK8A 3VBNA 2RJ5A 1YP3A 1H4DA 3U0XA 2RJ6A 5CMFX 2Q4JA 3T7MA 1OQMB 2P73A 4FRHA 2A8WA 2VS3A 4DDZA 1HM0A 5L6SA 4IHGA 1FR8A 3MC4A 3CKJA 2VD4A 3ST8A 4EAAA 4ARWA 2WLGA 5FUHA 3BSSA 2JCLA 2D7IA 1FO9A 1H7GA 3OC9A 4JD0A 2AM3A 4P02A 1FGXA 1QGSA 1LZIA 2RJ0A 1VPAA 4KC1A 5C1LA 5CMIA 2V0JA 2PGYA 2ZU7A 2Y4KA 3ZF8A 1S4PA 2I7BA 4G3PA 2VXMA 1H5RB 3U2VA 4CVHA 1QQ0A 4KNXA 4HO8A 3Q7UA 2P2OA 2AE7A 4HO4A 2OI5A 2V0KA 5AJPA 3ZGFA 5C1HA 1XZ6A 3SXGA 1VZTA 1H5TB 3QVBA 2VFZA 2BO7A 1V67A 1INJA 2NPOA 1QGQA 3R5DA 2YC5A 4MYOA 4NALA 1ZI5A 1EZIA 3PKPA 5C3DA 2E3DA 3V0LA 1TW1A 1VGWA 4AA7A 1ZCVA 3I0KA 3V0NA 1VGTA 4HO0A 3R0SA 1G1LA 4B3UA 3R3IA 1GA8A 2ZU8A 3OAMA 2IC7A 1R7UA 1V83A 5FTVA 3BSWA 1ZIZA 2AECA 1INIA 1QRLA 2V0LA 1LXAA 3OH1A 3JQYA 1IIMA 2YQHA 1G3LA 1MR7A 3I0CA 5CMHA 5C3AA 5C4BA 1FG5N 3KWDA 1H4CA 1IINA 4E6UA 3T7NA 3U2WA 2O1FA 1O0RA 1KGQA 3NGWA 4EABA 1H7LA 1MR9A 2XWNA 1ZJOA 1ZI1A 2Y4MA 4FRDA 1HJLA 2VXLA 2VS4A 5FV9A 5AJOA 1KK4A 2AGDA 3OH2A 2RJ4A 1ZCTA 5DEPA 2WLEA 2W0WA 4DE7A 2ICYA 2MZBA 1WT0A 5FU0A 4EVWA 2FKOA 1GQ9A 2XATA 2PX7A 3JUKA 1KHRA 4LW3A 5DG3A 5C8RA 2RIXA 3ECTA 4J09A 1LL0A 3R5AA 1JVDA 4KC2A 4P00A 1H7HA 3CGXA 1HJJA 1WT2A 2Y7AA 5IFYA 1K4VA 4FRPA 4B2WA 3I0DA 1G2VA 2FFVA 2BO4A 2FYAA 5DDTA 1JV3A 1MP5A 5C47A 2WE9A 3V8ZA 4EEAA 3RSBA 1NQIB 5DEMA 2PA4A 3OUPA 3TDTA 2QIVX 2ZU9A 4D48A 5JQQA 4B4GA 3C8VA 4Y9XA 1QWJA 2RJ8A 5ADXV 1EYRA 1ZCYA 2RIYA 1NF5B 1H7TA 2D0JA 4BMAA 3OTMA 2VSIA 4R7PA 1HM9A 1XHDA 2WGZA 4FROA 5J49A 3SXCA 1VH1A 2QH5A 4FRBA 3RMVA 4DCLA 4Y63A 3SXDA 1R7XA 2APCA 1O7OA 1KK6A 4M4KA 4M9CA 1H5SD 2WLDA 1OCXA 5IDTA 3BSYA 3BCVA 3R2WA 2AH9A 1JVGA 3IOHA 2JCOA 4Y64A 5CQPA 5CMGX 4GBPA 3DJ4A 2OEGA 3CKNA 4IRQA 4M2AA 4Y62A 5F42A 2QIAA 1R82A 3SRTA 4C2SA 5C3BA 3PKQA 4N6BA 3OW5A 3I0HA 4BQHA 3FWWA 1O23B 4R37A 4AYJA 3OH3A 5CQOA 3GOSA 2YQJA 3JTJA 5IDSA 1V82A 4Y6NA 3VBMA 5EIYA 5E3RA 3P1BA 3HL3A 3LW6A 1FWYA 1GX0A 4HO2A 2XWMA 3RMWA 2WLFA 2Y4LA 4M98A 3I0FA 1H7EA 3SXBA 4B4BA 5C4FA 3E25A 1G95A 3R5CA 2VSHA 4E75A 1S4NA 3EE5A 4IHFA 3Q4SA 2IU9A 1QRMA 3KWEA 2JCJA 2BO6A 3VBIA 1KRVA 4N69A 4HZCA 3POLA 5C4EA 3P47A 1Z90A 4HURA 4N27A 2RIZA 4HO6A 4ZDQA 2RIJA 1JV1A 4FCUA 1ZHJA 2XMEA 3OH0A 1TVYA 2WVLA 3IXCA 2NXVA 4KXOA 1R80A 2YQCA 4Y7VA 2FYDB 3CKOA 3EG4A 3F1CA 5AFUU 1H7QA
chains in the Genus database with same CATH superfamily
1W55A 4D0TA 3OU9A 5CQNX 1GX4A 3SX8A 3SPTA 3D98A 1WSZA 3O3PA 5EJZA 3KWCA 1ZDFA 4EGGA 3DHOA 1SSTA 5U2KA 2FYBA 2WEEA 1W77A 1GQCA 1R7VA 2OI6A 4E1KA 1T3DA 1LVWA 5DDVA 1GWWA 2I5EA 5C49A 1WT3A 1KK5A 4FCEA 1MP4A 4KPZA 1OMZA 1NMMB 4FRLA 2AM5A 5CQLX 3V8YA 1ZJ2A 2BO8A 1GWVA 4FIYA 2W0VA 2IUAA 3BFPA 2IU8A 2RITA 3SUCA 1WVCA 1ZI4A 5E3QA 5CQMX 1SS9A 4H7OA 4FREA 3PMOA 4L41C 4Y7FA 1L0SA 2O1HA 2QGIA 2A8UA 4CJCA 3KIAA 4Q7CA 3IOJA 2GGQA 1QRFA 4HUSA 2VS5A 1KRUA 1MC3A 4G3SA 2AESA 1R81A 4Y7UA 1HV9A 3R5BA 3ZLKA 2CU2A 5C48A 1PZYB 1JYKA 5D92A 3V0OA 1JYLA 2V0IA 3VBPA 3FOQA 4E79A 4KT7A 4CJ8A 3GQ9A 4EA9A 1FR9A 1R7YA 1KGTA 1G8OA 4B4MA 4B2XA 4FQWA 4FRQA 3K8EA 3VNPA 4HO9A 3V0PA 3VBKA 2YESA 3R1WA 1E5KA 1VICA 5C38A 1NHEB 3IOIA 3CU0A 3F1XA 4Y7TA 2I5KA 1MP3A 1R7TA 3FSBA 3VBLA 2XWLA 1VGUA 2Z86A 4EE4A 3VBJA 4D0ZA 5ADXU 3USQA 2JF3A 3FTTA 4EEOA 3I3AA 2AM4A 4UEGA 1V84A 4N6AA 3V0QA 3TQDA 1VM8A 1TDTA 1I52A 1NKHB 2WVMA 3JUJA 4NAKA 3HSQA 2RJ9A 1YP4A 4KPXA 1ON6A 1QREA 2RJ7A 1KRRA 4CJBA 4ISXA 3CJ8A 1M8NA 4MNDA 3MQGA 1Z2FA 1NWGB 3V0MA 3K8DA 3OTZA 2J0AA 3T57A 4EE5A 4HO3A 1FRWA 2OEFA 1ZJ1A 2X60A 2TDTA 5C4CA 2AQ9A 2GGOA 3U2UA 3TISA 4AC3A 4M99A 3T7OA 1H5RA 1VZXA 4KRVA 1XATA 5FYEA 3EEVA 1G9RA 1VGZA 5BXCA 5E3PA 2FY7A 2DPWA 5CMJA 1S80A 3DK5A 3GUEA 1H5TA 1ZDGA 1H5SC 4AAWA 1H5SA 3TWDA 3SX5A 3I3XA 1LL2A 4R36A 2O1GA 1ZJPA 4LW6A 3ZGGA 1KWSA 4KNRA 1SSQA 3CKQA 1H5SB 3OGZA 2YC3A 1G0RA 4EA8A 1H3MA 2WAWA 1WT1A 4E6TA 5D91A 1LZ0A 4EA7A 1ZCUA 2Z87A 3EH0A 4M28A 3V4EA 1H4EA 4YS8A 3NZ2A 3I0GA 2X5ZA 4DECA 1V3WA 1FOAA 3R8YA 5FU8A 2X65A 4D11C 4D11A 1KQAA 4EE3A 4FRMA 3GQ7A 1S4OA 2P6WA 4Y6UA 5AFUV 4J18A 1ON8A 5C36A 5HS2A 1LZJA 3HJJA 1ZI3A 3BRKX 4KQLA 3N9WA 4EEGA 4FRAA 3ZLLA 3TZTA 2XMHA 1ZJ0A 4NANA 3OH4A 2V0HA 3Q80A 5I1FA 3SX7A 4ECMA 5C4DA 1VH3A 4HO5A 2C0NA 2QKXA 5C1GA 3I0IX 1FXOA 4XWIA 4EEMA 3U2TA 1XHBA 3U0YA 1FGGA 4MFGA 2PGVA 2JF2A 3SX3A 