3DA5A

Crystal structure of piwi/argonaute/zwille(paz) domain from thermococcus thioreducens
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
KKTLWELVGRNKDALRDFLKEHRGTILLRDIASEHKVVYKPIFKRYNGDPDLIEDNSNDVEHWYDYHLERYWNTPELKKEFYKKFGPVDLNQPIILAKPLRQHNRGDLVHLLPQFVVPVYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Piwi/Argonaute/Zwille(PAZ) domain from Thermococcus thioreducens
rcsb
source organism Thermococcus thioreducens
molecule tags Rna binding protein
molecule keywords Argonaute
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12212 PAZ_siRNAbind PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.20 Mainly Beta Beta Complex paz domain paz domain 3da5A00
3DA5A 1Z26A 1U04A 1Z25A
chains in the Genus database with same CATH superfamily
2L5DA 5JS1A 3QIRA 4Z4EA 3HM9A 1T2RA 1SI3A 3O7VX 4NH5A 4KRFA 2QVWA 4Z4HA 3F73A 4NGGA 3U1UA 1U04A 3HVRA 4Z4CA 4NGCA 4OLBA 4W5QA 1T2SA 3HJFA 3O6EX 3HK2A 1Z26A 4NHAA 1VYNA 3MJ0A 4F3TA 4KREA 4W5TA 4NH6A 4W5NA 3O3IX 5T7BA 4NGBA 4OLAA 3DA5A 5KI6A 4NH3A 1SI2A 2L5CA 3HO1A 4Z4GA 2DB9A 2XFMA 3DLHA 3O7XA 5JS2A 4NGFA 4NGDA 3DLBA 1Z25A 4L1PA 4W5RA 4W5OA 4Z4IA 1R6ZA 1R4KA 2FFLA 4Z4FA 4L1UA 2BZEA
chains in the Genus database with same CATH topology
2L5DA 5JS1A 3QIRA 4Z4EA 3HM9A 1T2RA 1SI3A 3O7VX 4NH5A 4KRFA 2QVWA 4Z4HA 3F73A 4NGGA 3U1UA 1U04A 3HVRA 4Z4CA 4NGCA 4OLBA 4W5QA 1T2SA 3HJFA 3O6EX 3HK2A 1Z26A 4NHAA 1VYNA 3MJ0A 4F3TA 4KREA 4W5TA 4NH6A 4W5NA 3O3IX 5T7BA 4NGBA 4OLAA 3DA5A 5KI6A 4NH3A 1SI2A 2L5CA 3HO1A 4Z4GA 2DB9A 2XFMA 3DLHA 3O7XA 5JS2A 4NGFA 4NGDA 3DLBA 1Z25A 4L1PA 4W5RA 4W5OA 4Z4IA 1R6ZA 1R4KA 2FFLA 4Z4FA 4L1UA 2BZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DA5 A;  1Z26 A;  1U04 A;  1Z25 A; 
#chains in the Genus database with same CATH topology
 2L5D A;  5JS1 A;  3QIR A;  4Z4E A;  3HM9 A;  1T2R A;  1SI3 A;  3O7V X;  4NH5 A;  4KRF A;  2QVW A;  4Z4H A;  3F73 A;  4NGG A;  3U1U A;  1U04 A;  3HVR A;  4Z4C A;  4NGC A;  4OLB A;  4W5Q A;  1T2S A;  3HJF A;  3O6E X;  3HK2 A;  1Z26 A;  4NHA A;  1VYN A;  3MJ0 A;  4F3T A;  4KRE A;  4W5T A;  4NH6 A;  4W5N A;  3O3I X;  5T7B A;  4NGB A;  4OLA A;  3DA5 A;  5KI6 A;  4NH3 A;  1SI2 A;  2L5C A;  3HO1 A;  4Z4G A;  2DB9 A;  2XFM A;  3DLH A;  3O7X A;  5JS2 A;  4NGF A;  4NGD A;  3DLB A;  1Z25 A;  4L1P A;  4W5R A;  4W5O A;  4Z4I A;  1R6Z A;  1R4K A;  2FFL A;  4Z4F A;  4L1U A;  2BZE A; 
#chains in the Genus database with same CATH homology
 2L5D A;  5JS1 A;  3QIR A;  4Z4E A;  3HM9 A;  1T2R A;  1SI3 A;  3O7V X;  4NH5 A;  4KRF A;  2QVW A;  4Z4H A;  3F73 A;  4NGG A;  3U1U A;  1U04 A;  3HVR A;  4Z4C A;  4NGC A;  4OLB A;  4W5Q A;  1T2S A;  3HJF A;  3O6E X;  3HK2 A;  1Z26 A;  4NHA A;  1VYN A;  3MJ0 A;  4F3T A;  4KRE A;  4W5T A;  4NH6 A;  4W5N A;  3O3I X;  5T7B A;  4NGB A;  4OLA A;  3DA5 A;  5KI6 A;  4NH3 A;  1SI2 A;  2L5C A;  3HO1 A;  4Z4G A;  2DB9 A;  2XFM A;  3DLH A;  3O7X A;  5JS2 A;  4NGF A;  4NGD A;  3DLB A;  1Z25 A;  4L1P A;  4W5R A;  4W5O A;  4Z4I A;  1R6Z A;  1R4K A;  2FFL A;  4Z4F A;  4L1U A;  2BZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...