3D9KA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
137
structure length
137
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 57
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9kA00
3LDZA 5CMYA 3D9MA 1HG2A 2V8SE 1JPLA 3ONLA 3ONKA 1EDUA 2LO6A 3D9NA 4GZCA 1H0AA 3ZYLA 1HG5A 1EYHA 1HX8A 3G2TA 1PY1A 3D9IA 3G2VA 4FLBA 1JUQA 2BF0X 1MHQA 3D9JA 3D9OA 3G2WA 4GZDA 4JXTA 4NACA 2L0IA 2L0TB 3D9LA 1SZAA 3ZYQA 1INZA 4AVXA 3ZYMA 2KM4A 1HF8A 1LF8A 3D9KA 4HFGA 3ZYKA 2DIWA 3RRUA 2QY7A 1JWFA 1SZ9A 1HFAA 2MOWA 3G2UA 1DVPA 1UJKA 3G2SA 5LOZA 4FU3A 4Q96A 3CLJA 1JWGA 1XGWA 1VDYA 5CMWA 3D9PA 4Q94A 1UJJA 2DCPA 1ELKA 1X5BA 5J08A 5LP0A
chains in the Genus database with same CATH superfamily
3JQ1A 3OXGA 3Q7FA 4L2LA 4TV3A 3FU0A 4GU5A 2H6IA 3EHQA 2WXIA 3L82A 5D66A 4UUCA 3QKYA 2J4DA 3RRUA 4UI9J 5G04C 1DVPA 2NC9A 1N0RA 3GZ1A 2I6HA 4E6HA 5BPPA 3APDA 2B0OE 4N5QA 3FUMA 3HG0D 3D3MA 4MS6A 3ZYLA 2EINE 4NIKA 3NOGD 3SO8A 4GA0A 3L54A 2AWIA 3AU4A 5ENPD 3AJIA 4GPMA 4XKCA 3TAXA 3MKRA 2M63A 2R5SA 2BEDA 2R17C 3QOUA 3J5PA 3EDTB 4HORA 4BFRA 1IQRA 3TXMA 3DXKG 2NYJA 4GTVA 5B1AE 2VSNA 5AARA 4HI8A 2DCPA 4V3IA 4CGWA 3Q4AB 3FUIA 3UM1A 2WXMA 4GMLA 2LAIA 4WUYA 3HVEA 2RFAA 1UG3A 3U9WA 2VYIA 3TG4A 4RG9A 4Z68A 3FTYA 1ELRA 3Q7AA 4XKBA 3Q5MA 2L0TB 3DPYA 3Q73A 1E96B 3T8KA 1HS6A 1FVHA 1AWCB 4J7WA 4L2YA 4X8QA 5FZQA 3NB2A 4GCNA 4Y6CA 3UPVA 2OVFA 5M72A 2UWJG 3PUKA 4I1OB 2KBXA 1N52A 1Z3XA 3FULA 2XCBA 3IXEA 5ITZF 4HRMB 3FUHA 2LNIA 3FTSA 4APOA 4RLYA 3UKRG 3TWVA 3SBTB 1YCSB 1U3CA 1N94A 2XGOA 3MA5A 3CSTA 3LVRE 2ETBA 1U3DA 4FA6A 3Q79A 3G2SA 5AQ7A 5LCWC 2XQ0A 3PEVB 3LXUX 5KJMA 4CT0A 3DSXA 4JW1A 1OY3D 3S7FA 3T5VA 3FTXA 2LO6A 3JQ0A 4HOQA 5ENSD 4G26A 3SQVA 3ESKA 3RO2A 2KZTB 4RG6A 4M3OA 3DSSA 5BUZA 5C2YA 1QBQA 2HO1A 4IYPA 2A5EA 5ENOD 3HXBA 4O6FA 2FO1E 2BTDA 3CHMA 4K03A 4CYMD 5EYPF 4KZ0A 2GRRB 3IEGA 3E30A 1SA5A 2MRIA 1WG0A 1TN6A 4XI9A 4GTRA 5D0QD 3U3WA 3CHSA 5B3SE 3RK6A 5CEDB 3JXIA 4PS8A 3HXEA 4YDEA 2KCVA 3NZSA 5KJNA 3KD7A 5CRUA 2V0PA 3BQOA 1E90A 4N3CA 3KS2A 5KNGA 1NP7A 3L6AA 4DI4A 3UTMA 4ANXA 4DRXE 3SD5A 2XZTG 3LPZA 1OWNA 4WNFA 3PDNA 3TWQA 3D9KA 3ABLE 5KWDA 4K5BA 5EILA 1XGWA 4B8CB 1B89A 3MEKA 1PC2A 3E37A 3LJ3A 2ZU6B 4J8SA 4GTTA 2GRNB 3R9AB 2Y1LE 3CHRA 2IO3C 3C72A 2P9LG 3CGHA 3I4RB 4C48B 2OEWA 3SBSA 2Y4TA 3U4TA 2DVWA 4J0UA 3Q15A 1E7VA 2AVPA 2EQXA 3RKVA 4OAVB 2X6HA 4G11A 4XEIG 3CKBA 4BT8A 3AAAC 3PVLA 4GZ6A 4GZ5A 2EIJE 1HO8A 3ONKA 4MLPA 4FP7A 2QYUA 5BW8C 1H2UA 1FPPA 1OUVA 3DXMG 5JJ6A 4U96D 4GMJA 3ASOE 3BU8A 2IU1A 1BD8A 2CFUA 4IULA 1Q2ZA 3ZRHA 4KT6B 4F1PA 3FU3A 2IF4A 3Q75A 3CEQA 1FT2A 3QWVA 2PM6A 2AJAA 4U8YD 2BF0X 4LNUD 4BSZB 1SZAA 2P9NG 5JJ7A 2A5UA 1SZ9A 3GZSA 3SY2A 5KCMA 5CCLA 2QFCA 4I1MA 3S2AA 4U07A 1BU9A 2GRMA 3APCA 5B1BE 4C0MA 2P58C 2BKKB 4HB5A 3SGHA 3I4GA 1N0QA 2WXNA 5EIDA 1S63A 1IKND 5CECB 1O1SA 3FH8A 3JYSA 4GYWA 4CDMA 2GRQB 3X2QE 1UN8A 2VSYA 4QQIA 2DBAA 3G2TA 4JXTA 2QC9A 5HI7A 1O1TA 2DWZA 1WDYA 1KPSB 1HZ4A 3HDXA 1V55E 3TWWA 3FHEA 3SFXA 4RSYA 3PZ1A 3EJNA 4Y6WA 3RJVA 3RRNB 2ONDA 3E4BA 3D9NA 2J8SD 2X3MA 2WQ7A 2PQNA 2V4LA 2VSXE 4DX1A 5JHAA 3VTYA 1N4RA 4JD2G 2EILE 5BT1A 4KBQA 4PS7A 3ZKJA 2UY1B 2LXMA 5D2MC 3MYVA 3ZU7B 4JVSA 4HLEA 1EDUA 3PS6A 3I3NA 3CVUA 4J8DA 3HRAA 3EUVA 3UM3A 1S0PA 3PZ2A 2WMOA 3QARA 4FU3A 4O1PA 4AY6A 2VGYA 2RKKA 4I2WA 4JC8A 3UM0A 3PH0C 5G2NA 4CRWA 3D9IA 4LRZA 2GGFA 2X6FA 2WXOA 3NQPA 2YHEA 4JB8P 4U0SA 1WY6A 5AAOA 3CR3A 4I6EA 4C0EA 4GAAA 2V5QC 1ELWA 2R02A 1OCRE 4GA1A 3ULQA 3FUNA 2XRYA 4PH4B 2C0MA 3AU5A 3CIAA 3E32A 4RQIA 3ENEA 2XRZA 2WXJA 4GCOA 2PM7A 1UN9A 3BUAA 4GTPA 1UW4B 4UQYA 4DX6D 4J6IA 4A63B 1E8ZA 4JA7A 3ZEFA 4BX8A 4GYOA 2P9IG 3FTVA 3D9OA 4NACA 4J8YA 4YDYA 3CVXA 4LERA 3ML8A 3D9HA 3CQCB 4DJAA 4FADA 2L6BA 4F3VA 5FQ8A 5T4YA 4FJZA 1UJJA 1TJFA 4AXHA 4MKTA 5G05J 1HG5A 4DX7D 1TN8A 3CQGB 2WPVA 4HBDA 1TNZA 3KSLA 4OVUA 1D9SA 2MOWA 3G2UA 4IRUA 4L23A 4QFVA 4PDXA 1Y8MA 3NBNB 4MRUA 3PZDA 3LCAA 5KNHD 2MYOA 3V2OA 3ESLA 1E8WA 4K0RA 3FUFA 3GZ2A 3LVQE 4DPRA 1KZOA 3MV2B 4AIFA 1HE8A 2RG8A 4EHMA 2H6FA 4CGVA 5FIOA 5EN5D 4URKA 2Y0BG 3T8MA 4G2VA 2J9QA 3TWRA 4WNDA 4I17A 5DIZA 2QZAA 1DNPA 4AEZC 1LD8A 3FUEA 4U0ZA 5ANLA 3SFZA 3PZ4A 1P5QA 5AN8A 2I2OA 1OWMA 2V4HC 2YHCA 4HOTA 3FEXA 3MGBA 5AQ9A 4AVXA 2KM4A 3HHMA 2DIWA 4WWOA 4IN3B 2WXKA 4U8HA 3BG1B 2Y3AA 3LDZA 3HVEB 4YDOA 3G2VA 1OT8A 5EKQD 3GYZA 2CHWA 3FUDA 5FTPA 4ACKA 4AJWA 4GTSA 1Y6IA 2GRPB 2XEEA 3LY9A 4ME2A 4HS2A 2GW1A 2R03A 2VJ8A 3FU6A 4UI9C 5EYLA 3CHOA 3NAWA 4B93B 4A3TA 2AW6A 2GRLA 2IEJA 1AP7A 1L5JA 3W9FA 4JHKA 4JZYA 3ONLA 4XE0A 1RZ4A 3UT4A 3IV0A 1JCRA 1BI7B 4TXRA 2VGXB 4CDRA 3Q47B 4BY6A 5ARFA 1E8YA 2VTBB 4LG6A 3VLDA 3ZHEA 3FUKA 5EX0A 3UX4A 4BX9A 3PREA 1LD7A 3B13A 2KCLA 2B6CA 4EECA 3B7TA 5A23A 3FH5A 4EZJA 3ZNGA 1N11A 2KXPC 5H7PA 4ANUA 4ZFHA 2J08A 2V8SE 3ASDA 3CHPA 5CEAA 3L17A 2DZOA 3ASFA 1H2VC 