3FSCA 1LL3A 3R3RA 1J2ZA 1G93A 2JCKA 1HM8A 2YCMA 3I0JA 5EJ1A 2E8BA 1H7FA 4B5BA 1VZUA 4B42A 4K6RA 1QG8A 2FFUA 3DUVA 5FTSA 3V91A 2FYCB 1SSMA 4AYLA 2X5SA 5AJNA 1G97A 1W57A 4NAIA 4Y7GA 3TIOA 1PZTA 3SXAA 3FSYA 1G23A 2ICXA 3U2XA 4MYBA 3OKRA 3SXEA 3D8VA 3TV0A 5L6VA 4IHHA 1FZWA 1OMXA 1TZFA 1MRLA 3Q1XA 2Y4JA 1LZ7A 3FSXA 2VHEA 3GVDA 2RJ1A 3V90A 4HG6A 2WLCA 3I0LA 4KC4A 1O7QA 1FXJA 2UX8A 4HCQA 3BXYA 3F1YA 2OI7A 3I0EA 4JISA 3FS8A 1YROB 3USRA 4ASYA 2Y6PA 3PNNA 4MZUA 1YP2A 4G3QA 4IRPA 2D7RA 1THJA 4HZDA 1FO8A 4EQYA 4HOCA 1ZJ3A 2WVKA 3MQHA 3IGJA 1TW5A 2P72A 1QRGA 3E26A 3D5NA 4M2BA 4G87A 4ASJA 2YQSA 3CKVA 3TK8A 3VBNA 2RJ5A 1YP3A 1H4DA 3U0XA 2RJ6A 5CMFX 2Q4JA 3T7MA 1OQMB 2P73A 3GQAA 2A8WA 2VS3A 4FRHA 4DDZA 1HM0A 5L6SA 4IHGA 1FR8A 3MC4A 3CKJA 2VD4A 3ST8A 2J0BA 4EAAA 4ARWA 2WLGA 4MIXA 5FUHA 3BSSA 2JCLA 2D7IA 1FO9A 1H7GA 3OC9A 4JD0A 2AM3A 4P02A 1FGXA 1QGSA 1LZIA 2RJ0A 1VPAA 4KC1A 5C1LA 5CMIA 2V0JA 2PGYA 2ZU7A 2Y4KA 3ZF8A 1S4PA 2I7BA 4G3PA 2VXMA 1H5RB 3U2VA 4CVHA 1QQ0A 4KNXA 4HO8A 3Q7UA 2P2OA 2AE7A 4HO4A 2OI5A 2V0KA 5AJPA 3ZGFA 5C1HA 1XZ6A 3SXGA 1VZTA 1H5TB 3QVBA 2VFZA 2BO7A 1V67A 1INJA 2NPOA 1QGQA 3R5DA 2YC5A 4MYOA 4NALA 1ZI5A 1EZIA 3PKPA 5C3DA 2E3DA 3V0LA 1TW1A 1VGWA 4AA7A 1ZCVA 3I0KA 3V0NA 1VGTA 4HO0A 4FIXA 3R0SA 1G1LA 4B3UA 3R3IA 1GA8A 2ZU8A 3OAMA 2IC7A 1R7UA 1V83A 5FTVA 3BSWA 1ZIZA 2AECA 1EWWA 1INIA 1QRLA 2V0LA 1LXAA 3OH1A 3JQYA 1IIMA 2YQHA 1G3LA 1MR7A 3I0CA 5CMHA 5C3AA 5C4BA 1FG5N 3KWDA 1H4CA 1IINA 4E6UA 3T7NA 3U2WA 2O1FA 1O0RA 1KGQA 3NGWA 4EABA 1H7LA 1MR9A 3GQ8A 2XWNA 1ZJOA 1ZI1A 2Y4MA 4FRDA 1HJLA 2VXLA 2VS4A 5FV9A 5AJOA 1KK4A 2AGDA 3OH2A 2RJ4A 1ZCTA 5DEPA 2WLEA 2W0WA 4DE7A 2ICYA 2MZBA 1WT0A 5FU0A 4EVWA 2FKOA 1GQ9A 2XATA 2PX7A 3JUKA 1KHRA 4LW3A 5DG3A 5C8RA 2RIXA 3ECTA 4J09A 1LL0A 3R5AA 1JVDA 4KC2A 4P00A 1H7HA 3CGXA 1HJJA 1WT2A 2Y7AA 5IFYA 1K4VA 4FRPA 4B2WA 3I0DA 1G2VA 2FFVA 2BO4A 2FYAA 5DDTA 1JV3A 1MP5A 5C47A 2WE9A 3V8ZA 4EEAA 3RSBA 1NQIB 5DEMA 2PA4A 3OUPA 3TDTA 2QIVX 2ZU9A 4D48A 5JQQA 4B4GA 3C8VA 4Y9XA 1QWJA 2RJ8A 5ADXV 1EYRA 1ZCYA 2RIYA 1NF5B 1H7TA 2D0JA 4BMAA 3OTMA 2VSIA 4R7PA 1HM9A 1XHDA 2WGZA 4FROA 5J49A 3SXCA 1VH1A 2QH5A 4FRBA 3RMVA 4DCLA 4Y63A 3SXDA 1R7XA 2APCA 1O7OA 1KK6A 4M4KA 4M9CA 1H5SD 2WLDA 1OCXA 5IDTA 3BSYA 3BCVA 3R2WA 2AH9A 1JVGA 3IOHA 2JCOA 4Y64A 5CQPA 5CMGX 4GBPA 3DJ4A 2OEGA 3CKNA 1N4IA 4M2AA 4IRQA 4Y62A 5F42A 2QIAA 1R82A 3SRTA 4C2SA 5C3BA 3PKQA 4N6BA 3OW5A 3I0HA 4BQHA 3FWWA 1O23B 4R37A 4AYJA 3OH3A 5CQOA 3GOSA 2YQJA 3JTJA 5IDSA 1V82A 4Y6NA 3VBMA 5EIYA 5E3RA 3P1BA 3HL3A 3LW6A 1FWYA 1GX0A 4HO2A 2XWMA 3RMWA 2WLFA 2Y4LA 2VK9A 4M98A 3I0FA 1H7EA 3SXBA 4B4BA 4O6MA 5C4FA 3E25A 1G95A 3R5CA 2VSHA 4E75A 1S4NA 3EE5A 4IHFA 3Q4SA 4O6NA 2IU9A 1QRMA 3KWEA 2JCJA 2BO6A 3VBIA 1KRVA 4N69A 4HZCA 3POLA 5C4EA 3P47A 1Z90A 4HURA 4N27A 2RIZA 4HO6A 4ZDQA 2RIJA 1JV1A 4FCUA 1ZHJA 3OH0A 2XMEA 1TVYA 2WVLA 3IXCA 2NXVA 4KXOA 1R80A 2YQCA 4Y7VA 2FYDB 3CKOA 3EG4A 3F1CA 5AFUU 1H7QA
chains in the Genus database with same CATH topology
1W55A 4D0TA 3OU9A 5CQNX 1GX4A 3SX8A 3SPTA 3D98A 1WSZA 3O3PA 5EJZA 3KWCA 1ZDFA 4EGGA 3DHOA 1SSTA 5U2KA 2FYBA 2WEEA 1W77A 1GQCA 1R7VA 2OI6A 4E1KA 1T3DA 1LVWA 5DDVA 1GWWA 2I5EA 5C49A 1WT3A 1KK5A 4FCEA 1MP4A 4KPZA 1OMZA 1NMMB 4FRLA 2AM5A 5CQLX 3V8YA 1ZJ2A 2BO8A 1GWVA 4FIYA 2W0VA 2IUAA 3BFPA 2IU8A 2RITA 1WVCA 1ZI4A 5E3QA 5CQMX 1SS9A 4H7OA 4FREA 3PMOA 4L41C 4Y7FA 2O1HA 2QGIA 2A8UA 4CJCA 3KIAA 4Q7CA 3IOJA 2GGQA 1QRFA 4HUSA 2VS5A 1KRUA 1MC3A 4G3SA 2AESA 1R81A 4Y7UA 1HV9A 3R5BA 3ZLKA 2CU2A 5C48A 1PZYB 1JYKA 5D92A 3V0OA 1JYLA 2V0IA 3VBPA 3FOQA 4E79A 4KT7A 4CJ8A 4EA9A 1FR9A 1R7YA 1KGTA 1G8OA 4B4MA 4B2XA 4FQWA 4FRQA 3K8EA 3VNPA 4HO9A 3V0PA 3VBKA 2YESA 3R1WA 1E5KA 1VICA 5C38A 1NHEB 3IOIA 3CU0A 3F1XA 4Y7TA 2I5KA 1MP3A 1R7TA 3FSBA 3VBLA 2XWLA 1VGUA 2Z86A 4EE4A 3VBJA 4D0ZA 5ADXU 3USQA 2JF3A 3FTTA 4EEOA 3I3AA 2AM4A 4UEGA 1V84A 4N6AA 3V0QA 3TQDA 1VM8A 1TDTA 1I52A 1NKHB 2WVMA 3JUJA 4NAKA 3HSQA 2RJ9A 1YP4A 4KPXA 1ON6A 1QREA 2RJ7A 1KRRA 4CJBA 4ISXA 3CJ8A 4MNDA 3MQGA 1NWGB 3V0MA 3K8DA 3OTZA 2J0AA 3T57A 4EE5A 4HO3A 1FRWA 2OEFA 1ZJ1A 2X60A 2TDTA 5C4CA 2AQ9A 2GGOA 3U2UA 3TISA 4AC3A 4M99A 3T7OA 1H5RA 1VZXA 4KRVA 1XATA 5FYEA 3EEVA 1G9RA 1VGZA 5BXCA 5E3PA 