3D8XA

Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
VHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1
publication title Crystal structure of Saccharomyces cerevisiae cytoplasmic thioredoxin reductase Trr1 reveals the structural basis for species-specific recognition of thioredoxin
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 98
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3d8xA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3d8xA02
3NRNA 1PDHA 4NZHA 1P2EA 4ICYA 2YLWA 3EPTA 1LQUA 2J3NA 2WEUA 1LPFA 5FS6A 2C64A 1PS9A 1LJ1A 3GYJA 3M12A 1B4VA 4YT0A 2R4EA 2X8HA 2YWLA 1BZLA 3QSSA 3SM8A 1Y56A 2ARDA 4PABA 4CY8A 2V3AA 3NK1X 3NN6X 1GESA 3LZWA 3UTEA 4JN9A 4ZN0A 2Q6UA 3H8IA 2WS3A 3ISHA 2O9ZA 3M13A 4GF7A 3QVPA 4XXGA 4Z26A 1TDFA 1DODA 1IUTA 1IUSA 1ZP0A 2WPCA 3C4NA 2XLRA 3DK9A 4UDPA 1NDAA 2A89A 4YTMA 2AR8A 3DMEA 2YR6A 4WCTA 2XDOA 4A7AA 3G5RA 1GT8A 1TDNA 2YQUA 1K0JA 1IUXA 1S2YA 4A5LA 2UZZA 2XCGA 1DNCA 2XVHA 2VVLG 2X8GA 1B5QA 3AEEA 1IUWA 3FBSA 1N4VA 4CY6A 2WP6A 3AYJA 4DSHA 4J33A 2YLXA 1E7PA 3UKLA 2VQ7A 4AOXA 3GD4A 2B9YA 4K2XA 1VG9A 3AEFA 3EAOA 3ZYXA 5J60A 4K5RA 1ZDLA 2GR0A 4IV9A 2YM2A 3P4SA 3IWAA 2WU2A 4EQSA 3NLCA 1FOHA 3P4QA 1TYTA 5KOWA 4B68A 3GDPA 1CJ2A 4NTEA 2Q0LA 4YWOA 3PO7A 3R9UA 4U8JA 3UP5A 1NG3A 4OPTA 5LV9A 3QJ4A 3NIXA 4BURA 1L9DA 3AEGA 4K8DA 1NG4A 4TM0A 2CULA 3FMWA 4BJZA 4LA1A 1X31B 1BGNA 1DXLA 2EQ8A 1VRQB 4JNQA 4RSLA 5EB5A 3OZ2A 3DK4A 2XFQA 2TMDA 2JB1A 1GRBA 3AB1A 3AE8A 2JB2A 4N9XA 3P4RA 3JSKA 4UDQA 2BACA 3I3LA 3LADA 5HYMA 4BJYA 2FJDA 5KVHA 2XFNA 2B9XA 2CDUA 3CNJA 1EBDA 1K4QA 2QAEA 3GYIA 4EM3A 1D4EA 5J7XA 3ICSA 2V6OA 1XANA 1KSUA 2BCPA 3ITJA 4H4VA 3RP6A 4CNJA 1KDGA 3NKSA 2XFPA 4A6NA 1PXBA 2H89A 2NPXA 2QCUA 4USRA 1FEBA 1EL8A 1H81A 1H7XA 4J2WA 2VRLA 2WP9A 1Q1RA 2A87A 4H50A 4U2SA 4DSGA 4YKGA 2WPEA 4DNAA 3UTGA 3BHFA 2IVEA 2C72A 4H4SA 2YG6A 1E1LA 4H2PA 1B37A 4H4ZA 3KKJA 4EQXA 3IHMA 2F5ZA 3PVCA 3H8LA 3LXDA 5IPYA 4CCRA 5BRTA 3UTFA 5JCMA 1CJ3A 1DOCA 4U8PA 3GSIA 2FBWA 3UKKA 4B65A 1DOBA 2Q7VA 2R45A 4J57A 2BC1A 3KA7A 4TLXA 1CJ4A 2XFOA 4UDRA 5GRTA 2BXSA 5M0ZA 1LVLA 4GRTA 4AT0A 3IF9A 3DH9A 1E39A 3K7QX 1JEHA 1XPQA 1F8WA 2FJEA 1H82A 3IC9A 2VVMA 1Y0PA 1GRAA 1CBOA 2WHDA 4H4WA 1REOA 4J56A 1Q9IA 2WDQA 3AECA 3ATQA 1KNRA 1JU2A 3CPJG 1DJNA 4NTCA 1PBCA 4AT2A 3S5WA 1ZOVA 2WOWA 4EIPA 4EMJA 2Z5XA 1GNDA 3L8KA 3UKHA 4GCMA 4UP3A 4K22A 4K7ZA 3RP7A 2C7GA 5FS9A 1FECA 1GOSA 2E1MA 3AE6A 1HYUA 3AE1A 1GRTA 1ONFA 5U63A 4Z2RA 4NEVA 4CNKA 4B67A 3F8PA 2BABA 2YLZA 1TRBA 4EQWA 3K7TA 3P4PA 4B64A 2GH5A 1S3BA 1W4XA 2JK6A 2VOUA 1ZOYA 4H4YA 4IA5A 3AD9B 1CC2A 5ER0A 1EL9A 3CGDA 1YQ4A 1Z6LA 4ZCDA 3NNEA 4RG4A 4AP1A 3FIMB 1PXAA 1OJDA 3GRSA 4D03A 4GDPA 2E4GA 4H2NA 2JB3A 3DJEA 3ALJA 1NENA 3EANA 2QA1A 4CCQA 3AXBA 1K0IA 1IUVA 4REKA 1L9EA 5EBKA 1H86A 2V5ZA 4OPGA 3SFDA 2FJBA 3AEBA 4X9NA 2BCGG 1L9CA 5KWFA 4C5OA 4MJWA 3UKQA 2C70A 3F8DA 1TYPA 2C67A 3VRDB 1BKWA 5HXIA 4HB9A 2ZZCA 1GRHA 1D7YA 1PXCA 3CNDA 1N4UA 1RSGA 3WE0A 1F8SA 3BI5A 1PBEA 3ICTA 2NVKX 2YLSA 3HZLA 1GEUA 4IVMB 2V61A 3UKFA 4ADWA 4EIQA 4C3YA 2BK4A 1F8RA 4H4XA 4Z44A 2VQBA 1AOGA 5EB4A 1EL7A 1KNPA 3CGBA 3UOVA 4KPRA 2C75A 2GEWA 1OJCA 1RYIA 5CKUA 5FS7A 4B1BA 3Q6JA 1YKJA 2R0GA 3AE4A 3UCLA 2YLRA 1TDOA 3NK2X 4P9SA 1LQTA 4X9MA 1GPEA 3GMCA 1OJAA 1XDIA 3NYEA 1GSNA 4Z24A 1GXFA 2OALA 1KFYA 1VQWA 2CFYA 2APGA 4YSZA 2Y6QA 3AYLA 1E6EA 2OLNA 3BNUA 4U2LA 5KRQA 4H4QA 4A9WA 4DGKA 4BK1A 2B7RA 4OCGA 1KSSA 1OJTA 2EQ6A 3VR8A 1KF6A 3DJDA 1CHUA 3CNTA 3CIRA 2IVDA 3IHGA 3VRBA 3GWDA 3BI4A 4Y4MA 4A99A 2GAGB 2BA9A 3BI2A 5JCLA 5FMHA 2YG4A 1UKVG 5M10A 1TDEA 3AEAA 3GD3A 4H7UA 2JKCA 5L46A 4C77A 4J31A 4H4TA 4JY2A 2X3NA 4OPLA 2GVCA 2GAHB 3B3RA 1GTHA 3CGCA 4H2QA 4U2TA 1VG0A 2H88A 2XVIA 3P1WA 4J36A 2E5VA 3NK0X 2GQWA 2CVJA 2R46A 2WP5A 1XHCA 2YVJA 2R0CA 4JY3A 4BK3A 2YAUA 1YQ3A 2BS4A 3LZXA 4IA6A 3UKPA 1CL0A 3VR9A 5BVAA 1BGJA 4APNA 2A8XA 5CQFA 1MOKA 5DBJA 3UOXA 3BHKA 2BC0A 1GERA 3NT6A 3QSMA 1F3PA 2GF3A 2GB0A 1NHPA 4NTDA 1JRYA 5U25A 2GQFA 2ZBWA 1O5WA 4O5QA 2VVLA 2WU5A 2PYXA 2X50A 1COYA 2BK3A 4JQ9A 2XVEA 4Z25A 3AYIA 5C3JA 5IQ4A 4YSHA 4HA6A 4OVIA 2WQYA 3O0HA 1BF3A 4J34A 3ABVA 1GV4A 3ATRA 3II4A 2RABA 1PHHA 3UTHA 3DA1A 1YY5A 2GR3A 1DOEA 3NG7X 3AE9A 2GR1A 2QA2A 1GREA 1ZMDA 2V3BA 3AWIA 4EM4A 2C3CA 3CN8A 1NHQA 2WOIA 3COXA 3GMBA 4AOSA 3CTYA 3ALLA 3ZDNA 1JRXA 2C3DA 2YG3A 3CGEA 3ICRA 4FK1A 3DJGX 4E0VA 4TLZA 3NYFA 3CPHG 2YR4A 2WDRA 3BNMA 3M0OA 1O95A 4YXDA 2GMJA 4AP3A 3C4AA 2BYBA 1K0LA 3Q9TA 2XFUA 4KX6A 4ZCCA 1CF3A 2EQ9A 2RGHA 3AEDA 4C3XA 2B7SA 3K30A 1NEKA 3GWFA 2GRTA 5U1OA 4A65A 3QFAA 1FL2A 3REDA 2FJAA 2C65A 1SEZA 4YTPA 3DK8A 1D4DA 3VQRA 3E1TA 2PHHA 3CNPA 3RP8A 4OPIA 4CRTA 3URHA 2Y6RA 3NN0X 3V76A 2TPRA 2B76A 2RGJA 3SFEA 1E1NA 1ZKQA 3CNSA 2XVJA 3RHAA 3LJPA 2XLUA 1CC4A 3AD7B 1PBDA 2GMHA 1Y56B 2YLTA 3RNMA 1ZK7A 2EQ7A 3VRAA 1GETA 2VZ2A 3DGHA 2WBAA 3FPZA 1NPXA 4OPUA 4B66A 1YQZA 1ZMCA 1MXTA 3PS9A 4M52A 4BK2A 4WX1A 1E1MA 2ACZA 5EOWA 4EMWA 4OPDA 4I59A 1LTXR 2GV8A 4H4RA 3T37A 4U8LA 3UOZA 4LU6A 2WOVA 1QO8A 1V59A 1D7LA 2AAQA 4JNAA 4H2RA 3SGLA 3DJJA 2C66A 2AQJA 4U8IA 3H4KA 4YSXA 3NGCX 4GUVA 5IQ1A 2YR5A 3SQPA 1LV0A 1JNRA 3AE2A 3D1CA 3QSEA 1PJ5A 1PBFA 2DKIA 4B69A 4NEWA 4OPCA 4H4UA 2HQMA 3K7MX 1NHRA 1DJQA 1IUUA 2BS3A 3KD9A 3LB8A 4PAAA 4FX9A 4U8MA 5BUKA 1BWCA 1H84A 4RG3A 4TM1A 2BS2A 2C73A 1H6VA 1E1KA 4C74A 2YG5A 4TM3A 3NHOX 1PBBA 4U8NA 4YSYA 2Q0KA 1EL5A 3G5QA 3AD8B 2XVFA 3QVRA 3V3OA 1D4CA 2OAMA 2VRMA 4FK1C 4USQA 4YKFA 1P2HA 2JAEA 2YVFA 4U8KA 1H83A 4XWRA 3UKAA 1F6MA 4B63A 5KOXA 2Z5YA 3KU9A 2YVGA 4EQRA 2ZZBA 5HY5A 2V60A 3AE5A 2IIDA 4GDEA 4BV6A 3I6DA 3GRTA 3F8RA 4K5SA 5GSNA 2DKHA 4H4PA 4Z43A 2OLOA 2OA1A 5JCIA 3GDNA 2XLTA 2WDVA 3ALMA 5TR3A 3QFBA 2ZZ0A 2I0ZA 3P9UA 1GRGA 3UP4A 3ADAB 3NYCA 4CBQA 2XLPA 4Y4NA 1TDKA 1JOAA 2W0HA 2YM1A 1D5TA 4Y4LA 2R0PA 2XYOA 4JDRA 1JNZA 1L0VA 4ECHA 4TM4A 2BK5A 1GTEA 2C76A 1GALA 3KVEA 4LIIA 4U8OA 3DGZA 4D04A 3NTDA 1NAAA 1ELIA 4YTNA 4Z2TA 4XWZA 1PJ7A 1NHSA 4A6NB 1PJ6A 4I58A 3KPFA 5KVIA 1S2QA 4A79A 1JRZA 2JBVA 4EMIA 5C2TA 1S3EA 3C96A 1ZY8A 5KXJA 1N1PA 2B9WA 3LOVA 4IVOB 1FEAA 1PN0A 5JCNA 1QJDA 1OJ9A 1Q1WA 4FDCB 4Z2UA 5FS8A 5HHFA 1ZX9A 3NH3X 1RP0A 3S61A 5BULA 4GR1A 2YG7A 1GRFA 2WETA 3AE7A 3B6DA 2RGOA 1QLBA 3KLJA 3D8XA 4X4JA 1B8SA 3NTAA 1CC6A 2X8CA 3UOYA 2R4JA 1IJHA 3AE3A 2R9ZA 3CPIG 4O5UA 1H7WA 3G5SA 1VDCA 3OC4A 2WPFA 3V3NA 1M6IA 1MO9A 1CJCA 1M64A 1O94A 2BXRA 2GR2A 2X99A 2WESA 1N4WA 3L1RA 5JCKA 1FCDA 3EF6A 2XLSA 3FG2P
