3D8XA

Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
VHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Saccharomyces cerevisiae cytoplasmic thioredoxin reductase Trr1 reveals the structural basis for species-specific recognition of thioredoxin
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1
total genus 98
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3d8xA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3d8xA02
4H2QA 2FJAA 3NYFA 4J56A 3AD7B 3RP6A 4ADWA 1E6EA 3K7MX 4H4QA 4ECHA 1D5TA 2XVJA 1Q1WA 3RHAA 4Z26A 1CL0A 1QO8A 2XVFA 1VQWA 1V59A 4Y4LA 3ABVA 1H83A 1NEKA 1ZDLA 1IUVA 2R0GA 3K7TA 3GMBA 2V6OA 2GEWA 1KF6A 1HYUA 1NHRA 2RABA 4B65A 1PHHA 1TDOA 4C77A 3NTAA 3DGZA 4USQA 2W0HA 1E39A 2YLZA 4DGKA 4EMWA 3NRNA 4CCRA 1JEHA 1RP0A 5FS6A 1PBDA 3C4AA 5CKUA 4C3XA 3ALMA 3LJPA 1NHSA 1EL5A 1CBOA 4AP1A 3GRSA 3K7QX 2C66A 2GQFA 3V3NA 1M6IA 2YLSA 1PN0A 2Q7VA 4H4UA 3UTHA 5CQFA 5EOWA 5U63A 4U2TA 1UKVG 1AOGA 2X50A 4OPIA 1ZMCA 1NG3A 2V3AA 5JCNA 3FPZA 4NTEA 1ZKQA 4D03A 2BK4A 2JKCA 4H50A 2C65A 4JNQA 4O5UA 2J3NA 3UCLA 3VR9A 1D7LA 1H86A 1KNPA 5HYMA 2BS4A 1YQ4A 3M0OA 1CHUA 1KFYA 2QAEA 2WOWA 2DKHA 4UDRA 2BABA 1LV0A 2C75A 1E1KA 3GRTA 4CBQA 2X8GA 2XFUA 3G5RA 1N4VA 2R0PA 1TDNA 4OCGA 3PVCA 3DH9A 1DJNA 4RG4A 4YSHA 5JCMA 1NDAA 2CULA 2EQ7A 2QCUA 1GALA 4YTMA 2YLXA 2GH5A 2BYBA 2QA2A 2WPFA 3EPTA 3GD3A 1S2YA 4RG3A 3UTGA 3EF6A 3SM8A 4EQSA 1QJDA 1KSUA 3QVPA 2WS3A 1VDCA 2XLRA 3S5WA 4NZHA 4AOSA 2TMDA 2CVJA 2X8HA 3KD9A 1PJ7A 1NENA 2XFOA 1GETA 2R45A 3NNEA 4EQXA 2BK5A 3REDA 2GAHB 2GAGB 4A5LA 2A87A 2OLOA 2C72A 2FJBA 3CTYA 1PBFA 3UOXA 4DNAA 1KNRA 3UTEA 2OALA 1GT8A 4BURA 1B37A 4Z44A 2WBAA 3DK4A 3ICTA 4J34A 2GR1A 2XDOA 3UKPA 2APGA 2Q0KA 4KPRA 5FS9A 4U8NA 2V5ZA 1O5WA 2YAUA 2GB0A 2X3NA 2YVJA 1GRFA 2V3BA 4H2RA 5U1OA 3WE0A 1GTHA 3LOVA 1MXTA 4IVOB 4REKA 3P4RA 3B6DA 1VG0A 1EBDA 3COXA 4PABA 1YKJA 2BS2A 2JAEA 3S61A 4C3YA 4B67A 1D4DA 2Y6QA 2GVCA 1L0VA 3AWIA 1H6VA 3F8RA 2RGOA 1JNZA 4U8MA 5GSNA 4AT0A 1NG4A 1PXAA 4J31A 1CJ2A 3F8PA 2C3DA 3ZDNA 2E4GA 4WCTA 3VRAA 2C70A 1X31B 2WESA 2B9XA 4I59A 3SFDA 5IPYA 4GUVA 1P2EA 1NHQA 1P2HA 1D4EA 2YQUA 3NK0X 1CC6A 1PBEA 4K2XA 4U8PA 2BC1A 2Q0LA 3C4NA 1E1MA 3II4A 4CNJA 2JB1A 4Z24A 4H4ZA 2VVLG 2DKIA 1OJCA 1TDFA 5EB5A 3D1CA 1E1LA 3AE1A 2NPXA 2GF3A 3AYLA 5TR3A 2BS3A 3VRDB 1D7YA 2XFQA 5JCKA 4JY3A 3VRBA 4A99A 2XFPA 1N1PA 5EBKA 4YT0A 1DNCA 4E0VA 1GEUA 2AAQA 3IF9A 1O94A 3SFEA 1GOSA 3VR8A 4A9WA 5GRTA 5M10A 1CC2A 1O95A 3NTDA 3AECA 4TM1A 5KXJA 1GRGA 1H84A 2NVKX 2GV8A 3GMCA 1BF3A 4AT2A 3QFBA 4CNKA 3GDPA 2B7RA 5KRQA 3URHA 4A65A 2V60A 1OJAA 5U25A 3P4QA 4APNA 2R9ZA 4J36A 3H4KA 4ZN0A 3IHMA 1K0IA 4H4XA 4GCMA 5BUKA 2ACZA 4USRA 3DK8A 1RSGA 1OJDA 1PBCA 4FK1A 1LQUA 1CJ3A 1QLBA 2TPRA 2VRMA 3V76A 3O0HA 5FS8A 4H4WA 2BK3A 2EQ8A 4EMJA 3CIRA 5KVHA 3IHGA 1YY5A 5J7XA 4BJZA 3LB8A 3L1RA 2VVLA 4IA6A 2IVDA 4LA1A 3NYEA 4IV9A 4D04A 3DK9A 3IC9A 4YKGA 1F8RA 1S3BA 4AP3A 3QSEA 2FJEA 4LIIA 4H7UA 4DSHA 4J33A 4B69A 1ZOVA 3NN6X 3G5QA 4OPCA 1YQ3A 3D8XA 2C3CA 2ZZCA 1VRQB 3G5SA 4YKFA 1L9DA 3EAOA 3AE9A 3ICRA 2GQWA 5HXIA 1FEAA 3BI4A 2YVGA 3P4PA 3GWDA 3IWAA 1L9EA 2BC0A 4OPLA 4YXDA 4TLXA 1TDEA 1XDIA 1DODA 2BCGG 2BXRA 4X9MA 1TYPA 5KWFA 1PBBA 3FIMB 3AEAA 3ATRA 2OA1A 4Z25A 1JU2A 2GRTA 3Q9TA 3V3OA 2VZ2A 3DMEA 1NAAA 1ZMDA 2EQ6A 2XLPA 1DJQA 4U8KA 3ITJA 3AE5A 2R4EA 4BV6A 4U2SA 2YG3A 1H7WA 3QFAA 4U8IA 4YTPA 2RGHA 1F8WA 3LZWA 1NHPA 1GERA 3CPJG 4YSXA 2C67A 5KVIA 4JNAA 3PS9A 2JBVA 3LXDA 5HY5A 3DGHA 3DJEA 2X8CA 4EIQA 3M12A 3UTFA 1Y56B 4A6NA 1EL9A 1CJCA 4TLZA 4H4YA 3AEDA 5EB4A 4B64A 3AE8A 1GXFA 4Y4MA 4K5SA 2YLWA 1GRHA 4EM4A 4NEVA 3RP7A 2XVHA 2YR6A 1B4VA 2C73A 1PJ6A 3GYIA 1DOBA 2YG5A 1JRYA 3KKJA 4JQ9A 4PAAA 2GMJA 3QSMA 3R9UA 4HB9A 5C3JA 1LTXR 1EL7A 2JB2A 3NGCX 3P9UA 3ADAB 4IVMB 5M0ZA 5JCLA 2A8XA 3AE4A 1ELIA 1BZLA 1B5QA 3NN0X 1DOCA 1M64A 4ZCCA 3UP4A 2YG4A 2VOUA 2YM2A 1GRTA 2AQJA 1REOA 2C64A 3AB1A 3CNDA 2FBWA 3I6DA 4GF7A 4H4SA 4OPGA 1TYTA 3DJDA 4EIPA 4LU6A 1ONFA 1PJ5A 3HZLA 1GPEA 4XWRA 4JY2A 2GR0A 3EANA 1PXBA 4DSGA 1MO9A 4GDEA 1E1NA 4C5OA 2YR5A 4AOXA 1BGJA 3BNMA 2WQYA 1LVLA 1F3PA 1L9CA 2Q6UA 3E1TA 5IQ4A 4H4PA 3ICSA 1TDKA 2WP9A 5FMHA 4JN9A 2FJDA 3GD4A 3H8IA 2B7SA 3CGBA 3PO7A 3FG2P 1ZY8A 2WDVA 4TM3A 3UKAA 4Z2RA 3UOZA 2X99A 1GRAA 4UP3A 4OPUA 1F8SA 3LZXA 4M52A 1H81A 3SGLA 4A79A 4U8JA 1GV4A 3C96A 3B3RA 3LADA 4GR1A 4H2NA 2O9ZA 1S3EA 2RGJA 4O5QA 1KSSA 2Z5XA 3NIXA 4B63A 2OLNA 3BI2A 1FCDA 2F5ZA 1Q1RA 2VQ7A 3ZYXA 1KDGA 3GDNA 2AR8A 3K30A 3Q6JA 1CJ4A 1EL8A 4BK3A 4K8DA 3QVRA 4FX9A 4OPTA 3CN8A 1COYA 4GRTA 1MOKA 1Y56A 2BA9A 3AXBA 2A89A 2WHDA 4Y4NA 4NEWA 3UKKA 3UKLA 3NYCA 3BHFA 1Q9IA 2WPEA 4OVIA 2ZBWA 3VQRA 5KOWA 1IJHA 3AEGA 1VG9A 3RP8A 4MJWA 2VQBA 1GSNA 1IUSA 2ARDA 2WDQA 3AE2A 1XANA 1B8SA 4J2WA 4X4JA 3ALLA 4NTCA 4UDPA 5HHFA 1H82A 3AD9B 4EMIA 2BCPA 2XLTA 3M13A 2XLUA 3CGEA 3T37A 3CNPA 4EM3A 2ZZ0A 2WOIA 2WU5A 1GTEA 2V61A 1Z6LA 1LJ1A 1CC4A 3JSKA 4A7AA 4YSYA 4N9XA 3DJJA 1ZK7A 2VRLA 3UKHA 4NTDA 3NK2X 3CNSA 2XLSA 5BRTA 2GR3A 1OJ9A 1ZX9A 1LQTA 4I58A 1IUXA 1ZP0A 3BHKA 5KOXA 4UDQA 2YM1A 3UOYA 2PHHA 3CPHG 4Z43A 3GYJA 2R0CA 4X9NA 1FL2A 2WPCA 2PYXA 2WP5A 2C7GA 1YQZA 1BKWA 1CF3A 3CNJA 4HA6A 3KPFA 3ALJA 4EQWA 3AEEA 5IQ1A 1XPQA 3FMWA 1PXCA 4U2LA 2YVFA 4BK1A 3GWFA 2XYOA 3SQPA 1W4XA 1GRBA 1IUUA 3KU9A 4TM0A 4B1BA 1K4QA 4P9SA 2BXSA 3GSIA 2WU2A 4B68A 4K22A 2GMHA 1BGNA 2E1MA 2WP6A 4H4VA 2BACA 4K5RA 3NH3X 2H88A 1F6MA 2JK6A 4J57A 3AE7A 2YG7A 1PDHA 2YG6A 4H2PA 3NK1X 1H7XA 1NPXA 3AD8B 1S2QA 3QSSA 1D4CA 3NT6A 4KX6A 3KVEA 4XWZA 2B9WA 2XCGA 4JDRA 3L8KA 4U8LA 4RSLA 3BI5A 5LV9A 1IUTA 1XHCA 4A6NB 5FS7A 2C76A 3UP5A 2ZZBA 3CGCA 4FK1C 2R4JA 1GESA 3FBSA 2I0ZA 1GNDA 1DXLA 1IUWA 1BWCA 1N4WA 3AEFA 2YWLA 4GDPA 4YSZA 4BK2A 1FOHA 5BVAA 2HQMA 4ZCDA 1ZOYA 3NG7X 4WX1A 3I3LA 2Y6RA 1SEZA 2Z5YA 3UKQA 2VVMA 1PS9A 4Z2TA 2WDRA 4H4RA 2EQ9A 4Z2UA 3OC4A 3AEBA 3AE6A 5J60A 1FECA 1LPFA 4B66A 3P1WA 4CY8A 2YR4A 5JCIA 3BNUA 2IIDA 4CRTA 3NHOX 3AE3A 3CGDA 4K7ZA 2WETA 4YTNA 3UOVA 3AYIA 2CFYA 3F8DA 4IA5A 1GREA 3UKFA 4XXGA 3OZ2A 2YLTA 3RNMA 3H8LA 3ISHA 1JRXA 2H89A 3NLCA 1JNRA 1OJTA 5BULA 2GR2A 2B76A 1N4UA 2QA1A 3KA7A 4H4TA 1K0JA 3DA1A 4U8OA 2OAMA 4FDCB 3DJGX 5DBJA 1Y0PA 2JB3A 2CDUA 3CNTA 2UZZA 3NKSA 3QJ4A 1FEBA 1K0LA 2E5VA 5ER0A 1DOEA 1RYIA 2WEUA 3AYJA 4ICYA 1JOAA 4BJYA 4TM4A 4C74A 2XFNA 4YWOA 4OPDA 2XVEA 2YLRA 3CPIG 1JRZA 2XVIA 2WOVA 2B9YA 4CCQA 5C2TA 4EQRA 2R46A 3KLJA 3P4SA 2IVEA 3ATQA 4CY6A 5L46A 1TRBA 1E7PA
