3DB5A

Crystal structure of methyltransferase domain of human pr domain-containing protein 4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
124
Chain Sequence
b'PVTFVPDTPIESRARLSLPKQLVLRQSIEVGVWTGETIPVRTCFGPLIGQQSHVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 4
molecule tags Transferase
source organism Homo sapiens
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 4.
rcsb
total genus 22
structure length 124
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3db5A00
4E47A 3CBPA 4J7FA 5HQ8A 3KMTA 4JDSA 5TTFA 3OXGA 4QENA 4QEOA 5HI7A 5F5EA 3VUZA 3CBMA 4O30A 3S7BA 1H3IA 3KMJA 5EX3A 3SWCA 2F69A 5ARGA 5CPRB 4YPAA 4AU7A 3RJWA 3M57A 1N6CA 3RAYA 2JV0A 4FMUA 1ML9A 3PDNA 4NVQA 5EG2A 5F59A 1O9SA 4QEPA 5KJNA 4BUPA 3DB5A 4YNPA 2G46A 2W5ZA 3OXFA 2BQZA 3HNAA 3MO5A 5TEGA 2QPWA 3OXLA 3F9ZA 3OPEA 2O8JA 5KJMA 4J8OA 1MVHA 3F9WA 3QWPA 5F6KC 2IGQA 4C1QA 4J7IA 3M54A 5KJLA 4LDGA 1PEGA 2RFIA 3S8PA 3BO5A 5ARFA 3DALA 5TH7A 4JLGA 4RZ0A 5F6LA 5T0KA 5LSXA 3EP0A 3OS5A 1MUFA 5AYFA 4MI0A 3RU0A 3MO2A 3SW9A 3TG4A 5CCLA 3M58A 5KJKA 5T5GA 3S7JA 3F9XA 3TG5A 3N71A 5JJ0A 2W5YA 5JHNA 3M56A 3QWVA 3CBOA 4YPEA 3VV0A 3S7DA 3KMAA 3RQ4A 4I51A 3QWWA 3S7FA 4MI5A 4WUYA 1N6AA 4J83A 3OOIA 3RIBA 3F9YA 5LSZA 1MT6A 4H12A 5JINA 1MVXA 4O6FA 4IJ8A 3FPDA 3M55A 1ZKKA 4YNMA 3MO0A 3K5KA 5JIYA 4YPUA 3M53A 4NJ5A 3IHXA 4IJDA 4YNDA 2R3AA 5EX0A 4Z4PA 5T0MA 3MEKA 5CCMA 3M5AA 1XQHA 1N3JA 3M59A
chains in the Genus database with same CATH superfamily
4E47A 3CBPA 4J7FA 5HQ8A 3KMTA 4JDSA 5TTFA 3OXGA 4QENA 4QEOA 5HI7A 5F5EA 3VUZA 3CBMA 4O30A 3S7BA 1H3IA 3KMJA 5EX3A 3SWCA 2F69A 5ARGA 5CPRB 4YPAA 4AU7A 3RJWA 3M57A 1N6CA 3RAYA 2JV0A 4FMUA 1ML9A 3PDNA 4NVQA 5EG2A 5F59A 1O9SA 4QEPA 5KJNA 4BUPA 3DB5A 4YNPA 2G46A 2W5ZA 3OXFA 2BQZA 3HNAA 3MO5A 5TEGA 2QPWA 3OXLA 3F9ZA 3OPEA 2O8JA 5KJMA 4J8OA 1MVHA 3F9WA 3QWPA 5F6KC 2IGQA 4C1QA 4J7IA 3M54A 5KJLA 4LDGA 1PEGA 2RFIA 3S8PA 3BO5A 5ARFA 3DALA 5TH7A 4JLGA 4RZ0A 5F6LA 5T0KA 5LSXA 3EP0A 3OS5A 1MUFA 5AYFA 4MI0A 3RU0A 3MO2A 3SW9A 3TG4A 5CCLA 3M58A 5KJKA 5T5GA 3S7JA 3F9XA 3TG5A 3N71A 5JJ0A 2W5YA 5JHNA 3M56A 3QWVA 3CBOA 4YPEA 3VV0A 3S7DA 3KMAA 3RQ4A 4I51A 3QWWA 3S7FA 4MI5A 4WUYA 1N6AA 4J83A 3OOIA 3RIBA 3F9YA 5LSZA 1MT6A 4H12A 5JINA 1MVXA 4O6FA 4IJ8A 3FPDA 3M55A 1ZKKA 4YNMA 3MO0A 3K5KA 5JIYA 4YPUA 3M53A 4NJ5A 3IHXA 4IJDA 4YNDA 2R3AA 5EX0A 4Z4PA 5T0MA 3MEKA 5CCMA 3M5AA 1XQHA 1N3JA 3M59A
chains in the Genus database with same CATH topology