2FY7A 2DPWA 5CMJA 1S80A 3DK5A 3GUEA 1H5TA 1ZDGA 1H5SC 4AAWA 1H5SA 3TWDA 3SX5A 3I3XA 1LL2A 4R36A 2O1GA 1ZJPA 4LW6A 3ZGGA 1KWSA 4KNRA 1SSQA 3CKQA 1H5SB 3OGZA 2YC3A 1G0RA 4EA8A 1H3MA 2WAWA 1WT1A 4E6TA 5D91A 1LZ0A 4EA7A 1ZCUA 2Z87A 3EH0A 4M28A 3V4EA 1H4EA 4YS8A 3NZ2A 3I0GA 2X5ZA 4DECA 1V3WA 1FOAA 3R8YA 5FU8A 2X65A 4D11C 4D11A 1KQAA 4EE3A 4FRMA 1S4OA 2P6WA 4Y6UA 5AFUV 4J18A 1ON8A 5C36A 5HS2A 1LZJA 3HJJA 1ZI3A 3BRKX 4KQLA 3N9WA 4EEGA 4FRAA 3ZLLA 3TZTA 2XMHA 1ZJ0A 4NANA 3OH4A 2V0HA 3Q80A 5I1FA 3SX7A 4ECMA 5C4DA 1VH3A 4HO5A 2C0NA 2QKXA 5C1GA 3I0IX 1FXOA 4XWIA 4EEMA 3U2TA 1XHBA 3U0YA 1FGGA 4MFGA 2PGVA 2JF2A 3SX3A 3FSCA 1LL3A 3R3RA 1J2ZA 1G93A 2JCKA 1HM8A 2YCMA 3I0JA 5EJ1A 2E8BA 1H7FA 4B5BA 1VZUA 4B42A 4K6RA 1QG8A 2FFUA 3DUVA 5FTSA 3V91A 2FYCB 1SSMA 4AYLA 2X5SA 5AJNA 1G97A 1W57A 4NAIA 4Y7GA 3TIOA 1PZTA 3SXAA 3FSYA 1G23A 2ICXA 3U2XA 4MYBA 3OKRA 3SXEA 3D8VA 3TV0A 5L6VA 4IHHA 1FZWA 1OMXA 1TZFA 1MRLA 3Q1XA 2Y4JA 1LZ7A 3FSXA 2VHEA 3GVDA 2RJ1A 3V90A 4HG6A 2WLCA 3I0LA 4KC4A 1O7QA 1FXJA 2UX8A 4HCQA 3BXYA 3F1YA 2OI7A 3I0EA 4JISA 3FS8A 1YROB 3USRA 4ASYA 2Y6PA 3PNNA 4MZUA 1YP2A 4G3QA 4IRPA 2D7RA 1THJA 4HZDA 1FO8A 4EQYA 4HOCA 1ZJ3A 2WVKA 3MQHA 3IGJA 1TW5A 2P72A 1QRGA 3E26A 3D5NA 4M2BA 4G87A 4ASJA 2YQSA 3CKVA 3TK8A 3VBNA 2RJ5A 1YP3A 1H4DA 3U0XA 2RJ6A 5CMFX 2Q4JA 3T7MA 1OQMB 2P73A 4FRHA 2A8WA 2VS3A 4DDZA 1HM0A 5L6SA 4IHGA 1FR8A 3MC4A 3CKJA 2VD4A 3ST8A 2J0BA 4EAAA 4ARWA 2WLGA 4MIXA 5FUHA 3BSSA 2JCLA 2D7IA 1FO9A 1H7GA 3OC9A 4JD0A 2AM3A 4P02A 1FGXA 1QGSA 1LZIA 2RJ0A 1VPAA 4KC1A 5C1LA 5CMIA 2V0JA 2PGYA 2ZU7A 2Y4KA 3ZF8A 1S4PA 2I7BA 4G3PA 2VXMA 1H5RB 3U2VA 4CVHA 1QQ0A 4KNXA 4HO8A 3Q7UA 2P2OA 2AE7A 4HO4A 2OI5A 2V0KA 5AJPA 3ZGFA 5C1HA 1XZ6A 3SXGA 1VZTA 1H5TB 3QVBA 2VFZA 2BO7A 1V67A 1INJA 2NPOA 1QGQA 3R5DA 2YC5A 4MYOA 4NALA 1ZI5A 1EZIA 3PKPA 5C3DA 2E3DA 3V0LA 1TW1A 1VGWA 4AA7A 1ZCVA 3I0KA 3V0NA 1VGTA 4HO0A 4FIXA 3R0SA 1G1LA 4B3UA 3R3IA 1GA8A 2ZU8A 3OAMA 2IC7A 1R7UA 1V83A 5FTVA 3BSWA 1ZIZA 2AECA 1INIA 1QRLA 2V0LA 1LXAA 3OH1A 3JQYA 1IIMA 2YQHA 1G3LA 1MR7A 3I0CA 5CMHA 5C3AA 5C4BA 1FG5N 3KWDA 1H4CA 1IINA 4E6UA 3T7NA 3U2WA 2O1FA 1O0RA 1KGQA 3NGWA 4EABA 1H7LA 1MR9A 2XWNA 1ZJOA 1ZI1A 2Y4MA 4FRDA 1HJLA 2VXLA 2VS4A 5FV9A 5AJOA 1KK4A 2AGDA 3OH2A 2RJ4A 1ZCTA 5DEPA 2WLEA 2W0WA 4DE7A 2ICYA 2MZBA 1WT0A 5FU0A 4EVWA 2FKOA 1GQ9A 2XATA 2PX7A 3JUKA 1KHRA 4LW3A 5DG3A 5C8RA 2RIXA 3ECTA 4J09A 1LL0A 3R5AA 1JVDA 4KC2A 4P00A 1H7HA 3CGXA 1HJJA 1WT2A 2Y7AA 5IFYA 1K4VA 4FRPA 4B2WA 3I0DA 1G2VA 2FFVA 2BO4A 2FYAA 5DDTA 1JV3A 1MP5A 5C47A 2WE9A 3V8ZA 4EEAA 3RSBA 1NQIB 5DEMA 2PA4A 3OUPA 3TDTA 2QIVX 2ZU9A 4D48A 5JQQA 4B4GA 3C8VA 4Y9XA 1QWJA 2RJ8A 5ADXV 1EYRA 1ZCYA 2RIYA 1NF5B 1H7TA 2D0JA 4BMAA 3OTMA 2VSIA 4R7PA 1HM9A 1XHDA 2WGZA 4FROA 5J49A 3SXCA 1VH1A 2QH5A 4FRBA 3RMVA 4DCLA 4Y63A 3SXDA 1R7XA 2APCA 1O7OA 1KK6A 4M4KA 4M9CA 1H5SD 2WLDA 1OCXA 5IDTA 3BSYA 3BCVA 3R2WA 2AH9A 1JVGA 3IOHA 2JCOA 4Y64A 5CQPA 5CMGX 4GBPA 3DJ4A 2OEGA 3CKNA 4IRQA 4M2AA 4Y62A 5F42A 2QIAA 1R82A 3SRTA 4C2SA 5C3BA 3PKQA 4N6BA 3OW5A 3I0HA 4BQHA 3FWWA 1O23B 4R37A 4AYJA 3OH3A 5CQOA 3GOSA 2YQJA 3JTJA 5IDSA 1V82A 4Y6NA 3VBMA 5EIYA 5E3RA 3P1BA 3HL3A 3LW6A 1FWYA 1GX0A 4HO2A 2XWMA 3RMWA 2WLFA 2Y4LA 2VK9A 4M98A 3I0FA 1H7EA 3SXBA 4B4BA 4O6MA 5C4FA 3E25A 1G95A 3R5CA 2VSHA 4E75A 1S4NA 3EE5A 4IHFA 3Q4SA 4O6NA 2IU9A 1QRMA 3KWEA 2JCJA 2BO6A 3VBIA 1KRVA 4N69A 4HZCA 3POLA 5C4EA 3P47A 1Z90A 4HURA 4N27A 2RIZA 4HO6A 4ZDQA 2RIJA 1JV1A 4FCUA 1ZHJA 2XMEA 3OH0A 1TVYA 2WVLA 3IXCA 2NXVA 4KXOA 1R80A 2YQCA 4Y7VA 2FYDB 3CKOA 3EG4A 3F1CA 5AFUU 1H7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  4D0T A;  3OU9 A;  5CQN X;  1GX4 A;  3SX8 A;  3SPT A;  3D98 A;  1WSZ A;  3O3P A;  5EJZ A;  3KWC A;  1ZDF A;  4EGG A;  3DHO A;  1SST A;  5U2K A;  2FYB A;  2WEE A;  1W77 A;  1GQC A;  1R7V A;  2OI6 A;  4E1K A;  1T3D A;  1LVW A;  5DDV A;  1GWW A;  2I5E A;  5C49 A;  1WT3 A;  1KK5 A;  4FCE A;  1MP4 A;  4KPZ A;  1OMZ A;  1NMM B;  4FRL A;  2AM5 A;  5CQL X;  3V8Y A;  1ZJ2 A;  2BO8 A;  1GWV A;  2W0V A;  2IUA A;  3BFP A;  2IU8 A;  2RIT A;  1WVC A;  1ZI4 A;  5E3Q A;  5CQM X;  1SS9 A;  4H7O A;  4FRE A;  3PMO A;  4L41 C;  4Y7F A;  2O1H A;  2QGI A;  2A8U A;  4CJC A;  