chains in the Genus database with same CATH superfamily
3NRNA 1PDHA 4NZHA 1P2EA 4ICYA 2YLWA 3EPTA 3SYIA 1LQUA 2J3NA 2WEUA 1LPFA 4G9KA 5FS6A 2C64A 1PS9A 1LJ1A 3GYJA 3M12A 1B4VA 4YT0A 2R4EA 2X8HA 2YWLA 1BZLA 3QSSA 3SM8A 1Y56A 2ARDA 4PABA 4CY8A 2V3AA 3NK1X 3NN6X 1GESA 3LZWA 3UTEA 4JN9A 4ZN0A 2Q6UA 3H8IA 2WS3A 3ISHA 2O9ZA 3M13A 4GF7A 3QVPA 4XXGA 4Z26A 1TDFA 3HYXA 1DODA 1IUTA 1IUSA 1ZP0A 2WPCA 3C4NA 2XLRA 3DK9A 4UDPA 1NDAA 2A89A 4YTMA 2AR8A 3DMEA 2YR6A 4WCTA 4GAVA 2XDOA 4A7AA 3G5RA 1GT8A 1TDNA 2YQUA 1K0JA 1IUXA 1S2YA 2C4CA 2UZZA 4A5LA 2XCGA 1DNCA 2XVHA 2VVLG 2X8GA 1B5QA 3AEEA 1IUWA 3FBSA 1N4VA 4CY6A 2WP6A 3AYJA 4DSHA 4J33A 2YLXA 1E7PA 3UKLA 2VQ7A 4AOXA 3GD4A 2B9YA 4K2XA 1VG9A 3AEFA 5KMPA 3EAOA 3ZYXA 3SZCA 5J60A 4K5RA 1ZDLA 2GR0A 4IV9A 2YM2A 3P4SA 3IWAA 2WU2A 4EQSA 3NLCA 1FOHA 3P4QA 1TYTA 2BRYA 3SX6A 5KOWA 4B68A 3GDPA 4II3A 1CJ2A 4NTEA 2Q0LA 4YWOA 3PO7A 3R9UA 4U8JA 3UP5A 1NG3A 4OPTA 5LV9A 3QJ4A 3NIXA 4BURA 5KMRA 3T14A 1L9DA 3AEGA 4K8DA 1NG4A 4TM0A 2CULA 3FMWA 4BJZA 4LA1A 1X31B 1BGNA 1DXLA 2EQ8A 1VRQB 4JNQA 4RSLA 5EB5A 3OZ2A 3DK4A 2XFQA 2TMDA 2JB1A 1GRBA 3AB1A 3AE8A 3T2YA 2JB2A 4N9XA 3P4RA 3JSKA 4UDQA 2BACA 3I3LA 3LADA 5HYMA 4BJYA 2FJDA 5KVHA 2XFNA 2B9XA 2CDUA 3CNJA 1EBDA 1K4QA 2QAEA 3GYIA 4EM3A 1D4EA 5J7XA 3ICSA 2V6OA 1XANA 1KSUA 2BCPA 3ITJA 4H4VA 3RP6A 4CNJA 1KDGA 3NKSA 2XFPA 4A6NA 1PXBA 2H89A 2NPXA 2QCUA 4USRA 1FEBA 1EL8A 1H81A 1H7XA 4J2WA 2VRLA 2WP9A 1Q1RA 2A87A 4H50A 4U2SA 4DSGA 4YKGA 2WPEA 4DNAA 3UTGA 3BHFA 2IVEA 2C72A 4H4SA 2YG6A 1E1LA 4H2PA 1B37A 4H4ZA 3KKJA 4EQXA 3IHMA 2F5ZA 3PVCA 3H8LA 3LXDA 5IPYA 4CCRA 5BRTA 3UTFA 5JCMA 1CJ3A 1DOCA 4U8PA 3GSIA 2FBWA 3UKKA 4B65A 1DOBA 2Q7VA 2R45A 4J57A 2BC1A 3KA7A 4TLXA 1CJ4A 2XFOA 4UDRA 5GRTA 2BXSA 5M0ZA 1LVLA 4GRTA 4AT0A 3IF9A 3DH9A 1E39A 3K7QX 1JEHA 4G74A 1XPQA 1F8WA 2FJEA 1H82A 3IC9A 2VVMA 1Y0PA 1GRAA 1CBOA 2WHDA 4H4WA 1REOA 4J56A 1Q9IA 2WDQA 3AECA 3ATQA 1KNRA 1JU2A 3CPJG 1DJNA 4NTCA 1PBCA 4AT2A 3S5WA 1ZOVA 2WOWA 4EIPA 4EMJA 2Z5XA 1GNDA 3L8KA 3UKHA 4GCMA 4UP3A 4K22A 4K7ZA 3RP7A 2C7GA 5FS9A 1FECA 1GOSA 2E1MA 3AE6A 1HYUA 3AE1A 1GRTA 5KMSA 1ONFA 4NWZA 5U63A 4Z2RA 4NEVA 4CNKA 4B67A 3F8PA 2BABA 2YLZA 1TRBA 4EQWA 3K7TA 3P4PA 4B64A 2GH5A 1S3BA 1W4XA 2JK6A 2VOUA 1ZOYA 4H4YA 4IA5A 3AD9B 1CC2A 5ER0A 1EL9A 3CGDA 1YQ4A 1Z6LA 4ZCDA 3NNEA 4RG4A 4AP1A 3FIMB 1PXAA 1OJDA 3GRSA 4D03A 4GDPA 2E4GA 4H2NA 2JB3A 3DJEA 3ALJA 1NENA 3EANA 2QA1A 4CCQA 3AXBA 1K0IA 1IUVA 4REKA 1L9EA 5EBKA 1H86A 2V5ZA 4OPGA 3SFDA 2FJBA 3AEBA 4X9NA 2BCGG 1L9CA 5KWFA 4C5OA 4MJWA 3UKQA 2C70A 3F8DA 1TYPA 2C67A 3VRDB 3T31A 1BKWA 5HXIA 3SZ0A 4HB9A 2ZZCA 1GRHA 1D7YA 1PXCA 3CNDA 1N4UA 1RSGA 3WE0A 1F8SA 3T2ZA 3BI5A 1PBEA 3ICTA 2NVKX 2YLSA 3HZLA 1GEUA 4IVMB 2V61A 3UKFA 4ADWA 4EIQA 4C3YA 2BK4A 1F8RA 4H4XA 4Z44A 3SZWA 2VQBA 1AOGA 5EB4A 1EL7A 1KNPA 3CGBA 3UOVA 4KPRA 2C75A 2GEWA 1OJCA 1RYIA 5CKUA 5FS7A 4B1BA 3Q6JA 1YKJA 2R0GA 3AE4A 3HYVA 3UCLA 2YLRA 1TDOA 3NK2X 4P9SA 1LQTA 4X9MA 1GPEA 3GMCA 1OJAA 1XDIA 3NYEA 1GSNA 4Z24A 1GXFA 2OALA 1KFYA 1VQWA 2CFYA 2APGA 4YSZA 2Y6QA 3AYLA 1E6EA 2OLNA 3BNUA 4U2LA 5KRQA 4H4QA 4A9WA 4DGKA 4BK1A 2B7RA 4OCGA 1KSSA 1OJTA 2EQ6A 3SY4A 4G73A 3VR8A 1KF6A 3DJDA 1CHUA 3CNTA 3CIRA 2IVDA 3IHGA 3VRBA 3GWDA 3BI4A 4Y4MA 3T0KA 2GAGB 4A99A 2BA9A 3BI2A 5JCLA 5FMHA 2YG4A 1UKVG 5M10A 1TDEA 3AEAA 3GD3A 4H7UA 2JKCA 5L46A 4C77A 4J31A 4H4TA 4JY2A 2X3NA 4OPLA 2GVCA 2GAHB 3B3RA 1GTHA 3CGCA 4H2QA 4U2TA 1VG0A 2H88A 2XVIA 3P1WA 4J36A 2E5VA 3NK0X 2GQWA 2CVJA 2R46A 2WP5A 1XHCA 2YVJA 2R0CA 4JY3A 4BK3A 2YAUA 1YQ3A 2BS4A 3LZXA 4IA6A 3UKPA 1CL0A 3VR9A 5BVAA 1BGJA 4APNA 2A8XA 3HYWA 5CQFA 3GYXA 1MOKA 5DBJA 3UOXA 3BHKA 2BC0A 1GERA 3NT6A 3QSMA 1F3PA 2GF3A 2GB0A 1NHPA 2BRAA 4NTDA 5KNLA 1JRYA 5U25A 2GQFA 2ZBWA 3CMMA 1O5WA 4O5QA 2VVLA 2WU5A 2PYXA 2X50A 1COYA 2BK3A 4JQ9A 4NNJA 2XVEA 4Z25A 3AYIA 5C3JA 5IQ4A 4YSHA 4HA6A 4OVIA 2WQYA 3O0HA 1BF3A 4G6HA 4J34A 3ABVA 1GV4A 3ATRA 3II4A 2RABA 1PHHA 3UTHA 3DA1A 1YY5A 2GR3A 1DOEA 3NG7X 3AE9A 2GR1A 2QA2A 1GREA 1ZMDA 2V3BA 3AWIA 4EM4A 2C3CA 3CN8A 1NHQA 2WOIA 3COXA 3GMBA 4AOSA 3CTYA 3ALLA 3ZDNA 1JRXA 2C3DA 2YG3A 3CGEA 3ICRA 4FK1A 3DJGX 4E0VA 4TLZA 3NYFA 3CPHG 2YR4A 2WDRA 3BNMA 3M0OA 1O95A 4YXDA 2GMJA 4AP3A 3C4AA 2BYBA 1K0LA 3Q9TA 2XFUA 4KX6A 4ZCCA 1CF3A 2EQ9A 2RGHA 3AEDA 4C3XA 2B7SA 3K30A 1NEKA 3GWFA 2GRTA 5U1OA 4A65A 3QFAA 1FL2A 3REDA 2FJAA 2C65A 1SEZA 4YTPA 3DK8A 1D4DA 4G6GA 3VQRA 3E1TA 2PHHA 3CNPA 3RP8A 4OPIA 4CRTA 3URHA 2Y6RA 3NN0X 3V76A 5KMQA 2TPRA 2B76A 2RGJA 3SFEA 1E1NA 1ZKQA 3CNSA 2XVJA 3RHAA 3LJPA 2XLUA 1CC4A 3AD7B 1PBDA 2GMHA 1Y56B 2YLTA 3RNMA 1ZK7A 2EQ7A 3VRAA 1GETA 2VZ2A 3DGHA 2WBAA 3FPZA 1NPXA 4OPUA 4B66A 1YQZA 1ZMCA 1MXTA 3PS9A 4M52A 4BK2A 4WX1A 1E1MA 2ACZA 5EOWA 4EMWA 4OPDA 4I59A 1LTXR 2GV8A 4H4RA 3T37A 4U8LA 3UOZA 4LU6A 2WOVA 1QO8A 1V59A 1D7LA 2AAQA 4JNAA 3SZFA 4H2RA 3SGLA 3DJJA 2C66A 2AQJA 4U8IA 3H4KA 4YSXA 3NGCX 4GUVA 5IQ1A 2YR5A 3SQPA 1LV0A 1JNRA 3AE2A 3D1CA 3QSEA 1PJ5A 1PBFA 2DKIA 4B69A 4NEWA 4OPCA 4H4UA 2HQMA 3T2KA 3K7MX 1NHRA 1DJQA 1IUUA 2BS3A 3KD9A 3LB8A 4PAAA 4FX9A 4U8MA 5BUKA 1BWCA 1H84A 4RG3A 4TM1A 2BS2A 2C73A 1H6VA 1E1KA 4C74A 2YG5A 4TM3A 3NHOX 1PBBA 4U8NA 4YSYA 2Q0KA 1EL5A 3G5QA 3AD8B 2XVFA 3QVRA 3V3OA 1D4CA 2OAMA 2VRMA 