3DA5A

Crystal structure of piwi/argonaute/zwille(paz) domain from thermococcus thioreducens
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
KKTLWELVGRNKDALRDFLKEHRGTILLRDIASEHKVVYKPIFKRYNGDPDLIEDNSNDVEHWYDYHLERYWNTPELKKEFYKKFGPVDLNQPIILAKPLRQHNRGDLVHLLPQFVVPVYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Argonaute
publication title Crystal Structure of Piwi/Argonaute/Zwille(PAZ) domain from Thermococcus thioreducens
rcsb
source organism Thermococcus thioreducens
molecule tags Rna binding protein
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12212 PAZ_siRNAbind PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.20 Mainly Beta Beta Complex paz domain paz domain 3da5A00
3DA5A 1Z26A 1Z25A 1U04A
chains in the Genus database with same CATH superfamily
4L1PA 2QVWA 3O6EX 3F73A 3HK2A 3MJ0A 4NGFA 4NHAA 1R6ZA 1R4KA 3QIRA 4Z4IA 4KRFA 2FFLA 4KREA 2DB9A 4W5TA 1Z25A 4W5NA 5T7BA 4Z4EA 4NGDA 2L5CA 3DLBA 4W5RA 3U1UA 1T2RA 4NGGA 4NH3A 5KI6A 3O3IX 1U04A 4OLBA 4F3TA 4Z4CA 2XFMA 4Z4GA 1VYNA 3DA5A 1Z26A 3HVRA 5JS2A 4W5OA 3O7VX 4W5QA 3DLHA 1SI3A 4NGCA 4NH6A 3HO1A 4OLAA 2L5DA 4L1UA 2BZEA 1SI2A 5JS1A 3HM9A 4Z4HA 3HJFA 1T2SA 4NGBA 4Z4FA 4NH5A 3O7XA
chains in the Genus database with same CATH topology
4L1PA 2QVWA 3O6EX 3F73A 3HK2A 3MJ0A 4NGFA 4NHAA 1R6ZA 1R4KA 3QIRA 4Z4IA 4KRFA 2FFLA 4KREA 2DB9A 4W5TA 1Z25A 4W5NA 5T7BA 4Z4EA 4NGDA 2L5CA 3DLBA 4W5RA 3U1UA 1T2RA 4NGGA 4NH3A 5KI6A 3O3IX 1U04A 4OLBA 4F3TA 4Z4CA 2XFMA 4Z4GA 1VYNA 3DA5A 1Z26A 3HVRA 5JS2A 4W5OA 3O7VX 4W5QA 3DLHA 1SI3A 4NGCA 4NH6A 3HO1A 4OLAA 2L5DA 4L1UA 2BZEA 1SI2A 5JS1A 3HM9A 4Z4HA 3HJFA 1T2SA 4NGBA 4Z4FA 4NH5A 3O7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DA5 A;  1Z26 A;  1Z25 A;  1U04 A; 
#chains in the Genus database with same CATH topology
 4L1P A;  2QVW A;  3O6E X;  3F73 A;  3HK2 A;  3MJ0 A;  4NGF A;  4NHA A;  1R6Z A;  1R4K A;  3QIR A;  4Z4I A;  4KRF A;  2FFL A;  4KRE A;  2DB9 A;  4W5T A;  1Z25 A;  4W5N A;  5T7B A;  4Z4E A;  4NGD A;  2L5C A;  3DLB A;  4W5R A;  3U1U A;  1T2R A;  4NGG A;  4NH3 A;  5KI6 A;  3O3I X;  1U04 A;  4OLB A;  4F3T A;  4Z4C A;  2XFM A;  4Z4G A;  1VYN A;  3DA5 A;  1Z26 A;  3HVR A;  5JS2 A;  4W5O A;  3O7V X;  4W5Q A;  3DLH A;  1SI3 A;  4NGC A;  4NH6 A;  3HO1 A;  4OLA A;  2L5D A;  4L1U A;  2BZE A;  1SI2 A;  5JS1 A;  3HM9 A;  4Z4H A;  3HJF A;  1T2S A;  4NGB A;  4Z4F A;  4NH5 A;  3O7X A; 
#chains in the Genus database with same CATH homology
 4L1P A;  2QVW A;  3O6E X;  3F73 A;  3HK2 A;  3MJ0 A;  4NGF A;  4NHA A;  1R6Z A;  1R4K A;  3QIR A;  4Z4I A;  4KRF A;  2FFL A;  4KRE A;  2DB9 A;  4W5T A;  1Z25 A;  4W5N A;  5T7B A;  4Z4E A;  4NGD A;  2L5C A;  3DLB A;  4W5R A;  3U1U A;  1T2R A;  4NGG A;  4NH3 A;  5KI6 A;  3O3I X;  1U04 A;  4OLB A;  4F3T A;  4Z4C A;  2XFM A;  4Z4G A;  1VYN A;  3DA5 A;  1Z26 A;  3HVR A;  5JS2 A;  4W5O A;  3O7V X;  4W5Q A;  3DLH A;  1SI3 A;  4NGC A;  4NH6 A;  3HO1 A;  4OLA A;  2L5D A;  4L1U A;  2BZE A;  1SI2 A;  5JS1 A;  3HM9 A;  4Z4H A;  3HJF A;  1T2S A;  4NGB A;  4Z4F A;  4NH5 A;  3O7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...