4B94A 3GW4A 4DX5D 3CVNA 3EU5A 3MJWA 2IOSA 4NQ0A 3P2BA 5CCMA 1DCEA 3S7BA 4YNDA 1N4QA 4I2ZA 1WM5A 3ASGA 3T5XA 3TWTA 3B7BA 3VTXA 1IHBA 5FWQA 1A5EA 3QDNA 4ILGA 2X38A 1TN7A 2DYSE 3QAQA 4UWKA 5CBNA 3EHMA 2ZGGA 5CBOA 4BWRA 1NL4A 3AG1E 2HM8A 1MX6A 3ZIMA 2HE0A 2L9BA 1IYGA 4XI0A 1SQMA 4A1GA 1IXVA 3R7QA 5LCWJ 3UMVA 1N95A 3E33A 1NA3A 5JA4D 3L08A 3PNTB 1NZNA 2CHXA 3RRMB 5T8IA 2PL2A 3OAWA 3HYMB 4GTOA 3ULYA 1OWLA 2WXLA 3KAEA 4GTQA 2YNQA 3ABKE 3L9TA 3DSWA 2KCKA 4B8AA 2XEHA 4GTMA 4HLLA 1MYOA 1H2TC 2XENA 2H6GA 3C98A 3CVYA 1QZ2A 1DCQA 3SHFA 1IHGA 3EIQC 1W3BA 4KYOB 2R2LA 4LCTA 2I1JA 1E7UA 2P9PG 1MX4A 1NFIE 3PUJA 3ZFWA 2XPZA 5IY5E 3AG2E 3JCKC 1BLXB 5JMND 3CLJA 2A4ZA 3AG3E 3UINC 4BTAA 3JXJA 2J07A 2KATA 2XPYA 4N3AA 3HXDA 4FC8A 4L9PA 4GZDA 1NA0A 4WWNA 2F8XK 4N3BA 4FHJA 1HF8A 1LF8A 4WNEA 4C9BB 5BV0A 3AS4A 1MQSA 3QNKA 1ZU2A 5G04J 2C0LA 3PE3A 3I5PA 1E8XA 5FZSA 4F7AA 5AENA 1Z5SC 3TWUA 2XCCA 3KEAA 3TJPA 2KZTA 3AS8A 3ZUVB 1U2VG 5EX3A 4U8VD 4GZ3A 2FO7A 3RU0A 1HU3A 2JABA 3UIPC 4W9RA 2LSUA 4XIFA 3Q78A 3OTNA 4UQZA 2XGSA 1SVXA 5FQ4A 3DWLG 4DI3A 4G8KA 3D9LA 2FEZA 1A17A 5CERB 1MX2A 4KVMA 4AM9A 4ATGA 4EBAA 4H7XA 2E0IA 1TNOA 3SF4A 4G25A 4YVQC 1BI8B 1JPLA 1TNBA 4OYSA 2YINA 3MCXA 1INZA 3PRZA 3L16A 2V5FA 1ZBPA 3QWPA 4U0UA 4ATZD 1TEZA 1N54A 2WXRA 4F53A 2RD0A 1FCHA 2VQ2A 3L22A 1PAQA 5EDSA 3Q9UC 3VLFA 3LY8A 4APFA 5KBAA 4EQFA 1JCSA 3IKOB 3BG0B 3TWSA 4G23A 2F8YA 3C3RA 2OOEA 3B7SA 1TNYA 3CK8A 1YA0A 1Z3YA 5E75A 1YYHA 1FT1A 5KJKA 4KVOA 2BKGA 2H6HA 3IHVA 4UI9K 4TUUA 3FTWA 4DUIA 3QB2A 2UY1A 2WXPA 5G05C 3UIOC 4I1AA 3V2XA 1NI1A 4BESA 4ANWA 3ULEG 3Q49B 3CV0A 3QC1A 2FI7A 4KZCA 3QWWA 4O60A 3FH7A 3UQ3A 2NSZA 3CHQA 3JUIA 5AIJA 1EYHA 2OV8A 3D9JA 3LEWA 3ZYQA 2QYJA 2R05A 3CK9A 2OCCE 3EU9A 3QK0A 4J8FA 3R9MA 5AYWD 3SNXA 5CHEE 3MV3B 4CCAA 1TNUA 2EIKE 3CK7A 1KT0A 3OXLA 3FU5A 3DSVA 3G2WA 5D0OD 2WQHA 3WG7E 3ZYMA 5E76A 4EZLA 5T3RA 1TYQG 4LSZE 1VDYA 4HXIA 5CMWA 2OEVA 4P29A 4ILHB 2PZIA 5ENTD 3D9MA 2NXPA 1N9AA 3SI5A 5ARGA 4WAFA 2BUGA 2I9CA 3ZGQA 3AS5A 4CZ2D 1EF1C 3C5RA 3NF1A 2XS1A 1HH8A 2L6JA 4JEUA 3L13A 4PS3A 5DBKA 4HQDA 4HI9A 4BT9A 1KZPA 1N4SA 5FQ7A 1HFAA 2Q7FA 4TXPA 4AY5A 2ZISA 3V31A 1KLXA 2CHZA 4GA2A 3V30A 2KC7A 2P9UG 2X6KA 5JJTA 4U7EB 4EBAG 1HG2A 3EIJA 3U64A 2VGEA 2JEKA 3NOCD 2HR2A 2XHEA 3FTZA 2WVIA 4J8EA 2ZIRA 2JLBA 5HQ8A 2QY7A 1V54E 3Q9NC 2J49A 3RO3A 4OAUC 4U63A 2AXVA 4H7YA 3O48A 3ZXPA 3DSTA 1TR4A 4Q69A 4PUCA 1X5BA 3B95A 3DSUA 5JHBA 3ABME 3UT8A 2DYRE 3CVWA 3ISMC 5FJYA 1SW6A 3NZUA 4A1SA 3ZVVA 5G55A 4DX2A 3OXFA 1K8KG 1DC2A 3PE4A 5LFAA 2J09A 3TGOA 4JPSA 2LSVA 5LX8A 3PEUB 4F1SA 3S7DA 1PY1A 4CDNA 3HXCA 3RAUA 4L7TA 2AXZA 3ZYKA 4N2SA 3UKUG 4TUMA 3ZW3A 4KMOA 2F37A 4FHKA 3EHNA 1S64A 4GPKA 3U66A 2HYZA 3B7RL 4JA9A 3S7JA 2CG3A 4G8LA 4GYYA 1UJKA 5J90A 4G1TA 3CSFA 1S70B 1OCZE 2R59A 2AXUA 2XEVA 4U04A 3W9GA 3LJNA 3HXFA 1JWFA 3TWXA 3LYAA 4HNAD 2F0YA 1GW6A 4ACLA 2YQ8A 3HIZA 4YDWA 1D8EA 5ENNA 3CVLA 2OVBA 3FP3A 1Z6TA 4UQXA 2LAHA 3J5QB 5EIBE 1XNFA 5BXUA 3TL5A 3SZ7A 4AOFA 1K3ZD 3ZPJA 3F6QA 2WMNA 3D9PA 2IJGX 2LXLA 3PNLB 1TJCA 3MZLB 3LY7A 3APFA 3FDHA 4GZCA 3MKQB 4NURA 4XX5A 2Y4UA 2IFUA 2ZGDA 2GROB 5LOZA 3C3OA 1O1RA 3BEEA 2WM9A 1MJ0A 4GMRA 4UWHA 5A6CA 3CKCA 4LEUA 3DEPA 2L0IA 1QNFA 2LUHA 3FTUA 4FULA 2IONA 3K9IA 5C1DA 5AJLA 3R7RA 2IOLA 3B7UX 5CMYA 2IY0C 3P1UA 1H6KA 3ASNE 3RIBA 4GB9A 5FINA 1HX8A 4AP2A 4JL0A 4L1BA 4BSXA 5FQ6A 3ZXSA 4ANVA 4HOSA 2WXHA 5KJLA 1QQEA 1N4PA 1WAO1 2PNNA 4N5CA 2ZXWE 1JUQA 1K1BA 4AV7A 4HFGA 4TRQA 1JWGA 1OWOA 4ILIA 2I1KA 4O1OA 3KEZA 1OCOE 1OXJA 3FEYA 4K5AB 1UOHA 4ZHBA 4BTBA 4BEPA 4I9EA 4DLOA 4R7LA 1SA4A 4WNGA 3LKUA 4RVBA 1H6PA 3RSEG 3CVQA 5AJDA 1OCCE 4EPZA 1LTXA 4Q94A 4UWGA 2MHKA 4I6JA 2ETAA 1EPUA 4TXQA 3CVVA 2CFZA 5BV1A 2PQRA 1O5MA 2IO2C 1OWPA 4D10C 2J4BA 2Y69E 4EZKA 5BNWA 4HRLA 3UT7A 2ILRA 5HS0A 5LP0A 4FJYA 3ML9A 4KXKB 3JUEA 4MBGA 4B0ZA 2DZNA 4UWLA 4BERA 1ZB1A 3KSQA 1YMPA 1MHQA 3DPDA 4DLQA 4UWFA 1H6OA 4DK5A 2VSOE 3WXXA 5ENQD 3V79K 1ELKA 5J08A 3DBSA 4HRNA 4JHRA 1JCQA 2VGXA 5FT9A 4B89A 3T9KA 4LUNU 3FUJA 4WWPA 4ABNA 4G24A 3ZHEB 5FZRA 3E34A 4JEHA 5A7DB 5ANRA 3FFLA 4I6GA 3UUXA 3DEOA 4N39A 5HKPA 4A3VA 5AQBA 4OVVA 5AQAA 1H0AA 3ASHA 2FBNA 4I43A 2WXGA 4N2QA 3UM2A 4E85A 4BETA 4K5CA 3MKQA 4CT4A 2E2EA 1QYMA 5CRVA 2X6JA 2P9SG 1HXIA 2XGMA 4M7CA 3TG5A 4NRHB 3EHRA 2ETCA 4HVBA 5BXOA 3AG4E 3TXNA 5HRYA 2CG2A 1BPOA 2XS8A 3UXGA 2XZDG 1MZCA 2P2CP 1KT1A 3IBEA 3LS8A 3FY4A 2WXFA 3PZ3A 3CVPA 3UI2A 2EIME 2WB2A 1G3NB 2C2LA 4FLBA 2FULA 2WQ6A 4LNGA 1IQUA 4I9CA 2WXQA 3IHYA 3MX3A 4CEMA 4Q96A 4FLHA 4YVOA 2IQCA 3QJZA 4U95D 3N71A 3ZN3A 4A55A 3O4ZA 3C3QA 4LNBA 2FF4A 4F6RD 3FWVA 4HOUA 2X6IA 2XPIA 1X81A 3VLEA 3URZA 2RFMA 1FVFA 4JHJA 5ENRD 1RW2A 1D8DA 4XZ4A 1K1AA 2P9KG 1H19A 3DRAA 3SFYA 2VTBA
chains in the Genus database with same CATH topology