3KIA A;  3IOJ A;  2GGQ A;  1QRF A;  4HUS A;  2VS5 A;  1KRU A;  1MC3 A;  4G3S A;  2AES A;  1R81 A;  4Y7U A;  1HV9 A;  3R5B A;  3ZLK A;  2CU2 A;  5C48 A;  1PZY B;  1JYK A;  3V0O A;  1JYL A;  2V0I A;  3VBP A;  3FOQ A;  4E79 A;  4KT7 A;  4CJ8 A;  4EA9 A;  1FR9 A;  1R7Y A;  1KGT A;  1G8O A;  4B4M A;  4B2X A;  4FQW A;  4FRQ A;  3K8E A;  3VNP A;  4HO9 A;  3V0P A;  3VBK A;  2YES A;  3R1W A;  1E5K A;  1VIC A;  5C38 A;  1NHE B;  3IOI A;  3CU0 A;  3F1X A;  4Y7T A;  2I5K A;  1MP3 A;  1R7T A;  3FSB A;  3VBL A;  2XWL A;  1VGU A;  2Z86 A;  4EE4 A;  3VBJ A;  4D0Z A;  5ADX U;  3USQ A;  2JF3 A;  3FTT A;  4EEO A;  3I3A A;  2AM4 A;  4UEG A;  1V84 A;  4N6A A;  3V0Q A;  3TQD A;  1VM8 A;  1TDT A;  1I52 A;  1NKH B;  2WVM A;  3JUJ A;  4NAK A;  3HSQ A;  2RJ9 A;  1YP4 A;  4KPX A;  1ON6 A;  1QRE A;  2RJ7 A;  1KRR A;  4CJB A;  4ISX A;  3CJ8 A;  4MND A;  3MQG A;  1NWG B;  3V0M A;  3K8D A;  3OTZ A;  3T57 A;  4EE5 A;  4HO3 A;  1FRW A;  2OEF A;  1ZJ1 A;  2X60 A;  2TDT A;  5C4C A;  2AQ9 A;  2GGO A;  3U2U A;  3TIS A;  4AC3 A;  4M99 A;  3T7O A;  1H5R A;  1VZX A;  4KRV A;  1XAT A;  5FYE A;  3EEV A;  1G9R A;  1VGZ A;  5BXC A;  5E3P A;  2FY7 A;  2DPW A;  5CMJ A;  1S80 A;  3DK5 A;  3GUE A;  1H5T A;  1ZDG A;  1H5S C;  4AAW A;  1H5S A;  3TWD A;  3SX5 A;  3I3X A;  1LL2 A;  4R36 A;  2O1G A;  1ZJP A;  4LW6 A;  3ZGG A;  1KWS A;  4KNR A;  1SSQ A;  3CKQ A;  1H5S B;  3OGZ A;  2YC3 A;  1G0R A;  4EA8 A;  1H3M A;  2WAW A;  1WT1 A;  4E6T A;  1LZ0 A;  4EA7 A;  1ZCU A;  2Z87 A;  3EH0 A;  4M28 A;  3V4E A;  1H4E A;  4YS8 A;  3NZ2 A;  3I0G A;  2X5Z A;  4DEC A;  1V3W A;  1FOA A;  3R8Y A;  5FU8 A;  2X65 A;  4D11 C;  4D11 A;  1KQA A;  4EE3 A;  4FRM A;  1S4O A;  2P6W A;  4Y6U A;  5AFU V;  4J18 A;  1ON8 A;  5C36 A;  5HS2 A;  1LZJ A;  3HJJ A;  1ZI3 A;  3BRK X;  4KQL A;  3N9W A;  4EEG A;  4FRA A;  3ZLL A;  3TZT A;  2XMH A;  1ZJ0 A;  4NAN A;  3OH4 A;  2V0H A;  3Q80 A;  5I1F A;  3SX7 A;  4ECM A;  5C4D A;  1VH3 A;  4HO5 A;  2QKX A;  5C1G A;  3I0I X;  1FXO A;  4XWI A;  4EEM A;  3U2T A;  1XHB A;  3U0Y A;  1FGG A;  4MFG A;  2PGV A;  2JF2 A;  3SX3 A;  3FSC A;  1LL3 A;  3R3R A;  1J2Z A;  1G93 A;  2JCK A;  1HM8 A;  2YCM A;  3I0J A;  5EJ1 A;  2E8B A;  1H7F A;  4B5B A;  1VZU A;  4B42 A;  4K6R A;  1QG8 A;  2FFU A;  3DUV A;  5FTS A;  3V91 A;  2FYC B;  1SSM A;  4AYL A;  2X5S A;  5AJN A;  1G97 A;  1W57 A;  4NAI A;  4Y7G A;  3TIO A;  1PZT A;  3SXA A;  3FSY A;  1G23 A;  2ICX A;  3U2X A;  4MYB A;  3OKR A;  3SXE A;  3D8V A;  3TV0 A;  5L6V A;  4IHH A;  1FZW A;  1OMX A;  1TZF A;  1MRL A;  3Q1X A;  2Y4J A;  1LZ7 A;  3FSX A;  2VHE A;  3GVD A;  2RJ1 A;  3V90 A;  4HG6 A;  2WLC A;  3I0L A;  4KC4 A;  1O7Q A;  1FXJ A;  2UX8 A;  4HCQ A;  3BXY A;  3F1Y A;  2OI7 A;  3I0E A;  4JIS A;  3FS8 A;  1YRO B;  3USR A;  4ASY A;  2Y6P A;  3PNN A;  4MZU A;  1YP2 A;  4G3Q A;  4IRP A;  2D7R A;  1THJ A;  4HZD A;  1FO8 A;  4EQY A;  4HOC A;  1ZJ3 A;  2WVK A;  3MQH A;  3IGJ A;  1TW5 A;  2P72 A;  1QRG A;  3E26 A;  3D5N A;  4M2B A;  4G87 A;  4ASJ A;  2YQS A;  3CKV A;  3TK8 A;  3VBN A;  2RJ5 A;  1YP3 A;  1H4D A;  3U0X A;  2RJ6 A;  5CMF X;  2Q4J A;  3T7M A;  1OQM B;  2P73 A;  4FRH A;  2A8W A;  2VS3 A;  4DDZ A;  1HM0 A;  5L6S A;  4IHG A;  1FR8 A;  3MC4 A;  3CKJ A;  2VD4 A;  3ST8 A;  4EAA A;  4ARW A;  2WLG A;  5FUH A;  3BSS A;  2JCL A;  2D7I A;  1FO9 A;  1H7G A;  3OC9 A;  4JD0 A;  2AM3 A;  4P02 A;  1FGX A;  1QGS A;  1LZI A;  2RJ0 A;  1VPA A;  4KC1 A;  5C1L A;  5CMI A;  2V0J A;  2PGY A;  2ZU7 A;  2Y4K A;  3ZF8 A;  1S4P A;  2I7B A;  4G3P A;  2VXM A;  1H5R B;  3U2V A;  4CVH A;  1QQ0 A;  4KNX A;  4HO8 A;  3Q7U A;  2P2O A;  2AE7 A;  4HO4 A;  2OI5 A;  2V0K A;  5AJP A;  3ZGF A;  5C1H A;  1XZ6 A;  3SXG A;  1VZT A;  1H5T B;  3QVB A;  2VFZ A;  2BO7 A;  1V67 A;  1INJ A;  2NPO A;  1QGQ A;  3R5D A;  2YC5 A;  4MYO A;  4NAL A;  1ZI5 A;  1EZI A;  3PKP A;  5C3D A;  2E3D A;  3V0L A;  1TW1 A;  1VGW A;  4AA7 A;  1ZCV A;  3I0K A;  3V0N A;  1VGT A;  4HO0 A;  3R0S A;  1G1L A;  4B3U A;  3R3I A;  1GA8 A;  2ZU8 A;  3OAM A;  2IC7 A;  1R7U A;  1V83 A;  5FTV A;  3BSW A;  1ZIZ A;  2AEC A;  1INI A;  1QRL A;  2V0L A;  1LXA A;  3OH1 A;  3JQY A;  1IIM A;  2YQH A;  1G3L