chains in the Genus database with same CATH superfamily
4H2QA 2FJAA 3NYFA 4J56A 3AD7B 3RP6A 4ADWA 1E6EA 3K7MX 4H4QA 4ECHA 1D5TA 2XVJA 1Q1WA 3RHAA 4Z26A 1CL0A 1QO8A 2XVFA 1VQWA 1V59A 4Y4LA 3ABVA 1H83A 1NEKA 1ZDLA 1IUVA 2R0GA 3K7TA 3GMBA 2V6OA 2GEWA 1KF6A 1HYUA 1NHRA 2RABA 4B65A 1PHHA 1TDOA 4C77A 3NTAA 3DGZA 4USQA 2W0HA 1E39A 2YLZA 4DGKA 4EMWA 3NRNA 4CCRA 1JEHA 3CMMA 1RP0A 5FS6A 1PBDA 3C4AA 5CKUA 4C3XA 3ALMA 3LJPA 1NHSA 1EL5A 1CBOA 4AP1A 3GRSA 3K7QX 2C66A 2GQFA 3V3NA 1M6IA 2YLSA 1PN0A 2Q7VA 4H4UA 3UTHA 5CQFA 5EOWA 5U63A 4U2TA 1UKVG 1AOGA 2X50A 4OPIA 1ZMCA 1NG3A 2V3AA 5JCNA 3FPZA 4NTEA 1ZKQA 4D03A 2BK4A 2JKCA 4H50A 2C65A 4JNQA 4O5UA 2J3NA 3UCLA 3VR9A 1D7LA 1H86A 1KNPA 5HYMA 2BS4A 1YQ4A 3M0OA 1CHUA 1KFYA 2QAEA 2WOWA 2DKHA 4UDRA 2BABA 1LV0A 2C75A 1E1KA 3GRTA 4CBQA 2X8GA 2XFUA 3G5RA 1N4VA 3SX6A 2BRAA 2R0PA 1TDNA 4GAVA 3PVCA 3DH9A 1DJNA 4OCGA 4RG4A 4YSHA 5JCMA 1NDAA 2CULA 2EQ7A 3HYXA 2QCUA 1GALA 4YTMA 2YLXA 2GH5A 2BYBA 2QA2A 2WPFA 3EPTA 3GD3A 1S2YA 4RG3A 3UTGA 3EF6A 3SM8A 3T31A 4EQSA 1QJDA 1KSUA 3QVPA 2WS3A 1VDCA 2XLRA 3S5WA 4NZHA 4AOSA 2TMDA 2CVJA 2X8HA 3KD9A 1PJ7A 1NENA 2XFOA 1GETA 2R45A 3NNEA 4EQXA 2BK5A 3REDA 2GAHB 2GAGB 4A5LA 2A87A 2OLOA 2C72A 2FJBA 3CTYA 1PBFA 3UOXA 4NNJA 4DNAA 1KNRA 3UTEA 2OALA 1GT8A 4BURA 1B37A 4Z44A 2WBAA 3DK4A 3ICTA 4J34A 2GR1A 2XDOA 3UKPA 2APGA 2Q0KA 4KPRA 5FS9A 4U8NA 2V5ZA 1O5WA 2YAUA 2GB0A 2X3NA 2YVJA 1GRFA 2V3BA 4H2RA 4II2A 5U1OA 3WE0A 1GTHA 3LOVA 1MXTA 4IVOB 4REKA 3P4RA 3B6DA 1VG0A 1EBDA 3COXA 4PABA 1YKJA 2BS2A 2JAEA 3S61A 4C3YA 4B67A 1D4DA 2Y6QA 2GVCA 1L0VA 3AWIA 1H6VA 3F8RA 2RGOA 1JNZA 4U8MA 5GSNA 4AT0A 1NG4A 1PXAA 4J31A 1CJ2A 3F8PA 2C3DA 3ZDNA 2E4GA 4WCTA 3SXIA 3VRAA 2C70A 1X31B 2WESA 2B9XA 4I59A 3SFDA 5IPYA 4GUVA 1P2EA 1NHQA 1P2HA 1D4EA 2YQUA 3NK0X 3HYWA 1CC6A 1PBEA 4K2XA 4U8PA 2BC1A 2Q0LA 3C4NA 1E1MA 3II4A 4CNJA 2JB1A 4Z24A 4H4ZA 2VVLG 2DKIA 1OJCA 1TDFA 5EB5A 3D1CA 1E1LA 3AE1A 2NPXA 3SZWA 2GF3A 3AYLA 5TR3A 2BS3A 3VRDB 1D7YA 2XFQA 3T2YA 5JCKA 4JY3A 3VRBA 4A99A 2XFPA 1N1PA 5EBKA 4YT0A 1DNCA 4E0VA 1GEUA 2AAQA 3IF9A 4G73A 1O94A 3SFEA 1GOSA 3VR8A 4A9WA 5GRTA 5M10A 1CC2A 1O95A 3NTDA 3AECA 4TM1A 5KXJA 1GRGA 1H84A 2NVKX 2GV8A 3GMCA 1BF3A 4AT2A 3QFBA 4CNKA 3GDPA 2B7RA 4G6GA 3URHA 5KRQA 3T14A 4A65A 2V60A 1OJAA 5U25A 3P4QA 4APNA 2R9ZA 4J36A 3H4KA 4ZN0A 3IHMA 1K0IA 4H4XA 4GCMA 5BUKA 2ACZA 4USRA 3DK8A 1RSGA 1OJDA 1PBCA 4FK1A 1LQUA 1CJ3A 1QLBA 3SYIA 2TPRA 2VRMA 3V76A 3O0HA 5FS8A 4H4WA 2BK3A 2EQ8A 4EMJA 3CIRA 5KVHA 3IHGA 1YY5A 5J7XA 4BJZA 3LB8A 3L1RA 2VVLA 4IA6A 2IVDA 4LA1A 3NYEA 4IV9A 4D04A 3DK9A 3IC9A 4YKGA 1F8RA 1S3BA 4AP3A 3QSEA 2FJEA 4LIIA 4H7UA 4DSHA 4J33A 4B69A 1ZOVA 3NN6X 3G5QA 4OPCA 1YQ3A 3D8XA 2C3CA 2ZZCA 1VRQB 3G5SA 4YKFA 1L9DA 3EAOA 3AE9A 3ICRA 2GQWA 5HXIA 3T2ZA 1FEAA 3BI4A 2YVGA 3P4PA 3GWDA 3IWAA 1L9EA 2BC0A 4OPLA 4YXDA 4TLXA 1TDEA 1XDIA 1DODA 2BCGG 2BXRA 4X9MA 1TYPA 5KWFA 1PBBA 3FIMB 3AEAA 3ATRA 2OA1A 4Z25A 1JU2A 2GRTA 3KPKA 3Q9TA 3V3OA 2VZ2A 3DMEA 1NAAA 1ZMDA 2EQ6A 2XLPA 1DJQA 4U8KA 3ITJA 3AE5A 2R4EA 4BV6A 4U2SA 2YG3A 1H7WA 3QFAA 4U8IA 4II3A 4YTPA 2RGHA 1F8WA 2C4CA 1NHPA 3LZWA 1GERA 3CPJG 4YSXA 2C67A 5KVIA 4JNAA 3PS9A 2JBVA 4G9KA 3LXDA 5HY5A 3DGHA 3DJEA 2X8CA 4G6HA 4EIQA 3M12A 3UTFA 1Y56B 4A6NA 3SZ0A 1EL9A 1CJCA 4G74A 4H4YA 4TLZA 3AEDA 5EB4A 3SZCA 4B64A 3AE8A 1GXFA 4Y4MA 4K5SA 2YLWA 1GRHA 4EM4A 4NEVA 3RP7A 2XVHA 2YR6A 1B4VA 2C73A 1PJ6A 3GYIA 1DOBA 2YG5A 1JRYA 3KKJA 4JQ9A 4PAAA 2GMJA 3QSMA 3R9UA 4HB9A 5C3JA 1LTXR 1EL7A 2JB2A 3NGCX 3P9UA 3ADAB 4IVMB 5M0ZA 5JCLA 2A8XA 3AE4A 1ELIA 1BZLA 1B5QA 3NN0X 1DOCA 1M64A 4ZCCA 3UP4A 2YG4A 2VOUA 2YM2A 1GRTA 2AQJA 1REOA 2C64A 3AB1A 3CNDA 2FBWA 3I6DA 4GF7A 4H4SA 4OPGA 1TYTA 3DJDA 4EIPA 4LU6A 1ONFA 1PJ5A 3HZLA 1GPEA 4XWRA 4JY2A 2GR0A 3EANA 1PXBA 4DSGA 1MO9A 4GDEA 1E1NA 4C5OA 2YR5A 4AOXA 1BGJA 3BNMA 2WQYA 1LVLA 1F3PA 1L9CA 2Q6UA 3E1TA 5IQ4A 4H4PA 3ICSA 1TDKA 2WP9A 5KMSA 5FMHA 4JN9A 2FJDA 3GD4A 3H8IA 2B7SA 3CGBA 3PO7A 3FG2P 1ZY8A 2WDVA 4TM3A 3UKAA 4Z2RA 3UOZA 2X99A 1GRAA 4UP3A 4OPUA 1F8SA 3LZXA 4M52A 1H81A 3SGLA 4A79A 4U8JA 1GV4A 3C96A 3B3RA 3LADA 4GR1A 4H2NA 2O9ZA 1S3EA 2RGJA 4O5QA 1KSSA 2Z5XA 3NIXA 4B63A 2OLNA 3BI2A 1FCDA 2F5ZA 1Q1RA 2VQ7A 3ZYXA 1KDGA 3GDNA 2AR8A 3K30A 3Q6JA 1CJ4A 3SY4A 1EL8A 4BK3A 4K8DA 3QVRA 4FX9A 4OPTA 3CN8A 1COYA 4GRTA 1MOKA 1Y56A 2BA9A 3AXBA 2A89A 2WHDA 4Y4NA 4NEWA 3UKKA 3UKLA 3NYCA 3BHFA 1Q9IA 2WPEA 4OVIA 2ZBWA 4NWZA 3HYVA 3VQRA 4GAPA 1IJHA 3AEGA 5KOWA 1VG9A 3RP8A 4MJWA 2VQBA 1GSNA 1IUSA 2ARDA 2WDQA 3AE2A 1XANA 1B8SA 4J2WA 4X4JA 3ALLA 4NTCA 4UDPA 5HHFA 1H82A 3AD9B 4EMIA 2BCPA 2XLTA 3M13A 2XLUA 3CGEA 3T37A 3CNPA 4EM3A 2ZZ0A 2WOIA 2WU5A 1GTEA 2V61A 1Z6LA 1LJ1A 1CC4A 3JSKA 4A7AA 4YSYA 4N9XA 3DJJA 1ZK7A 2VRLA 3UKHA 4NTDA 3NK2X 3CNSA 2XLSA 5BRTA 2GR3A 1OJ9A 1ZX9A 1LQTA 4I58A 1IUXA 1ZP0A 3BHKA 5KOXA 4UDQA 2YM1A 3UOYA 2PHHA 3CPHG 4Z43A 3GYJA 2R0CA 4X9NA 1FL2A 2WPCA 2PYXA 2WP5A 2C7GA 1YQZA 1BKWA 1CF3A 3CNJA 4HA6A 3KPFA 3ALJA 3GYXA 4EQWA 3AEEA 5IQ1A 1XPQA 3FMWA 1PXCA 4U2LA 2YVFA 4BK1A 3GWFA 2XYOA 3SQPA 1W4XA 1GRBA 1IUUA 3KU9A 4TM0A 4B1BA 1K4QA 4P9SA 2BXSA 3GSIA 2WU2A 4B68A 4K22A 2GMHA 1BGNA 2E1MA 2WP6A 4H4VA 2BACA 4K5RA 5KNLA 3NH3X 2H88A 1F6MA 2JK6A 4J57A 3AE7A 2YG7A 1PDHA 2YG6A 4H2PA 3NK1X 1H7XA 