3PE4A 4U07A 5LFAA 2X38A 2GRMA 3APCA 3JQ1A 3OXGA 3QAQA 4UWKA 2J09A 3TGOA 4JPSA 2LSVA 5LX8A 4L2LA 3EHMA 3FU0A 3PEUB 2P58C 1PY1A 4TV3A 4GU5A 3S7DA 4C0MA 4CDNA 4F1SA 2WXIA 4BWRA 3SGHA 3I4GA 3QKYA 2J4DA 2HM8A 4L7TA 2AXZA 2WXNA 3ZYKA 3RRUA 3ZIMA 4UI9J 5G04C 4N2SA 1DVPA 2NC9A 2L9BA 1IYGA 3GZ1A 2I6HA 4E6HA 3FH8A 3ZW3A 3JYSA 4XI0A 5BPPA 4KMOA 3APDA 1SQMA 4GYWA 4A1GA 3R7QA 5LCWJ 3FUMA 3D3MA 4FHKA 3UMVA 4CDMA 3EHNA 1UN8A 4MS6A 4GPKA 2VSYA 1NA3A 3U66A 3ZYLA 2DBAA 3G2TA 2HYZA 3B7RL 3L08A 3PNTB 4JXTA 4JA9A 5HI7A 1NZNA 2CHXA 3RRMB 5T8IA 2PL2A 1HZ4A 3OAWA 4GA0A 3HDXA 3L54A 3S7JA 2CG3A 3HYMB 4GYYA 1UJKA 2AWIA 5J90A 3AU4A 1OWLA 2WXLA 3FHEA 4RSYA 4G1TA 3CSFA 3EJNA 3KAEA 4Y6WA 2R59A 2YNQA 3RJVA 4XKCA 2AXUA 3RRNB 3TAXA 2ONDA 2XEVA 3E4BA 3D9NA 3MKRA 2M63A 2R5SA 2KCKA 4U04A 4B8AA 2R17C 2X3MA 2WQ7A 3QOUA 2PQNA 2V4LA 2VSXE 3EDTB 4HORA 4BFRA 1IQRA 3TXMA 1JWFA 3LYAA 1H2TC 5JHAA 3C98A 3VTYA 3CVYA 1QZ2A 2VSNA 5BT1A 4KBQA 1GW6A 2DCPA 4PS7A 4ACLA 2UY1B 4V3IA 3SHFA 2YQ8A 1IHGA 3HIZA 3MYVA 4CGWA 3Q4AB 4JVSA 4HLEA 3EIQC 1EDUA 1W3BA 5ENNA 3FUIA 3PS6A 4KYOB 3I3NA 4LCTA 3CVUA 2I1JA 4J8DA 3CVLA 2OVBA 3FP3A 1Z6TA 4UQXA 1E7UA 2LAHA 1XNFA 1S0PA 3PUJA 3ZFWA 2XPZA 3TL5A 2WMOA 2WXMA 3QARA 3JCKC 4GMLA 4FU3A 3SZ7A 4AOFA 3CLJA 2LAIA 3ZPJA 2WMNA 4WUYA 2A4ZA 3HVEA 4AY6A 3D9PA 2IJGX 3PNLB 2VGYA 4BTAA 1TJCA 1UG3A 3MZLB 4I2WA 4JC8A 3U9WA 2VYIA 2J07A 3LY7A 3APFA 3FDHA 2KATA 3PH0C 4RG9A 3TG4A 5G2NA 4GZCA 2XPYA 3FTYA 4N3AA 1ELRA 3MKQB 4XKBA 4CRWA 3D9IA 3Q5MA 4FC8A 4LRZA 4NURA 4XX5A 2Y4UA 2IFUA 4GZDA 2L0TB 1NA0A 4WWNA 2GGFA 4N3BA 4FHJA 1HF8A 1LF8A 4WNEA 4C9BB 2X6FA 2WXOA 1E96B 3NQPA 5BV0A 1HS6A 2YHEA 1MQSA 1FVHA 3AS4A 4U0SA 3QNKA 5LOZA 1WY6A 1ZU2A 5G04J 3CR3A 4I6EA 4L2YA 2C0LA 3PE3A 4C0EA 4GAAA 3I5PA 1E8XA 5FZSA 5FZQA 3BEEA 4GCNA 2WM9A 4Y6CA 4F7AA 5AENA 1ELWA 2OVFA 3UPVA 4GA1A 3ULQA 3FUNA 2XCCA 2XRYA 5M72A 2UWJG 4PH4B 2C0MA 3AU5A 4UWHA 3PUKA 4I1OB 3TJPA 5A6CA 3CIAA 2KZTA 3CKCA 3AS8A 1N52A 1Z3XA 4LEUA 2L0IA 1QNFA 3ENEA 2XRZA 2WXJA 2XCBA 3FULA 4GCOA 2PM7A 5EX3A 1UN9A 3FTUA 4FULA 2IONA 4GZ3A 3K9IA 5C1DA 1UW4B 2FO7A 3FUHA 3RU0A 1HU3A 4UQYA 4J6IA 2LNIA 4W9RA 3FTSA 2LSUA 5AJLA 4APOA 3R7RA 2IOLA 4XIFA 1E8ZA 3B7UX 3OTNA 4JA7A 3ZEFA 4BX8A 5CMYA 3SBTB 1U3CA 4GYOA 3P1UA 2XGOA 3MA5A 4UQZA 1H6KA 3FTVA 3RIBA 2XGSA 3CSTA 4GB9A 5FQ4A 1HX8A 3D9OA 4NACA 4DI3A 3LVRE 4AP2A 3D9LA 4JL0A 3CVXA 4L1BA 4LERA 3ML8A 3CQCB 4DJAA 1U3DA 4FADA 2FEZA 4FA6A 3G2SA 5LCWC 2XQ0A 4BSXA 5FQ6A 1A17A 3ZXSA 4F3VA 4ANVA 5FQ8A 3PEVB 4KVMA 4FJZA 5T4YA 4AM9A 1UJJA 1TJFA 3LXUX 4ATGA 2WXHA 4EBAA 4CT0A 1QQEA 5KJLA 5KJMA 4HOSA 4H7XA 2E0IA 4JW1A 4AXHA 3SF4A 4G25A 4MKTA 4YVQC 3S7FA 3T5VA 1JPLA 3FTXA 1WAO1 4N5CA 4OYSA 2LO6A 5G05J 3JQ0A 1HG5A 2YINA 4HOQA 1JUQA 3MCXA 3CQGB 2WPVA 4G26A 1INZA 3PRZA 4AV7A 3L16A 2V5FA 3ESKA 1ZBPA 4OVUA 3RO2A 2KZTB 4HFGA 3QWPA 4U0UA 4RG6A 2MOWA 4M3OA 3G2UA 4TRQA 1TEZA 1N54A 2WXRA 5BUZA 4IRUA 1JWGA 1OWOA 4L23A 4F53A 4QFVA 2RD0A 1FCHA 2VQ2A 3L22A 1PAQA 4ILIA 4PDXA 5C2YA 1Y8MA 5EDSA 3VLFA 2HO1A 4MRUA 2I1KA 3PZDA 3LY8A 4APFA 3LCAA 4EQFA 3KEZA 4IYPA 3FEYA 3ESLA 1E8WA 4K0RA 3IKOB 3BG0B 4BTBA 4I9EA 4DLOA 4R7LA 3FUFA 3GZ2A 4WNGA 3LKUA 4O6FA 4RVBA 2BTDA 3CHMA 3LVQE 4G23A 4K03A 4DPRA 3CVQA 4KZ0A 2OOEA 3B7SA 3MV2B 5AJDA 3CK8A 4AIFA 1HE8A 1YA0A 3IEGA 4EPZA 1Z3YA 5E75A 2RG8A 2MRIA 4Q94A 4CGVA 5KJKA 4KVOA 3IHVA 4UWGA 4UI9K 4TUUA 4XI9A 2MHKA 4I6JA 3FTWA 3QB2A 4URKA 2UY1A 5D0QD 3U3WA 2WXPA 3CHSA 3T8MA 5G05C 3RK6A 1EPUA 4G2VA 2J9QA 4WNDA 3CVVA 2CFZA 5BV1A 4I17A 5DIZA 2PQRA 4I1AA 1DNPA 1OWPA 4AEZC 4D10C 2J4BA 4EZKA 3FUEA 4U0ZA 4PS8A 5BNWA 3UT7A 2ILRA 2KCVA 4ANWA 3Q49B 5ANLA 3CV0A 3QC1A 2FI7A 4KZCA 3QWWA 3SFZA 3NZSA 2VTBA 5KJNA 3KD7A 5LP0A 3FH7A 3UQ3A 4FJYA 1P5QA 3ML9A 4KXKB 2NSZA 4B0ZA 3CHQA 3JUIA 4UWLA 2V0PA 5AIJA 1EYHA 2OV8A 3D9JA 1MHQA 3LEWA 3ZYQA 2I2OA 1OWMA 3DPDA 2YHCA 4HOTA 3FEXA 3MGBA 4AVXA 4DLQA 2KM4A 1E90A 4N3CA 3KS2A 4UWFA 3HHMA 1NP7A 3CK9A 3L6AA 2DIWA 4DK5A 2VSOE 3WXXA 4DI4A 3QK0A 4WWOA 4J8FA 4ANXA 4IN3B 2WXKA 5AYWD 4U8HA 3BG1B 2Y3AA 3SNXA 3SD5A 1ELKA 5J08A 5CHEE 3LPZA 3MV3B 4CCAA 3DBSA 3LDZA 1OWNA 3HVEB 3CK7A 4WNFA 1KT0A 3OXLA 3PDNA 4JHRA 3FU5A 3G2VA 2VGXA 5FT9A 3G2WA 5EKQD 5D0OD 3GYZA 2CHWA 3FUDA 2WQHA 3ZYMA 3D9KA 4B89A 5FTPA 5E76A 4EZLA 4LUNU 3FUJA 4WWPA 4ACKA 4AJWA 5T3RA 4ABNA 4G24A 3ZHEB 5FZRA 4JEHA 5A7DB 1XGWA 5ANRA 1VDYA 4HXIA 4B8CB 5CMWA 3FFLA 4I6GA 1Y6IA 4P29A 4ILHB 2PZIA 1B89A 3MEKA 1PC2A 4N39A 3UUXA 3LJ3A 3D9MA 4A3VA 2NXPA 4OVVA 3SI5A 1H0AA 3LY9A 3ASHA 2ZU6B 4ME2A 4HS2A 2FBNA 4J8SA 5ARGA 2GW1A 4WAFA 2BUGA 4I43A 2I9CA 2VJ8A 3R9AB 3ZGQA 2WXGA 3AS5A 4N2QA 3CHRA 3FU6A 4UI9C 3CHOA 4E85A 4A3TA 3CGHA 3I4RB 2AW6A 1EF1C 2GRLA 3SBSA 2Y4TA 3MKQA 1L5JA 3NF1A 4CT4A 3U4TA 4JHKA 1HH8A 4J0UA 2E2EA 2L6JA 3Q15A 4JZYA 1E7VA 4JEUA 3ONLA 2X6JA 3L13A 4PS3A 1HXIA 2XGMA 2AVPA 5DBKA 2EQXA 3RKVA 4XE0A 3TG5A 