A;  1MR7 A;  3I0C A;  5CMH A;  5C3A A;  5C4B A;  1FG5 N;  3KWD A;  1H4C A;  1IIN A;  4E6U A;  3T7N A;  3U2W A;  2O1F A;  1O0R A;  1KGQ A;  3NGW A;  4EAB A;  1H7L A;  1MR9 A;  2XWN A;  1ZJO A;  1ZI1 A;  2Y4M A;  4FRD A;  1HJL A;  2VXL A;  2VS4 A;  5FV9 A;  5AJO A;  1KK4 A;  2AGD A;  3OH2 A;  2RJ4 A;  1ZCT A;  5DEP A;  2WLE A;  2W0W A;  4DE7 A;  2ICY A;  2MZB A;  1WT0 A;  5FU0 A;  4EVW A;  2FKO A;  1GQ9 A;  2XAT A;  2PX7 A;  3JUK A;  1KHR A;  4LW3 A;  5DG3 A;  5C8R A;  2RIX A;  3ECT A;  4J09 A;  1LL0 A;  3R5A A;  1JVD A;  4KC2 A;  4P00 A;  1H7H A;  3CGX A;  1HJJ A;  1WT2 A;  2Y7A A;  5IFY A;  1K4V A;  4FRP A;  4B2W A;  3I0D A;  1G2V A;  2FFV A;  2BO4 A;  2FYA A;  5DDT A;  1JV3 A;  1MP5 A;  5C47 A;  2WE9 A;  3V8Z A;  4EEA A;  3RSB A;  1NQI B;  5DEM A;  2PA4 A;  3OUP A;  3TDT A;  2QIV X;  2ZU9 A;  4D48 A;  5JQQ A;  4B4G A;  3C8V A;  4Y9X A;  1QWJ A;  2RJ8 A;  5ADX V;  1EYR A;  1ZCY A;  2RIY A;  1NF5 B;  1H7T A;  2D0J A;  4BMA A;  3OTM A;  2VSI A;  4R7P A;  1HM9 A;  1XHD A;  2WGZ A;  4FRO A;  5J49 A;  3SXC A;  1VH1 A;  2QH5 A;  4FRB A;  3RMV A;  4DCL A;  4Y63 A;  3SXD A;  1R7X A;  2APC A;  1O7O A;  1KK6 A;  4M4K A;  4M9C A;  1H5S D;  2WLD A;  1OCX A;  5IDT A;  3BSY A;  3BCV A;  3R2W A;  2AH9 A;  1JVG A;  3IOH A;  2JCO A;  4Y64 A;  5CQP A;  5CMG X;  4GBP A;  3DJ4 A;  2OEG A;  3CKN A;  4IRQ A;  4M2A A;  4Y62 A;  5F42 A;  2QIA A;  1R82 A;  3SRT A;  4C2S A;  5C3B A;  3PKQ A;  4N6B A;  3OW5 A;  3I0H A;  4BQH A;  3FWW A;  1O23 B;  4R37 A;  4AYJ A;  3OH3 A;  5CQO A;  3GOS A;  2YQJ A;  3JTJ A;  5IDS A;  1V82 A;  4Y6N A;  3VBM A;  5EIY A;  5E3R A;  3P1B A;  3HL3 A;  3LW6 A;  1FWY A;  1GX0 A;  4HO2 A;  2XWM A;  3RMW A;  2WLF A;  2Y4L A;  4M98 A;  3I0F A;  1H7E A;  3SXB A;  4B4B A;  5C4F A;  3E25 A;  1G95 A;  3R5C A;  2VSH A;  4E75 A;  1S4N A;  3EE5 A;  4IHF A;  3Q4S A;  2IU9 A;  1QRM A;  3KWE A;  2JCJ A;  2BO6 A;  3VBI A;  1KRV A;  4N69 A;  4HZC A;  3POL A;  5C4E A;  3P47 A;  1Z90 A;  4HUR A;  4N27 A;  2RIZ A;  4HO6 A;  4ZDQ A;  2RIJ A;  1JV1 A;  4FCU A;  1ZHJ A;  2XME A;  3OH0 A;  1TVY A;  2WVL A;  3IXC A;  2NXV A;  4KXO A;  1R80 A;  2YQC A;  4Y7V A;  2FYD B;  3CKO A;  3EG4 A;  3F1C A;  5AFU U;  1H7Q A; 
#chains in the Genus database with same CATH topology
 1W55 A;  4D0T A;  3OU9 A;  5CQN X;  1GX4 A;  3SX8 A;  3SPT A;  3D98 A;  1WSZ A;  3O3P A;  5EJZ A;  3KWC A;  1ZDF A;  4EGG A;  3DHO A;  1SST A;  5U2K A;  2FYB A;  2WEE A;  1W77 A;  1GQC A;  1R7V A;  2OI6 A;  4E1K A;  1T3D A;  1LVW A;  5DDV A;  1GWW A;  2I5E A;  5C49 A;  1WT3 A;  1KK5 A;  4FCE A;  1MP4 A;  4KPZ A;  1OMZ A;  1NMM B;  4FRL A;  2AM5 A;  5CQL X;  3V8Y A;  1ZJ2 A;  2BO8 A;  1GWV A;  4FIY A;  2W0V A;  2IUA A;  3BFP A;  2IU8 A;  2RIT A;  3SUC A;  1WVC A;  1ZI4 A;  5E3Q A;  5CQM X;  1SS9 A;  4H7O A;  4FRE A;  3PMO A;  4L41 C;  4Y7F A;  1L0S A;  2O1H A;  2QGI A;  2A8U A;  4CJC A;  3KIA A;  4Q7C A;  3IOJ A;  2GGQ A;  1QRF A;  4HUS A;  2VS5 A;  1KRU A;  1MC3 A;  4G3S A;  2AES A;  1R81 A;  4Y7U A;  1HV9 A;  3R5B A;  3ZLK A;  2CU2 A;  5C48 A;  1PZY B;  1JYK A;  5D92 A;  3V0O A;  1JYL A;  2V0I A;  3VBP A;  3FOQ A;  4E79 A;  4KT7 A;  4CJ8 A;  3GQ9 A;  4EA9 A;  1FR9 A;  1R7Y A;  1KGT A;  1G8O A;  4B4M A;  4B2X A;  4FQW A;  4FRQ A;  3K8E A;  3VNP A;  4HO9 A;  3V0P A;  3VBK A;  2YES A;  3R1W A;  1E5K A;  1VIC A;  5C38 A;  1NHE B;  3IOI A;  3CU0 A;  3F1X A;  4Y7T A;  2I5K A;  1MP3 A;  1R7T A;  3FSB A;  3VBL A;  2XWL A;  1VGU A;  2Z86 A;  4EE4 A;  3VBJ A;  4D0Z A;  5ADX U;  3USQ A;  2JF3 A;  3FTT A;  4EEO A;  3I3A A;  2AM4 A;  4UEG A;  1V84 A;  4N6A A;  3V0Q A;  3TQD A;  1VM8 A;  1TDT A;  1I52 A;  1NKH B;  2WVM A;  3JUJ A;  4NAK A;  3HSQ A;  2RJ9 A;  1YP4 A;  4KPX A;  1ON6 A;  1QRE A;  2RJ7 A;  1KRR A;  4CJB A;  4ISX A;  3CJ8 A;  1M8N A;  4MND A;  3MQG A;  1Z2F A;  1NWG B;  3V0M A;  3K8D A;  3OTZ A;  2J0A A;  3T57 A;  4EE5 A;  4HO3 A;  1FRW A;  2OEF A;  1ZJ1 A;  2X60 A;  2TDT A;  5C4C A;  2AQ9 A;  2GGO A;  3U2U A;  3TIS A;  4AC3 A;  4M99 A;  3T7O A;  1H5R A;  1VZX A;  4KRV A;  1XAT A;  5FYE A;  3EEV A;  1G9R A;  1VGZ A;  5BXC A;  5E3P A;  2FY7 A;  2DPW A;  5CMJ A;  1S80 A;  3DK5 A;  