5KMPA 1NPXA 3AD8B 1S2QA 3QSSA 1D4CA 3NT6A 4KX6A 3KVEA 4XWZA 2BRYA 2B9WA 2XCGA 4JDRA 3L8KA 5KMQA 4U8LA 4RSLA 3T2KA 3BI5A 5LV9A 1IUTA 1XHCA 4A6NB 5FS7A 2C76A 3UP5A 2ZZBA 3CGCA 4FK1C 2R4JA 1GESA 3FBSA 2I0ZA 1GNDA 1DXLA 1IUWA 1BWCA 1N4WA 3AEFA 2YWLA 4GDPA 4YSZA 4BK2A 1FOHA 5BVAA 2HQMA 4ZCDA 1ZOYA 3NG7X 4WX1A 3I3LA 2Y6RA 1SEZA 2Z5YA 3UKQA 2VVMA 1PS9A 4Z2TA 2WDRA 4H4RA 2EQ9A 4Z2UA 3OC4A 3AEBA 3AE6A 5J60A 1FECA 1LPFA 4B66A 3P1WA 4CY8A 2YR4A 5JCIA 3BNUA 2IIDA 4CRTA 3NHOX 3AE3A 3CGDA 4K7ZA 2WETA 4YTNA 3UOVA 5KMRA 3AYIA 2CFYA 3F8DA 4IA5A 1GREA 3UKFA 4XXGA 3OZ2A 2YLTA 3RNMA 3H8LA 3ISHA 1JRXA 2H89A 3NLCA 1JNRA 1OJTA 5BULA 2GR2A 2B76A 1N4UA 2QA1A 3KA7A 4H4TA 1K0JA 3DA1A 4U8OA 2OAMA 4FDCB 3DJGX 5DBJA 1Y0PA 2JB3A 2CDUA 3CNTA 2UZZA 3NKSA 3QJ4A 3SZFA 1FEBA 1K0LA 2E5VA 5ER0A 1DOEA 1RYIA 2WEUA 3AYJA 4ICYA 1JOAA 4BJYA 4TM4A 4C74A 2XFNA 4YWOA 4OPDA 2XVEA 2YLRA 3CPIG 1JRZA 2XVIA 2WOVA 3T0KA 2B9YA 4CCQA 5C2TA 4EQRA 2R46A 3KLJA 3P4SA 2IVEA 3ATQA 4CY6A 5L46A 1TRBA 1E7PA
chains in the Genus database with same CATH topology
4H2QA 2FJAA 3NYFA 4J56A 3AD7B 3RP6A 4ADWA 1E6EA 3K7MX 4H4QA 4ECHA 1D5TA 2XVJA 1Q1WA 3RHAA 4Z26A 1CL0A 1QO8A 2XVFA 1VQWA 1V59A 4Y4LA 3ABVA 1H83A 1NEKA 1ZDLA 1IUVA 2R0GA 3K7TA 3GMBA 2V6OA 2GEWA 1KF6A 1HYUA 1NHRA 2RABA 4B65A 1PHHA 1TDOA 4C77A 3NTAA 3DGZA 4USQA 2W0HA 1E39A 2YLZA 4DGKA 4EMWA 3NRNA 4CCRA 1JEHA 3CMMA 1RP0A 5FS6A 1PBDA 3C4AA 5CKUA 4C3XA 3ALMA 3LJPA 1NHSA 1EL5A 1CBOA 4AP1A 3GRSA 3K7QX 2C66A 2GQFA 3V3NA 1M6IA 2YLSA 1PN0A 2Q7VA 4H4UA 3UTHA 5CQFA 5EOWA 5U63A 4U2TA 1UKVG 1AOGA 2X50A 4OPIA 1ZMCA 1NG3A 2V3AA 5JCNA 3FPZA 4NTEA 1ZKQA 4D03A 2BK4A 2JKCA 4H50A 2C65A 4JNQA 4O5UA 2J3NA 3UCLA 3VR9A 1D7LA 1H86A 1KNPA 5HYMA 2BS4A 1YQ4A 3M0OA 1CHUA 1KFYA 2QAEA 2WOWA 2DKHA 4UDRA 2BABA 1LV0A 2C75A 1E1KA 3GRTA 4CBQA 2X8GA 2XFUA 3G5RA 1N4VA 3SX6A 2BRAA 2R0PA 1TDNA 4GAVA 3PVCA 3DH9A 1DJNA 4OCGA 4RG4A 4YSHA 5JCMA 1NDAA 2CULA 2EQ7A 3HYXA 2QCUA 1GALA 4YTMA 2YLXA 2GH5A 2BYBA 2QA2A 2WPFA 3EPTA 3GD3A 1S2YA 4RG3A 3UTGA 3EF6A 3SM8A 3T31A 4EQSA 1QJDA 1KSUA 3QVPA 2WS3A 1VDCA 2XLRA 3S5WA 4NZHA 4AOSA 2TMDA 2CVJA 2X8HA 3KD9A 1PJ7A 1NENA 2XFOA 1GETA 2R45A 3NNEA 4EQXA 2BK5A 3REDA 2GAHB 2GAGB 4A5LA 2A87A 2OLOA 2C72A 2FJBA 3CTYA 1PBFA 3UOXA 4NNJA 4DNAA 1KNRA 3UTEA 2OALA 1GT8A 4BURA 1B37A 4Z44A 2WBAA 3DK4A 3ICTA 4J34A 2GR1A 2XDOA 3UKPA 2APGA 2Q0KA 4KPRA 5FS9A 4U8NA 2V5ZA 1O5WA 2YAUA 2GB0A 2X3NA 2YVJA 1GRFA 2V3BA 4H2RA 4II2A 5U1OA 3WE0A 1GTHA 3LOVA 1MXTA 4IVOB 4REKA 3P4RA 3B6DA 1VG0A 1EBDA 3COXA 4PABA 1YKJA 2BS2A 2JAEA 3S61A 4C3YA 4B67A 1D4DA 2Y6QA 2GVCA 1L0VA 3AWIA 1H6VA 3F8RA 2RGOA 1JNZA 4U8MA 5GSNA 4AT0A 1NG4A 1PXAA 4J31A 1CJ2A 3F8PA 2C3DA 3ZDNA 2E4GA 4WCTA 3SXIA 3VRAA 2C70A 1X31B 2WESA 2B9XA 4I59A 3SFDA 5IPYA 4GUVA 1P2EA 1NHQA 1P2HA 1D4EA 2YQUA 3NK0X 3HYWA 1CC6A 1PBEA 4K2XA 4U8PA 2BC1A 2Q0LA 3C4NA 1E1MA 3II4A 4CNJA 2JB1A 4Z24A 4H4ZA 2VVLG 2DKIA 1OJCA 1TDFA 5EB5A 3D1CA 1E1LA 3AE1A 2NPXA 3SZWA 2GF3A 3AYLA 5TR3A 2BS3A 3VRDB 1D7YA 2XFQA 3T2YA 5JCKA 4JY3A 3VRBA 4A99A 2XFPA 1N1PA 5EBKA 4YT0A 1DNCA 4E0VA 1GEUA 2AAQA 3IF9A 4G73A 1O94A 3SFEA 1GOSA 3VR8A 4A9WA 5GRTA 5M10A 1CC2A 1O95A 3NTDA 3AECA 4TM1A 5KXJA 1GRGA 1H84A 2NVKX 2GV8A 3GMCA 1BF3A 4AT2A 3QFBA 4CNKA 3GDPA 2B7RA 4G6GA 3URHA 5KRQA 3T14A 4A65A 2V60A 1OJAA 5U25A 3P4QA 4APNA 2R9ZA 4J36A 3H4KA 4ZN0A 3IHMA 1K0IA 4H4XA 4GCMA 5BUKA 2ACZA 4USRA 3DK8A 1RSGA 1OJDA 1PBCA 4FK1A 1LQUA 1CJ3A 1QLBA 3SYIA 2TPRA 2VRMA 3V76A 3O0HA 5FS8A 4H4WA 2BK3A 2EQ8A 4EMJA 3CIRA 5KVHA 3IHGA 1YY5A 5J7XA 4BJZA 3LB8A 3L1RA 2VVLA 4IA6A 2IVDA 4LA1A 3NYEA 4IV9A 4D04A 3DK9A 3IC9A 4YKGA 1F8RA 1S3BA 4AP3A 3QSEA 2FJEA 4LIIA 4H7UA 4DSHA 4J33A 4B69A 1ZOVA 3NN6X 3G5QA 4OPCA 1YQ3A 3D8XA 2C3CA 2ZZCA 1VRQB 3G5SA 4YKFA 1L9DA 3EAOA 3AE9A 3ICRA 2GQWA 5HXIA 3T2ZA 1FEAA 3BI4A 2YVGA 3P4PA 3GWDA 3IWAA 1L9EA 2BC0A 4OPLA 4YXDA 4TLXA 1TDEA 1XDIA 1DODA 2BCGG 2BXRA 4X9MA 1TYPA 5KWFA 1PBBA 3FIMB 3AEAA 3ATRA 2OA1A 4Z25A 1JU2A 2GRTA 3KPKA 3Q9TA 3V3OA 2VZ2A 3DMEA 1NAAA 1ZMDA 2EQ6A 2XLPA 1DJQA 4U8KA 3ITJA 3AE5A 2R4EA 4BV6A 4U2SA 2YG3A 1H7WA 3QFAA 4U8IA 4II3A 4YTPA 2RGHA 1F8WA 2C4CA 1NHPA 3LZWA 1GERA 3CPJG 4YSXA 2C67A 5KVIA 4JNAA 3PS9A 2JBVA 4G9KA 3LXDA 5HY5A 3DGHA 3DJEA 2X8CA 4G6HA 4EIQA 3M12A 3UTFA 1Y56B 4A6NA 3SZ0A 1EL9A 1CJCA 4G74A 4H4YA 4TLZA 3AEDA 5EB4A 3SZCA 4B64A 3AE8A 1GXFA 4Y4MA 4K5SA 2YLWA 1GRHA 4EM4A 4NEVA 3RP7A 2XVHA 2YR6A 1B4VA 2C73A 1PJ6A 3GYIA 1DOBA 2YG5A 1JRYA 3KKJA 4JQ9A 4PAAA 2GMJA 3QSMA 3R9UA 4HB9A 5C3JA 1LTXR 1EL7A 2JB2A 3NGCX 3P9UA 3ADAB 4IVMB 5M0ZA 5JCLA 2A8XA 3AE4A 1ELIA 1BZLA 1B5QA 3NN0X 1DOCA 1M64A 4ZCCA 3UP4A 2YG4A 2VOUA 2YM2A 1GRTA 2AQJA 1REOA 2C64A 3AB1A 3CNDA 2FBWA 3I6DA 4GF7A 4H4SA 4OPGA 1TYTA 3DJDA 4EIPA 4LU6A 1ONFA 1PJ5A 3HZLA 1GPEA 4XWRA 4JY2A 2GR0A 3EANA 1PXBA 4DSGA 1MO9A 4GDEA 1E1NA 4C5OA 2YR5A 4AOXA 1BGJA 3BNMA 2WQYA 1LVLA 1F3PA 1L9CA 2Q6UA 3E1TA 5IQ4A 4H4PA 3ICSA 1TDKA 2WP9A 5KMSA 5FMHA 4JN9A 2FJDA 3GD4A 3H8IA 2B7SA 3CGBA 3PO7A 3FG2P 1ZY8A 2WDVA 4TM3A 3UKAA 4Z2RA 3UOZA 2X99A 1GRAA 4UP3A 4OPUA 1F8SA 3LZXA 4M52A 1H81A 3SGLA 4A79A 4U8JA 1GV4A 3C96A 3B3RA 3LADA 4GR1A 4H2NA 2O9ZA 1S3EA 2RGJA 4O5QA 1KSSA 2Z5XA 3NIXA 4B63A 2OLNA 3BI2A 1FCDA 2F5ZA 1Q1RA 2VQ7A 3ZYXA 1KDGA 3GDNA 2AR8A 3K30A 3Q6JA 1CJ4A 3SY4A 1EL8A 4BK3A 4K8DA 3QVRA 4FX9A 4OPTA 3CN8A 1COYA 4GRTA 1MOKA 1Y56A 2BA9A 3AXBA 2A89A 2WHDA 4Y4NA 4NEWA 3UKKA 3UKLA 3NYCA 3BHFA 1Q9IA 2WPEA 4OVIA 2ZBWA 4NWZA 3HYVA 3VQRA 4GAPA 1IJHA 3AEGA 5KOWA 1VG9A 3RP8A 4MJWA 2VQBA 1GSNA 1IUSA 2ARDA 2WDQA 3AE2A 1XANA 1B8SA 4J2WA 4X4JA 3ALLA 4NTCA 4UDPA 5HHFA 1H82A 3AD9B 4EMIA 2BCPA 2XLTA 3M13A 2XLUA 3CGEA 3T37A 3CNPA 4EM3A 2ZZ0A 2WOIA 2WU5A 1GTEA 2V61A 1Z6LA 1LJ1A 1CC4A 3JSKA 4A7AA 4YSYA 4N9XA 3DJJA 1ZK7A 2VRLA 3UKHA 4NTDA 3NK2X 3CNSA 2XLSA 5BRTA 2GR3A 1OJ9A 1ZX9A 1LQTA 4I58A 1IUXA 1ZP0A 3BHKA 5KOXA 4UDQA 