4NRHB 3UT4A 3IV0A 4BT9A 4HVBA 3TXNA 2CG2A 1BPOA 2VGXB 2X6HA 4G11A 4CDRA 5FQ7A 1HFAA 2Q7FA 4AY5A 3Q47B 4BY6A 3CKBA 1KT1A 5ARFA 1E8YA 4BT8A 1KLXA 2VTBB 3VLDA 2CHZA 3IBEA 3LS8A 3FY4A 4GA2A 2KC7A 2X6KA 3FUKA 5EX0A 3UX4A 3PVLA 4GZ6A 3ZHEA 5JJTA 4GZ5A 4EBAG 4BX9A 2WXFA 3PREA 1HG2A 1HO8A 3B13A 3CVPA 3EIJA 3U64A 3ONKA 2KCLA 4MLPA 4EECA 2WB2A 2C2LA 4FP7A 2JEKA 4FLBA 2HR2A 2FULA 2XHEA 3B7TA 2WQ6A 3FTZA 5A23A 2WVIA 5BW8C 4J8EA 1H2UA 1IQUA 4I9CA 1OUVA 3FH5A 5JJ6A 2JLBA 4EZJA 2WXQA 4GMJA 5HQ8A 2QY7A 3IHYA 2J49A 3MX3A 3RO3A 4CEMA 4U63A 2AXVA 4H7YA 4FLHA 3O48A 4Q96A 4YVOA 2IQCA 3QJZA 2IU1A 4ANUA 3N71A 3ZN3A 2CFUA 4IULA 4A55A 4Q69A 3ZRHA 4PUCA 1X5BA 3O4ZA 4KT6B 5JHBA 2FF4A 2J08A 2V8SE 3ASDA 3CHPA 3FU3A 2IF4A 3CEQA 3QWVA 2PM6A 3L17A 3ASFA 3UT8A 2BF0X 3FWVA 4HOUA 1H2VC 2X6IA 2XPIA 4B94A 1SZAA 3VLEA 3GW4A 3CVNA 3URZA 1FVFA 3CVWA 3MJWA 5JJ7A 2IOSA 4JHJA 4NQ0A 3P2BA 2A5UA 5CCMA 1SZ9A 3GZSA 5FJYA 3S7BA 4YNDA 3NZUA 5KCMA 4XZ4A 4A1SA 4I2ZA 1WM5A 3ASGA 3T5XA 3ZVVA 5CCLA 2QFCA 4I1MA 5FWQA 5G55A 3VTXA 1H19A 3S2AA 3QDNA 4ILGA 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDZ A;  5CMY A;  3D9M A;  1HG2 A;  2V8S E;  1JPL A;  3ONL A;  3ONK A;  1EDU A;  2LO6 A;  3D9N A;  4GZC A;  1H0A A;  3ZYL A;  1HG5 A;  1EYH A;  1HX8 A;  3G2T A;  1PY1 A;  3D9I A;  3G2V A;  4FLB A;  1JUQ A;  2BF0 X;  1MHQ A;  3D9J A;  3D9O A;  3G2W A;  4GZD A;  4JXT A;  4NAC A;  2L0I A;  2L0T B;  3D9L A;  1SZA A;  3ZYQ A;  1INZ A;  4AVX A;  3ZYM A;  2KM4 A;  1HF8 A;  1LF8 A;  3D9K A;  4HFG A;  3ZYK A;  2DIW A;  3RRU A;  2QY7 A;  1JWF A;  1SZ9 A;  1HFA A;  2MOW A;  3G2U A;  1DVP A;  1UJK A;  3G2S A;  5LOZ A;  4FU3 A;  4Q96 A;  3CLJ A;  1JWG A;  1XGW A;  1VDY A;  5CMW A;  3D9P A;  4Q94 A;  1UJJ A;  2DCP A;  1ELK A;  1X5B A;  5J08 A;  5LP0 A; 
#chains in the Genus database with same CATH topology
 3JQ1 A;  3OXG A;  3Q7F A;  4L2L A;  4TV3 A;  3FU0 A;  4GU5 A;  2H6I A;  3EHQ A;  2WXI A;  3L82 A;  5D66 A;  4UUC A;  3QKY A;  2J4D A;  3RRU A;  4UI9 J;  5G04 C;  1DVP A;  2NC9 A;  1N0R A;  3GZ1 A;  2I6H A;  4E6H A;  5BPP A;  3APD A;  2B0O E;  4N5Q A;  3FUM A;  3HG0 D;  3D3M A;  4MS6 A;  3ZYL A;  2EIN E;  4NIK A;  3NOG D;  3SO8 A;  4GA0 A;  3L54 A;  2AWI A;  3AU4 A;  5ENP D;  3AJI A;  4GPM A;  4XKC A;  3TAX A;  3MKR A;  2M63 A;  2R5S A;  2BED A;  2R17 C;  3QOU A;  3J5P A;  3EDT B;  4HOR A;  4BFR A;  1IQR A;  3TXM A;  3DXK G;  2NYJ A;  4GTV A;  5B1A E;  2VSN A;  5AAR A;  4HI8 A;  2DCP A;  4V3I A;  4CGW A;  3Q4A B;  3FUI A;  3UM1 A;  2WXM A;  4GML A;  2LAI A;  4WUY A;  3HVE A;  2RFA A;  1UG3 A;  3U9W A;  2VYI A;  3TG4 A;  4RG9 A;  4Z68 A;  3FTY A;  1ELR A;  3Q7A A;  4XKB A;  3Q5M A;  2L0T B;  3DPY A;  3Q73 A;  1E96 B;  3T8K A;  1HS6 A;  1FVH A;  1AWC B;  4J7W A;  4L2Y A;  4X8Q A;  5FZQ A;  3NB2 A;  4GCN A;  4Y6C A;  3UPV A;  2OVF A;  5M72 A;  2UWJ G;  3PUK A;  4I1O B;  2KBX A;  1N52 A;  1Z3X A;  3FUL A;  2XCB A;  3IXE A;  5ITZ F;  4HRM B;  3FUH A;  2LNI A;  3FTS A;  4APO A;  4RLY A;  3UKR G;  3TWV A;  3SBT B;  1YCS B;  1U3C A;  1N94 A;  2XGO A;  3MA5 A;  3CST A;  3LVR E;  2ETB A;  1U3D A;  4FA6 A;  3Q79 A;  3G2S A;  5AQ7 A;  5LCW C;  2XQ0 A;  3PEV B;  3LXU X;  5KJM A;  4CT0 A;  3DSX A;  4JW1 A;  1OY3 D;  3S7F A;  3T5V A;  3FTX A;  2LO6 A;  3JQ0 A;  4HOQ A;  5ENS D;  4G26 A;  3SQV A;  3ESK A;  3RO2 A;  2KZT B;  4RG6 A;  4M3O A;  3DSS A;  5BUZ A;  5C2Y A;  1QBQ A;  2HO1 A;  4IYP A;  2A5E A;  5ENO D;  3HXB A;  4O6F A;  2FO1 E;  2BTD A;  3CHM A;  4K03 A;  4CYM D;  5EYP F;  4KZ0 A;  2GRR B;  3IEG A;  3E30 A;  1SA5 A;  2MRI A;  1WG0 A;  1TN6 A;  4XI9 A;  4GTR A;  5D0Q D;  3U3W A;  3CHS A;  5B3S E;  3RK6 A;  5CED B;  3JXI A;  4PS8 A;  3HXE A;  4YDE A;  2KCV A;  3NZS A;  5KJN A;  3KD7 A;  5CRU A;  2V0P A;  3BQO A;  1E90 A;  4N3C A;  3KS2 A;  5KNG A;  1NP7 A;  3L6A A;  4DI4 A;  3UTM A;  4ANX A;  4DRX E;  3SD5 A;  2XZT G;  3LPZ A;  1OWN A;  4WNF A;  3PDN A;  3TWQ A;  3D9K A;  3ABL E;  5KWD A;  4K5B A;  5EIL A;  1XGW A;  4B8C B;  1B89 A;  3MEK A;  1PC2 A;  3E37 A;  3LJ3 A;  2ZU6 B;  4J8S A;  4GTT A;  2GRN B;  3R9A B;  2Y1L E;  3CHR A;  2IO3 C;  3C72 A;  2P9L G;  3CGH A;  3I4R B;  4C48 B;  2OEW A;  3SBS A;  2Y4T A;  3U4T A;  2DVW A;  4J0U A;  3Q15 A;  1E7V A;  2AVP A;  2EQX A;  3RKV A;  4OAV B;  2X6H A;  4G11 A;  4XEI G;  3CKB A;  4BT8 A;  3AAA C;  3PVL A;  4GZ6 A;  4GZ5 A;  2EIJ E;  1HO8 A;  3ONK A;  4MLP A;  4FP7 A;  2QYU A;  5BW8 C;  1H2U A;  1FPP A;  1OUV A;  3DXM G;  5JJ6 A;  4U96 D;  4GMJ A;  3ASO E;  3BU8 A;  2IU1 A;  1BD8 A;  2CFU A;  4IUL A;  1Q2Z A;  3ZRH A;  4KT6 B;  4F1P A;  3FU3 A;  2IF4 A;  3Q75 A;  3CEQ A;  1FT2 A;  3QWV A;  2PM6 A;  2AJA A;  4U8Y D;  2BF0 X;  4LNU D;  4BSZ B;  1SZA A;  2P9N G;  5JJ7 A;  2A5U A;  1SZ9 A;  3GZS A;  3SY2 A;  5KCM