3GUE A;  1H5T A;  1ZDG A;  1H5S C;  4AAW A;  1H5S A;  3TWD A;  3SX5 A;  3I3X A;  1LL2 A;  4R36 A;  2O1G A;  1ZJP A;  4LW6 A;  3ZGG A;  1KWS A;  4KNR A;  1SSQ A;  3CKQ A;  1H5S B;  3OGZ A;  2YC3 A;  1G0R A;  4EA8 A;  1H3M A;  2WAW A;  1WT1 A;  4E6T A;  5D91 A;  1LZ0 A;  4EA7 A;  1ZCU A;  2Z87 A;  3EH0 A;  4M28 A;  3V4E A;  1H4E A;  4YS8 A;  3NZ2 A;  3I0G A;  2X5Z A;  4DEC A;  1V3W A;  1FOA A;  3R8Y A;  5FU8 A;  2X65 A;  4D11 C;  4D11 A;  1KQA A;  4EE3 A;  4FRM A;  3GQ7 A;  1S4O A;  2P6W A;  4Y6U A;  5AFU V;  4J18 A;  1ON8 A;  5C36 A;  5HS2 A;  1LZJ A;  3HJJ A;  1ZI3 A;  3BRK X;  4KQL A;  3N9W A;  4EEG A;  4FRA A;  3ZLL A;  3TZT A;  2XMH A;  1ZJ0 A;  4NAN A;  3OH4 A;  2V0H A;  3Q80 A;  5I1F A;  3SX7 A;  4ECM A;  5C4D A;  1VH3 A;  4HO5 A;  2C0N A;  2QKX A;  5C1G A;  3I0I X;  1FXO A;  4XWI A;  4EEM A;  3U2T A;  1XHB A;  3U0Y A;  1FGG A;  4MFG A;  2PGV A;  2JF2 A;  3SX3 A;  3FSC A;  1LL3 A;  3R3R A;  1J2Z A;  1G93 A;  2JCK A;  1HM8 A;  2YCM A;  3I0J A;  5EJ1 A;  2E8B A;  1H7F A;  4B5B A;  1VZU A;  4B42 A;  4K6R A;  1QG8 A;  2FFU A;  3DUV A;  5FTS A;  3V91 A;  2FYC B;  1SSM A;  4AYL A;  2X5S A;  5AJN A;  1G97 A;  1W57 A;  4NAI A;  4Y7G A;  3TIO A;  1PZT A;  3SXA A;  3FSY A;  1G23 A;  2ICX A;  3U2X A;  4MYB A;  3OKR A;  3SXE A;  3D8V A;  3TV0 A;  5L6V A;  4IHH A;  1FZW A;  1OMX A;  1TZF A;  1MRL A;  3Q1X A;  2Y4J A;  1LZ7 A;  3FSX A;  2VHE A;  3GVD A;  2RJ1 A;  3V90 A;  4HG6 A;  2WLC A;  3I0L A;  4KC4 A;  1O7Q A;  1FXJ A;  2UX8 A;  4HCQ A;  3BXY A;  3F1Y A;  2OI7 A;  3I0E A;  4JIS A;  3FS8 A;  1YRO B;  3USR A;  4ASY A;  2Y6P A;  3PNN A;  4MZU A;  1YP2 A;  4G3Q A;  4IRP A;  2D7R A;  1THJ A;  4HZD A;  1FO8 A;  4EQY A;  4HOC A;  1ZJ3 A;  2WVK A;  3MQH A;  3IGJ A;  1TW5 A;  2P72 A;  1QRG A;  3E26 A;  3D5N A;  4M2B A;  4G87 A;  4ASJ A;  2YQS A;  3CKV A;  3TK8 A;  3VBN A;  2RJ5 A;  1YP3 A;  1H4D A;  3U0X A;  2RJ6 A;  5CMF X;  2Q4J A;  3T7M A;  1OQM B;  2P73 A;  3GQA A;  2A8W A;  2VS3 A;  4FRH A;  4DDZ A;  1HM0 A;  5L6S A;  4IHG A;  1FR8 A;  3MC4 A;  3CKJ A;  2VD4 A;  3ST8 A;  2J0B A;  4EAA A;  4ARW A;  2WLG A;  4MIX A;  5FUH A;  3BSS A;  2JCL A;  2D7I A;  1FO9 A;  1H7G A;  3OC9 A;  4JD0 A;  2AM3 A;  4P02 A;  1FGX A;  1QGS A;  1LZI A;  2RJ0 A;  1VPA A;  4KC1 A;  5C1L A;  5CMI A;  2V0J A;  2PGY A;  2ZU7 A;  2Y4K A;  3ZF8 A;  1S4P A;  2I7B A;  4G3P A;  2VXM A;  1H5R B;  3U2V A;  4CVH A;  1QQ0 A;  4KNX A;  4HO8 A;  3Q7U A;  2P2O A;  2AE7 A;  4HO4 A;  2OI5 A;  2V0K A;  5AJP A;  3ZGF A;  5C1H A;  1XZ6 A;  3SXG A;  1VZT A;  1H5T B;  3QVB A;  2VFZ A;  2BO7 A;  1V67 A;  1INJ A;  2NPO A;  1QGQ A;  3R5D A;  2YC5 A;  4MYO A;  4NAL A;  1ZI5 A;  1EZI A;  3PKP A;  5C3D A;  2E3D A;  3V0L A;  1TW1 A;  1VGW A;  4AA7 A;  1ZCV A;  3I0K A;  3V0N A;  1VGT A;  4HO0 A;  4FIX A;  3R0S A;  1G1L A;  4B3U A;  3R3I A;  1GA8 A;  2ZU8 A;  3OAM A;  2IC7 A;  1R7U A;  1V83 A;  5FTV A;  3BSW A;  1ZIZ A;  2AEC A;  1EWW A;  1INI A;  1QRL A;  2V0L A;  1LXA A;  3OH1 A;  3JQY A;  1IIM A;  2YQH A;  1G3L A;  1MR7 A;  3I0C A;  5CMH A;  5C3A A;  5C4B A;  1FG5 N;  3KWD A;  1H4C A;  1IIN A;  4E6U A;  3T7N A;  3U2W A;  2O1F A;  1O0R A;  1KGQ A;  3NGW A;  4EAB A;  1H7L A;  1MR9 A;  3GQ8 A;  2XWN A;  1ZJO A;  1ZI1 A;  2Y4M A;  4FRD A;  1HJL A;  2VXL A;  2VS4 A;  5FV9 A;  5AJO A;  1KK4 A;  2AGD A;  3OH2 A;  2RJ4 A;  1ZCT A;  5DEP A;  2WLE A;  2W0W A;  4DE7 A;  2ICY A;  2MZB A;  1WT0 A;  5FU0 A;  4EVW A;  2FKO A;  1GQ9 A;  2XAT A;  2PX7 A;  3JUK A;  1KHR A;  4LW3 A;  5DG3 A;  5C8R A;  2RIX A;  3ECT A;  4J09 A;  1LL0 A;  3R5A A;  1JVD A;  4KC2 A;  4P00 A;  1H7H A;  3CGX A;  1HJJ A;  1WT2 A;  2Y7A A;  5IFY A;  1K4V A;  4FRP A;  4B2W A;  3I0D A;  1G2V A;  2FFV A;  2BO4 A;  2FYA A;  5DDT A;  1JV3 A;  1MP5 A;  5C47 A;  2WE9 A;  3V8Z A;  4EEA A;  3RSB A;  1NQI B;  5DEM A;  2PA4 A;  3OUP A;  3TDT A;  2QIV X;  2ZU9 A;  4D48 A;  5JQQ A;  4B4G A;  3C8V A;  4Y9X A;  1QWJ A;  2RJ8 A;  5ADX V;  1EYR A;  1ZCY A;  2RIY A;  1NF5 B;  1H7T A;  2D0J A;  4BMA A;  3OTM A;  2VSI A;  4R7P A;  1HM9 A;  1XHD A;  2WGZ A;  4FRO A;  5J49 A;  3SXC A;  1VH1 A;  2QH5 A;  4FRB A;  3RMV A;  4DCL A;  4Y63 A;  3SXD