2YM1A 3UOYA 2PHHA 3CPHG 4Z43A 3GYJA 2R0CA 4X9NA 1FL2A 2WPCA 2PYXA 2WP5A 2C7GA 1YQZA 1BKWA 1CF3A 3CNJA 4HA6A 3KPFA 3ALJA 3GYXA 4EQWA 3AEEA 5IQ1A 1XPQA 3FMWA 1PXCA 4U2LA 2YVFA 4BK1A 3GWFA 2XYOA 3SQPA 1W4XA 1GRBA 1IUUA 3KU9A 4TM0A 4B1BA 1K4QA 4P9SA 2BXSA 3GSIA 2WU2A 4B68A 4K22A 2GMHA 1BGNA 2E1MA 2WP6A 4H4VA 2BACA 4K5RA 5KNLA 3NH3X 2H88A 1F6MA 2JK6A 4J57A 3AE7A 2YG7A 1PDHA 2YG6A 4H2PA 3NK1X 1H7XA 5KMPA 1NPXA 3AD8B 1S2QA 3QSSA 1D4CA 3NT6A 4KX6A 3KVEA 4XWZA 2BRYA 2B9WA 2XCGA 4JDRA 3L8KA 5KMQA 4U8LA 4RSLA 3T2KA 3BI5A 5LV9A 1IUTA 1XHCA 4A6NB 5FS7A 2C76A 3UP5A 2ZZBA 3CGCA 4FK1C 2R4JA 1GESA 3FBSA 2I0ZA 1GNDA 1DXLA 1IUWA 1BWCA 1N4WA 3AEFA 2YWLA 4GDPA 4YSZA 4BK2A 1FOHA 5BVAA 2HQMA 4ZCDA 1ZOYA 3NG7X 4WX1A 3I3LA 2Y6RA 1SEZA 2Z5YA 3UKQA 2VVMA 1PS9A 4Z2TA 2WDRA 4H4RA 2EQ9A 4Z2UA 3OC4A 3AEBA 3AE6A 5J60A 1FECA 1LPFA 4B66A 3P1WA 4CY8A 2YR4A 5JCIA 3BNUA 2IIDA 4CRTA 3NHOX 3AE3A 3CGDA 4K7ZA 2WETA 4YTNA 3UOVA 5KMRA 3AYIA 2CFYA 3F8DA 4IA5A 1GREA 3UKFA 4XXGA 3OZ2A 2YLTA 3RNMA 3H8LA 3ISHA 1JRXA 2H89A 3NLCA 1JNRA 1OJTA 5BULA 2GR2A 2B76A 1N4UA 2QA1A 3KA7A 4H4TA 1K0JA 3DA1A 4U8OA 2OAMA 4FDCB 3DJGX 5DBJA 1Y0PA 2JB3A 2CDUA 3CNTA 2UZZA 3NKSA 3QJ4A 3SZFA 1FEBA 1K0LA 2E5VA 5ER0A 1DOEA 1RYIA 2WEUA 3AYJA 4ICYA 1JOAA 4BJYA 4TM4A 4C74A 2XFNA 4YWOA 4OPDA 2XVEA 2YLRA 3CPIG 1JRZA 2XVIA 2WOVA 3T0KA 2B9YA 4CCQA 5C2TA 4EQRA 2R46A 3KLJA 3P4SA 2IVEA 3ATQA 4CY6A 5L46A 1TRBA 1E7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Q A;  2FJA A;  3NYF A;  4J56 A;  3AD7 B;  3RP6 A;  4ADW A;  1E6E A;  3K7M X;  4H4Q A;  4ECH A;  1D5T A;  2XVJ A;  1Q1W A;  3RHA A;  4Z26 A;  1CL0 A;  1QO8 A;  2XVF A;  1VQW A;  1V59 A;  4Y4L A;  3ABV A;  1H83 A;  1NEK A;  1ZDL A;  1IUV A;  2R0G A;  3K7T A;  3GMB A;  2V6O A;  2GEW A;  1KF6 A;  1HYU A;  1NHR A;  2RAB A;  4B65 A;  1PHH A;  1TDO A;  4C77 A;  3NTA A;  3DGZ A;  4USQ A;  2W0H A;  1E39 A;  2YLZ A;  4DGK A;  4EMW A;  3NRN A;  4CCR A;  1JEH A;  1RP0 A;  5FS6 A;  1PBD A;  3C4A A;  5CKU A;  4C3X A;  3ALM A;  3LJP A;  1NHS A;  1EL5 A;  1CBO A;  4AP1 A;  3GRS A;  3K7Q X;  2C66 A;  2GQF A;  3V3N A;  1M6I A;  2YLS A;  1PN0 A;  2Q7V A;  4H4U A;  3UTH A;  5CQF A;  5EOW A;  5U63 A;  4U2T A;  1UKV G;  1AOG A;  2X50 A;  4OPI A;  1ZMC A;  1NG3 A;  2V3A A;  5JCN A;  3FPZ A;  4NTE A;  1ZKQ A;  4D03 A;  2BK4 A;  2JKC A;  4H50 A;  2C65 A;  4JNQ A;  4O5U A;  2J3N A;  3UCL A;  3VR9 A;  1D7L A;  1H86 A;  1KNP A;  5HYM A;  2BS4 A;  1YQ4 A;  3M0O A;  1CHU A;  1KFY A;  2QAE A;  2WOW A;  2DKH A;  4UDR A;  2BAB A;  1LV0 A;  2C75 A;  1E1K A;  3GRT A;  4CBQ A;  2X8G A;  2XFU A;  3G5R A;  1N4V A;  2R0P A;  1TDN A;  4OCG A;  3PVC A;  3DH9 A;  1DJN A;  4RG4 A;  4YSH A;  5JCM A;  1NDA A;  2CUL A;  2EQ7 A;  2QCU A;  1GAL A;  4YTM A;  2YLX A;  2GH5 A;  2BYB A;  2QA2 A;  2WPF A;  3EPT A;  3GD3 A;  1S2Y A;  4RG3 A;  3UTG A;  3EF6 A;  3SM8 A;  4EQS A;  1QJD A;  1KSU A;  3QVP A;  2WS3 A;  1VDC A;  2XLR A;  3S5W A;  4NZH A;  4AOS A;  2TMD A;  2CVJ A;  2X8H A;  3KD9 A;  1PJ7 A;  1NEN A;  2XFO A;  1GET A;  2R45 A;  3NNE A;  4EQX A;  2BK5 A;  3RED A;  2GAH B;  2GAG B;  4A5L A;  2A87 A;  2OLO A;  2C72 A;  2FJB A;  3CTY A;  1PBF A;  3UOX A;  4DNA A;  1KNR A;  3UTE A;  2OAL A;  1GT8 A;  4BUR A;  1B37 A;  4Z44 A;  2WBA A;  3DK4 A;  3ICT A;  4J34 A;  2GR1 A;  2XDO A;  3UKP A;  2APG A;  2Q0K A;  4KPR A;  5FS9 A;  4U8N A;  2V5Z A;  1O5W A;  2YAU A;  2GB0 A;  2X3N A;  2YVJ A;  1GRF A;  2V3B A;  4H2R A;  5U1O A;  3WE0 A;  1GTH A;  3LOV A;  1MXT A;  4IVO B;  4REK A;  3P4R A;  3B6D A;  1VG0 A;  1EBD A;  3COX A;  4PAB A;  1YKJ A;  2BS2 A;  2JAE A;  3S61 A;  4C3Y A;  4B67 A;  1D4D A;  2Y6Q A;  2GVC A;  1L0V A;  3AWI A;  1H6V A;  3F8R A;  2RGO A;  1JNZ A;  4U8M A;  5GSN A;  4AT0 A;  1NG4 A;  1PXA A;  4J31 A;  1CJ2 A;  3F8P A;  2C3D A;  3ZDN A;  2E4G A;  4WCT A;  3VRA A;  2C70 A;  1X31 B;  2WES A;  2B9X A;  4I59 A;  3SFD A;  5IPY A;  4GUV A;  1P2E A;  1NHQ A;  1P2H A;  1D4E A;  2YQU A;  3NK0 X;  1CC6 A;  1PBE A;  4K2X A;  4U8P A;  2BC1 A;  2Q0L A;  3C4N A;  1E1M A;  3II4 A;  4CNJ A;  2JB1 A;  4Z24 A;  4H4Z A;  2VVL G;  2DKI A;  1OJC A;  1TDF A;  5EB5 A;  3D1C A;  1E1L A;  3AE1 A;  2NPX A;  2GF3 A;  3AYL A;  5TR3 A;  2BS3 A;  3VRD B;  1D7Y A;  2XFQ A;  5JCK A;  4JY3 A;  3VRB A;  4A99 A;  2XFP A;  1N1P A;  5EBK A;  4YT0 A;  1DNC A;  4E0V A;  1GEU A;  2AAQ A;  3IF9 A;  1O94 A;  3SFE A;  1GOS A;  3VR8 A;  4A9W A;  5GRT A;  5M10 A;  1CC2 A;  1O95 A;  3NTD A;  3AEC A;  4TM1 A;  5KXJ A;  1GRG A;  1H84 A;  2NVK X;  2GV8 A;  3GMC A;  1BF3 A;  4AT2 A;  3QFB A;  4CNK A;  3GDP A;  2B7R A;  5KRQ A;  3URH A;  4A65 A;  2V60 A;  1OJA A;  5U25 A;  3P4Q A;  4APN A;  2R9Z A;  4J36 A;  3H4K A;  4ZN0 A;  3IHM A;  1K0I A;  4H4X A;  4GCM A;  5BUK A;  2ACZ A;  4USR A;  3DK8 A;  1RSG A;  1OJD A;  1PBC A;  4FK1 A;  1LQU A;  1CJ3 A;  1QLB A;  2TPR A;  2VRM A;  3V76 A;  3O0H A;  5FS8 A;  4H4W A;  2BK3 A;  2EQ8 A;  4EMJ A;  3CIR A;  5KVH A;  3IHG A;  1YY5 A;  5J7X A;  4BJZ A;  3LB8 A;  3L1R A;  2VVL A;  4IA6 A;  2IVD A;  4LA1 A;  3NYE A;  4IV9 A;  4D04 A;  3DK9 A;  3IC9 A;  4YKG A;  1F8R A;  1S3B A;  4AP3 A;  3QSE A;  2FJE A;  4LII A;  4H7U A;  4DSH A;  4J33 A;  4B69 A;  1ZOV A;  3NN6 X;  3G5Q A;  4OPC A;  1YQ3 A;  3D8X A;  2C3C A;  2ZZC A;  1VRQ B;  3G5S A;  4YKF A;  1L9D A;  3EAO A;  3AE9 A;  3ICR A;  2GQW A;  5HXI A;  1FEA A;  3BI4 A;  2YVG A;  3P4P A;  3GWD A;  3IWA A;  1L9E A;  2BC0 A;  4OPL A;  4YXD A;  4TLX A;  1TDE A;  1XDI A;  1DOD A;  2BCG G;  2BXR A;  4X9M A;  1TYP A;  5KWF A;  1PBB A;  3FIM B;  3AEA A;  3ATR A;  2OA1 A;  4Z25 A;  1JU2 A;  2GRT A;  3Q9T A;  3V3O A;  2VZ2 A;  3DME A;  1NAA A;  1ZMD A;  2EQ6 A;  2XLP A;  1DJQ A;  4U8K A;  3ITJ A;  3AE5 A;  2R4E A;  4BV6 A;  4U2S A;  2YG3 A;  1H7W A;  3QFA A;  