A;  5CCL A;  2QFC A;  4I1M A;  3S2A A;  4U07 A;  1BU9 A;  2GRM A;  3APC A;  5B1B E;  4C0M A;  2P58 C;  2BKK B;  4HB5 A;  3SGH A;  3I4G A;  1N0Q A;  2WXN A;  5EID A;  1S63 A;  1IKN D;  5CEC B;  1O1S A;  3FH8 A;  3JYS A;  4GYW A;  4CDM A;  2GRQ B;  3X2Q E;  1UN8 A;  2VSY A;  4QQI A;  2DBA A;  3G2T A;  4JXT A;  2QC9 A;  5HI7 A;  1O1T A;  2DWZ A;  1WDY A;  1KPS B;  1HZ4 A;  3HDX A;  1V55 E;  3TWW A;  3FHE A;  3SFX A;  4RSY A;  3PZ1 A;  3EJN A;  4Y6W A;  3RJV A;  3RRN B;  2OND A;  3E4B A;  3D9N A;  2J8S D;  2X3M A;  2WQ7 A;  2PQN A;  2V4L A;  2VSX E;  4DX1 A;  5JHA A;  3VTY A;  1N4R A;  4JD2 G;  2EIL E;  5BT1 A;  4KBQ A;  4PS7 A;  3ZKJ A;  2UY1 B;  2LXM A;  5D2M C;  3MYV A;  3ZU7 B;  4JVS A;  4HLE A;  1EDU A;  3PS6 A;  3I3N A;  3CVU A;  4J8D A;  3HRA A;  3EUV A;  3UM3 A;  1S0P A;  3PZ2 A;  2WMO A;  3QAR A;  4FU3 A;  4O1P A;  4AY6 A;  2VGY A;  2RKK A;  4I2W A;  4JC8 A;  3UM0 A;  3PH0 C;  5G2N A;  4CRW A;  3D9I A;  4LRZ A;  2GGF A;  2X6F A;  2WXO A;  3NQP A;  2YHE A;  4JB8 P;  4U0S A;  1WY6 A;  5AAO A;  3CR3 A;  4I6E A;  4C0E A;  4GAA A;  2V5Q C;  1ELW A;  2R02 A;  1OCR E;  4GA1 A;  3ULQ A;  3FUN A;  2XRY A;  4PH4 B;  2C0M A;  3AU5 A;  3CIA A;  3E32 A;  4RQI A;  3ENE A;  2XRZ A;  2WXJ A;  4GCO A;  2PM7 A;  1UN9 A;  3BUA A;  4GTP A;  1UW4 B;  4UQY A;  4DX6 D;  4J6I A;  4A63 B;  1E8Z A;  4JA7 A;  3ZEF A;  4BX8 A;  4GYO A;  2P9I G;  3FTV A;  3D9O A;  4NAC A;  4J8Y A;  4YDY A;  3CVX A;  4LER A;  3ML8 A;  3D9H A;  3CQC B;  4DJA A;  4FAD A;  2L6B A;  4F3V A;  5FQ8 A;  5T4Y A;  4FJZ A;  1UJJ A;  1TJF A;  4AXH A;  4MKT A;  5G05 J;  1HG5 A;  4DX7 D;  1TN8 A;  3CQG B;  2WPV A;  4HBD A;  1TNZ A;  3KSL A;  4OVU A;  1D9S A;  2MOW A;  3G2U A;  4IRU A;  4L23 A;  4QFV A;  4PDX A;  1Y8M A;  3NBN B;  4MRU A;  3PZD A;  3LCA A;  5KNH D;  2MYO A;  3V2O A;  3ESL A;  1E8W A;  4K0R A;  3FUF A;  3GZ2 A;  3LVQ E;  4DPR A;  1KZO A;  3MV2 B;  4AIF A;  1HE8 A;  2RG8 A;  4EHM A;  2H6F A;  4CGV A;  5FIO A;  5EN5 D;  4URK A;  2Y0B G;  3T8M A;  4G2V A;  2J9Q A;  3TWR A;  4WND A;  4I17 A;  5DIZ A;  2QZA A;  1DNP A;  4AEZ C;  1LD8 A;  3FUE A;  4U0Z A;  5ANL A;  3SFZ A;  3PZ4 A;  1P5Q A;  5AN8 A;  2I2O A;  1OWM A;  2V4H C;  2YHC A;  4HOT A;  3FEX A;  3MGB A;  5AQ9 A;  4AVX A;  2KM4 A;  3HHM A;  2DIW A;  4WWO A;  4IN3 B;  2WXK A;  4U8H A;  3BG1 B;  2Y3A A;  3LDZ A;  3HVE B;  4YDO A;  3G2V A;  1OT8 A;  5EKQ D;  3GYZ A;  2CHW A;  3FUD A;  5FTP A;  4ACK A;  4AJW A;  4GTS A;  1Y6I A;  2GRP B;  2XEE A;  3LY9 A;  4ME2 A;  4HS2 A;  2GW1 A;  2R03 A;  2VJ8 A;  3FU6 A;  4UI9 C;  5EYL A;  3CHO A;  3NAW A;  4B93 B;  4A3T A;  2AW6 A;  2GRL A;  2IEJ A;  1AP7 A;  1L5J A;  3W9F A;  4JHK A;  4JZY A;  3ONL A;  4XE0 A;  1RZ4 A;  3UT4 A;  3IV0 A;  1JCR A;  1BI7 B;  4TXR A;  2VGX B;  4CDR A;  3Q47 B;  4BY6 A;  5ARF A;  1E8Y A;  2VTB B;  4LG6 A;  3VLD A;  3ZHE A;  3FUK A;  5EX0 A;  3UX4 A;  4BX9 A;  3PRE A;  1LD7 A;  3B13 A;  2KCL A;  2B6C A;  4EEC A;  3B7T A;  5A23 A;  3FH5 A;  4EZJ A;  3ZNG A;  1N11 A;  2KXP C;  5H7P A;  4ANU A;  4ZFH A;  2J08 A;  2V8S E;  3ASD A;  3CHP A;  5CEA A;  3L17 A;  2DZO A;  3ASF A;  1H2V C;  4B94 A;  3GW4 A;  4DX5 D;  3CVN A;  3EU5 A;  3MJW A;  2IOS A;  4NQ0 A;  3P2B A;  5CCM A;  1DCE A;  3S7B A;  4YND A;  1N4Q A;  4I2Z A;  1WM5 A;  3ASG A;  3T5X A;  3TWT A;  3B7B A;  3VTX A;  1IHB A;  5FWQ A;  1A5E A;  3QDN A;  4ILG A;  2X38 A;  1TN7 A;  2DYS E;  3QAQ A;  4UWK A;  5CBN A;  3EHM A;  2ZGG A;  5CBO A;  4BWR A;  1NL4 A;  3AG1 E;  2HM8 A;  1MX6 A;  3ZIM A;  2HE0 A;  2L9B A;  1IYG A;  4XI0 A;  1SQM A;  4A1G A;  1IXV A;  3R7Q A;  5LCW J;  3UMV A;  1N95 A;  3E33 A;  1NA3 A;  5JA4 D;  3L08 A;  3PNT B;  1NZN A;  2CHX A;  3RRM B;  5T8I A;  2PL2 A;  3OAW A;  3HYM B;  4GTO A;  3ULY A;  1OWL A;  2WXL A;  3KAE A;  4GTQ A;  2YNQ A;  3ABK E;  3L9T A;  3DSW A;  2KCK A;  4B8A A;  2XEH A;  4GTM A;  4HLL A;  1MYO A;  1H2T C;  2XEN A;  2H6G A;  3C98 A;  3CVY A;  1QZ2 A;  1DCQ A;  3SHF A;  1IHG A;  3EIQ C;  1W3B A;  4KYO B;  2R2L A;  4LCT A;  2I1J A;  1E7U A;  2P9P G;  1MX4 A;  1NFI E;  3PUJ A;  3ZFW A;  2XPZ A;  5IY5 E;  3AG2 E;  3JCK C;  1BLX B;  5JMN D;  3CLJ A;  2A4Z A;  3AG3 E;  3UIN C;  4BTA A;  3JXJ A;  2J07 A;  2KAT A;  2XPY A;  4N3A A;  3HXD A;  4FC8 A;  4L9P A;  4GZD A;  1NA0 A;  4WWN A;  2F8X K;  4N3B A;  4FHJ A;  1HF8 A;  1LF8 A;  4WNE A;  4C9B B;  5BV0 A;  3AS4 A;  1MQS A;  3QNK A;  1ZU2 A;  5G04 J;  2C0L A;  3PE3 A;  3I5P A;  1E8X A;  5FZS A;  4F7A A;  5AEN A;  1Z5S C;  3TWU A;  2XCC A;  3KEA A;  3TJP A;  2KZT A;  3AS8 A;  3ZUV B;  1U2V G;  5EX3 A;  4U8V D;  4GZ3 A;  2FO7 A;  3RU0 A;  1HU3 A;  2JAB A;  3UIP C;  4W9R A;  2LSU A;  4XIF A;  3Q78 A;  3OTN A;  4UQZ A;  2XGS A;  1SVX A;  5FQ4 A;  3DWL G;  4DI3 A;  4G8K