A;  1R7X A;  2APC A;  1O7O A;  1KK6 A;  4M4K A;  4M9C A;  1H5S D;  2WLD A;  1OCX A;  5IDT A;  3BSY A;  3BCV A;  3R2W A;  2AH9 A;  1JVG A;  3IOH A;  2JCO A;  4Y64 A;  5CQP A;  5CMG X;  4GBP A;  3DJ4 A;  2OEG A;  3CKN A;  1N4I A;  4M2A A;  4IRQ A;  4Y62 A;  5F42 A;  2QIA A;  1R82 A;  3SRT A;  4C2S A;  5C3B A;  3PKQ A;  4N6B A;  3OW5 A;  3I0H A;  4BQH A;  3FWW A;  1O23 B;  4R37 A;  4AYJ A;  3OH3 A;  5CQO A;  3GOS A;  2YQJ A;  3JTJ A;  5IDS A;  1V82 A;  4Y6N A;  3VBM A;  5EIY A;  5E3R A;  3P1B A;  3HL3 A;  3LW6 A;  1FWY A;  1GX0 A;  4HO2 A;  2XWM A;  3RMW A;  2WLF A;  2Y4L A;  2VK9 A;  4M98 A;  3I0F A;  1H7E A;  3SXB A;  4B4B A;  4O6M A;  5C4F A;  3E25 A;  1G95 A;  3R5C A;  2VSH A;  4E75 A;  1S4N A;  3EE5 A;  4IHF A;  3Q4S A;  4O6N A;  2IU9 A;  1QRM A;  3KWE A;  2JCJ A;  2BO6 A;  3VBI A;  1KRV A;  4N69 A;  4HZC A;  3POL A;  5C4E A;  3P47 A;  1Z90 A;  4HUR A;  4N27 A;  2RIZ A;  4HO6 A;  4ZDQ A;  2RIJ A;  1JV1 A;  4FCU A;  1ZHJ A;  3OH0 A;  2XME A;  1TVY A;  2WVL A;  3IXC A;  2NXV A;  4KXO A;  1R80 A;  2YQC A;  4Y7V A;  2FYD B;  3CKO A;  3EG4 A;  3F1C A;  5AFU U;  1H7Q A; 
#chains in the Genus database with same CATH homology
 1W55 A;  4D0T A;  3OU9 A;  5CQN X;  1GX4 A;  3SX8 A;  3SPT A;  3D98 A;  1WSZ A;  3O3P A;  5EJZ A;  3KWC A;  1ZDF A;  4EGG A;  3DHO A;  1SST A;  5U2K A;  2FYB A;  2WEE A;  1W77 A;  1GQC A;  1R7V A;  2OI6 A;  4E1K A;  1T3D A;  1LVW A;  5DDV A;  1GWW A;  2I5E A;  5C49 A;  1WT3 A;  1KK5 A;  4FCE A;  1MP4 A;  4KPZ A;  1OMZ A;  1NMM B;  4FRL A;  2AM5 A;  5CQL X;  3V8Y A;  1ZJ2 A;  2BO8 A;  1GWV A;  4FIY A;  2W0V A;  2IUA A;  3BFP A;  2IU8 A;  2RIT A;  1WVC A;  1ZI4 A;  5E3Q A;  5CQM X;  1SS9 A;  4H7O A;  4FRE A;  3PMO A;  4L41 C;  4Y7F A;  2O1H A;  2QGI A;  2A8U A;  4CJC A;  3KIA A;  4Q7C A;  3IOJ A;  2GGQ A;  1QRF A;  4HUS A;  2VS5 A;  1KRU A;  1MC3 A;  4G3S A;  2AES A;  1R81 A;  4Y7U A;  1HV9 A;  3R5B A;  3ZLK A;  2CU2 A;  5C48 A;  1PZY B;  1JYK A;  5D92 A;  3V0O A;  1JYL A;  2V0I A;  3VBP A;  3FOQ A;  4E79 A;  4KT7 A;  4CJ8 A;  4EA9 A;  1FR9 A;  1R7Y A;  1KGT A;  1G8O A;  4B4M A;  4B2X A;  4FQW A;  4FRQ A;  3K8E A;  3VNP A;  4HO9 A;  3V0P A;  3VBK A;  2YES A;  3R1W A;  1E5K A;  1VIC A;  5C38 A;  1NHE B;  3IOI A;  3CU0 A;  3F1X A;  4Y7T A;  2I5K A;  1MP3 A;  1R7T A;  3FSB A;  3VBL A;  2XWL A;  1VGU A;  2Z86 A;  4EE4 A;  3VBJ A;  4D0Z A;  5ADX U;  3USQ A;  2JF3 A;  3FTT A;  4EEO A;  3I3A A;  2AM4 A;  4UEG A;  1V84 A;  4N6A A;  3V0Q A;  3TQD A;  1VM8 A;  1TDT A;  1I52 A;  1NKH B;  2WVM A;  3JUJ A;  4NAK A;  3HSQ A;  2RJ9 A;  1YP4 A;  4KPX A;  1ON6 A;  1QRE A;  2RJ7 A;  1KRR A;  4CJB A;  4ISX A;  3CJ8 A;  4MND A;  3MQG A;  1NWG B;  3V0M A;  3K8D A;  3OTZ A;  2J0A A;  3T57 A;  4EE5 A;  4HO3 A;  1FRW A;  2OEF A;  1ZJ1 A;  2X60 A;  2TDT A;  5C4C A;  2AQ9 A;  2GGO A;  3U2U A;  3TIS A;  4AC3 A;  4M99 A;  3T7O A;  1H5R A;  1VZX A;  4KRV A;  1XAT A;  5FYE A;  3EEV A;  1G9R A;  1VGZ A;  5BXC A;  5E3P A;  2FY7 A;  2DPW A;  5CMJ A;  1S80 A;  3DK5 A;  3GUE A;  1H5T A;  1ZDG A;  1H5S C;  4AAW A;  1H5S A;  3TWD A;  3SX5 A;  3I3X A;  1LL2 A;  4R36 A;  2O1G A;  1ZJP A;  4LW6 A;  3ZGG A;  1KWS A;  4KNR A;  1SSQ A;  3CKQ A;  1H5S B;  3OGZ A;  2YC3 A;  1G0R A;  4EA8 A;  1H3M A;  2WAW A;  1WT1 A;  4E6T A;  5D91 A;  1LZ0 A;  4EA7 A;  1ZCU A;  2Z87 A;  3EH0 A;  4M28 A;  3V4E A;  1H4E A;  4YS8 A;  3NZ2 A;  3I0G A;  2X5Z A;  4DEC A;  1V3W A;  1FOA A;  3R8Y A;  5FU8 A;  2X65 A;  4D11 C;  4D11 A;  1KQA A;  4EE3 A;  4FRM A;  1S4O A;  2P6W A;  4Y6U A;  5AFU V;  4J18 A;  1ON8 A;  5C36 A;  5HS2 A;  1LZJ A;  3HJJ A;  1ZI3 A;  3BRK X;  4KQL A;  3N9W A;  4EEG A;  4FRA A;  3ZLL A;  3TZT A;  2XMH A;  1ZJ0 A;  4NAN A;  3OH4 A;  2V0H A;  3Q80 A;  5I1F A;  3SX7 A;  4ECM A;  5C4D A;  1VH3 A;  4HO5 A;  2C0N A;  2QKX A;  5C1G A;  3I0I X;  1FXO A;  4XWI A;  4EEM A;  3U2T A;  1XHB A;  3U0Y A;  1FGG A;  4MFG A;  2PGV A;  2JF2 A;  3SX3 A;  3FSC A;  1LL3 A;  3R3R A;  1J2Z A;  1G93 A;  2JCK A;  1HM8 A;  2YCM A;  3I0J A;  5EJ1 A;  2E8B A;  1H7F A;  4B5B A;  1VZU A;  4B42 A;  4K6R A;  1QG8 A;  2FFU A;  3DUV A;  5FTS A;  3V91 A;  2FYC B;  1SSM A;  4AYL A;  