4U8I A;  4YTP A;  2RGH A;  1F8W A;  3LZW A;  1NHP A;  1GER A;  3CPJ G;  4YSX A;  2C67 A;  5KVI A;  4JNA A;  3PS9 A;  2JBV A;  3LXD A;  5HY5 A;  3DGH A;  3DJE A;  2X8C A;  4EIQ A;  3M12 A;  3UTF A;  1Y56 B;  4A6N A;  1EL9 A;  1CJC A;  4TLZ A;  4H4Y A;  3AED A;  5EB4 A;  4B64 A;  3AE8 A;  1GXF A;  4Y4M A;  4K5S A;  2YLW A;  1GRH A;  4EM4 A;  4NEV A;  3RP7 A;  2XVH A;  2YR6 A;  1B4V A;  2C73 A;  1PJ6 A;  3GYI A;  1DOB A;  2YG5 A;  1JRY A;  3KKJ A;  4JQ9 A;  4PAA A;  2GMJ A;  3QSM A;  3R9U A;  4HB9 A;  5C3J A;  1LTX R;  1EL7 A;  2JB2 A;  3NGC X;  3P9U A;  3ADA B;  4IVM B;  5M0Z A;  5JCL A;  2A8X A;  3AE4 A;  1ELI A;  1BZL A;  1B5Q A;  3NN0 X;  1DOC A;  1M64 A;  4ZCC A;  3UP4 A;  2YG4 A;  2VOU A;  2YM2 A;  1GRT A;  2AQJ A;  1REO A;  2C64 A;  3AB1 A;  3CND A;  2FBW A;  3I6D A;  4GF7 A;  4H4S A;  4OPG A;  1TYT A;  3DJD A;  4EIP A;  4LU6 A;  1ONF A;  1PJ5 A;  3HZL A;  1GPE A;  4XWR A;  4JY2 A;  2GR0 A;  3EAN A;  1PXB A;  4DSG A;  1MO9 A;  4GDE A;  1E1N A;  4C5O A;  2YR5 A;  4AOX A;  1BGJ A;  3BNM A;  2WQY A;  1LVL A;  1F3P A;  1L9C A;  2Q6U A;  3E1T A;  5IQ4 A;  4H4P A;  3ICS A;  1TDK A;  2WP9 A;  5FMH A;  4JN9 A;  2FJD A;  3GD4 A;  3H8I A;  2B7S A;  3CGB A;  3PO7 A;  3FG2 P;  1ZY8 A;  2WDV A;  4TM3 A;  3UKA A;  4Z2R A;  3UOZ A;  2X99 A;  1GRA A;  4UP3 A;  4OPU A;  1F8S A;  3LZX A;  4M52 A;  1H81 A;  3SGL A;  4A79 A;  4U8J A;  1GV4 A;  3C96 A;  3B3R A;  3LAD A;  4GR1 A;  4H2N A;  2O9Z A;  1S3E A;  2RGJ A;  4O5Q A;  1KSS A;  2Z5X A;  3NIX A;  4B63 A;  2OLN A;  3BI2 A;  1FCD A;  2F5Z A;  1Q1R A;  2VQ7 A;  3ZYX A;  1KDG A;  3GDN A;  2AR8 A;  3K30 A;  3Q6J A;  1CJ4 A;  1EL8 A;  4BK3 A;  4K8D A;  3QVR A;  4FX9 A;  4OPT A;  3CN8 A;  1COY A;  4GRT A;  1MOK A;  1Y56 A;  2BA9 A;  3AXB A;  2A89 A;  2WHD A;  4Y4N A;  4NEW A;  3UKK A;  3UKL A;  3NYC A;  3BHF A;  1Q9I A;  2WPE A;  4OVI A;  2ZBW A;  3VQR A;  5KOW A;  1IJH A;  3AEG A;  1VG9 A;  3RP8 A;  4MJW A;  2VQB A;  1GSN A;  1IUS A;  2ARD A;  2WDQ A;  3AE2 A;  1XAN A;  1B8S A;  4J2W A;  4X4J A;  3ALL A;  4NTC A;  4UDP A;  5HHF A;  1H82 A;  3AD9 B;  4EMI A;  2BCP A;  2XLT A;  3M13 A;  2XLU A;  3CGE A;  3T37 A;  3CNP A;  4EM3 A;  2ZZ0 A;  2WOI A;  2WU5 A;  1GTE A;  2V61 A;  1Z6L A;  1LJ1 A;  1CC4 A;  3JSK A;  4A7A A;  4YSY A;  4N9X A;  3DJJ A;  1ZK7 A;  2VRL A;  3UKH A;  4NTD A;  3NK2 X;  3CNS A;  2XLS A;  5BRT A;  2GR3 A;  1OJ9 A;  1ZX9 A;  1LQT A;  4I58 A;  1IUX A;  1ZP0 A;  3BHK A;  5KOX A;  4UDQ A;  2YM1 A;  3UOY A;  2PHH A;  3CPH G;  4Z43 A;  3GYJ A;  2R0C A;  4X9N A;  1FL2 A;  2WPC A;  2PYX A;  2WP5 A;  2C7G A;  1YQZ A;  1BKW A;  1CF3 A;  3CNJ A;  4HA6 A;  3KPF A;  3ALJ A;  4EQW A;  3AEE A;  5IQ1 A;  1XPQ A;  3FMW A;  1PXC A;  4U2L A;  2YVF A;  4BK1 A;  3GWF A;  2XYO A;  3SQP A;  1W4X A;  1GRB A;  1IUU A;  3KU9 A;  4TM0 A;  4B1B A;  1K4Q A;  4P9S A;  2BXS A;  3GSI A;  2WU2 A;  4B68 A;  4K22 A;  2GMH A;  1BGN A;  2E1M A;  2WP6 A;  4H4V A;  2BAC A;  4K5R A;  3NH3 X;  2H88 A;  1F6M A;  2JK6 A;  4J57 A;  3AE7 A;  2YG7 A;  1PDH A;  2YG6 A;  4H2P A;  3NK1 X;  1H7X A;  1NPX A;  3AD8 B;  1S2Q A;  3QSS A;  1D4C A;  3NT6 A;  4KX6 A;  3KVE A;  4XWZ A;  2B9W A;  2XCG A;  4JDR A;  3L8K A;  4U8L A;  4RSL A;  3BI5 A;  5LV9 A;  1IUT A;  1XHC A;  4A6N B;  5FS7 A;  2C76 A;  3UP5 A;  2ZZB A;  3CGC A;  4FK1 C;  2R4J A;  1GES A;  3FBS A;  2I0Z A;  1GND A;  1DXL A;  1IUW A;  1BWC A;  1N4W A;  3AEF A;  2YWL A;  4GDP A;  4YSZ A;  4BK2 A;  1FOH A;  5BVA A;  2HQM A;  4ZCD A;  1ZOY A;  3NG7 X;  4WX1 A;  3I3L A;  2Y6R A;  1SEZ A;  2Z5Y A;  3UKQ A;  2VVM A;  1PS9 A;  4Z2T A;  2WDR A;  4H4R A;  2EQ9 A;  4Z2U A;  3OC4 A;  3AEB A;  3AE6 A;  5J60 A;  1FEC A;  1LPF A;  4B66 A;  3P1W A;  4CY8 A;  2YR4 A;  5JCI A;  3BNU A;  2IID A;  4CRT A;  3NHO X;  3AE3 A;  3CGD A;  4K7Z A;  2WET A;  4YTN A;  3UOV A;  3AYI A;  2CFY A;  3F8D A;  4IA5 A;  1GRE A;  3UKF A;  4XXG A;  3OZ2 A;  2YLT A;  3RNM A;  3H8L A;  3ISH A;  1JRX A;  2H89 A;  3NLC A;  1JNR A;  1OJT A;  5BUL A;  2GR2 A;  2B76 A;  1N4U A;  2QA1 A;  3KA7 A;  4H4T A;  1K0J A;  3DA1 A;  4U8O A;  2OAM A;  4FDC B;  3DJG X;  5DBJ A;  1Y0P A;  2JB3 A;  2CDU A;  3CNT A;  2UZZ A;  3NKS A;  3QJ4 A;  1FEB A;  1K0L A;  2E5V A;  5ER0 A;  1DOE A;  1RYI A;  2WEU A;  3AYJ A;  4ICY A;  1JOA A;  4BJY A;  4TM4 A;  4C74 A;  2XFN A;  4YWO A;  4OPD A;  2XVE A;  2YLR A;  3CPI G;  1JRZ A;  2XVI A;  2WOV A;  2B9Y A;  4CCQ A;  5C2T A;  4EQR A;  2R46 A;  3KLJ A;  3P4S A;  2IVE A;  3ATQ A;  4CY6 A;  5L46 A;  1TRB A;  1E7P A; 
#chains in the Genus database with same CATH topology
 4H2Q A;  2FJA A;  3NYF A;  4J56 A;  3AD7 B;  3RP6 A;  4ADW A;  1E6E A;  3K7M X;  4H4Q A;  4ECH A;  1D5T A;  2XVJ A;  1Q1W A;  3RHA A;  4Z26 A;  1CL0 A;  1QO8 A;  2XVF A;  1VQW A;  1V59 A;  4Y4L A;  3ABV A;  1H83 A;  1NEK A;  1ZDL A;  1IUV A;  2R0G A;  3K7T A;  3GMB A;  2V6O A;  2GEW A;  1KF6 A;  1HYU A;  1NHR A;  2RAB A;  4B65 A;  1PHH A;  1TDO A;  4C77 A;  3NTA A;  3DGZ A;  4USQ A;  2W0H A;  1E39 A;  2YLZ A;  4DGK A;  4EMW A;  3NRN A;  4CCR A;  1JEH A;  3CMM A;  1RP0 A;  5FS6 A;  1PBD A;  3C4A A;  5CKU A;  4C3X A;  3ALM A;  3LJP A;  1NHS A;  1EL5 A;  1CBO A;  4AP1 A;  3GRS A;  3K7Q X;  2C66 A;  2GQF A;  3V3N A;  1M6I A;  2YLS A;  1PN0 A;  2Q7V A;  4H4U A;  3UTH A;  5CQF A;  5EOW A;  5U63 A;  4U2T A;  1UKV G;  1AOG A;  2X50 A;  4OPI A;  1ZMC A;  1NG3 A;  2V3A A;  5JCN A;  3FPZ A;  4NTE A;  1ZKQ A;  4D03 A;  2BK4 A;  2JKC A;  4H50 A;  2C65 A;  4JNQ A;  4O5U A;  2J3N A;  3UCL A;  3VR9 A;  1D7L A;  1H86 A;  1KNP A;  5HYM A;  2BS4 A;  1YQ4 A;  3M0O A;  1CHU A;  1KFY A;  2QAE A;  2WOW A;  2DKH A;  4UDR A;  2BAB A;  1LV0 A;  2C75 A;  1E1K A;  3GRT A;  4CBQ A;  2X8G A;  2XFU A;  3G5R A;  1N4V A;  3SX6 A;  2BRA A;  2R0P A;  1TDN