A;  3D9L A;  2FEZ A;  1A17 A;  5CER B;  1MX2 A;  4KVM A;  4AM9 A;  4ATG A;  4EBA A;  4H7X A;  2E0I A;  1TNO A;  3SF4 A;  4G25 A;  4YVQ C;  1BI8 B;  1JPL A;  1TNB A;  4OYS A;  2YIN A;  3MCX A;  1INZ A;  3PRZ A;  3L16 A;  2V5F A;  1ZBP A;  3QWP A;  4U0U A;  4ATZ D;  1TEZ A;  1N54 A;  2WXR A;  4F53 A;  2RD0 A;  1FCH A;  2VQ2 A;  3L22 A;  1PAQ A;  5EDS A;  3Q9U C;  3VLF A;  3LY8 A;  4APF A;  5KBA A;  4EQF A;  1JCS A;  3IKO B;  3BG0 B;  3TWS A;  4G23 A;  2F8Y A;  3C3R A;  2OOE A;  3B7S A;  1TNY A;  3CK8 A;  1YA0 A;  1Z3Y A;  5E75 A;  1YYH A;  1FT1 A;  5KJK A;  4KVO A;  2BKG A;  2H6H A;  3IHV A;  4UI9 K;  4TUU A;  3FTW A;  4DUI A;  3QB2 A;  2UY1 A;  2WXP A;  5G05 C;  3UIO C;  4I1A A;  3V2X A;  1NI1 A;  4BES A;  4ANW A;  3ULE G;  3Q49 B;  3CV0 A;  3QC1 A;  2FI7 A;  4KZC A;  3QWW A;  4O60 A;  3FH7 A;  3UQ3 A;  2NSZ A;  3CHQ A;  3JUI A;  5AIJ A;  1EYH A;  2OV8 A;  3D9J A;  3LEW A;  3ZYQ A;  2QYJ A;  2R05 A;  3CK9 A;  2OCC E;  3EU9 A;  3QK0 A;  4J8F A;  3R9M A;  5AYW D;  3SNX A;  5CHE E;  3MV3 B;  4CCA A;  1TNU A;  2EIK E;  3CK7 A;  1KT0 A;  3OXL A;  3FU5 A;  3DSV A;  3G2W A;  5D0O D;  2WQH A;  3WG7 E;  3ZYM A;  5E76 A;  4EZL A;  5T3R A;  1TYQ G;  4LSZ E;  1VDY A;  4HXI A;  5CMW A;  2OEV A;  4P29 A;  4ILH B;  2PZI A;  5ENT D;  3D9M A;  2NXP A;  1N9A A;  3SI5 A;  5ARG A;  4WAF A;  2BUG A;  2I9C A;  3ZGQ A;  3AS5 A;  4CZ2 D;  1EF1 C;  3C5R A;  3NF1 A;  2XS1 A;  1HH8 A;  2L6J A;  4JEU A;  3L13 A;  4PS3 A;  5DBK A;  4HQD A;  4HI9 A;  4BT9 A;  1KZP A;  1N4S A;  5FQ7 A;  1HFA A;  2Q7F A;  4TXP A;  4AY5 A;  2ZIS A;  3V31 A;  1KLX A;  2CHZ A;  4GA2 A;  3V30 A;  2KC7 A;  2P9U G;  2X6K A;  5JJT A;  4U7E B;  4EBA G;  1HG2 A;  3EIJ A;  3U64 A;  2VGE A;  2JEK A;  3NOC D;  2HR2 A;  2XHE A;  3FTZ A;  2WVI A;  4J8E A;  2ZIR A;  2JLB A;  5HQ8 A;  2QY7 A;  1V54 E;  3Q9N C;  2J49 A;  3RO3 A;  4OAU C;  4U63 A;  2AXV A;  4H7Y A;  3O48 A;  3ZXP A;  3DST A;  1TR4 A;  4Q69 A;  4PUC A;  1X5B A;  3B95 A;  3DSU A;  5JHB A;  3ABM E;  3UT8 A;  2DYR E;  3CVW A;  3ISM C;  5FJY A;  1SW6 A;  3NZU A;  4A1S A;  3ZVV A;  5G55 A;  4DX2 A;  3OXF A;  1K8K G;  1DC2 A;  3PE4 A;  5LFA A;  2J09 A;  3TGO A;  4JPS A;  2LSV A;  5LX8 A;  3PEU B;  4F1S A;  3S7D A;  1PY1 A;  4CDN A;  3HXC A;  3RAU A;  4L7T A;  2AXZ A;  3ZYK A;  4N2S A;  3UKU G;  4TUM A;  3ZW3 A;  4KMO A;  2F37 A;  4FHK A;  3EHN A;  1S64 A;  4GPK A;  3U66 A;  2HYZ A;  3B7R L;  4JA9 A;  3S7J A;  2CG3 A;  4G8L A;  4GYY A;  1UJK A;  5J90 A;  4G1T A;  3CSF A;  1S70 B;  1OCZ E;  2R59 A;  2AXU A;  2XEV A;  4U04 A;  3W9G A;  3LJN A;  3HXF A;  1JWF A;  3TWX A;  3LYA A;  4HNA D;  2F0Y A;  1GW6 A;  4ACL A;  2YQ8 A;  3HIZ A;  4YDW A;  1D8E A;  5ENN A;  3CVL A;  2OVB A;  3FP3 A;  1Z6T A;  4UQX A;  2LAH A;  3J5Q B;  5EIB E;  1XNF A;  5BXU A;  3TL5 A;  3SZ7 A;  4AOF A;  1K3Z D;  3ZPJ A;  3F6Q A;  2WMN A;  3D9P A;  2IJG X;  2LXL A;  3PNL B;  1TJC A;  3MZL B;  3LY7 A;  3APF A;  3FDH A;  4GZC A;  3MKQ B;  4NUR A;  4XX5 A;  2Y4U A;  2IFU A;  2ZGD A;  2GRO B;  5LOZ A;  3C3O A;  1O1R A;  3BEE A;  2WM9 A;  1MJ0 A;  4GMR A;  4UWH A;  5A6C A;  3CKC A;  4LEU A;  3DEP A;  2L0I A;  1QNF A;  2LUH A;  3FTU A;  4FUL A;  2ION A;  3K9I A;  5C1D A;  5AJL A;  3R7R A;  2IOL A;  3B7U X;  5CMY A;  2IY0 C;  3P1U A;  1H6K A;  3ASN E;  3RIB A;  4GB9 A;  5FIN A;  1HX8 A;  4AP2 A;  4JL0 A;  4L1B A;  4BSX A;  5FQ6 A;  3ZXS A;  4ANV A;  4HOS A;  2WXH A;  5KJL A;  1QQE A;  1N4P A;  1WAO 1;  2PNN A;  4N5C A;  2ZXW E;  1JUQ A;  1K1B A;  4AV7 A;  4HFG A;  4TRQ A;  1JWG A;  1OWO A;  4ILI A;  2I1K A;  4O1O A;  3KEZ A;  1OCO E;  1OXJ A;  3FEY A;  4K5A B;  1UOH A;  4ZHB A;  4BTB A;  4BEP A;  4I9E A;  4DLO A;  4R7L A;  1SA4 A;  4WNG A;  3LKU A;  4RVB A;  1H6P A;  3RSE G;  3CVQ A;  5AJD A;  1OCC E;  4EPZ A;  1LTX A;  4Q94 A;  4UWG A;  2MHK A;  4I6J A;  2ETA A;  1EPU A;  4TXQ A;  3CVV A;  2CFZ A;  5BV1 A;  2PQR A;  1O5M A;  2IO2 C;  1OWP A;  4D10 C;  2J4B A;  2Y69 E;  4EZK A;  5BNW A;  4HRL A;  3UT7 A;  2ILR A;  5HS0 A;  5LP0 A;  4FJY A;  3ML9 A;  4KXK B;  3JUE A;  4MBG A;  4B0Z A;  2DZN A;  4UWL A;  4BER A;  1ZB1 A;  3KSQ A;  1YMP A;  1MHQ A;  3DPD A;  4DLQ A;  4UWF A;  1H6O A;  4DK5 A;  2VSO E;  3WXX A;  5ENQ D;  3V79 K;  1ELK A;  5J08 A;  3DBS A;  4HRN A;  4JHR A;  1JCQ A;  2VGX A;  5FT9 A;  4B89 A;  3T9K A;  4LUN U;  3FUJ A;  4WWP A;  4ABN A;  4G24 A;  3ZHE B;  5FZR A;  3E34 A;  4JEH A;  5A7D B;  5ANR A;  3FFL A;  4I6G A;  3UUX A;  3DEO A;  4N39 A;  5HKP A;  4A3V A;  5AQB A;  4OVV A;  5AQA A;  1H0A A;  3ASH A;  2FBN A;  4I43 A;  2WXG A;  4N2Q A;  3UM2 A;  4E85 A;  4BET A;  4K5C A;  3MKQ A;  4CT4 A;  2E2E A;  1QYM A;  5CRV A;  2X6J A;  2P9S G;  1HXI A;  2XGM A;  4M7C A;  3TG5 A;  4NRH B;  3EHR A;  2ETC A;  4HVB A;  5BXO A;  3AG4 E;  3TXN A;  5HRY A;  2CG2 A;  1BPO A;  2XS8 A;  3UXG A;  2XZD G;  1MZC A;  2P2C P;  1KT1 A;  3IBE A;  3LS8 A;  3FY4 A;  2WXF A;  3PZ3 A;  3CVP A;  3UI2 A;  2EIM E;  2WB2 A;  1G3N B;  2C2L A;  4FLB A;  2FUL A;  2WQ6 A;  4LNG A;  1IQU A;  4I9C A;  2WXQ A;  3IHY A;  3MX3 A;  4CEM A;  4Q96 A;  4FLH A;  4YVO A;  2IQC A;  3QJZ A;  4U95 D;  3N71 A;  3ZN3 A;  4A55 A;  3O4Z A;  3C3Q A;  4LNB A;  2FF4 A;  4F6R D;  3FWV A;  4HOU A;  2X6I A;  2XPI A;  1X81 A;  3VLE A;  3URZ A;  2RFM A;  1FVF A;  4JHJ A;  5ENR D;  1RW2 A;  1D8D A;  4XZ4 A;  1K1A A;  2P9K G;  1H19 A;  3DRA A;  3SFY A;  2VTB A; 