4FK1C 4USQA 4YKFA 1P2HA 2JAEA 2YVFA 4U8KA 1H83A 4XWRA 3UKAA 1F6MA 4B63A 3SXIA 5KOXA 2Z5YA 3KU9A 2YVGA 4EQRA 2ZZBA 5HY5A 2V60A 3AE5A 2IIDA 4GDEA 4BV6A 3I6DA 3GRTA 3F8RA 4K5SA 5GSNA 2DKHA 4H4PA 4Z43A 2OLOA 2OA1A 5JCIA 3GDNA 2XLTA 2WDVA 3ALMA 5TR3A 3QFBA 2ZZ0A 2I0ZA 3P9UA 1GRGA 3UP4A 3ADAB 3NYCA 4CBQA 2XLPA 4Y4NA 1TDKA 4II2A 1JOAA 2W0HA 2YM1A 1D5TA 4Y4LA 2R0PA 2XYOA 4JDRA 1JNZA 1L0VA 4ECHA 4TM4A 2BK5A 1GTEA 2C76A 1GALA 3KVEA 4LIIA 4U8OA 3DGZA 4D04A 3NTDA 1NAAA 1ELIA 4YTNA 4Z2TA 4XWZA 1PJ7A 1NHSA 4A6NB 1PJ6A 4I58A 3KPFA 5KVIA 1S2QA 4A79A 1JRZA 2JBVA 4EMIA 5C2TA 1S3EA 3C96A 3KPKA 1ZY8A 5KXJA 1N1PA 2B9WA 3LOVA 4IVOB 1FEAA 1PN0A 5JCNA 1QJDA 1OJ9A 4GAPA 1Q1WA 4FDCB 4Z2UA 5FS8A 5HHFA 1ZX9A 3NH3X 1RP0A 3S61A 5BULA 4GR1A 2YG7A 1GRFA 2WETA 3AE7A 3B6DA 2RGOA 1QLBA 3KLJA 3D8XA 4X4JA 1B8SA 3NTAA 1CC6A 2X8CA 3UOYA 2R4JA 1IJHA 3AE3A 2R9ZA 3CPIG 4O5UA 1H7WA 3G5SA 1VDCA 3OC4A 2WPFA 3V3NA 1M6IA 1MO9A 1CJCA 1M64A 1O94A 2BXRA 2GR2A 2X99A 2WESA 1N4WA 3L1RA 5JCKA 1FCDA 3EF6A 2XLSA 3FG2P
chains in the Genus database with same CATH topology
3NRNA 1PDHA 4NZHA 1P2EA 4ICYA 2YLWA 3EPTA 3SYIA 1LQUA 2J3NA 2WEUA 1LPFA 4G9KA 5FS6A 2C64A 1PS9A 1LJ1A 3GYJA 3M12A 1B4VA 4YT0A 2R4EA 2X8HA 2YWLA 1BZLA 3QSSA 3SM8A 1Y56A 2ARDA 4PABA 4CY8A 2V3AA 3NK1X 3NN6X 1GESA 3LZWA 3UTEA 4JN9A 4ZN0A 2Q6UA 3H8IA 2WS3A 3ISHA 2O9ZA 3M13A 4GF7A 3QVPA 4XXGA 4Z26A 1TDFA 3HYXA 1DODA 1IUTA 1IUSA 1ZP0A 2WPCA 3C4NA 2XLRA 3DK9A 4UDPA 1NDAA 2A89A 4YTMA 2AR8A 3DMEA 2YR6A 4WCTA 4GAVA 2XDOA 4A7AA 3G5RA 1GT8A 1TDNA 2YQUA 1K0JA 1IUXA 1S2YA 2C4CA 2UZZA 4A5LA 2XCGA 1DNCA 2XVHA 2VVLG 2X8GA 1B5QA 3AEEA 1IUWA 3FBSA 1N4VA 4CY6A 2WP6A 3AYJA 4DSHA 4J33A 2YLXA 1E7PA 3UKLA 2VQ7A 4AOXA 3GD4A 2B9YA 4K2XA 1VG9A 3AEFA 5KMPA 3EAOA 3ZYXA 3SZCA 5J60A 4K5RA 1ZDLA 2GR0A 4IV9A 2YM2A 3P4SA 3IWAA 2WU2A 4EQSA 3NLCA 1FOHA 3P4QA 1TYTA 2BRYA 3SX6A 5KOWA 4B68A 3GDPA 4II3A 1CJ2A 4NTEA 2Q0LA 4YWOA 3PO7A 3R9UA 4U8JA 3UP5A 1NG3A 4OPTA 5LV9A 3QJ4A 3NIXA 4BURA 5KMRA 3T14A 1L9DA 3AEGA 4K8DA 1NG4A 4TM0A 2CULA 3FMWA 4BJZA 4LA1A 1X31B 1BGNA 1DXLA 2EQ8A 1VRQB 4JNQA 4RSLA 5EB5A 3OZ2A 3DK4A 2XFQA 2TMDA 2JB1A 1GRBA 3AB1A 3AE8A 3T2YA 2JB2A 4N9XA 3P4RA 3JSKA 4UDQA 2BACA 3I3LA 3LADA 5HYMA 4BJYA 2FJDA 5KVHA 2XFNA 2B9XA 2CDUA 3CNJA 1EBDA 1K4QA 2QAEA 3GYIA 4EM3A 1D4EA 5J7XA 3ICSA 2V6OA 1XANA 1KSUA 2BCPA 3ITJA 4H4VA 3RP6A 4CNJA 1KDGA 3NKSA 2XFPA 4A6NA 1PXBA 2H89A 2NPXA 2QCUA 4USRA 1FEBA 1EL8A 1H81A 1H7XA 4J2WA 2VRLA 2WP9A 1Q1RA 2A87A 4H50A 4U2SA 4DSGA 4YKGA 2WPEA 4DNAA 3UTGA 3BHFA 2IVEA 2C72A 4H4SA 2YG6A 1E1LA 4H2PA 1B37A 4H4ZA 3KKJA 4EQXA 3IHMA 2F5ZA 3PVCA 3H8LA 3LXDA 5IPYA 4CCRA 5BRTA 3UTFA 5JCMA 1CJ3A 1DOCA 4U8PA 3GSIA 2FBWA 3UKKA 4B65A 1DOBA 2Q7VA 2R45A 4J57A 2BC1A 3KA7A 4TLXA 1CJ4A 2XFOA 4UDRA 5GRTA 2BXSA 5M0ZA 1LVLA 4GRTA 4AT0A 3IF9A 3DH9A 1E39A 3K7QX 1JEHA 4G74A 1XPQA 1F8WA 2FJEA 1H82A 3IC9A 2VVMA 1Y0PA 1GRAA 1CBOA 2WHDA 4H4WA 1REOA 4J56A 1Q9IA 2WDQA 3AECA 3ATQA 1KNRA 1JU2A 3CPJG 1DJNA 4NTCA 1PBCA 4AT2A 3S5WA 1ZOVA 2WOWA 4EIPA 4EMJA 2Z5XA 1GNDA 3L8KA 3UKHA 4GCMA 4UP3A 4K22A 4K7ZA 3RP7A 2C7GA 5FS9A 1FECA 1GOSA 2E1MA 3AE6A 1HYUA 3AE1A 1GRTA 5KMSA 1ONFA 4NWZA 5U63A 4Z2RA 4NEVA 4CNKA 4B67A 3F8PA 2BABA 2YLZA 1TRBA 4EQWA 3K7TA 3P4PA 4B64A 2GH5A 1S3BA 1W4XA 2JK6A 2VOUA 1ZOYA 4H4YA 4IA5A 3AD9B 1CC2A 5ER0A 1EL9A 3CGDA 1YQ4A 1Z6LA 4ZCDA 3NNEA 4RG4A 4AP1A 3FIMB 1PXAA 1OJDA 3GRSA 4D03A 4GDPA 2E4GA 4H2NA 2JB3A 3DJEA 3ALJA 1NENA 3EANA 2QA1A 4CCQA 3AXBA 1K0IA 1IUVA 4REKA 1L9EA 5EBKA 1H86A 2V5ZA 4OPGA 3SFDA 2FJBA 3AEBA 4X9NA 2BCGG 1L9CA 5KWFA 4C5OA 4MJWA 3UKQA 2C70A 3F8DA 1TYPA 2C67A 3VRDB 3T31A 1BKWA 5HXIA 3SZ0A 4HB9A 2ZZCA 1GRHA 1D7YA 1PXCA 3CNDA 1N4UA 1RSGA 3WE0A 1F8SA 3T2ZA 3BI5A 1PBEA 3ICTA 2NVKX 2YLSA 3HZLA 1GEUA 4IVMB 2V61A 3UKFA 4ADWA 4EIQA 4C3YA 2BK4A 1F8RA 4H4XA 4Z44A 3SZWA 2VQBA 1AOGA 5EB4A 1EL7A 1KNPA 3CGBA 3UOVA 4KPRA 2C75A 2GEWA 1OJCA 1RYIA 5CKUA 5FS7A 4B1BA 3Q6JA 1YKJA 2R0GA 3AE4A 3HYVA 3UCLA 2YLRA 1TDOA 3NK2X 4P9SA 1LQTA 4X9MA 1GPEA 3GMCA 1OJAA 1XDIA 3NYEA 1GSNA 4Z24A 1GXFA 2OALA 1KFYA 1VQWA 2CFYA 2APGA 4YSZA 2Y6QA 3AYLA 1E6EA 2OLNA 3BNUA 4U2LA 5KRQA 4H4QA 4A9WA 4DGKA 4BK1A 2B7RA 4OCGA 1KSSA 1OJTA 2EQ6A 3SY4A 4G73A 3VR8A 1KF6A 3DJDA 1CHUA 3CNTA 3CIRA 2IVDA 3IHGA 3VRBA 3GWDA 3BI4A 4Y4MA 3T0KA 2GAGB 4A99A 2BA9A 3BI2A 5JCLA 5FMHA 2YG4A 1UKVG 5M10A 1TDEA 3AEAA 3GD3A 4H7UA 2JKCA 5L46A 4C77A 4J31A 4H4TA 4JY2A 2X3NA 4OPLA 2GVCA 2GAHB 3B3RA 1GTHA 3CGCA 4H2QA 4U2TA 1VG0A 2H88A 2XVIA 3P1WA 4J36A 2E5VA 3NK0X 2GQWA 2CVJA 2R46A 2WP5A 1XHCA 2YVJA 2R0CA 4JY3A 4BK3A 2YAUA 1YQ3A 2BS4A 3LZXA 4IA6A 3UKPA 1CL0A 3VR9A 5BVAA 1BGJA 4APNA 2A8XA 3HYWA 5CQFA 3GYXA 1MOKA 5DBJA 3UOXA 3BHKA 2BC0A 1GERA 3NT6A 3QSMA 1F3PA 2GF3A 2GB0A 1NHPA 2BRAA 4NTDA 5KNLA 1JRYA 5U25A 2GQFA 2ZBWA 3CMMA 1O5WA 4O5QA 2VVLA 2WU5A 2PYXA 2X50A 1COYA 2BK3A 4JQ9A 4NNJA 2XVEA 4Z25A 3AYIA 5C3JA 5IQ4A 4YSHA 4HA6A 4OVIA 2WQYA 3O0HA 1BF3A 4G6HA 4J34A 3ABVA 1GV4A 3ATRA 3II4A 2RABA 1PHHA 3UTHA 3DA1A 1YY5A 2GR3A 1DOEA 3NG7X 3AE9A 2GR1A 2QA2A 1GREA 1ZMDA 2V3BA 3AWIA 4EM4A 2C3CA 3CN8A 1NHQA 2WOIA 3COXA 3GMBA 4AOSA 3CTYA 3ALLA 3ZDNA 1JRXA 2C3DA 2YG3A 3CGEA 3ICRA 4FK1A 3DJGX 4E0VA 4TLZA 3NYFA 3CPHG 2YR4A 2WDRA 3BNMA 3M0OA 1O95A 4YXDA 2GMJA 4AP3A 3C4AA 2BYBA 1K0LA 3Q9TA 2XFUA 4KX6A 4ZCCA 1CF3A 2EQ9A 2RGHA 3AEDA 4C3XA 2B7SA 3K30A 1NEKA 3GWFA 2GRTA 5U1OA 4A65A 3QFAA 1FL2A 3REDA 2FJAA 2C65A 1SEZA 4YTPA 3DK8A 1D4DA 4G6GA 3VQRA 3E1TA 2PHHA 3CNPA 3RP8A 4OPIA 4CRTA 3URHA 2Y6RA 3NN0X 3V76A 5KMQA 2TPRA 2B76A 2RGJA 3SFEA 1E1NA 1ZKQA 3CNSA 2XVJA 3RHAA 3LJPA 2XLUA 1CC4A 3AD7B 1PBDA 2GMHA 1Y56B 2YLTA 3RNMA 1ZK7A 2EQ7A 3VRAA 1GETA 2VZ2A 3DGHA 2WBAA 3FPZA 1NPXA 4OPUA 4B66A 1YQZA 1ZMCA 1MXTA 3PS9A 4M52A 4BK2A 4WX1A 1E1MA 2ACZA 5EOWA 4EMWA 4OPDA 4I59A 1LTXR 2GV8A 4H4RA 3T37A 4U8LA 3UOZA 4LU6A 2WOVA 1QO8A 1V59A 1D7LA 