3DB5A

Crystal structure of methyltransferase domain of human pr domain-containing protein 4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
124
Chain Sequence
b'PVTFVPDTPIESRARLSLPKQLVLRQSIEVGVWTGETIPVRTCFGPLIGQQSHVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 4
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 4.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 124
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3db5A00
4YPUA 4YNPA 5EX0A 3RU0A 3TG4A 4H12A 5KJNA 5CCMA 4QENA 1PEGA 3M55A 5F6KC 4BUPA 3M5AA 4YNDA 5EX3A 3OOIA 5EG2A 4LDGA 4O6FA 3OS5A 1N6CA 4C1QA 3MO2A 1H3IA 5HQ8A 3F9XA 3BO5A 4JLGA 3K5KA 2RFIA 1XQHA 3M59A 3QWVA 4WUYA 1N6AA 3OXGA 3S7JA 5HI7A 3CBMA 3EP0A 3KMJA 4RZ0A 5TH7A 5CCLA 3FPDA 3OXLA 3RIBA 2QPWA 1MT6A 3OPEA 4IJDA 3OXFA 5JIYA 3M58A 3S7FA 4YPEA 4E47A 2W5YA 3F9WA 3M54A 5JINA 2IGQA 2R3AA 5F6LA 1MUFA 1MVHA 5LSXA 4QEPA 5LSZA 4MI0A 3SWCA 5KJKA 4NVQA 5T5GA 5KJMA 4IJ8A 4NJ5A 2JV0A 4J8OA 3MO0A 3CBPA 2O8JA 2F69A 5T0KA 3KMAA 3QWWA 3VUZA 4I51A 3RQ4A 3CBOA 1N3JA 1MVXA 5ARGA 3RAYA 3SW9A 1ZKKA 5TTFA 4AU7A 2W5ZA 3DB5A 3S7DA 3M57A 3TG5A 5T0MA 5F59A 3N71A 2G46A 3MEKA 4MI5A 1ML9A 3VV0A 4YNMA 1O9SA 3QWPA 4Z4PA 4YPAA 3F9ZA 3KMTA 5AYFA 3F9YA 5JHNA 5ARFA 4QEOA 4J7IA 3RJWA 3IHXA 3S8PA 5KJLA 3M56A 4O30A 5TEGA 3MO5A 2BQZA 3PDNA 4J83A 3HNAA 3DALA 3S7BA 4J7FA 4JDSA 5F5EA 5JJ0A 5CPRB 4FMUA 3M53A
chains in the Genus database with same CATH superfamily
4YPUA 4YNPA 5EX0A 3RU0A 3TG4A 4H12A 5KJNA 5CCMA 4QENA 1PEGA 3M55A 5F6KC 4BUPA 3M5AA 4YNDA 5EX3A 3OOIA 5EG2A 4LDGA 4O6FA 3OS5A 1N6CA 4C1QA 3MO2A 1H3IA 5HQ8A 3F9XA 3BO5A 4JLGA 3K5KA 2RFIA 1XQHA 3M59A 3QWVA 4WUYA 1N6AA 3OXGA 3S7JA 5HI7A 3CBMA 3EP0A 3KMJA 4RZ0A 5TH7A 5CCLA 3FPDA 3OXLA 3RIBA 2QPWA 1MT6A 3OPEA 4IJDA 3OXFA 5JIYA 3M58A 3S7FA 4YPEA 4E47A 2W5YA 3F9WA 3M54A 5JINA 2IGQA 2R3AA 5F6LA 1MUFA 1MVHA 5LSXA 4QEPA 5LSZA 4MI0A 3SWCA 5KJKA 4NVQA 5T5GA 5KJMA 4IJ8A 4NJ5A 2JV0A 4J8OA 3MO0A 3CBPA 2O8JA 2F69A 5T0KA 3KMAA 3QWWA 3VUZA 4I51A 3RQ4A 3CBOA 1N3JA 1MVXA 5ARGA 3RAYA 3SW9A 1ZKKA 5TTFA 4AU7A 2W5ZA 3DB5A 3S7DA 3M57A 3TG5A 5T0MA 5F59A 3N71A 2G46A 3MEKA 4MI5A 1ML9A 3VV0A 4YNMA 1O9SA 3QWPA 4Z4PA 4YPAA 3F9ZA 3KMTA 5AYFA 3F9YA 5JHNA 5ARFA 4QEOA 4J7IA 3RJWA 3IHXA 3S8PA 5KJLA 3M56A 4O30A 5TEGA 3MO5A 2BQZA 3PDNA 4J83A 3HNAA 3DALA 3S7BA 4J7FA 4JDSA 5F5EA 5JJ0A 5CPRB 4FMUA 3M53A
chains in the Genus database with same CATH topology