#chains in the Genus database with same CATH homology
 3PE4 A;  4U07 A;  5LFA A;  2X38 A;  2GRM A;  3APC A;  3JQ1 A;  3OXG A;  3QAQ A;  4UWK A;  2J09 A;  3TGO A;  4JPS A;  2LSV A;  5LX8 A;  4L2L A;  3EHM A;  3FU0 A;  3PEU B;  2P58 C;  1PY1 A;  4TV3 A;  4GU5 A;  3S7D A;  4C0M A;  4CDN A;  4F1S A;  2WXI A;  4BWR A;  3SGH A;  3I4G A;  3QKY A;  2J4D A;  2HM8 A;  4L7T A;  2AXZ A;  2WXN A;  3ZYK A;  3RRU A;  3ZIM A;  4UI9 J;  5G04 C;  4N2S A;  1DVP A;  2NC9 A;  2L9B A;  1IYG A;  3GZ1 A;  2I6H A;  4E6H A;  3FH8 A;  3ZW3 A;  3JYS A;  4XI0 A;  5BPP A;  4KMO A;  3APD A;  1SQM A;  4GYW A;  4A1G A;  3R7Q A;  5LCW J;  3FUM A;  3D3M A;  4FHK A;  3UMV A;  4CDM A;  3EHN A;  1UN8 A;  4MS6 A;  4GPK A;  2VSY A;  1NA3 A;  3U66 A;  3ZYL A;  2DBA A;  3G2T A;  2HYZ A;  3B7R L;  3L08 A;  3PNT B;  4JXT A;  4JA9 A;  5HI7 A;  1NZN A;  2CHX A;  3RRM B;  5T8I A;  2PL2 A;  1HZ4 A;  3OAW A;  4GA0 A;  3HDX A;  3L54 A;  3S7J A;  2CG3 A;  3HYM B;  4GYY A;  1UJK A;  2AWI A;  5J90 A;  3AU4 A;  1OWL A;  2WXL A;  3FHE A;  4RSY A;  4G1T A;  3CSF A;  3EJN A;  3KAE A;  4Y6W A;  2R59 A;  2YNQ A;  3RJV A;  4XKC A;  2AXU A;  3RRN B;  3TAX A;  2OND A;  2XEV A;  3E4B A;  3D9N A;  3MKR A;  2M63 A;  2R5S A;  2KCK A;  4U04 A;  4B8A A;  2R17 C;  2X3M A;  2WQ7 A;  3QOU A;  2PQN A;  2V4L A;  2VSX E;  3EDT B;  4HOR A;  4BFR A;  1IQR A;  3TXM A;  1JWF A;  3LYA A;  1H2T C;  5JHA A;  3C98 A;  3VTY A;  3CVY A;  1QZ2 A;  2VSN A;  5BT1 A;  4KBQ A;  1GW6 A;  2DCP A;  4PS7 A;  4ACL A;  2UY1 B;  4V3I A;  3SHF A;  2YQ8 A;  1IHG A;  3HIZ A;  3MYV A;  4CGW A;  3Q4A B;  4JVS A;  4HLE A;  3EIQ C;  1EDU A;  1W3B A;  5ENN A;  3FUI A;  3PS6 A;  4KYO B;  3I3N A;  4LCT A;  3CVU A;  2I1J A;  4J8D A;  3CVL A;  2OVB A;  3FP3 A;  1Z6T A;  4UQX A;  1E7U A;  2LAH A;  1XNF A;  1S0P A;  3PUJ A;  3ZFW A;  2XPZ A;  3TL5 A;  2WMO A;  2WXM A;  3QAR A;  3JCK C;  4GML A;  4FU3 A;  3SZ7 A;  4AOF A;  3CLJ A;  2LAI A;  3ZPJ A;  2WMN A;  4WUY A;  2A4Z A;  3HVE A;  4AY6 A;  3D9P A;  2IJG X;  3PNL B;  2VGY A;  4BTA A;  1TJC A;  1UG3 A;  3MZL B;  4I2W A;  4JC8 A;  3U9W A;  2VYI A;  2J07 A;  3LY7 A;  3APF A;  3FDH A;  2KAT A;  3PH0 C;  4RG9 A;  3TG4 A;  5G2N A;  4GZC A;  2XPY A;  3FTY A;  4N3A A;  1ELR A;  3MKQ B;  4XKB A;  4CRW A;  3D9I A;  3Q5M A;  4FC8 A;  4LRZ A;  4NUR A;  4XX5 A;  2Y4U A;  2IFU A;  4GZD A;  2L0T B;  1NA0 A;  4WWN A;  2GGF A;  4N3B A;  4FHJ A;  1HF8 A;  1LF8 A;  4WNE A;  4C9B B;  2X6F A;  2WXO A;  1E96 B;  3NQP A;  5BV0 A;  1HS6 A;  2YHE A;  1MQS A;  1FVH A;  3AS4 A;  4U0S A;  3QNK A;  5LOZ A;  1WY6 A;  1ZU2 A;  5G04 J;  3CR3 A;  4I6E A;  4L2Y A;  2C0L A;  3PE3 A;  4C0E A;  4GAA A;  3I5P A;  1E8X A;  5FZS A;  5FZQ A;  3BEE A;  4GCN A;  2WM9 A;  4Y6C A;  4F7A A;  5AEN A;  1ELW A;  2OVF A;  3UPV A;  4GA1 A;  3ULQ A;  3FUN A;  2XCC A;  2XRY A;  5M72 A;  2UWJ G;  4PH4 B;  2C0M A;  3AU5 A;  4UWH A;  3PUK A;  4I1O B;  3TJP A;  5A6C A;  3CIA A;  2KZT A;  3CKC A;  3AS8 A;  1N52 A;  1Z3X A;  4LEU A;  2L0I A;  1QNF A;  3ENE A;  2XRZ A;  2WXJ A;  2XCB A;  3FUL A;  4GCO A;  2PM7 A;  5EX3 A;  1UN9 A;  3FTU A;  4FUL A;  2ION A;  4GZ3 A;  3K9I A;  5C1D A;  1UW4 B;  2FO7 A;  3FUH A;  3RU0 A;  1HU3 A;  4UQY A;  4J6I A;  2LNI A;  4W9R A;  3FTS A;  2LSU A;  5AJL A;  4APO A;  3R7R A;  2IOL A;  4XIF A;  1E8Z A;  3B7U X;  3OTN A;  4JA7 A;  3ZEF A;  4BX8 A;  5CMY A;  3SBT B;  1U3C A;  4GYO A;  3P1U A;  2XGO A;  3MA5 A;  4UQZ A;  1H6K A;  3FTV A;  3RIB A;  2XGS A;  3CST A;  4GB9 A;  5FQ4 A;  1HX8 A;  3D9O A;  4NAC A;  4DI3 A;  3LVR E;  4AP2 A;  3D9L A;  4JL0 A;  3CVX A;  4L1B A;  4LER A;  3ML8 A;  3CQC B;  4DJA A;  1U3D A;  4FAD A;  2FEZ A;  4FA6 A;  3G2S A;  5LCW C;  2XQ0 A;  4BSX A;  5FQ6 A;  1A17 A;  3ZXS A;  4F3V A;  4ANV A;  5FQ8 A;  3PEV B;  4KVM A;  4FJZ A;  5T4Y A;  4AM9 A;  1UJJ A;  1TJF A;  3LXU X;  4ATG A;  2WXH A;  4EBA A;  4CT0 A;  1QQE A;  5KJL A;  5KJM A;  4HOS A;  4H7X A;  2E0I A;  4JW1 A;  4AXH A;  3SF4 A;  4G25 A;  4MKT A;  4YVQ C;  3S7F A;  3T5V A;  1JPL A;  3FTX A;  1WAO 1;  4N5C A;  4OYS A;  2LO6 A;  5G05 J;  3JQ0 A;  1HG5 A;  2YIN A;  4HOQ A;  1JUQ A;  3MCX