2AAQA 4JNAA 3SZFA 4H2RA 3SGLA 3DJJA 2C66A 2AQJA 4U8IA 3H4KA 4YSXA 3NGCX 4GUVA 5IQ1A 2YR5A 3SQPA 1LV0A 1JNRA 3AE2A 3D1CA 3QSEA 1PJ5A 1PBFA 2DKIA 4B69A 4NEWA 4OPCA 4H4UA 2HQMA 3T2KA 3K7MX 1NHRA 1DJQA 1IUUA 2BS3A 3KD9A 3LB8A 4PAAA 4FX9A 4U8MA 5BUKA 1BWCA 1H84A 4RG3A 4TM1A 2BS2A 2C73A 1H6VA 1E1KA 4C74A 2YG5A 4TM3A 3NHOX 1PBBA 4U8NA 4YSYA 2Q0KA 1EL5A 3G5QA 3AD8B 2XVFA 3QVRA 3V3OA 1D4CA 2OAMA 2VRMA 4FK1C 4USQA 4YKFA 1P2HA 2JAEA 2YVFA 4U8KA 1H83A 4XWRA 3UKAA 1F6MA 4B63A 3SXIA 5KOXA 2Z5YA 3KU9A 2YVGA 4EQRA 2ZZBA 5HY5A 2V60A 3AE5A 2IIDA 4GDEA 4BV6A 3I6DA 3GRTA 3F8RA 4K5SA 5GSNA 2DKHA 4H4PA 4Z43A 2OLOA 2OA1A 5JCIA 3GDNA 2XLTA 2WDVA 3ALMA 5TR3A 3QFBA 2ZZ0A 2I0ZA 3P9UA 1GRGA 3UP4A 3ADAB 3NYCA 4CBQA 2XLPA 4Y4NA 1TDKA 4II2A 1JOAA 2W0HA 2YM1A 1D5TA 4Y4LA 2R0PA 2XYOA 4JDRA 1JNZA 1L0VA 4ECHA 4TM4A 2BK5A 1GTEA 2C76A 1GALA 3KVEA 4LIIA 4U8OA 3DGZA 4D04A 3NTDA 1NAAA 1ELIA 4YTNA 4Z2TA 4XWZA 1PJ7A 1NHSA 4A6NB 1PJ6A 4I58A 3KPFA 5KVIA 1S2QA 4A79A 1JRZA 2JBVA 4EMIA 5C2TA 1S3EA 3C96A 3KPKA 1ZY8A 5KXJA 1N1PA 2B9WA 3LOVA 4IVOB 1FEAA 1PN0A 5JCNA 1QJDA 1OJ9A 4GAPA 1Q1WA 4FDCB 4Z2UA 5FS8A 5HHFA 1ZX9A 3NH3X 1RP0A 3S61A 5BULA 4GR1A 2YG7A 1GRFA 2WETA 3AE7A 3B6DA 2RGOA 1QLBA 3KLJA 3D8XA 4X4JA 1B8SA 3NTAA 1CC6A 2X8CA 3UOYA 2R4JA 1IJHA 3AE3A 2R9ZA 3CPIG 4O5UA 1H7WA 3G5SA 1VDCA 3OC4A 2WPFA 3V3NA 1M6IA 1MO9A 1CJCA 1M64A 1O94A 2BXRA 2GR2A 2X99A 2WESA 1N4WA 3L1RA 5JCKA 1FCDA 3EF6A 2XLSA 3FG2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRN A;  1PDH A;  4NZH A;  1P2E A;  4ICY A;  2YLW A;  3EPT A;  1LQU A;  2J3N A;  2WEU A;  1LPF A;  5FS6 A;  2C64 A;  1PS9 A;  1LJ1 A;  3GYJ A;  3M12 A;  1B4V A;  4YT0 A;  2R4E A;  2X8H A;  2YWL A;  1BZL A;  3QSS A;  3SM8 A;  1Y56 A;  2ARD A;  4PAB A;  4CY8 A;  2V3A A;  3NK1 X;  3NN6 X;  1GES A;  3LZW A;  3UTE A;  4JN9 A;  4ZN0 A;  2Q6U A;  3H8I A;  2WS3 A;  3ISH A;  2O9Z A;  3M13 A;  4GF7 A;  3QVP A;  4XXG A;  4Z26 A;  1TDF A;  1DOD A;  1IUT A;  1IUS A;  1ZP0 A;  2WPC A;  3C4N A;  2XLR A;  3DK9 A;  4UDP A;  1NDA A;  2A89 A;  4YTM A;  2AR8 A;  3DME A;  2YR6 A;  4WCT A;  2XDO A;  4A7A A;  3G5R A;  1GT8 A;  1TDN A;  2YQU A;  1K0J A;  1IUX A;  1S2Y A;  4A5L A;  2UZZ A;  2XCG A;  1DNC A;  2XVH A;  2VVL G;  2X8G A;  1B5Q A;  3AEE A;  1IUW A;  3FBS A;  1N4V A;  4CY6 A;  2WP6 A;  3AYJ A;  4DSH A;  4J33 A;  2YLX A;  1E7P A;  3UKL A;  2VQ7 A;  4AOX A;  3GD4 A;  2B9Y A;  4K2X A;  1VG9 A;  3AEF A;  3EAO A;  3ZYX A;  5J60 A;  4K5R A;  1ZDL A;  2GR0 A;  4IV9 A;  2YM2 A;  3P4S A;  3IWA A;  2WU2 A;  4EQS A;  3NLC A;  1FOH A;  3P4Q A;  1TYT A;  5KOW A;  4B68 A;  3GDP A;  1CJ2 A;  4NTE A;  2Q0L A;  4YWO A;  3PO7 A;  3R9U A;  4U8J A;  3UP5 A;  1NG3 A;  4OPT A;  5LV9 A;  3QJ4 A;  3NIX A;  4BUR A;  1L9D A;  3AEG A;  4K8D A;  1NG4 A;  4TM0 A;  2CUL A;  3FMW A;  4BJZ A;  4LA1 A;  1X31 B;  1BGN A;  1DXL A;  2EQ8 A;  1VRQ B;  4JNQ A;  4RSL A;  5EB5 A;  3OZ2 A;  3DK4 A;  2XFQ A;  2TMD A;  2JB1 A;  1GRB A;  3AB1 A;  3AE8 A;  2JB2 A;  4N9X A;  3P4R A;  3JSK A;  4UDQ A;  2BAC A;  3I3L A;  3LAD A;  5HYM A;  4BJY A;  2FJD A;  5KVH A;  2XFN A;  2B9X A;  2CDU A;  3CNJ A;  1EBD A;  1K4Q A;  2QAE A;  3GYI A;  4EM3 A;  1D4E A;  5J7X A;  3ICS A;  2V6O A;  1XAN A;  1KSU A;  2BCP A;  3ITJ A;  4H4V A;  3RP6 A;  4CNJ A;  1KDG A;  3NKS A;  2XFP A;  4A6N A;  1PXB A;  2H89 A;  2NPX A;  2QCU A;  4USR A;  1FEB A;  1EL8 A;  1H81 A;  1H7X A;  4J2W A;  2VRL A;  2WP9 A;  1Q1R A;  2A87 A;  4H50 A;  4U2S A;  4DSG A;  4YKG A;  2WPE A;  4DNA A;  3UTG A;  3BHF A;  2IVE A;  2C72 A;  4H4S A;  2YG6 A;  1E1L A;  4H2P A;  1B37 A;  4H4Z A;  3KKJ A;  4EQX A;  3IHM A;  2F5Z A;  3PVC A;  3H8L A;  3LXD A;  5IPY A;  4CCR A;  5BRT A;  3UTF A;  5JCM A;  1CJ3 A;  1DOC A;  4U8P A;  3GSI A;  2FBW A;  3UKK A;  4B65 A;  1DOB A;  2Q7V A;  2R45 A;  4J57 A;  2BC1 A;  3KA7 A;  4TLX A;  1CJ4 A;  2XFO A;  4UDR A;  5GRT A;  2BXS A;  5M0Z A;  1LVL A;  4GRT A;  4AT0 A;  3IF9 A;  3DH9 A;  1E39 A;  3K7Q X;  1JEH A;  1XPQ A;  1F8W A;  2FJE A;  1H82 A;  3IC9 A;  2VVM A;  1Y0P A;  1GRA A;  1CBO A;  2WHD A;  4H4W A;  1REO A;  4J56 A;  1Q9I A;  2WDQ A;  3AEC A;  3ATQ A;  1KNR A;  1JU2 A;  3CPJ G;  1DJN A;  4NTC A;  1PBC A;  4AT2 A;  3S5W A;  1ZOV A;  2WOW A;  4EIP A;  4EMJ A;  2Z5X A;  1GND A;  3L8K A;  3UKH A;  4GCM A;  4UP3 A;  4K22 A;  4K7Z A;  3RP7 A;  2C7G A;  5FS9 A;  1FEC A;  1GOS A;  2E1M A;  3AE6 A;  1HYU A;  3AE1 A;  1GRT A;  1ONF A;  5U63 A;  4Z2R A;  4NEV A;  4CNK A;  4B67 A;  3F8P A;  2BAB A;  2YLZ A;  1TRB A;  4EQW A;  3K7T A;  3P4P A;  4B64 A;  2GH5 A;  1S3B A;  1W4X A;  2JK6 A;  2VOU A;  1ZOY A;  4H4Y A;  4IA5 A;  3AD9 B;  1CC2 A;  5ER0 A;  1EL9 A;  3CGD A;  1YQ4 A;  1Z6L A;  4ZCD A;  3NNE A;  4RG4 A;  4AP1 A;  3FIM B;  1PXA A;  1OJD A;  3GRS A;  4D03 A;  4GDP A;  2E4G A;  4H2N A;  2JB3 A;  3DJE A;  3ALJ A;  1NEN A;  3EAN A;  2QA1 A;  4CCQ A;  3AXB A;  1K0I A;  1IUV A;  4REK A;  1L9E A;  5EBK A;  1H86 A;  2V5Z A;  4OPG A;  3SFD A;  2FJB A;  3AEB A;  4X9N A;  2BCG G;  1L9C A;  5KWF A;  4C5O A;  4MJW A;  3UKQ A;  2C70 A;  3F8D A;  1TYP A;  2C67 A;  3VRD B;  1BKW A;  5HXI A;  4HB9 A;  2ZZC A;  1GRH A;  1D7Y A;  1PXC A;  3CND A;  1N4U A;  1RSG A;  3WE0 A;  1F8S A;  3BI5 A;  1PBE A;  3ICT A;  2NVK X;  2YLS A;  3HZL A;  1GEU A;  4IVM B;  2V61 A;  3UKF A;  4ADW A;  4EIQ A;  4C3Y A;  2BK4 A;  1F8R A;  4H4X A;  4Z44 A;  2VQB A;  1AOG A;  5EB4 A;  1EL7 A;  1KNP A;  3CGB A;  3UOV A;  4KPR A;  2C75 A;  2GEW A;  1OJC A;  1RYI A;  5CKU A;  5FS7 A;  4B1B A;  3Q6J A;  1YKJ A;  2R0G A;  3AE4 A;  3UCL A;  2YLR A;  1TDO A;  3NK2 X;  4P9S A;  1LQT A;  4X9M A;  1GPE A;  3GMC A;  1OJA A;  1XDI A;  3NYE A;  1GSN A;  4Z24 A;  1GXF A;  2OAL A;  1KFY A;  1VQW A;  2CFY A;  2APG A;  4YSZ A;  2Y6Q A;  3AYL A;  1E6E A;  2OLN A;  3BNU