A;  4GAV A;  3PVC A;  3DH9 A;  1DJN A;  4OCG A;  4RG4 A;  4YSH A;  5JCM A;  1NDA A;  2CUL A;  2EQ7 A;  3HYX A;  2QCU A;  1GAL A;  4YTM A;  2YLX A;  2GH5 A;  2BYB A;  2QA2 A;  2WPF A;  3EPT A;  3GD3 A;  1S2Y A;  4RG3 A;  3UTG A;  3EF6 A;  3SM8 A;  3T31 A;  4EQS A;  1QJD A;  1KSU A;  3QVP A;  2WS3 A;  1VDC A;  2XLR A;  3S5W A;  4NZH A;  4AOS A;  2TMD A;  2CVJ A;  2X8H A;  3KD9 A;  1PJ7 A;  1NEN A;  2XFO A;  1GET A;  2R45 A;  3NNE A;  4EQX A;  2BK5 A;  3RED A;  2GAH B;  2GAG B;  4A5L A;  2A87 A;  2OLO A;  2C72 A;  2FJB A;  3CTY A;  1PBF A;  3UOX A;  4NNJ A;  4DNA A;  1KNR A;  3UTE A;  2OAL A;  1GT8 A;  4BUR A;  1B37 A;  4Z44 A;  2WBA A;  3DK4 A;  3ICT A;  4J34 A;  2GR1 A;  2XDO A;  3UKP A;  2APG A;  2Q0K A;  4KPR A;  5FS9 A;  4U8N A;  2V5Z A;  1O5W A;  2YAU A;  2GB0 A;  2X3N A;  2YVJ A;  1GRF A;  2V3B A;  4H2R A;  4II2 A;  5U1O A;  3WE0 A;  1GTH A;  3LOV A;  1MXT A;  4IVO B;  4REK A;  3P4R A;  3B6D A;  1VG0 A;  1EBD A;  3COX A;  4PAB A;  1YKJ A;  2BS2 A;  2JAE A;  3S61 A;  4C3Y A;  4B67 A;  1D4D A;  2Y6Q A;  2GVC A;  1L0V A;  3AWI A;  1H6V A;  3F8R A;  2RGO A;  1JNZ A;  4U8M A;  5GSN A;  4AT0 A;  1NG4 A;  1PXA A;  4J31 A;  1CJ2 A;  3F8P A;  2C3D A;  3ZDN A;  2E4G A;  4WCT A;  3SXI A;  3VRA A;  2C70 A;  1X31 B;  2WES A;  2B9X A;  4I59 A;  3SFD A;  5IPY A;  4GUV A;  1P2E A;  1NHQ A;  1P2H A;  1D4E A;  2YQU A;  3NK0 X;  3HYW A;  1CC6 A;  1PBE A;  4K2X A;  4U8P A;  2BC1 A;  2Q0L A;  3C4N A;  1E1M A;  3II4 A;  4CNJ A;  2JB1 A;  4Z24 A;  4H4Z A;  2VVL G;  2DKI A;  1OJC A;  1TDF A;  5EB5 A;  3D1C A;  1E1L A;  3AE1 A;  2NPX A;  3SZW A;  2GF3 A;  3AYL A;  5TR3 A;  2BS3 A;  3VRD B;  1D7Y A;  2XFQ A;  3T2Y A;  5JCK A;  4JY3 A;  3VRB A;  4A99 A;  2XFP A;  1N1P A;  5EBK A;  4YT0 A;  1DNC A;  4E0V A;  1GEU A;  2AAQ A;  3IF9 A;  4G73 A;  1O94 A;  3SFE A;  1GOS A;  3VR8 A;  4A9W A;  5GRT A;  5M10 A;  1CC2 A;  1O95 A;  3NTD A;  3AEC A;  4TM1 A;  5KXJ A;  1GRG A;  1H84 A;  2NVK X;  2GV8 A;  3GMC A;  1BF3 A;  4AT2 A;  3QFB A;  4CNK A;  3GDP A;  2B7R A;  4G6G A;  3URH A;  5KRQ A;  3T14 A;  4A65 A;  2V60 A;  1OJA A;  5U25 A;  3P4Q A;  4APN A;  2R9Z A;  4J36 A;  3H4K A;  4ZN0 A;  3IHM A;  1K0I A;  4H4X A;  4GCM A;  5BUK A;  2ACZ A;  4USR A;  3DK8 A;  1RSG A;  1OJD A;  1PBC A;  4FK1 A;  1LQU A;  1CJ3 A;  1QLB A;  3SYI A;  2TPR A;  2VRM A;  3V76 A;  3O0H A;  5FS8 A;  4H4W A;  2BK3 A;  2EQ8 A;  4EMJ A;  3CIR A;  5KVH A;  3IHG A;  1YY5 A;  5J7X A;  4BJZ A;  3LB8 A;  3L1R A;  2VVL A;  4IA6 A;  2IVD A;  4LA1 A;  3NYE A;  4IV9 A;  4D04 A;  3DK9 A;  3IC9 A;  4YKG A;  1F8R A;  1S3B A;  4AP3 A;  3QSE A;  2FJE A;  4LII A;  4H7U A;  4DSH A;  4J33 A;  4B69 A;  1ZOV A;  3NN6 X;  3G5Q A;  4OPC A;  1YQ3 A;  3D8X A;  2C3C A;  2ZZC A;  1VRQ B;  3G5S A;  4YKF A;  1L9D A;  3EAO A;  3AE9 A;  3ICR A;  2GQW A;  5HXI A;  3T2Z A;  1FEA A;  3BI4 A;  2YVG A;  3P4P A;  3GWD A;  3IWA A;  1L9E A;  2BC0 A;  4OPL A;  4YXD A;  4TLX A;  1TDE A;  1XDI A;  1DOD A;  2BCG G;  2BXR A;  4X9M A;  1TYP A;  5KWF A;  1PBB A;  3FIM B;  3AEA A;  3ATR A;  2OA1 A;  4Z25 A;  1JU2 A;  2GRT A;  3KPK A;  3Q9T A;  3V3O A;  2VZ2 A;  3DME A;  1NAA A;  1ZMD A;  2EQ6 A;  2XLP A;  1DJQ A;  4U8K A;  3ITJ A;  3AE5 A;  2R4E A;  4BV6 A;  4U2S A;  2YG3 A;  1H7W A;  3QFA A;  4U8I A;  4II3 A;  4YTP A;  2RGH A;  1F8W A;  2C4C A;  1NHP A;  3LZW A;  1GER A;  3CPJ G;  4YSX A;  2C67 A;  5KVI A;  4JNA A;  3PS9 A;  2JBV A;  4G9K A;  3LXD A;  5HY5 A;  3DGH A;  3DJE A;  2X8C A;  4G6H A;  4EIQ A;  3M12 A;  3UTF A;  1Y56 B;  4A6N A;  3SZ0 A;  1EL9 A;  1CJC A;  4G74 A;  4H4Y A;  4TLZ A;  3AED A;  5EB4 A;  3SZC A;  4B64 A;  3AE8 A;  1GXF A;  4Y4M A;  4K5S A;  2YLW A;  1GRH A;  4EM4 A;  4NEV A;  3RP7 A;  2XVH A;  2YR6 A;  1B4V A;  2C73 A;  1PJ6 A;  3GYI A;  1DOB A;  2YG5 A;  1JRY A;  3KKJ A;  4JQ9 A;  4PAA A;  2GMJ A;  3QSM A;  3R9U A;  4HB9 A;  5C3J A;  1LTX R;  1EL7 A;  2JB2 A;  3NGC X;  3P9U A;  3ADA B;  4IVM B;  5M0Z A;  5JCL A;  2A8X A;  3AE4 A;  1ELI A;  1BZL A;  1B5Q A;  3NN0 X;  1DOC A;  1M64 A;  4ZCC A;  3UP4 A;  2YG4 A;  2VOU A;  2YM2 A;  1GRT A;  2AQJ A;  1REO A;  2C64 A;  3AB1 A;  3CND A;  2FBW A;  3I6D A;  4GF7 A;  4H4S A;  4OPG A;  1TYT A;  3DJD A;  4EIP A;  4LU6 A;  1ONF A;  1PJ5 A;  3HZL A;  1GPE A;  4XWR A;  4JY2 A;  2GR0 A;  3EAN A;  1PXB A;  4DSG A;  1MO9 A;  4GDE A;  1E1N A;  4C5O A;  2YR5 A;  4AOX A;  1BGJ A;  3BNM A;  2WQY A;  1LVL A;  1F3P A;  1L9C A;  2Q6U A;  3E1T A;  5IQ4 A;  4H4P A;  3ICS A;  1TDK A;  2WP9 A;  5KMS A;  5FMH A;  4JN9 A;  2FJD A;  3GD4 A;  3H8I A;  2B7S A;  3CGB A;  3PO7 A;  3FG2 P;  1ZY8 A;  2WDV A;  4TM3 A;  3UKA A;  4Z2R A;  3UOZ A;  2X99 A;  1GRA A;  4UP3 A;  4OPU A;  1F8S A;  3LZX A;  4M52 A;  1H81 A;  3SGL A;  4A79 A;  4U8J A;  1GV4 A;  3C96 A;  3B3R A;  3LAD A;  4GR1 A;  4H2N A;  2O9Z A;  1S3E A;  2RGJ A;  4O5Q A;  1KSS A;  2Z5X A;  3NIX A;  4B63 A;  2OLN A;  3BI2 A;  1FCD A;  2F5Z A;  1Q1R A;  2VQ7 A;  3ZYX A;  1KDG A;  3GDN A;  2AR8 A;  3K30 A;  3Q6J A;  1CJ4 A;  3SY4 A;  1EL8 A;  4BK3 A;  4K8D A;  3QVR A;  4FX9 A;  4OPT A;  3CN8 A;  1COY A;  4GRT A;  1MOK A;  1Y56 A;  2BA9 A;  3AXB A;  2A89 A;  2WHD A;  4Y4N A;  4NEW A;  3UKK A;  3UKL A;  3NYC A;  3BHF A;  1Q9I A;  2WPE A;  4OVI A;  2ZBW A;  4NWZ A;  3HYV A;  3VQR A;  4GAP A;  1IJH A;  3AEG A;  5KOW A;  1VG9 A;  3RP8 A;  4MJW A;  2VQB A;  1GSN A;  1IUS A;  2ARD A;  2WDQ A;  3AE2 A;  1XAN A;  1B8S A;  4J2W A;  4X4J A;  3ALL A;  4NTC A;  4UDP A;  5HHF A;  1H82 A;  3AD9 B;  4EMI A;  2BCP A;  2XLT A;  3M13 A;  2XLU A;  3CGE A;  3T37 A;  3CNP A;  4EM3 A;  2ZZ0 A;  2WOI A;  2WU5 A;  1GTE A;  2V61 A;  1Z6L A;  1LJ1 A;  1CC4 A;  3JSK A;  4A7A A;  4YSY A;  4N9X A;  3DJJ A;  1ZK7 A;  2VRL A;  3UKH A;  4NTD A;  3NK2 X;  3CNS A;  