4E47A 3CBPA 4J7FA 5HQ8A 3KMTA 4JDSA 5TTFA 3OXGA 4QENA 4QEOA 5HI7A 5F5EA 3VUZA 3CBMA 4O30A 3S7BA 1H3IA 3KMJA 5EX3A 3SWCA 2F69A 5ARGA 5CPRB 4YPAA 4AU7A 3RJWA 3M57A 1N6CA 3RAYA 2JV0A 4FMUA 1ML9A 3PDNA 4NVQA 5EG2A 5F59A 1O9SA 4QEPA 5KJNA 4BUPA 3DB5A 4YNPA 2G46A 2W5ZA 3OXFA 2BQZA 3HNAA 3MO5A 5TEGA 2QPWA 3OXLA 3F9ZA 3OPEA 2O8JA 5KJMA 4J8OA 1MVHA 3F9WA 3QWPA 5F6KC 2IGQA 4C1QA 4J7IA 3M54A 5KJLA 4LDGA 1PEGA 2RFIA 3S8PA 3BO5A 5ARFA 3DALA 5TH7A 4JLGA 4RZ0A 5F6LA 5T0KA 5LSXA 3EP0A 3OS5A 1MUFA 5AYFA 4MI0A 3RU0A 3MO2A 3SW9A 3TG4A 5CCLA 3M58A 5KJKA 5T5GA 3S7JA 3F9XA 3TG5A 3N71A 5JJ0A 2W5YA 5JHNA 3M56A 3QWVA 3CBOA 4YPEA 3VV0A 3S7DA 3KMAA 3RQ4A 4I51A 3QWWA 3S7FA 4MI5A 4WUYA 1N6AA 4J83A 3OOIA 3RIBA 3F9YA 5LSZA 1MT6A 4H12A 5JINA 1MVXA 4O6FA 4IJ8A 3FPDA 3M55A 1ZKKA 4YNMA 3MO0A 3K5KA 5JIYA 4YPUA 3M53A 4NJ5A 3IHXA 4IJDA 4YNDA 2R3AA 5EX0A 4Z4PA 5T0MA 3MEKA 5CCMA 3M5AA 1XQHA 1N3JA 3M59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E47 A;  3CBP A;  4J7F A;  5HQ8 A;  3KMT A;  4JDS A;  5TTF A;  3OXG A;  4QEN A;  4QEO A;  5HI7 A;  5F5E A;  3VUZ A;  3CBM A;  4O30 A;  3S7B A;  1H3I A;  3KMJ A;  5EX3 A;  3SWC A;  2F69 A;  5ARG A;  5CPR B;  4YPA A;  4AU7 A;  3RJW A;  3M57 A;  1N6C A;  3RAY A;  2JV0 A;  4FMU A;  1ML9 A;  3PDN A;  4NVQ A;  5EG2 A;  5F59 A;  1O9S A;  4QEP A;  5KJN A;  4BUP A;  3DB5 A;  4YNP A;  2G46 A;  2W5Z A;  3OXF A;  2BQZ A;  3HNA A;  3MO5 A;  5TEG A;  2QPW A;  3OXL A;  3F9Z A;  3OPE A;  2O8J A;  5KJM A;  4J8O A;  1MVH A;  3F9W A;  3QWP A;  5F6K C;  2IGQ A;  4C1Q A;  4J7I A;  3M54 A;  5KJL A;  4LDG A;  1PEG A;  2RFI A;  3S8P A;  3BO5 A;  5ARF A;  3DAL A;  5TH7 A;  4JLG A;  4RZ0 A;  5F6L A;  5T0K A;  5LSX A;  3EP0 A;  3OS5 A;  1MUF A;  5AYF A;  4MI0 A;  3RU0 A;  3MO2 A;  3SW9 A;  3TG4 A;  5CCL A;  3M58 A;  5KJK A;  5T5G A;  3S7J A;  3F9X A;  3TG5 A;  3N71 A;  5JJ0 A;  2W5Y A;  5JHN A;  3M56 A;  3QWV A;  3CBO A;  4YPE A;  3VV0 A;  3S7D A;  3KMA A;  3RQ4 A;  4I51 A;  3QWW A;  3S7F A;  4MI5 A;  4WUY A;  1N6A A;  4J83 A;  3OOI A;  3RIB A;  3F9Y A;  5LSZ A;  1MT6 A;  4H12 A;  5JIN A;  1MVX A;  4O6F A;  4IJ8 A;  3FPD A;  3M55 A;  1ZKK A;  4YNM A;  3MO0 A;  3K5K A;  5JIY A;  4YPU A;  3M53 A;  4NJ5 A;  3IHX A;  4IJD A;  4YND A;  2R3A A;  5EX0 A;  4Z4P A;  5T0M A;  3MEK A;  5CCM A;  3M5A A;  1XQH A;  1N3J A;  3M59 A; 
#chains in the Genus database with same CATH topology