A;  4U2L A;  5KRQ A;  4H4Q A;  4A9W A;  4DGK A;  4BK1 A;  2B7R A;  4OCG A;  1KSS A;  1OJT A;  2EQ6 A;  3VR8 A;  1KF6 A;  3DJD A;  1CHU A;  3CNT A;  3CIR A;  2IVD A;  3IHG A;  3VRB A;  3GWD A;  3BI4 A;  4Y4M A;  4A99 A;  2GAG B;  2BA9 A;  3BI2 A;  5JCL A;  5FMH A;  2YG4 A;  1UKV G;  5M10 A;  1TDE A;  3AEA A;  3GD3 A;  4H7U A;  2JKC A;  5L46 A;  4C77 A;  4J31 A;  4H4T A;  4JY2 A;  2X3N A;  4OPL A;  2GVC A;  2GAH B;  3B3R A;  1GTH A;  3CGC A;  4H2Q A;  4U2T A;  1VG0 A;  2H88 A;  2XVI A;  3P1W A;  4J36 A;  2E5V A;  3NK0 X;  2GQW A;  2CVJ A;  2R46 A;  2WP5 A;  1XHC A;  2YVJ A;  2R0C A;  4JY3 A;  4BK3 A;  2YAU A;  1YQ3 A;  2BS4 A;  3LZX A;  4IA6 A;  3UKP A;  1CL0 A;  3VR9 A;  5BVA A;  1BGJ A;  4APN A;  2A8X A;  5CQF A;  1MOK A;  5DBJ A;  3UOX A;  3BHK A;  2BC0 A;  1GER A;  3NT6 A;  3QSM A;  1F3P A;  2GF3 A;  2GB0 A;  1NHP A;  4NTD A;  1JRY A;  5U25 A;  2GQF A;  2ZBW A;  1O5W A;  4O5Q A;  2VVL A;  2WU5 A;  2PYX A;  2X50 A;  1COY A;  2BK3 A;  4JQ9 A;  2XVE A;  4Z25 A;  3AYI A;  5C3J A;  5IQ4 A;  4YSH A;  4HA6 A;  4OVI A;  2WQY A;  3O0H A;  1BF3 A;  4J34 A;  3ABV A;  1GV4 A;  3ATR A;  3II4 A;  2RAB A;  1PHH A;  3UTH A;  3DA1 A;  1YY5 A;  2GR3 A;  1DOE A;  3NG7 X;  3AE9 A;  2GR1 A;  2QA2 A;  1GRE A;  1ZMD A;  2V3B A;  3AWI A;  4EM4 A;  2C3C A;  3CN8 A;  1NHQ A;  2WOI A;  3COX A;  3GMB A;  4AOS A;  3CTY A;  3ALL A;  3ZDN A;  1JRX A;  2C3D A;  2YG3 A;  3CGE A;  3ICR A;  4FK1 A;  3DJG X;  4E0V A;  4TLZ A;  3NYF A;  3CPH G;  2YR4 A;  2WDR A;  3BNM A;  3M0O A;  1O95 A;  4YXD A;  2GMJ A;  4AP3 A;  3C4A A;  2BYB A;  1K0L A;  3Q9T A;  2XFU A;  4KX6 A;  4ZCC A;  1CF3 A;  2EQ9 A;  2RGH A;  3AED A;  4C3X A;  2B7S A;  3K30 A;  1NEK A;  3GWF A;  2GRT A;  5U1O A;  4A65 A;  3QFA A;  1FL2 A;  3RED A;  2FJA A;  2C65 A;  1SEZ A;  4YTP A;  3DK8 A;  1D4D A;  3VQR A;  3E1T A;  2PHH A;  3CNP A;  3RP8 A;  4OPI A;  4CRT A;  3URH A;  2Y6R A;  3NN0 X;  3V76 A;  2TPR A;  2B76 A;  2RGJ A;  3SFE A;  1E1N A;  1ZKQ A;  3CNS A;  2XVJ A;  3RHA A;  3LJP A;  2XLU A;  1CC4 A;  3AD7 B;  1PBD A;  2GMH A;  1Y56 B;  2YLT A;  3RNM A;  1ZK7 A;  2EQ7 A;  3VRA A;  1GET A;  2VZ2 A;  3DGH A;  2WBA A;  3FPZ A;  1NPX A;  4OPU A;  4B66 A;  1YQZ A;  1ZMC A;  1MXT A;  3PS9 A;  4M52 A;  4BK2 A;  4WX1 A;  1E1M A;  2ACZ A;  5EOW A;  4EMW A;  4OPD A;  4I59 A;  1LTX R;  2GV8 A;  4H4R A;  3T37 A;  4U8L A;  3UOZ A;  4LU6 A;  2WOV A;  1QO8 A;  1V59 A;  1D7L A;  2AAQ A;  4JNA A;  4H2R A;  3SGL A;  3DJJ A;  2C66 A;  2AQJ A;  4U8I A;  3H4K A;  4YSX A;  3NGC X;  4GUV A;  5IQ1 A;  2YR5 A;  3SQP A;  1LV0 A;  1JNR A;  3AE2 A;  3D1C A;  3QSE A;  1PJ5 A;  1PBF A;  2DKI A;  4B69 A;  4NEW A;  4OPC A;  4H4U A;  2HQM A;  3K7M X;  1NHR A;  1DJQ A;  1IUU A;  2BS3 A;  3KD9 A;  3LB8 A;  4PAA A;  4FX9 A;  4U8M A;  5BUK A;  1BWC A;  1H84 A;  4RG3 A;  4TM1 A;  2BS2 A;  2C73 A;  1H6V A;  1E1K A;  4C74 A;  2YG5 A;  4TM3 A;  3NHO X;  1PBB A;  4U8N A;  4YSY A;  2Q0K A;  1EL5 A;  3G5Q A;  3AD8 B;  2XVF A;  3QVR A;  3V3O A;  1D4C A;  2OAM A;  2VRM A;  4FK1 C;  4USQ A;  4YKF A;  1P2H A;  2JAE A;  2YVF A;  4U8K A;  1H83 A;  4XWR A;  3UKA A;  1F6M A;  4B63 A;  5KOX A;  2Z5Y A;  3KU9 A;  2YVG A;  4EQR A;  2ZZB A;  5HY5 A;  2V60 A;  3AE5 A;  2IID A;  4GDE A;  4BV6 A;  3I6D A;  3GRT A;  3F8R A;  4K5S A;  5GSN A;  2DKH A;  4H4P A;  4Z43 A;  2OLO A;  2OA1 A;  5JCI A;  3GDN A;  2XLT A;  2WDV A;  3ALM A;  5TR3 A;  3QFB A;  2ZZ0 A;  2I0Z A;  3P9U A;  1GRG A;  3UP4 A;  3ADA B;  3NYC A;  4CBQ A;  2XLP A;  4Y4N A;  1TDK A;  1JOA A;  2W0H A;  2YM1 A;  1D5T A;  4Y4L A;  2R0P A;  2XYO A;  4JDR A;  1JNZ A;  1L0V A;  4ECH A;  4TM4 A;  2BK5 A;  1GTE A;  2C76 A;  1GAL A;  3KVE A;  4LII A;  4U8O A;  3DGZ A;  4D04 A;  3NTD A;  1NAA A;  1ELI A;  4YTN A;  4Z2T A;  4XWZ A;  1PJ7 A;  1NHS A;  4A6N B;  1PJ6 A;  4I58 A;  3KPF A;  5KVI A;  1S2Q A;  4A79 A;  1JRZ A;  2JBV A;  4EMI A;  5C2T A;  1S3E A;  3C96 A;  1ZY8 A;  5KXJ A;  1N1P A;  2B9W A;  3LOV A;  4IVO B;  1FEA A;  1PN0 A;  5JCN A;  1QJD A;  1OJ9 A;  1Q1W A;  4FDC B;  4Z2U A;  5FS8 A;  5HHF A;  1ZX9 A;  3NH3 X;  1RP0 A;  3S61 A;  5BUL A;  4GR1 A;  2YG7 A;  1GRF A;  2WET A;  3AE7 A;  3B6D A;  2RGO A;  1QLB A;  3KLJ A;  3D8X A;  4X4J A;  1B8S A;  3NTA A;  1CC6 A;  2X8C A;  3UOY A;  2R4J A;  1IJH A;  3AE3 A;  2R9Z A;  3CPI G;  4O5U A;  1H7W A;  3G5S A;  1VDC A;  3OC4 A;  2WPF A;  3V3N A;  1M6I A;  1MO9 A;  1CJC A;  1M64 A;  1O94 A;  2BXR A;  2GR2 A;  2X99 A;  2WES A;  1N4W A;  3L1R A;  5JCK A;  1FCD A;  3EF6 A;  2XLS A;  3FG2 P; 
#chains in the Genus database with same CATH topology
 3NRN A;  1PDH A;  4NZH A;  1P2E A;  4ICY A;  2YLW A;  3EPT A;  3SYI A;  1LQU A;  2J3N A;  2WEU A;  1LPF A;  4G9K A;  5FS6 A;  2C64 A;  1PS9 A;  1LJ1 A;  3GYJ A;  3M12 A;  1B4V A;  4YT0 A;  2R4E A;  2X8H A;  2YWL A;  1BZL A;  3QSS A;  3SM8 A;  1Y56 A;  2ARD A;  4PAB A;  4CY8 A;  2V3A A;  3NK1 X;  3NN6 X;  1GES A;  3LZW A;  3UTE A;  4JN9 A;  4ZN0 A;  2Q6U A;  3H8I A;  2WS3 A;  3ISH A;  2O9Z A;  3M13 A;  4GF7 A;  3QVP A;  4XXG A;  4Z26 A;  1TDF A;  3HYX A;  1DOD A;  1IUT A;  1IUS A;  1ZP0 A;  2WPC A;  3C4N A;  2XLR A;  3DK9 A;  4UDP A;  1NDA A;  2A89 A;  4YTM A;  2AR8 A;  3DME A;  2YR6 A;  4WCT A;  4GAV A;  2XDO A;  4A7A A;  3G5R A;  1GT8 A;  1TDN A;  2YQU A;  1K0J A;  1IUX A;  1S2Y A;  2C4C A;  2UZZ A;  4A5L A;  2XCG A;  1DNC A;  2XVH A;  2VVL G;  2X8G A;  1B5Q A;  3AEE A;  1IUW A;  3FBS A;  1N4V A;  4CY6 A;  2WP6 A;  3AYJ A;  4DSH A;  4J33 A;  2YLX A;  1E7P A;  3UKL A;  2VQ7 A;  4AOX A;  3GD4 A;  2B9Y A;  4K2X A;  1VG9 A;  3AEF A;  5KMP A;  3EAO A;  3ZYX A;  3SZC A;  5J60 A;  4K5R A;  1ZDL A;  2GR0 A;  4IV9 A;  2YM2 A;  3P4S A;  3IWA A;  2WU2 A;  4EQS A;  3NLC A;  1FOH A;  3P4Q A;  1TYT A;  2BRY A;  3SX6 A;  5KOW