4YPUA 4YNPA 5EX0A 3RU0A 3TG4A 4H12A 5KJNA 5CCMA 4QENA 1PEGA 3M55A 5F6KC 4BUPA 3M5AA 4YNDA 5EX3A 3OOIA 5EG2A 4LDGA 4O6FA 3OS5A 1N6CA 4C1QA 3MO2A 1H3IA 5HQ8A 3F9XA 3BO5A 4JLGA 3K5KA 2RFIA 1XQHA 3M59A 3QWVA 4WUYA 1N6AA 3OXGA 3S7JA 5HI7A 3CBMA 3EP0A 3KMJA 4RZ0A 5TH7A 5CCLA 3FPDA 3OXLA 3RIBA 2QPWA 1MT6A 3OPEA 4IJDA 3OXFA 5JIYA 3M58A 3S7FA 4YPEA 4E47A 2W5YA 3F9WA 3M54A 5JINA 2IGQA 2R3AA 5F6LA 1MUFA 1MVHA 5LSXA 4QEPA 5LSZA 4MI0A 3SWCA 5KJKA 4NVQA 5T5GA 5KJMA 4IJ8A 4NJ5A 2JV0A 4J8OA 3MO0A 3CBPA 2O8JA 2F69A 5T0KA 3KMAA 3QWWA 3VUZA 4I51A 3RQ4A 3CBOA 1N3JA 1MVXA 5ARGA 3RAYA 3SW9A 1ZKKA 5TTFA 4AU7A 2W5ZA 3DB5A 3S7DA 3M57A 3TG5A 5T0MA 5F59A 3N71A 2G46A 3MEKA 4MI5A 1ML9A 3VV0A 4YNMA 1O9SA 3QWPA 4Z4PA 4YPAA 3F9ZA 3KMTA 5AYFA 3F9YA 5JHNA 5ARFA 4QEOA 4J7IA 3RJWA 3IHXA 3S8PA 5KJLA 3M56A 4O30A 5TEGA 3MO5A 2BQZA 3PDNA 4J83A 3HNAA 3DALA 3S7BA 4J7FA 4JDSA 5F5EA 5JJ0A 5CPRB 4FMUA 3M53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPU A;  4YNP A;  5EX0 A;  3RU0 A;  3TG4 A;  4H12 A;  5KJN A;  5CCM A;  4QEN A;  1PEG A;  3M55 A;  5F6K C;  4BUP A;  3M5A A;  4YND A;  5EX3 A;  3OOI A;  5EG2 A;  4LDG A;  4O6F A;  3OS5 A;  1N6C A;  4C1Q A;  3MO2 A;  1H3I A;  5HQ8 A;  3F9X A;  3BO5 A;  4JLG A;  3K5K A;  2RFI A;  1XQH A;  3M59 A;  3QWV A;  4WUY A;  1N6A A;  3OXG A;  3S7J A;  5HI7 A;  3CBM A;  3EP0 A;  3KMJ A;  4RZ0 A;  5TH7 A;  5CCL A;  3FPD A;  3OXL A;  3RIB A;  2QPW A;  1MT6 A;  3OPE A;  4IJD A;  3OXF A;  5JIY A;  3M58 A;  3S7F A;  4YPE A;  4E47 A;  2W5Y A;  3F9W A;  3M54 A;  5JIN A;  2IGQ A;  2R3A A;  5F6L A;  1MUF A;  1MVH A;  5LSX A;  4QEP A;  5LSZ A;  4MI0 A;  3SWC A;  5KJK A;  4NVQ A;  5T5G A;  5KJM A;  4IJ8 A;  4NJ5 A;  2JV0 A;  4J8O A;  3MO0 A;  3CBP A;  2O8J A;  2F69 A;  5T0K A;  3KMA A;  3QWW A;  3VUZ A;  4I51 A;  3RQ4 A;  3CBO A;  1N3J A;  1MVX A;  5ARG A;  3RAY A;  3SW9 A;  1ZKK A;  5TTF A;  4AU7 A;  2W5Z A;  3DB5 A;  3S7D A;  3M57 A;  3TG5 A;  5T0M A;  5F59 A;  3N71 A;  2G46 A;  3MEK A;  4MI5 A;  1ML9 A;  3VV0 A;  4YNM A;  1O9S A;  3QWP A;  4Z4P A;  4YPA A;  3F9Z A;  3KMT A;  5AYF A;  3F9Y A;  5JHN A;  5ARF A;  4QEO A;  4J7I A;  3RJW A;  3IHX A;  3S8P A;  5KJL A;  3M56 A;  4O30 A;  5TEG A;  3MO5 A;  2BQZ A;  3PDN A;  4J83 A;  3HNA A;  3DAL A;  3S7B A;  4J7F A;  4JDS A;  5F5E A;  5JJ0 A;  5CPR B;  4FMU A;  3M53 A; 
#chains in the Genus database with same CATH topology