2XLS A;  5BRT A;  2GR3 A;  1OJ9 A;  1ZX9 A;  1LQT A;  4I58 A;  1IUX A;  1ZP0 A;  3BHK A;  5KOX A;  4UDQ A;  2YM1 A;  3UOY A;  2PHH A;  3CPH G;  4Z43 A;  3GYJ A;  2R0C A;  4X9N A;  1FL2 A;  2WPC A;  2PYX A;  2WP5 A;  2C7G A;  1YQZ A;  1BKW A;  1CF3 A;  3CNJ A;  4HA6 A;  3KPF A;  3ALJ A;  3GYX A;  4EQW A;  3AEE A;  5IQ1 A;  1XPQ A;  3FMW A;  1PXC A;  4U2L A;  2YVF A;  4BK1 A;  3GWF A;  2XYO A;  3SQP A;  1W4X A;  1GRB A;  1IUU A;  3KU9 A;  4TM0 A;  4B1B A;  1K4Q A;  4P9S A;  2BXS A;  3GSI A;  2WU2 A;  4B68 A;  4K22 A;  2GMH A;  1BGN A;  2E1M A;  2WP6 A;  4H4V A;  2BAC A;  4K5R A;  5KNL A;  3NH3 X;  2H88 A;  1F6M A;  2JK6 A;  4J57 A;  3AE7 A;  2YG7 A;  1PDH A;  2YG6 A;  4H2P A;  3NK1 X;  1H7X A;  5KMP A;  1NPX A;  3AD8 B;  1S2Q A;  3QSS A;  1D4C A;  3NT6 A;  4KX6 A;  3KVE A;  4XWZ A;  2BRY A;  2B9W A;  2XCG A;  4JDR A;  3L8K A;  5KMQ A;  4U8L A;  4RSL A;  3T2K A;  3BI5 A;  5LV9 A;  1IUT A;  1XHC A;  4A6N B;  5FS7 A;  2C76 A;  3UP5 A;  2ZZB A;  3CGC A;  4FK1 C;  2R4J A;  1GES A;  3FBS A;  2I0Z A;  1GND A;  1DXL A;  1IUW A;  1BWC A;  1N4W A;  3AEF A;  2YWL A;  4GDP A;  4YSZ A;  4BK2 A;  1FOH A;  5BVA A;  2HQM A;  4ZCD A;  1ZOY A;  3NG7 X;  4WX1 A;  3I3L A;  2Y6R A;  1SEZ A;  2Z5Y A;  3UKQ A;  2VVM A;  1PS9 A;  4Z2T A;  2WDR A;  4H4R A;  2EQ9 A;  4Z2U A;  3OC4 A;  3AEB A;  3AE6 A;  5J60 A;  1FEC A;  1LPF A;  4B66 A;  3P1W A;  4CY8 A;  2YR4 A;  5JCI A;  3BNU A;  2IID A;  4CRT A;  3NHO X;  3AE3 A;  3CGD A;  4K7Z A;  2WET A;  4YTN A;  3UOV A;  5KMR A;  3AYI A;  2CFY A;  3F8D A;  4IA5 A;  1GRE A;  3UKF A;  4XXG A;  3OZ2 A;  2YLT A;  3RNM A;  3H8L A;  3ISH A;  1JRX A;  2H89 A;  3NLC A;  1JNR A;  1OJT A;  5BUL A;  2GR2 A;  2B76 A;  1N4U A;  2QA1 A;  3KA7 A;  4H4T A;  1K0J A;  3DA1 A;  4U8O A;  2OAM A;  4FDC B;  3DJG X;  5DBJ A;  1Y0P A;  2JB3 A;  2CDU A;  3CNT A;  2UZZ A;  3NKS A;  3QJ4 A;  3SZF A;  1FEB A;  1K0L A;  2E5V A;  5ER0 A;  1DOE A;  1RYI A;  2WEU A;  3AYJ A;  4ICY A;  1JOA A;  4BJY A;  4TM4 A;  4C74 A;  2XFN A;  4YWO A;  4OPD A;  2XVE A;  2YLR A;  3CPI G;  1JRZ A;  2XVI A;  2WOV A;  3T0K A;  2B9Y A;  4CCQ A;  5C2T A;  4EQR A;  2R46 A;  3KLJ A;  3P4S A;  2IVE A;  3ATQ A;  4CY6 A;  5L46 A;  1TRB A;  1E7P A; 
#chains in the Genus database with same CATH homology
 4H2Q A;  2FJA A;  3NYF A;  4J56 A;  3AD7 B;  3RP6 A;  4ADW A;  1E6E A;  3K7M X;  4H4Q A;  4ECH A;  1D5T A;  2XVJ A;  1Q1W A;  3RHA A;  4Z26 A;  1CL0 A;  1QO8 A;  2XVF A;  1VQW A;  1V59 A;  4Y4L A;  3ABV A;  1H83 A;  1NEK A;  1ZDL A;  1IUV A;  2R0G A;  3K7T A;  3GMB A;  2V6O A;  2GEW A;  1KF6 A;  1HYU A;  1NHR A;  2RAB A;  4B65 A;  1PHH A;  1TDO A;  4C77 A;  3NTA A;  3DGZ A;  4USQ A;  2W0H A;  1E39 A;  2YLZ A;  4DGK A;  4EMW A;  3NRN A;  4CCR A;  1JEH A;  3CMM A;  1RP0 A;  5FS6 A;  1PBD A;  3C4A A;  5CKU A;  4C3X A;  3ALM A;  3LJP A;  1NHS A;  1EL5 A;  1CBO A;  4AP1 A;  3GRS A;  3K7Q X;  2C66 A;  2GQF A;  3V3N A;  1M6I A;  2YLS A;  1PN0 A;  2Q7V A;  4H4U A;  3UTH A;  5CQF A;  5EOW A;  5U63 A;  4U2T A;  1UKV G;  1AOG A;  2X50 A;  4OPI A;  1ZMC A;  1NG3 A;  2V3A A;  5JCN A;  3FPZ A;  4NTE A;  1ZKQ A;  4D03 A;  2BK4 A;  2JKC A;  4H50 A;  2C65 A;  4JNQ A;  4O5U A;  2J3N A;  3UCL A;  3VR9 A;  1D7L A;  1H86 A;  1KNP A;  5HYM A;  2BS4 A;  1YQ4 A;  3M0O A;  1CHU A;  1KFY A;  2QAE A;  2WOW A;  2DKH A;  4UDR A;  2BAB A;  1LV0 A;  2C75 A;  1E1K A;  3GRT A;  4CBQ A;  2X8G A;  2XFU A;  3G5R A;  1N4V A;  3SX6 A;  2BRA A;  2R0P A;  1TDN A;  4GAV A;  3PVC A;  3DH9 A;  1DJN A;  4OCG A;  4RG4 A;  4YSH A;  5JCM A;  1NDA A;  2CUL A;  2EQ7 A;  3HYX A;  2QCU A;  1GAL A;  4YTM A;  2YLX A;  2GH5 A;  2BYB A;  2QA2 A;  2WPF A;  3EPT A;  3GD3 A;  1S2Y A;  4RG3 A;  3UTG A;  3EF6 A;  3SM8 A;  3T31 A;  4EQS A;  1QJD A;  1KSU A;  3QVP A;  2WS3 A;  1VDC A;  2XLR A;  3S5W A;  4NZH A;  4AOS A;  2TMD A;  2CVJ A;  2X8H A;  3KD9 A;  1PJ7 A;  1NEN A;  2XFO A;  1GET A;  2R45 A;  3NNE A;  4EQX A;  2BK5 A;  3RED A;  2GAH B;  2GAG B;  4A5L A;  2A87 A;  2OLO A;  2C72 A;  2FJB A;  3CTY A;  1PBF A;  3UOX A;  4NNJ A;  4DNA A;  1KNR A;  3UTE A;  2OAL A;  1GT8 A;  4BUR A;  1B37 A;  4Z44 A;  2WBA A;  3DK4 A;  3ICT A;  4J34 A;  2GR1 A;  2XDO A;  3UKP A;  2APG A;  2Q0K A;  4KPR A;  5FS9 A;  4U8N A;  2V5Z A;  1O5W A;  2YAU A;  2GB0 A;  2X3N A;  2YVJ A;  1GRF A;  2V3B A;  4H2R A;  4II2 A;  5U1O A;  3WE0 A;  1GTH A;  3LOV A;  1MXT A;  4IVO B;  4REK A;  3P4R A;  3B6D A;  1VG0 A;  1EBD A;  3COX A;  4PAB A;  1YKJ A;  2BS2 A;  2JAE A;  3S61 A;  4C3Y A;  4B67 A;  1D4D A;  2Y6Q A;  2GVC A;  1L0V A;  3AWI A;  1H6V A;  3F8R A;  2RGO A;  1JNZ A;  4U8M A;  5GSN A;  4AT0 A;  1NG4 A;  1PXA A;  4J31 A;  1CJ2 A;  3F8P A;  2C3D A;  3ZDN A;  2E4G A;  4WCT A;  3SXI A;  3VRA A;  2C70 A;  1X31 B;  2WES A;  2B9X A;  4I59 A;  3SFD A;  5IPY A;  4GUV A;  1P2E A;  1NHQ A;  1P2H A;  1D4E A;  2YQU A;  3NK0 X;  3HYW A;  1CC6 A;  1PBE A;  4K2X A;  4U8P A;  2BC1 A;  2Q0L A;  3C4N A;  1E1M A;  3II4 A;  4CNJ A;  2JB1 A;  4Z24 A;  4H4Z A;  2VVL G;  2DKI A;  1OJC A;  1TDF A;  5EB5 A;  3D1C A;  1E1L A;  3AE1 A;  2NPX A;  3SZW A;  2GF3 A;  3AYL A;  5TR3 A;  2BS3 A;  3VRD B;  1D7Y A;  2XFQ A;  3T2Y A;  5JCK A;  4JY3 A;  3VRB A;  4A99 A;  2XFP A;  1N1P A;  5EBK A;  4YT0 A;  1DNC A;  4E0V A;  1GEU A;  2AAQ A;  3IF9 A;  4G73 A;  1O94 A;  3SFE A;  1GOS A;  3VR8 A;  4A9W A;  5GRT A;  5M10 A;  1CC2 A;  1O95 A;  3NTD A;  3AEC A;  4TM1 A;  5KXJ A;  1GRG A;  1H84 A;  2NVK X;  2GV8 A;  3GMC A;  1BF3 A;  4AT2 A;  3QFB A;  4CNK A;  3GDP A;  2B7R A;  4G6G A;  3URH A;  5KRQ A;  3T14 A;  4A65 A;  2V60 A;  1OJA A;  5U25 A;  3P4Q A;  4APN A;  2R9Z A;  4J36 A;  3H4K A;  4ZN0 A;  3IHM A;  1K0I A;  4H4X A;  4GCM A;  5BUK A;  2ACZ A;  4USR A;  3DK8 A;  1RSG A;  1OJD A;  1PBC A;  