A;  4B68 A;  3GDP A;  4II3 A;  1CJ2 A;  4NTE A;  2Q0L A;  4YWO A;  3PO7 A;  3R9U A;  4U8J A;  3UP5 A;  1NG3 A;  4OPT A;  5LV9 A;  3QJ4 A;  3NIX A;  4BUR A;  5KMR A;  3T14 A;  1L9D A;  3AEG A;  4K8D A;  1NG4 A;  4TM0 A;  2CUL A;  3FMW A;  4BJZ A;  4LA1 A;  1X31 B;  1BGN A;  1DXL A;  2EQ8 A;  1VRQ B;  4JNQ A;  4RSL A;  5EB5 A;  3OZ2 A;  3DK4 A;  2XFQ A;  2TMD A;  2JB1 A;  1GRB A;  3AB1 A;  3AE8 A;  3T2Y A;  2JB2 A;  4N9X A;  3P4R A;  3JSK A;  4UDQ A;  2BAC A;  3I3L A;  3LAD A;  5HYM A;  4BJY A;  2FJD A;  5KVH A;  2XFN A;  2B9X A;  2CDU A;  3CNJ A;  1EBD A;  1K4Q A;  2QAE A;  3GYI A;  4EM3 A;  1D4E A;  5J7X A;  3ICS A;  2V6O A;  1XAN A;  1KSU A;  2BCP A;  3ITJ A;  4H4V A;  3RP6 A;  4CNJ A;  1KDG A;  3NKS A;  2XFP A;  4A6N A;  1PXB A;  2H89 A;  2NPX A;  2QCU A;  4USR A;  1FEB A;  1EL8 A;  1H81 A;  1H7X A;  4J2W A;  2VRL A;  2WP9 A;  1Q1R A;  2A87 A;  4H50 A;  4U2S A;  4DSG A;  4YKG A;  2WPE A;  4DNA A;  3UTG A;  3BHF A;  2IVE A;  2C72 A;  4H4S A;  2YG6 A;  1E1L A;  4H2P A;  1B37 A;  4H4Z A;  3KKJ A;  4EQX A;  3IHM A;  2F5Z A;  3PVC A;  3H8L A;  3LXD A;  5IPY A;  4CCR A;  5BRT A;  3UTF A;  5JCM A;  1CJ3 A;  1DOC A;  4U8P A;  3GSI A;  2FBW A;  3UKK A;  4B65 A;  1DOB A;  2Q7V A;  2R45 A;  4J57 A;  2BC1 A;  3KA7 A;  4TLX A;  1CJ4 A;  2XFO A;  4UDR A;  5GRT A;  2BXS A;  5M0Z A;  1LVL A;  4GRT A;  4AT0 A;  3IF9 A;  3DH9 A;  1E39 A;  3K7Q X;  1JEH A;  4G74 A;  1XPQ A;  1F8W A;  2FJE A;  1H82 A;  3IC9 A;  2VVM A;  1Y0P A;  1GRA A;  1CBO A;  2WHD A;  4H4W A;  1REO A;  4J56 A;  1Q9I A;  2WDQ A;  3AEC A;  3ATQ A;  1KNR A;  1JU2 A;  3CPJ G;  1DJN A;  4NTC A;  1PBC A;  4AT2 A;  3S5W A;  1ZOV A;  2WOW A;  4EIP A;  4EMJ A;  2Z5X A;  1GND A;  3L8K A;  3UKH A;  4GCM A;  4UP3 A;  4K22 A;  4K7Z A;  3RP7 A;  2C7G A;  5FS9 A;  1FEC A;  1GOS A;  2E1M A;  3AE6 A;  1HYU A;  3AE1 A;  1GRT A;  5KMS A;  1ONF A;  4NWZ A;  5U63 A;  4Z2R A;  4NEV A;  4CNK A;  4B67 A;  3F8P A;  2BAB A;  2YLZ A;  1TRB A;  4EQW A;  3K7T A;  3P4P A;  4B64 A;  2GH5 A;  1S3B A;  1W4X A;  2JK6 A;  2VOU A;  1ZOY A;  4H4Y A;  4IA5 A;  3AD9 B;  1CC2 A;  5ER0 A;  1EL9 A;  3CGD A;  1YQ4 A;  1Z6L A;  4ZCD A;  3NNE A;  4RG4 A;  4AP1 A;  3FIM B;  1PXA A;  1OJD A;  3GRS A;  4D03 A;  4GDP A;  2E4G A;  4H2N A;  2JB3 A;  3DJE A;  3ALJ A;  1NEN A;  3EAN A;  2QA1 A;  4CCQ A;  3AXB A;  1K0I A;  1IUV A;  4REK A;  1L9E A;  5EBK A;  1H86 A;  2V5Z A;  4OPG A;  3SFD A;  2FJB A;  3AEB A;  4X9N A;  2BCG G;  1L9C A;  5KWF A;  4C5O A;  4MJW A;  3UKQ A;  2C70 A;  3F8D A;  1TYP A;  2C67 A;  3VRD B;  3T31 A;  1BKW A;  5HXI A;  3SZ0 A;  4HB9 A;  2ZZC A;  1GRH A;  1D7Y A;  1PXC A;  3CND A;  1N4U A;  1RSG A;  3WE0 A;  1F8S A;  3T2Z A;  3BI5 A;  1PBE A;  3ICT A;  2NVK X;  2YLS A;  3HZL A;  1GEU A;  4IVM B;  2V61 A;  3UKF A;  4ADW A;  4EIQ A;  4C3Y A;  2BK4 A;  1F8R A;  4H4X A;  4Z44 A;  3SZW A;  2VQB A;  1AOG A;  5EB4 A;  1EL7 A;  1KNP A;  3CGB A;  3UOV A;  4KPR A;  2C75 A;  2GEW A;  1OJC A;  1RYI A;  5CKU A;  5FS7 A;  4B1B A;  3Q6J A;  1YKJ A;  2R0G A;  3AE4 A;  3HYV A;  3UCL A;  2YLR A;  1TDO A;  3NK2 X;  4P9S A;  1LQT A;  4X9M A;  1GPE A;  3GMC A;  1OJA A;  1XDI A;  3NYE A;  1GSN A;  4Z24 A;  1GXF A;  2OAL A;  1KFY A;  1VQW A;  2CFY A;  2APG A;  4YSZ A;  2Y6Q A;  3AYL A;  1E6E A;  2OLN A;  3BNU A;  4U2L A;  5KRQ A;  4H4Q A;  4A9W A;  4DGK A;  4BK1 A;  2B7R A;  4OCG A;  1KSS A;  1OJT A;  2EQ6 A;  3SY4 A;  4G73 A;  3VR8 A;  1KF6 A;  3DJD A;  1CHU A;  3CNT A;  3CIR A;  2IVD A;  3IHG A;  3VRB A;  3GWD A;  3BI4 A;  4Y4M A;  3T0K A;  2GAG B;  4A99 A;  2BA9 A;  3BI2 A;  5JCL A;  5FMH A;  2YG4 A;  1UKV G;  5M10 A;  1TDE A;  3AEA A;  3GD3 A;  4H7U A;  2JKC A;  5L46 A;  4C77 A;  4J31 A;  4H4T A;  4JY2 A;  2X3N A;  4OPL A;  2GVC A;  2GAH B;  3B3R A;  1GTH A;  3CGC A;  4H2Q A;  4U2T A;  1VG0 A;  2H88 A;  2XVI A;  3P1W A;  4J36 A;  2E5V A;  3NK0 X;  2GQW A;  2CVJ A;  2R46 A;  2WP5 A;  1XHC A;  2YVJ A;  2R0C A;  4JY3 A;  4BK3 A;  2YAU A;  1YQ3 A;  2BS4 A;  3LZX A;  4IA6 A;  3UKP A;  1CL0 A;  3VR9 A;  5BVA A;  1BGJ A;  4APN A;  2A8X A;  3HYW A;  5CQF A;  3GYX A;  1MOK A;  5DBJ A;  3UOX A;  3BHK A;  2BC0 A;  1GER A;  3NT6 A;  3QSM A;  1F3P A;  2GF3 A;  2GB0 A;  1NHP A;  2BRA A;  4NTD A;  5KNL A;  1JRY A;  5U25 A;  2GQF A;  2ZBW A;  3CMM A;  1O5W A;  4O5Q A;  2VVL A;  2WU5 A;  2PYX A;  2X50 A;  1COY A;  2BK3 A;  4JQ9 A;  4NNJ A;  2XVE A;  4Z25 A;  3AYI A;  5C3J A;  5IQ4 A;  4YSH A;  4HA6 A;  4OVI A;  2WQY A;  3O0H A;  1BF3 A;  4G6H A;  4J34 A;  3ABV A;  1GV4 A;  3ATR A;  3II4 A;  2RAB A;  1PHH A;  3UTH A;  3DA1 A;  1YY5 A;  2GR3 A;  1DOE A;  3NG7 X;  3AE9 A;  2GR1 A;  2QA2 A;  1GRE A;  1ZMD A;  2V3B A;  3AWI A;  4EM4 A;  2C3C A;  3CN8 A;  1NHQ A;  2WOI A;  3COX A;  3GMB A;  4AOS A;  3CTY A;  3ALL A;  3ZDN A;  1JRX A;  2C3D A;  2YG3 A;  3CGE A;  3ICR A;  4FK1 A;  3DJG X;  4E0V A;  4TLZ A;  3NYF A;  3CPH G;  2YR4 A;  2WDR A;  3BNM A;  3M0O A;  1O95 A;  4YXD A;  2GMJ A;  4AP3 A;  3C4A A;  2BYB A;  1K0L A;  3Q9T A;  2XFU A;  4KX6 A;  4ZCC A;  1CF3 A;  2EQ9 A;  2RGH A;  3AED A;  4C3X A;  2B7S A;  3K30 A;  1NEK A;  3GWF A;  2GRT A;  5U1O A;  4A65 A;  3QFA A;  1FL2 A;  3RED A;  2FJA A;  2C65 A;  1SEZ A;  4YTP A;  3DK8 A;  1D4D A;  4G6G A;  3VQR A;  3E1T A;  2PHH A;  3CNP A;  3RP8 A;  4OPI A;  4CRT A;  3URH A;  2Y6R A;  3NN0 X;  3V76 A;  5KMQ A;  2TPR A;  2B76 A;  2RGJ A;  3SFE A;  1E1N A;  1ZKQ A;  3CNS A;  2XVJ A;  3RHA A;  3LJP A;  2XLU A;  1CC4 A;  3AD7 B;  1PBD A;  2GMH A;  1Y56 B;  2YLT A;  3RNM A;  1ZK7 A;  2EQ7 A;  3VRA A;  1GET A;  2VZ2 A;  3DGH A;  2WBA A;  3FPZ A;  1NPX A;  4OPU A;  4B66 A;  1YQZ A;  1ZMC A;  1MXT A;  3PS9 A;  4M52 A;  4BK2 A;  4WX1 A;  1E1M A;  2ACZ A;  5EOW A;  4EMW A;  4OPD A;  4I59 A;  1LTX R;  2GV8 