 4YPU A;  4YNP A;  5EX0 A;  3RU0 A;  3TG4 A;  4H12 A;  5KJN A;  5CCM A;  4QEN A;  1PEG A;  3M55 A;  5F6K C;  4BUP A;  3M5A A;  4YND A;  5EX3 A;  3OOI A;  5EG2 A;  4LDG A;  4O6F A;  3OS5 A;  1N6C A;  4C1Q A;  3MO2 A;  1H3I A;  5HQ8 A;  3F9X A;  3BO5 A;  4JLG A;  3K5K A;  2RFI A;  1XQH A;  3M59 A;  3QWV A;  4WUY A;  1N6A A;  3OXG A;  3S7J A;  5HI7 A;  3CBM A;  3EP0 A;  3KMJ A;  4RZ0 A;  5TH7 A;  5CCL A;  3FPD A;  3OXL A;  3RIB A;  2QPW A;  1MT6 A;  3OPE A;  4IJD A;  3OXF A;  5JIY A;  3M58 A;  3S7F A;  4YPE A;  4E47 A;  2W5Y A;  3F9W A;  3M54 A;  5JIN A;  2IGQ A;  2R3A A;  5F6L A;  1MUF A;  1MVH A;  5LSX A;  4QEP A;  5LSZ A;  4MI0 A;  3SWC A;  5KJK A;  4NVQ A;  5T5G A;  5KJM A;  4IJ8 A;  4NJ5 A;  2JV0 A;  4J8O A;  3MO0 A;  3CBP A;  2O8J A;  2F69 A;  5T0K A;  3KMA A;  3QWW A;  3VUZ A;  4I51 A;  3RQ4 A;  3CBO A;  1N3J A;  1MVX A;  5ARG A;  3RAY A;  3SW9 A;  1ZKK A;  5TTF A;  4AU7 A;  2W5Z A;  3DB5 A;  3S7D A;  3M57 A;  3TG5 A;  5T0M A;  5F59 A;  3N71 A;  2G46 A;  3MEK A;  4MI5 A;  1ML9 A;  3VV0 A;  4YNM A;  1O9S A;  3QWP A;  4Z4P A;  4YPA A;  3F9Z A;  3KMT A;  5AYF A;  3F9Y A;  5JHN A;  5ARF A;  4QEO A;  4J7I A;  3RJW A;  3IHX A;  3S8P A;  5KJL A;  3M56 A;  4O30 A;  5TEG A;  3MO5 A;  2BQZ A;  3PDN A;  4J83 A;  3HNA A;  3DAL A;  3S7B A;  4J7F A;  4JDS A;  5F5E A;  5JJ0 A;  5CPR B;  4FMU A;  3M53 A; 
#chains in the Genus database with same CATH homology
 4YPU A;  4YNP A;  5EX0 A;  3RU0 A;  3TG4 A;  4H12 A;  5KJN A;  5CCM A;  4QEN A;  1PEG A;  3M55 A;  5F6K C;  4BUP A;  3M5A A;  4YND A;  5EX3 A;  3OOI A;  5EG2 A;  4LDG A;  4O6F A;  3OS5 A;  1N6C A;  4C1Q A;  3MO2 A;  1H3I A;  5HQ8 A;  3F9X A;  3BO5 A;  4JLG A;  3K5K A;  2RFI A;  1XQH A;  3M59 A;  3QWV A;  4WUY A;  1N6A A;  3OXG A;  3S7J A;  5HI7 A;  3CBM A;  3EP0 A;  3KMJ A;  4RZ0 A;  5TH7 A;  5CCL A;  3FPD A;  3OXL A;  3RIB A;  2QPW A;  1MT6 A;  3OPE A;  4IJD A;  3OXF A;  5JIY A;  3M58 A;  3S7F A;  4YPE A;  4E47 A;  2W5Y A;  3F9W A;  3M54 A;  5JIN A;  2IGQ A;  2R3A A;  5F6L A;  1MUF A;  1MVH A;  5LSX A;  4QEP A;  5LSZ A;  4MI0 A;  3SWC A;  5KJK A;  4NVQ A;  5T5G A;  5KJM A;  4IJ8 A;  4NJ5 A;  2JV0 A;  4J8O A;  3MO0 A;  3CBP A;  2O8J A;  2F69 A;  5T0K A;  3KMA A;  3QWW A;  3VUZ A;  4I51 A;  3RQ4 A;  3CBO A;  1N3J A;  1MVX A;  5ARG A;  3RAY A;  3SW9 A;  1ZKK A;  5TTF A;  4AU7 A;  2W5Z A;  3DB5 A;  3S7D A;  3M57 A;  3TG5 A;  5T0M A;  5F59 A;  3N71 A;  2G46 A;  3MEK A;  4MI5 A;  1ML9 A;  3VV0 A;  4YNM A;  1O9S A;  3QWP A;  4Z4P A;  4YPA A;  3F9Z A;  3KMT A;  5AYF A;  3F9Y A;  5JHN A;  5ARF A;  4QEO A;  4J7I A;  3RJW A;  3IHX A;  3S8P A;  5KJL A;  3M56 A;  4O30 A;  5TEG A;  3MO5 A;  2BQZ A;  3PDN A;  4J83 A;  3HNA A;  3DAL A;  3S7B A;  4J7F A;  4JDS A;  5F5E A;  5JJ0 A;  5CPR B;  4FMU A;  3M53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...