 4E47 A;  3CBP A;  4J7F A;  5HQ8 A;  3KMT A;  4JDS A;  5TTF A;  3OXG A;  4QEN A;  4QEO A;  5HI7 A;  5F5E A;  3VUZ A;  3CBM A;  4O30 A;  3S7B A;  1H3I A;  3KMJ A;  5EX3 A;  3SWC A;  2F69 A;  5ARG A;  5CPR B;  4YPA A;  4AU7 A;  3RJW A;  3M57 A;  1N6C A;  3RAY A;  2JV0 A;  4FMU A;  1ML9 A;  3PDN A;  4NVQ A;  5EG2 A;  5F59 A;  1O9S A;  4QEP A;  5KJN A;  4BUP A;  3DB5 A;  4YNP A;  2G46 A;  2W5Z A;  3OXF A;  2BQZ A;  3HNA A;  3MO5 A;  5TEG A;  2QPW A;  3OXL A;  3F9Z A;  3OPE A;  2O8J A;  5KJM A;  4J8O A;  1MVH A;  3F9W A;  3QWP A;  5F6K C;  2IGQ A;  4C1Q A;  4J7I A;  3M54 A;  5KJL A;  4LDG A;  1PEG A;  2RFI A;  3S8P A;  3BO5 A;  5ARF A;  3DAL A;  5TH7 A;  4JLG A;  4RZ0 A;  5F6L A;  5T0K A;  5LSX A;  3EP0 A;  3OS5 A;  1MUF A;  5AYF A;  4MI0 A;  3RU0 A;  3MO2 A;  3SW9 A;  3TG4 A;  5CCL A;  3M58 A;  5KJK A;  5T5G A;  3S7J A;  3F9X A;  3TG5 A;  3N71 A;  5JJ0 A;  2W5Y A;  5JHN A;  3M56 A;  3QWV A;  3CBO A;  4YPE A;  3VV0 A;  3S7D A;  3KMA A;  3RQ4 A;  4I51 A;  3QWW A;  3S7F A;  4MI5 A;  4WUY A;  1N6A A;  4J83 A;  3OOI A;  3RIB A;  3F9Y A;  5LSZ A;  1MT6 A;  4H12 A;  5JIN A;  1MVX A;  4O6F A;  4IJ8 A;  3FPD A;  3M55 A;  1ZKK A;  4YNM A;  3MO0 A;  3K5K A;  5JIY A;  4YPU A;  3M53 A;  4NJ5 A;  3IHX A;  4IJD A;  4YND A;  2R3A A;  5EX0 A;  4Z4P A;  5T0M A;  3MEK A;  5CCM A;  3M5A A;  1XQH A;  1N3J A;  3M59 A; 
#chains in the Genus database with same CATH homology
 4E47 A;  3CBP A;  4J7F A;  5HQ8 A;  3KMT A;  4JDS A;  5TTF A;  3OXG A;  4QEN A;  4QEO A;  5HI7 A;  5F5E A;  3VUZ A;  3CBM A;  4O30 A;  3S7B A;  1H3I A;  3KMJ A;  5EX3 A;  3SWC A;  2F69 A;  5ARG A;  5CPR B;  4YPA A;  4AU7 A;  3RJW A;  3M57 A;  1N6C A;  3RAY A;  2JV0 A;  4FMU A;  1ML9 A;  3PDN A;  4NVQ A;  5EG2 A;  5F59 A;  1O9S A;  4QEP A;  5KJN A;  4BUP A;  3DB5 A;  4YNP A;  2G46 A;  2W5Z A;  3OXF A;  2BQZ A;  3HNA A;  3MO5 A;  5TEG A;  2QPW A;  3OXL A;  3F9Z A;  3OPE A;  2O8J A;  5KJM A;  4J8O A;  1MVH A;  3F9W A;  3QWP A;  5F6K C;  2IGQ A;  4C1Q A;  4J7I A;  3M54 A;  5KJL A;  4LDG A;  1PEG A;  2RFI A;  3S8P A;  3BO5 A;  5ARF A;  3DAL A;  5TH7 A;  4JLG A;  4RZ0 A;  5F6L A;  5T0K A;  5LSX A;  3EP0 A;  3OS5 A;  1MUF A;  5AYF A;  4MI0 A;  3RU0 A;  3MO2 A;  3SW9 A;  3TG4 A;  5CCL A;  3M58 A;  5KJK A;  5T5G A;  3S7J A;  3F9X A;  3TG5 A;  3N71 A;  5JJ0 A;  2W5Y A;  5JHN A;  3M56 A;  3QWV A;  3CBO A;  4YPE A;  3VV0 A;  3S7D A;  3KMA A;  3RQ4 A;  4I51 A;  3QWW A;  3S7F A;  4MI5 A;  4WUY A;  1N6A A;  4J83 A;  3OOI A;  3RIB A;  3F9Y A;  5LSZ A;  1MT6 A;  4H12 A;  5JIN A;  1MVX A;  4O6F A;  4IJ8 A;  3FPD A;  3M55 A;  1ZKK A;  4YNM A;  3MO0 A;  3K5K A;  5JIY A;  4YPU A;  3M53 A;  4NJ5 A;  3IHX A;  4IJD A;  4YND A;  2R3A A;  5EX0 A;  4Z4P A;  5T0M A;  3MEK A;  5CCM A;  3M5A A;  1XQH A;  1N3J A;  3M59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...