A;  4H4R A;  3T37 A;  4U8L A;  3UOZ A;  4LU6 A;  2WOV A;  1QO8 A;  1V59 A;  1D7L A;  2AAQ A;  4JNA A;  3SZF A;  4H2R A;  3SGL A;  3DJJ A;  2C66 A;  2AQJ A;  4U8I A;  3H4K A;  4YSX A;  3NGC X;  4GUV A;  5IQ1 A;  2YR5 A;  3SQP A;  1LV0 A;  1JNR A;  3AE2 A;  3D1C A;  3QSE A;  1PJ5 A;  1PBF A;  2DKI A;  4B69 A;  4NEW A;  4OPC A;  4H4U A;  2HQM A;  3T2K A;  3K7M X;  1NHR A;  1DJQ A;  1IUU A;  2BS3 A;  3KD9 A;  3LB8 A;  4PAA A;  4FX9 A;  4U8M A;  5BUK A;  1BWC A;  1H84 A;  4RG3 A;  4TM1 A;  2BS2 A;  2C73 A;  1H6V A;  1E1K A;  4C74 A;  2YG5 A;  4TM3 A;  3NHO X;  1PBB A;  4U8N A;  4YSY A;  2Q0K A;  1EL5 A;  3G5Q A;  3AD8 B;  2XVF A;  3QVR A;  3V3O A;  1D4C A;  2OAM A;  2VRM A;  4FK1 C;  4USQ A;  4YKF A;  1P2H A;  2JAE A;  2YVF A;  4U8K A;  1H83 A;  4XWR A;  3UKA A;  1F6M A;  4B63 A;  3SXI A;  5KOX A;  2Z5Y A;  3KU9 A;  2YVG A;  4EQR A;  2ZZB A;  5HY5 A;  2V60 A;  3AE5 A;  2IID A;  4GDE A;  4BV6 A;  3I6D A;  3GRT A;  3F8R A;  4K5S A;  5GSN A;  2DKH A;  4H4P A;  4Z43 A;  2OLO A;  2OA1 A;  5JCI A;  3GDN A;  2XLT A;  2WDV A;  3ALM A;  5TR3 A;  3QFB A;  2ZZ0 A;  2I0Z A;  3P9U A;  1GRG A;  3UP4 A;  3ADA B;  3NYC A;  4CBQ A;  2XLP A;  4Y4N A;  1TDK A;  4II2 A;  1JOA A;  2W0H A;  2YM1 A;  1D5T A;  4Y4L A;  2R0P A;  2XYO A;  4JDR A;  1JNZ A;  1L0V A;  4ECH A;  4TM4 A;  2BK5 A;  1GTE A;  2C76 A;  1GAL A;  3KVE A;  4LII A;  4U8O A;  3DGZ A;  4D04 A;  3NTD A;  1NAA A;  1ELI A;  4YTN A;  4Z2T A;  4XWZ A;  1PJ7 A;  1NHS A;  4A6N B;  1PJ6 A;  4I58 A;  3KPF A;  5KVI A;  1S2Q A;  4A79 A;  1JRZ A;  2JBV A;  4EMI A;  5C2T A;  1S3E A;  3C96 A;  3KPK A;  1ZY8 A;  5KXJ A;  1N1P A;  2B9W A;  3LOV A;  4IVO B;  1FEA A;  1PN0 A;  5JCN A;  1QJD A;  1OJ9 A;  4GAP A;  1Q1W A;  4FDC B;  4Z2U A;  5FS8 A;  5HHF A;  1ZX9 A;  3NH3 X;  1RP0 A;  3S61 A;  5BUL A;  4GR1 A;  2YG7 A;  1GRF A;  2WET A;  3AE7 A;  3B6D A;  2RGO A;  1QLB A;  3KLJ A;  3D8X A;  4X4J A;  1B8S A;  3NTA A;  1CC6 A;  2X8C A;  3UOY A;  2R4J A;  1IJH A;  3AE3 A;  2R9Z A;  3CPI G;  4O5U A;  1H7W A;  3G5S A;  1VDC A;  3OC4 A;  2WPF A;  3V3N A;  1M6I A;  1MO9 A;  1CJC A;  1M64 A;  1O94 A;  2BXR A;  2GR2 A;  2X99 A;  2WES A;  1N4W A;  3L1R A;  5JCK A;  1FCD A;  3EF6 A;  2XLS A;  3FG2 P; 
#chains in the Genus database with same CATH homology
 3NRN A;  1PDH A;  4NZH A;  1P2E A;  4ICY A;  2YLW A;  3EPT A;  3SYI A;  1LQU A;  2J3N A;  2WEU A;  1LPF A;  4G9K A;  5FS6 A;  2C64 A;  1PS9 A;  1LJ1 A;  3GYJ A;  3M12 A;  1B4V A;  4YT0 A;  2R4E A;  2X8H A;  2YWL A;  1BZL A;  3QSS A;  3SM8 A;  1Y56 A;  2ARD A;  4PAB A;  4CY8 A;  2V3A A;  3NK1 X;  3NN6 X;  1GES A;  3LZW A;  3UTE A;  4JN9 A;  4ZN0 A;  2Q6U A;  3H8I A;  2WS3 A;  3ISH A;  2O9Z A;  3M13 A;  4GF7 A;  3QVP A;  4XXG A;  4Z26 A;  1TDF A;  3HYX A;  1DOD A;  1IUT A;  1IUS A;  1ZP0 A;  2WPC A;  3C4N A;  2XLR A;  3DK9 A;  4UDP A;  1NDA A;  2A89 A;  4YTM A;  2AR8 A;  3DME A;  2YR6 A;  4WCT A;  4GAV A;  2XDO A;  4A7A A;  3G5R A;  1GT8 A;  1TDN A;  2YQU A;  1K0J A;  1IUX A;  1S2Y A;  2C4C A;  2UZZ A;  4A5L A;  2XCG A;  1DNC A;  2XVH A;  2VVL G;  2X8G A;  1B5Q A;  3AEE A;  1IUW A;  3FBS A;  1N4V A;  4CY6 A;  2WP6 A;  3AYJ A;  4DSH A;  4J33 A;  2YLX A;  1E7P A;  3UKL A;  2VQ7 A;  4AOX A;  3GD4 A;  2B9Y A;  4K2X A;  1VG9 A;  3AEF A;  5KMP A;  3EAO A;  3ZYX A;  3SZC A;  5J60 A;  4K5R A;  1ZDL A;  2GR0 A;  4IV9 A;  2YM2 A;  3P4S A;  3IWA A;  2WU2 A;  4EQS A;  3NLC A;  1FOH A;  3P4Q A;  1TYT A;  2BRY A;  3SX6 A;  5KOW A;  4B68 A;  3GDP A;  4II3 A;  1CJ2 A;  4NTE A;  2Q0L A;  4YWO A;  3PO7 A;  3R9U A;  4U8J A;  3UP5 A;  1NG3 A;  4OPT A;  5LV9 A;  3QJ4 A;  3NIX A;  4BUR A;  5KMR A;  3T14 A;  1L9D A;  3AEG A;  4K8D A;  1NG4 A;  4TM0 A;  2CUL A;  3FMW A;  4BJZ A;  4LA1 A;  1X31 B;  1BGN A;  1DXL A;  2EQ8 A;  1VRQ B;  4JNQ A;  4RSL A;  5EB5 A;  3OZ2 A;  3DK4 A;  2XFQ A;  2TMD A;  2JB1 A;  1GRB A;  3AB1 A;  3AE8 A;  3T2Y A;  2JB2 A;  4N9X A;  3P4R A;  3JSK A;  4UDQ A;  2BAC A;  3I3L A;  3LAD A;  5HYM A;  4BJY A;  2FJD A;  5KVH A;  2XFN A;  2B9X A;  2CDU A;  3CNJ A;  1EBD A;  1K4Q A;  2QAE A;  3GYI A;  4EM3 A;  1D4E A;  5J7X A;  3ICS A;  2V6O A;  1XAN A;  1KSU A;  2BCP A;  3ITJ A;  4H4V A;  3RP6 A;  4CNJ A;  1KDG A;  3NKS A;  2XFP A;  4A6N A;  1PXB A;  2H89 A;  2NPX A;  2QCU A;  4USR A;  1FEB A;  1EL8 A;  1H81 A;  1H7X A;  4J2W A;  2VRL A;  2WP9 A;  1Q1R A;  2A87 A;  4H50 A;  4U2S A;  4DSG A;  4YKG A;  2WPE A;  4DNA A;  3UTG A;  3BHF A;  2IVE A;  2C72 A;  4H4S A;  2YG6 A;  1E1L A;  4H2P A;  1B37 A;  4H4Z A;  3KKJ A;  4EQX A;  3IHM A;  2F5Z A;  3PVC A;  3H8L A;  3LXD A;  5IPY A;  4CCR A;  5BRT A;  3UTF A;  5JCM A;  1CJ3 A;  1DOC A;  4U8P A;  3GSI A;  2FBW A;  3UKK A;  4B65 A;  1DOB A;  2Q7V A;  2R45 A;  4J57 A;  2BC1 A;  3KA7 A;  4TLX A;  1CJ4 A;  2XFO A;  4UDR A;  5GRT A;  2BXS A;  5M0Z A;  1LVL A;  4GRT A;  4AT0 A;  3IF9 A;  3DH9 A;  1E39 A;  3K7Q X;  1JEH A;  4G74 A;  1XPQ A;  1F8W A;  2FJE A;  1H82 A;  3IC9 A;  2VVM A;  1Y0P A;  1GRA A;  1CBO A;  2WHD A;  4H4W A;  1REO A;  4J56 A;  1Q9I A;  2WDQ A;  3AEC A;  3ATQ A;  1KNR A;  1JU2 A;  3CPJ G;  1DJN A;  4NTC A;  1PBC A;  4AT2 A;  3S5W A;  1ZOV A;  2WOW A;  4EIP A;  4EMJ A;  2Z5X A;  1GND A;  3L8K A;  3UKH A;  4GCM A;  4UP3 A;  4K22 A;  4K7Z A;  3RP7 A;  2C7G A;  5FS9 A;  1FEC A;  1GOS A;  2E1M A;  3AE6 A;  1HYU A;  3AE1 A;  1GRT A;  5KMS A;  1ONF A;  4NWZ A;  5U63 A;  4Z2R A;  4NEV A;  4CNK A;  4B67 A;  3F8P A;  2BAB A;  2YLZ A;  1TRB A;  4EQW A;  3K7T A;  3P4P A;  4B64 A;  2GH5 A;  1S3B A;  1W4X A;  2JK6 A;  2VOU A;  1ZOY A;  4H4Y A;  4IA5 A;  3AD9 B;  1CC2 A;  5ER0 A;  1EL9 A;  3CGD A;  1YQ4 A;  1Z6L A;  4ZCD A;  3NNE A;  4RG4 A;  4AP1 A;  3FIM B;  1PXA A;  1OJD A;  3GRS A;  4D03 A;  4GDP A;  2E4G A;  4H2N A;  2JB3 A;  3DJE