4FK1 A;  1LQU A;  1CJ3 A;  1QLB A;  3SYI A;  2TPR A;  2VRM A;  3V76 A;  3O0H A;  5FS8 A;  4H4W A;  2BK3 A;  2EQ8 A;  4EMJ A;  3CIR A;  5KVH A;  3IHG A;  1YY5 A;  5J7X A;  4BJZ A;  3LB8 A;  3L1R A;  2VVL A;  4IA6 A;  2IVD A;  4LA1 A;  3NYE A;  4IV9 A;  4D04 A;  3DK9 A;  3IC9 A;  4YKG A;  1F8R A;  1S3B A;  4AP3 A;  3QSE A;  2FJE A;  4LII A;  4H7U A;  4DSH A;  4J33 A;  4B69 A;  1ZOV A;  3NN6 X;  3G5Q A;  4OPC A;  1YQ3 A;  3D8X A;  2C3C A;  2ZZC A;  1VRQ B;  3G5S A;  4YKF A;  1L9D A;  3EAO A;  3AE9 A;  3ICR A;  2GQW A;  5HXI A;  3T2Z A;  1FEA A;  3BI4 A;  2YVG A;  3P4P A;  3GWD A;  3IWA A;  1L9E A;  2BC0 A;  4OPL A;  4YXD A;  4TLX A;  1TDE A;  1XDI A;  1DOD A;  2BCG G;  2BXR A;  4X9M A;  1TYP A;  5KWF A;  1PBB A;  3FIM B;  3AEA A;  3ATR A;  2OA1 A;  4Z25 A;  1JU2 A;  2GRT A;  3KPK A;  3Q9T A;  3V3O A;  2VZ2 A;  3DME A;  1NAA A;  1ZMD A;  2EQ6 A;  2XLP A;  1DJQ A;  4U8K A;  3ITJ A;  3AE5 A;  2R4E A;  4BV6 A;  4U2S A;  2YG3 A;  1H7W A;  3QFA A;  4U8I A;  4II3 A;  4YTP A;  2RGH A;  1F8W A;  2C4C A;  1NHP A;  3LZW A;  1GER A;  3CPJ G;  4YSX A;  2C67 A;  5KVI A;  4JNA A;  3PS9 A;  2JBV A;  4G9K A;  3LXD A;  5HY5 A;  3DGH A;  3DJE A;  2X8C A;  4G6H A;  4EIQ A;  3M12 A;  3UTF A;  1Y56 B;  4A6N A;  3SZ0 A;  1EL9 A;  1CJC A;  4G74 A;  4H4Y A;  4TLZ A;  3AED A;  5EB4 A;  3SZC A;  4B64 A;  3AE8 A;  1GXF A;  4Y4M A;  4K5S A;  2YLW A;  1GRH A;  4EM4 A;  4NEV A;  3RP7 A;  2XVH A;  2YR6 A;  1B4V A;  2C73 A;  1PJ6 A;  3GYI A;  1DOB A;  2YG5 A;  1JRY A;  3KKJ A;  4JQ9 A;  4PAA A;  2GMJ A;  3QSM A;  3R9U A;  4HB9 A;  5C3J A;  1LTX R;  1EL7 A;  2JB2 A;  3NGC X;  3P9U A;  3ADA B;  4IVM B;  5M0Z A;  5JCL A;  2A8X A;  3AE4 A;  1ELI A;  1BZL A;  1B5Q A;  3NN0 X;  1DOC A;  1M64 A;  4ZCC A;  3UP4 A;  2YG4 A;  2VOU A;  2YM2 A;  1GRT A;  2AQJ A;  1REO A;  2C64 A;  3AB1 A;  3CND A;  2FBW A;  3I6D A;  4GF7 A;  4H4S A;  4OPG A;  1TYT A;  3DJD A;  4EIP A;  4LU6 A;  1ONF A;  1PJ5 A;  3HZL A;  1GPE A;  4XWR A;  4JY2 A;  2GR0 A;  3EAN A;  1PXB A;  4DSG A;  1MO9 A;  4GDE A;  1E1N A;  4C5O A;  2YR5 A;  4AOX A;  1BGJ A;  3BNM A;  2WQY A;  1LVL A;  1F3P A;  1L9C A;  2Q6U A;  3E1T A;  5IQ4 A;  4H4P A;  3ICS A;  1TDK A;  2WP9 A;  5KMS A;  5FMH A;  4JN9 A;  2FJD A;  3GD4 A;  3H8I A;  2B7S A;  3CGB A;  3PO7 A;  3FG2 P;  1ZY8 A;  2WDV A;  4TM3 A;  3UKA A;  4Z2R A;  3UOZ A;  2X99 A;  1GRA A;  4UP3 A;  4OPU A;  1F8S A;  3LZX A;  4M52 A;  1H81 A;  3SGL A;  4A79 A;  4U8J A;  1GV4 A;  3C96 A;  3B3R A;  3LAD A;  4GR1 A;  4H2N A;  2O9Z A;  1S3E A;  2RGJ A;  4O5Q A;  1KSS A;  2Z5X A;  3NIX A;  4B63 A;  2OLN A;  3BI2 A;  1FCD A;  2F5Z A;  1Q1R A;  2VQ7 A;  3ZYX A;  1KDG A;  3GDN A;  2AR8 A;  3K30 A;  3Q6J A;  1CJ4 A;  3SY4 A;  1EL8 A;  4BK3 A;  4K8D A;  3QVR A;  4FX9 A;  4OPT A;  3CN8 A;  1COY A;  4GRT A;  1MOK A;  1Y56 A;  2BA9 A;  3AXB A;  2A89 A;  2WHD A;  4Y4N A;  4NEW A;  3UKK A;  3UKL A;  3NYC A;  3BHF A;  1Q9I A;  2WPE A;  4OVI A;  2ZBW A;  4NWZ A;  3HYV A;  3VQR A;  4GAP A;  1IJH A;  3AEG A;  5KOW A;  1VG9 A;  3RP8 A;  4MJW A;  2VQB A;  1GSN A;  1IUS A;  2ARD A;  2WDQ A;  3AE2 A;  1XAN A;  1B8S A;  4J2W A;  4X4J A;  3ALL A;  4NTC A;  4UDP A;  5HHF A;  1H82 A;  3AD9 B;  4EMI A;  2BCP A;  2XLT A;  3M13 A;  2XLU A;  3CGE A;  3T37 A;  3CNP A;  4EM3 A;  2ZZ0 A;  2WOI A;  2WU5 A;  1GTE A;  2V61 A;  1Z6L A;  1LJ1 A;  1CC4 A;  3JSK A;  4A7A A;  4YSY A;  4N9X A;  3DJJ A;  1ZK7 A;  2VRL A;  3UKH A;  4NTD A;  3NK2 X;  3CNS A;  2XLS A;  5BRT A;  2GR3 A;  1OJ9 A;  1ZX9 A;  1LQT A;  4I58 A;  1IUX A;  1ZP0 A;  3BHK A;  5KOX A;  4UDQ A;  2YM1 A;  3UOY A;  2PHH A;  3CPH G;  4Z43 A;  3GYJ A;  2R0C A;  4X9N A;  1FL2 A;  2WPC A;  2PYX A;  2WP5 A;  2C7G A;  1YQZ A;  1BKW A;  1CF3 A;  3CNJ A;  4HA6 A;  3KPF A;  3ALJ A;  3GYX A;  4EQW A;  3AEE A;  5IQ1 A;  1XPQ A;  3FMW A;  1PXC A;  4U2L A;  2YVF A;  4BK1 A;  3GWF A;  2XYO A;  3SQP A;  1W4X A;  1GRB A;  1IUU A;  3KU9 A;  4TM0 A;  4B1B A;  1K4Q A;  4P9S A;  2BXS A;  3GSI A;  2WU2 A;  4B68 A;  4K22 A;  2GMH A;  1BGN A;  2E1M A;  2WP6 A;  4H4V A;  2BAC A;  4K5R A;  5KNL A;  3NH3 X;  2H88 A;  1F6M A;  2JK6 A;  4J57 A;  3AE7 A;  2YG7 A;  1PDH A;  2YG6 A;  4H2P A;  3NK1 X;  1H7X A;  5KMP A;  1NPX A;  3AD8 B;  1S2Q A;  3QSS A;  1D4C A;  3NT6 A;  4KX6 A;  3KVE A;  4XWZ A;  2BRY A;  2B9W A;  2XCG A;  4JDR A;  3L8K A;  5KMQ A;  4U8L A;  4RSL A;  3T2K A;  3BI5 A;  5LV9 A;  1IUT A;  1XHC A;  4A6N B;  5FS7 A;  2C76 A;  3UP5 A;  2ZZB A;  3CGC A;  4FK1 C;  2R4J A;  1GES A;  3FBS A;  2I0Z A;  1GND A;  1DXL A;  1IUW A;  1BWC A;  1N4W A;  3AEF A;  2YWL A;  4GDP A;  4YSZ A;  4BK2 A;  1FOH A;  5BVA A;  2HQM A;  4ZCD A;  1ZOY A;  3NG7 X;  4WX1 A;  3I3L A;  2Y6R A;  1SEZ A;  2Z5Y A;  3UKQ A;  2VVM A;  1PS9 A;  4Z2T A;  2WDR A;  4H4R A;  2EQ9 A;  4Z2U A;  3OC4 A;  3AEB A;  3AE6 A;  5J60 A;  1FEC A;  1LPF A;  4B66 A;  3P1W A;  4CY8 A;  2YR4 A;  5JCI A;  3BNU A;  2IID A;  4CRT A;  3NHO X;  3AE3 A;  3CGD A;  4K7Z A;  2WET A;  4YTN A;  3UOV A;  5KMR A;  3AYI A;  2CFY A;  3F8D A;  4IA5 A;  1GRE A;  3UKF A;  4XXG A;  3OZ2 A;  2YLT A;  3RNM A;  3H8L A;  3ISH A;  1JRX A;  2H89 A;  3NLC A;  1JNR A;  1OJT A;  5BUL A;  2GR2 A;  2B76 A;  1N4U A;  2QA1 A;  3KA7 A;  4H4T A;  1K0J A;  3DA1 A;  4U8O A;  2OAM A;  4FDC B;  3DJG X;  5DBJ A;  1Y0P A;  2JB3 A;  2CDU A;  3CNT A;  2UZZ A;  3NKS A;  3QJ4 A;  3SZF A;  1FEB A;  1K0L A;  2E5V A;  5ER0 A;  1DOE A;  1RYI A;  2WEU A;  3AYJ A;  4ICY A;  1JOA A;  4BJY A;  4TM4 A;  4C74 A;  2XFN A;  4YWO A;  4OPD A;  2XVE A;  2YLR A;  3CPI G;  1JRZ A;  2XVI A;  2WOV A;  3T0K A;  2B9Y A;  4CCQ A;  5C2T A;  4EQR A;  2R46 A;  3KLJ A;  3P4S A;  2IVE A;  3ATQ A;  4CY6 A;  5L46 A;  1TRB A;  1E7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...