2X5S A;  5AJN A;  1G97 A;  1W57 A;  4NAI A;  4Y7G A;  3TIO A;  1PZT A;  3SXA A;  3FSY A;  1G23 A;  2ICX A;  3U2X A;  4MYB A;  3OKR A;  3SXE A;  3D8V A;  3TV0 A;  5L6V A;  4IHH A;  1FZW A;  1OMX A;  1TZF A;  1MRL A;  3Q1X A;  2Y4J A;  1LZ7 A;  3FSX A;  2VHE A;  3GVD A;  2RJ1 A;  3V90 A;  4HG6 A;  2WLC A;  3I0L A;  4KC4 A;  1O7Q A;  1FXJ A;  2UX8 A;  4HCQ A;  3BXY A;  3F1Y A;  2OI7 A;  3I0E A;  4JIS A;  3FS8 A;  1YRO B;  3USR A;  4ASY A;  2Y6P A;  3PNN A;  4MZU A;  1YP2 A;  4G3Q A;  4IRP A;  2D7R A;  1THJ A;  4HZD A;  1FO8 A;  4EQY A;  4HOC A;  1ZJ3 A;  2WVK A;  3MQH A;  3IGJ A;  1TW5 A;  2P72 A;  1QRG A;  3E26 A;  3D5N A;  4M2B A;  4G87 A;  4ASJ A;  2YQS A;  3CKV A;  3TK8 A;  3VBN A;  2RJ5 A;  1YP3 A;  1H4D A;  3U0X A;  2RJ6 A;  5CMF X;  2Q4J A;  3T7M A;  1OQM B;  2P73 A;  4FRH A;  2A8W A;  2VS3 A;  4DDZ A;  1HM0 A;  5L6S A;  4IHG A;  1FR8 A;  3MC4 A;  3CKJ A;  2VD4 A;  3ST8 A;  2J0B A;  4EAA A;  4ARW A;  2WLG A;  4MIX A;  5FUH A;  3BSS A;  2JCL A;  2D7I A;  1FO9 A;  1H7G A;  3OC9 A;  4JD0 A;  2AM3 A;  4P02 A;  1FGX A;  1QGS A;  1LZI A;  2RJ0 A;  1VPA A;  4KC1 A;  5C1L A;  5CMI A;  2V0J A;  2PGY A;  2ZU7 A;  2Y4K A;  3ZF8 A;  1S4P A;  2I7B A;  4G3P A;  2VXM A;  1H5R B;  3U2V A;  4CVH A;  1QQ0 A;  4KNX A;  4HO8 A;  3Q7U A;  2P2O A;  2AE7 A;  4HO4 A;  2OI5 A;  2V0K A;  5AJP A;  3ZGF A;  5C1H A;  1XZ6 A;  3SXG A;  1VZT A;  1H5T B;  3QVB A;  2VFZ A;  2BO7 A;  1V67 A;  1INJ A;  2NPO A;  1QGQ A;  3R5D A;  2YC5 A;  4MYO A;  4NAL A;  1ZI5 A;  1EZI A;  3PKP A;  5C3D A;  2E3D A;  3V0L A;  1TW1 A;  1VGW A;  4AA7 A;  1ZCV A;  3I0K A;  3V0N A;  1VGT A;  4HO0 A;  4FIX A;  3R0S A;  1G1L A;  4B3U A;  3R3I A;  1GA8 A;  2ZU8 A;  3OAM A;  2IC7 A;  1R7U A;  1V83 A;  5FTV A;  3BSW A;  1ZIZ A;  2AEC A;  1INI A;  1QRL A;  2V0L A;  1LXA A;  3OH1 A;  3JQY A;  1IIM A;  2YQH A;  1G3L A;  1MR7 A;  3I0C A;  5CMH A;  5C3A A;  5C4B A;  1FG5 N;  3KWD A;  1H4C A;  1IIN A;  4E6U A;  3T7N A;  3U2W A;  2O1F A;  1O0R A;  1KGQ A;  3NGW A;  4EAB A;  1H7L A;  1MR9 A;  2XWN A;  1ZJO A;  1ZI1 A;  2Y4M A;  4FRD A;  1HJL A;  2VXL A;  2VS4 A;  5FV9 A;  5AJO A;  1KK4 A;  2AGD A;  3OH2 A;  2RJ4 A;  1ZCT A;  5DEP A;  2WLE A;  2W0W A;  4DE7 A;  2ICY A;  2MZB A;  1WT0 A;  5FU0 A;  4EVW A;  2FKO A;  1GQ9 A;  2XAT A;  2PX7 A;  3JUK A;  1KHR A;  4LW3 A;  5DG3 A;  5C8R A;  2RIX A;  3ECT A;  4J09 A;  1LL0 A;  3R5A A;  1JVD A;  4KC2 A;  4P00 A;  1H7H A;  3CGX A;  1HJJ A;  1WT2 A;  2Y7A A;  5IFY A;  1K4V A;  4FRP A;  4B2W A;  3I0D A;  1G2V A;  2FFV A;  2BO4 A;  2FYA A;  5DDT A;  1JV3 A;  1MP5 A;  5C47 A;  2WE9 A;  3V8Z A;  4EEA A;  3RSB A;  1NQI B;  5DEM A;  2PA4 A;  3OUP A;  3TDT A;  2QIV X;  2ZU9 A;  4D48 A;  5JQQ A;  4B4G A;  3C8V A;  4Y9X A;  1QWJ A;  2RJ8 A;  5ADX V;  1EYR A;  1ZCY A;  2RIY A;  1NF5 B;  1H7T A;  2D0J A;  4BMA A;  3OTM A;  2VSI A;  4R7P A;  1HM9 A;  1XHD A;  2WGZ A;  4FRO A;  5J49 A;  3SXC A;  1VH1 A;  2QH5 A;  4FRB A;  3RMV A;  4DCL A;  4Y63 A;  3SXD A;  1R7X A;  2APC A;  1O7O A;  1KK6 A;  4M4K A;  4M9C A;  1H5S D;  2WLD A;  1OCX A;  5IDT A;  3BSY A;  3BCV A;  3R2W A;  2AH9 A;  1JVG A;  3IOH A;  2JCO A;  4Y64 A;  5CQP A;  5CMG X;  4GBP A;  3DJ4 A;  2OEG A;  3CKN A;  4IRQ A;  4M2A A;  4Y62 A;  5F42 A;  2QIA A;  1R82 A;  3SRT A;  4C2S A;  5C3B A;  3PKQ A;  4N6B A;  3OW5 A;  3I0H A;  4BQH A;  3FWW A;  1O23 B;  4R37 A;  4AYJ A;  3OH3 A;  5CQO A;  3GOS A;  2YQJ A;  3JTJ A;  5IDS A;  1V82 A;  4Y6N A;  3VBM A;  5EIY A;  5E3R A;  3P1B A;  3HL3 A;  3LW6 A;  1FWY A;  1GX0 A;  4HO2 A;  2XWM A;  3RMW A;  2WLF A;  2Y4L A;  2VK9 A;  4M98 A;  3I0F A;  1H7E A;  3SXB A;  4B4B A;  4O6M A;  5C4F A;  3E25 A;  1G95 A;  3R5C A;  2VSH A;  4E75 A;  1S4N A;  3EE5 A;  4IHF A;  3Q4S A;  4O6N A;  2IU9 A;  1QRM A;  3KWE A;  2JCJ A;  2BO6 A;  3VBI A;  1KRV A;  4N69 A;  4HZC A;  3POL A;  5C4E A;  3P47 A;  1Z90 A;  4HUR A;  4N27 A;  2RIZ A;  4HO6 A;  4ZDQ A;  2RIJ A;  1JV1 A;  4FCU A;  1ZHJ A;  2XME A;  3OH0 A;  1TVY A;  2WVL A;  3IXC A;  2NXV A;  4KXO A;  1R80 A;  2YQC A;  4Y7V A;  2FYD B;  3CKO A;  3EG4 A;  3F1C A;  5AFU U;  1H7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...