A;  3CQG B;  2WPV A;  4G26 A;  1INZ A;  3PRZ A;  4AV7 A;  3L16 A;  2V5F A;  3ESK A;  1ZBP A;  4OVU A;  3RO2 A;  2KZT B;  4HFG A;  3QWP A;  4U0U A;  4RG6 A;  2MOW A;  4M3O A;  3G2U A;  4TRQ A;  1TEZ A;  1N54 A;  2WXR A;  5BUZ A;  4IRU A;  1JWG A;  1OWO A;  4L23 A;  4F53 A;  4QFV A;  2RD0 A;  1FCH A;  2VQ2 A;  3L22 A;  1PAQ A;  4ILI A;  4PDX A;  5C2Y A;  1Y8M A;  5EDS A;  3VLF A;  2HO1 A;  4MRU A;  2I1K A;  3PZD A;  3LY8 A;  4APF A;  3LCA A;  4EQF A;  3KEZ A;  4IYP A;  3FEY A;  3ESL A;  1E8W A;  4K0R A;  3IKO B;  3BG0 B;  4BTB A;  4I9E A;  4DLO A;  4R7L A;  3FUF A;  3GZ2 A;  4WNG A;  3LKU A;  4O6F A;  4RVB A;  2BTD A;  3CHM A;  3LVQ E;  4G23 A;  4K03 A;  4DPR A;  3CVQ A;  4KZ0 A;  2OOE A;  3B7S A;  3MV2 B;  5AJD A;  3CK8 A;  4AIF A;  1HE8 A;  1YA0 A;  3IEG A;  4EPZ A;  1Z3Y A;  5E75 A;  2RG8 A;  2MRI A;  4Q94 A;  4CGV A;  5KJK A;  4KVO A;  3IHV A;  4UWG A;  4UI9 K;  4TUU A;  4XI9 A;  2MHK A;  4I6J A;  3FTW A;  3QB2 A;  4URK A;  2UY1 A;  5D0Q D;  3U3W A;  2WXP A;  3CHS A;  3T8M A;  5G05 C;  3RK6 A;  1EPU A;  4G2V A;  2J9Q A;  4WND A;  3CVV A;  2CFZ A;  5BV1 A;  4I17 A;  5DIZ A;  2PQR A;  4I1A A;  1DNP A;  1OWP A;  4AEZ C;  4D10 C;  2J4B A;  4EZK A;  3FUE A;  4U0Z A;  4PS8 A;  5BNW A;  3UT7 A;  2ILR A;  2KCV A;  4ANW A;  3Q49 B;  5ANL A;  3CV0 A;  3QC1 A;  2FI7 A;  4KZC A;  3QWW A;  3SFZ A;  3NZS A;  2VTB A;  5KJN A;  3KD7 A;  5LP0 A;  3FH7 A;  3UQ3 A;  4FJY A;  1P5Q A;  3ML9 A;  4KXK B;  2NSZ A;  4B0Z A;  3CHQ A;  3JUI A;  4UWL A;  2V0P A;  5AIJ A;  1EYH A;  2OV8 A;  3D9J A;  1MHQ A;  3LEW A;  3ZYQ A;  2I2O A;  1OWM A;  3DPD A;  2YHC A;  4HOT A;  3FEX A;  3MGB A;  4AVX A;  4DLQ A;  2KM4 A;  1E90 A;  4N3C A;  3KS2 A;  4UWF A;  3HHM A;  1NP7 A;  3CK9 A;  3L6A A;  2DIW A;  4DK5 A;  2VSO E;  3WXX A;  4DI4 A;  3QK0 A;  4WWO A;  4J8F A;  4ANX A;  4IN3 B;  2WXK A;  5AYW D;  4U8H A;  3BG1 B;  2Y3A A;  3SNX A;  3SD5 A;  1ELK A;  5J08 A;  5CHE E;  3LPZ A;  3MV3 B;  4CCA A;  3DBS A;  3LDZ A;  1OWN A;  3HVE B;  3CK7 A;  4WNF A;  1KT0 A;  3OXL A;  3PDN A;  4JHR A;  3FU5 A;  3G2V A;  2VGX A;  5FT9 A;  3G2W A;  5EKQ D;  5D0O D;  3GYZ A;  2CHW A;  3FUD A;  2WQH A;  3ZYM A;  3D9K A;  4B89 A;  5FTP A;  5E76 A;  4EZL A;  4LUN U;  3FUJ A;  4WWP A;  4ACK A;  4AJW A;  5T3R A;  4ABN A;  4G24 A;  3ZHE B;  5FZR A;  4JEH A;  5A7D B;  1XGW A;  5ANR A;  1VDY A;  4HXI A;  4B8C B;  5CMW A;  3FFL A;  4I6G A;  1Y6I A;  4P29 A;  4ILH B;  2PZI A;  1B89 A;  3MEK A;  1PC2 A;  4N39 A;  3UUX A;  3LJ3 A;  3D9M A;  4A3V A;  2NXP A;  4OVV A;  3SI5 A;  1H0A A;  3LY9 A;  3ASH A;  2ZU6 B;  4ME2 A;  4HS2 A;  2FBN A;  4J8S A;  5ARG A;  2GW1 A;  4WAF A;  2BUG A;  4I43 A;  2I9C A;  2VJ8 A;  3R9A B;  3ZGQ A;  2WXG A;  3AS5 A;  4N2Q A;  3CHR A;  3FU6 A;  4UI9 C;  3CHO A;  4E85 A;  4A3T A;  3CGH A;  3I4R B;  2AW6 A;  1EF1 C;  2GRL A;  3SBS A;  2Y4T A;  3MKQ A;  1L5J A;  3NF1 A;  4CT4 A;  3U4T A;  4JHK A;  1HH8 A;  4J0U A;  2E2E A;  2L6J A;  3Q15 A;  4JZY A;  1E7V A;  4JEU A;  3ONL A;  2X6J A;  3L13 A;  4PS3 A;  1HXI A;  2XGM A;  2AVP A;  5DBK A;  2EQX A;  3RKV A;  4XE0 A;  3TG5 A;  4NRH B;  3UT4 A;  3IV0 A;  4BT9 A;  4HVB A;  3TXN A;  2CG2 A;  1BPO A;  2VGX B;  2X6H A;  4G11 A;  4CDR A;  5FQ7 A;  1HFA A;  2Q7F A;  4AY5 A;  3Q47 B;  4BY6 A;  3CKB A;  1KT1 A;  5ARF A;  1E8Y A;  4BT8 A;  1KLX A;  2VTB B;  3VLD A;  2CHZ A;  3IBE A;  3LS8 A;  3FY4 A;  4GA2 A;  2KC7 A;  2X6K A;  3FUK A;  5EX0 A;  3UX4 A;  3PVL A;  4GZ6 A;  3ZHE A;  5JJT A;  4GZ5 A;  4EBA G;  4BX9 A;  2WXF A;  3PRE A;  1HG2 A;  1HO8 A;  3B13 A;  3CVP A;  3EIJ A;  3U64 A;  3ONK A;  2KCL A;  4MLP A;  4EEC A;  2WB2 A;  2C2L A;  4FP7 A;  2JEK A;  4FLB A;  2HR2 A;  2FUL A;  2XHE A;  3B7T A;  2WQ6 A;  3FTZ A;  5A23 A;  2WVI A;  5BW8 C;  4J8E A;  1H2U A;  1IQU A;  4I9C A;  1OUV A;  3FH5 A;  5JJ6 A;  2JLB A;  4EZJ A;  2WXQ A;  4GMJ A;  5HQ8 A;  2QY7 A;  3IHY A;  2J49 A;  3MX3 A;  3RO3 A;  4CEM A;  4U63 A;  2AXV A;  4H7Y A;  4FLH A;  3O48 A;  4Q96 A;  4YVO A;  2IQC A;  3QJZ A;  2IU1 A;  4ANU A;  3N71 A;  3ZN3 A;  2CFU A;  4IUL A;  4A55 A;  4Q69 A;  3ZRH A;  4PUC A;  1X5B A;  3O4Z A;  4KT6 B;  5JHB A;  2FF4 A;  2J08 A;  2V8S E;  3ASD A;  3CHP A;  3FU3 A;  2IF4 A;  3CEQ A;  3QWV A;  2PM6 A;  3L17 A;  3ASF A;  3UT8 A;  2BF0 X;  3FWV A;  4HOU A;  1H2V C;  2X6I A;  2XPI A;  4B94 A;  1SZA A;  3VLE A;  3GW4 A;  3CVN A;  3URZ A;  1FVF A;  3CVW A;  3MJW A;  5JJ7 A;  2IOS A;  4JHJ A;  4NQ0 A;  3P2B A;  2A5U A;  5CCM A;  1SZ9 A;  3GZS A;  5FJY A;  3S7B A;  4YND A;  3NZU A;  5KCM A;  4XZ4 A;  4A1S A;  4I2Z A;  1WM5 A;  3ASG A;  3T5X A;  3ZVV A;  5CCL A;  2QFC A;  4I1M A;  5FWQ A;  5G55 A;  3VTX A;  1H19 A;  3S2A A;  3QDN A;  4ILG A;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...