A;  3ALJ A;  1NEN A;  3EAN A;  2QA1 A;  4CCQ A;  3AXB A;  1K0I A;  1IUV A;  4REK A;  1L9E A;  5EBK A;  1H86 A;  2V5Z A;  4OPG A;  3SFD A;  2FJB A;  3AEB A;  4X9N A;  2BCG G;  1L9C A;  5KWF A;  4C5O A;  4MJW A;  3UKQ A;  2C70 A;  3F8D A;  1TYP A;  2C67 A;  3VRD B;  3T31 A;  1BKW A;  5HXI A;  3SZ0 A;  4HB9 A;  2ZZC A;  1GRH A;  1D7Y A;  1PXC A;  3CND A;  1N4U A;  1RSG A;  3WE0 A;  1F8S A;  3T2Z A;  3BI5 A;  1PBE A;  3ICT A;  2NVK X;  2YLS A;  3HZL A;  1GEU A;  4IVM B;  2V61 A;  3UKF A;  4ADW A;  4EIQ A;  4C3Y A;  2BK4 A;  1F8R A;  4H4X A;  4Z44 A;  3SZW A;  2VQB A;  1AOG A;  5EB4 A;  1EL7 A;  1KNP A;  3CGB A;  3UOV A;  4KPR A;  2C75 A;  2GEW A;  1OJC A;  1RYI A;  5CKU A;  5FS7 A;  4B1B A;  3Q6J A;  1YKJ A;  2R0G A;  3AE4 A;  3HYV A;  3UCL A;  2YLR A;  1TDO A;  3NK2 X;  4P9S A;  1LQT A;  4X9M A;  1GPE A;  3GMC A;  1OJA A;  1XDI A;  3NYE A;  1GSN A;  4Z24 A;  1GXF A;  2OAL A;  1KFY A;  1VQW A;  2CFY A;  2APG A;  4YSZ A;  2Y6Q A;  3AYL A;  1E6E A;  2OLN A;  3BNU A;  4U2L A;  5KRQ A;  4H4Q A;  4A9W A;  4DGK A;  4BK1 A;  2B7R A;  4OCG A;  1KSS A;  1OJT A;  2EQ6 A;  3SY4 A;  4G73 A;  3VR8 A;  1KF6 A;  3DJD A;  1CHU A;  3CNT A;  3CIR A;  2IVD A;  3IHG A;  3VRB A;  3GWD A;  3BI4 A;  4Y4M A;  3T0K A;  2GAG B;  4A99 A;  2BA9 A;  3BI2 A;  5JCL A;  5FMH A;  2YG4 A;  1UKV G;  5M10 A;  1TDE A;  3AEA A;  3GD3 A;  4H7U A;  2JKC A;  5L46 A;  4C77 A;  4J31 A;  4H4T A;  4JY2 A;  2X3N A;  4OPL A;  2GVC A;  2GAH B;  3B3R A;  1GTH A;  3CGC A;  4H2Q A;  4U2T A;  1VG0 A;  2H88 A;  2XVI A;  3P1W A;  4J36 A;  2E5V A;  3NK0 X;  2GQW A;  2CVJ A;  2R46 A;  2WP5 A;  1XHC A;  2YVJ A;  2R0C A;  4JY3 A;  4BK3 A;  2YAU A;  1YQ3 A;  2BS4 A;  3LZX A;  4IA6 A;  3UKP A;  1CL0 A;  3VR9 A;  5BVA A;  1BGJ A;  4APN A;  2A8X A;  3HYW A;  5CQF A;  3GYX A;  1MOK A;  5DBJ A;  3UOX A;  3BHK A;  2BC0 A;  1GER A;  3NT6 A;  3QSM A;  1F3P A;  2GF3 A;  2GB0 A;  1NHP A;  2BRA A;  4NTD A;  5KNL A;  1JRY A;  5U25 A;  2GQF A;  2ZBW A;  3CMM A;  1O5W A;  4O5Q A;  2VVL A;  2WU5 A;  2PYX A;  2X50 A;  1COY A;  2BK3 A;  4JQ9 A;  4NNJ A;  2XVE A;  4Z25 A;  3AYI A;  5C3J A;  5IQ4 A;  4YSH A;  4HA6 A;  4OVI A;  2WQY A;  3O0H A;  1BF3 A;  4G6H A;  4J34 A;  3ABV A;  1GV4 A;  3ATR A;  3II4 A;  2RAB A;  1PHH A;  3UTH A;  3DA1 A;  1YY5 A;  2GR3 A;  1DOE A;  3NG7 X;  3AE9 A;  2GR1 A;  2QA2 A;  1GRE A;  1ZMD A;  2V3B A;  3AWI A;  4EM4 A;  2C3C A;  3CN8 A;  1NHQ A;  2WOI A;  3COX A;  3GMB A;  4AOS A;  3CTY A;  3ALL A;  3ZDN A;  1JRX A;  2C3D A;  2YG3 A;  3CGE A;  3ICR A;  4FK1 A;  3DJG X;  4E0V A;  4TLZ A;  3NYF A;  3CPH G;  2YR4 A;  2WDR A;  3BNM A;  3M0O A;  1O95 A;  4YXD A;  2GMJ A;  4AP3 A;  3C4A A;  2BYB A;  1K0L A;  3Q9T A;  2XFU A;  4KX6 A;  4ZCC A;  1CF3 A;  2EQ9 A;  2RGH A;  3AED A;  4C3X A;  2B7S A;  3K30 A;  1NEK A;  3GWF A;  2GRT A;  5U1O A;  4A65 A;  3QFA A;  1FL2 A;  3RED A;  2FJA A;  2C65 A;  1SEZ A;  4YTP A;  3DK8 A;  1D4D A;  4G6G A;  3VQR A;  3E1T A;  2PHH A;  3CNP A;  3RP8 A;  4OPI A;  4CRT A;  3URH A;  2Y6R A;  3NN0 X;  3V76 A;  5KMQ A;  2TPR A;  2B76 A;  2RGJ A;  3SFE A;  1E1N A;  1ZKQ A;  3CNS A;  2XVJ A;  3RHA A;  3LJP A;  2XLU A;  1CC4 A;  3AD7 B;  1PBD A;  2GMH A;  1Y56 B;  2YLT A;  3RNM A;  1ZK7 A;  2EQ7 A;  3VRA A;  1GET A;  2VZ2 A;  3DGH A;  2WBA A;  3FPZ A;  1NPX A;  4OPU A;  4B66 A;  1YQZ A;  1ZMC A;  1MXT A;  3PS9 A;  4M52 A;  4BK2 A;  4WX1 A;  1E1M A;  2ACZ A;  5EOW A;  4EMW A;  4OPD A;  4I59 A;  1LTX R;  2GV8 A;  4H4R A;  3T37 A;  4U8L A;  3UOZ A;  4LU6 A;  2WOV A;  1QO8 A;  1V59 A;  1D7L A;  2AAQ A;  4JNA A;  3SZF A;  4H2R A;  3SGL A;  3DJJ A;  2C66 A;  2AQJ A;  4U8I A;  3H4K A;  4YSX A;  3NGC X;  4GUV A;  5IQ1 A;  2YR5 A;  3SQP A;  1LV0 A;  1JNR A;  3AE2 A;  3D1C A;  3QSE A;  1PJ5 A;  1PBF A;  2DKI A;  4B69 A;  4NEW A;  4OPC A;  4H4U A;  2HQM A;  3T2K A;  3K7M X;  1NHR A;  1DJQ A;  1IUU A;  2BS3 A;  3KD9 A;  3LB8 A;  4PAA A;  4FX9 A;  4U8M A;  5BUK A;  1BWC A;  1H84 A;  4RG3 A;  4TM1 A;  2BS2 A;  2C73 A;  1H6V A;  1E1K A;  4C74 A;  2YG5 A;  4TM3 A;  3NHO X;  1PBB A;  4U8N A;  4YSY A;  2Q0K A;  1EL5 A;  3G5Q A;  3AD8 B;  2XVF A;  3QVR A;  3V3O A;  1D4C A;  2OAM A;  2VRM A;  4FK1 C;  4USQ A;  4YKF A;  1P2H A;  2JAE A;  2YVF A;  4U8K A;  1H83 A;  4XWR A;  3UKA A;  1F6M A;  4B63 A;  3SXI A;  5KOX A;  2Z5Y A;  3KU9 A;  2YVG A;  4EQR A;  2ZZB A;  5HY5 A;  2V60 A;  3AE5 A;  2IID A;  4GDE A;  4BV6 A;  3I6D A;  3GRT A;  3F8R A;  4K5S A;  5GSN A;  2DKH A;  4H4P A;  4Z43 A;  2OLO A;  2OA1 A;  5JCI A;  3GDN A;  2XLT A;  2WDV A;  3ALM A;  5TR3 A;  3QFB A;  2ZZ0 A;  2I0Z A;  3P9U A;  1GRG A;  3UP4 A;  3ADA B;  3NYC A;  4CBQ A;  2XLP A;  4Y4N A;  1TDK A;  4II2 A;  1JOA A;  2W0H A;  2YM1 A;  1D5T A;  4Y4L A;  2R0P A;  2XYO A;  4JDR A;  1JNZ A;  1L0V A;  4ECH A;  4TM4 A;  2BK5 A;  1GTE A;  2C76 A;  1GAL A;  3KVE A;  4LII A;  4U8O A;  3DGZ A;  4D04 A;  3NTD A;  1NAA A;  1ELI A;  4YTN A;  4Z2T A;  4XWZ A;  1PJ7 A;  1NHS A;  4A6N B;  1PJ6 A;  4I58 A;  3KPF A;  5KVI A;  1S2Q A;  4A79 A;  1JRZ A;  2JBV A;  4EMI A;  5C2T A;  1S3E A;  3C96 A;  3KPK A;  1ZY8 A;  5KXJ A;  1N1P A;  2B9W A;  3LOV A;  4IVO B;  1FEA A;  1PN0 A;  5JCN A;  1QJD A;  1OJ9 A;  4GAP A;  1Q1W A;  4FDC B;  4Z2U A;  5FS8 A;  5HHF A;  1ZX9 A;  3NH3 X;  1RP0 A;  3S61 A;  5BUL A;  4GR1 A;  2YG7 A;  1GRF A;  2WET A;  3AE7 A;  3B6D A;  2RGO A;  1QLB A;  3KLJ A;  3D8X A;  4X4J A;  1B8S A;  3NTA A;  1CC6 A;  2X8C A;  3UOY A;  2R4J A;  1IJH A;  3AE3 A;  2R9Z A;  3CPI G;  4O5U A;  1H7W A;  3G5S A;  1VDC A;  3OC4 A;  2WPF A;  3V3N A;  1M6I A;  1MO9 A;  1CJC A;  1M64 A;  1O94 A;  2BXR A;  2GR2 A;  2X99 A;  2WES A;  1N4W A;  3L1R A;  5JCK A;  1FCD A;  3EF6 A;  2XLS A;  3FG2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...