3DB5A

Crystal structure of methyltransferase domain of human pr domain-containing protein 4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
124
Chain Sequence
PVTFVPDTPIESRARLSLPKQLVLRQSIEVGVWTGETIPVRTCFGPLIGQQSHVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 4.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 4
total genus 22
structure length 124
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3db5A00
4NJ5A 1ML9A 5HI7A 3VV0A 5KJLA 3MO0A 3QWPA 1N6AA 2R3AA 5EX0A 5TH7A 4O6FA 3OS5A 5HQ8A 5EG2A 4LDGA 5TEGA 3TG5A 3EP0A 3F9XA 4YNMA 5CCLA 4YPUA 5T0KA 5KJNA 4FMUA 3RQ4A 3DB5A 3QWWA 2JV0A 4MI0A 3PDNA 1ZKKA 4IJ8A 3N71A 5ARFA 3OOIA 3RU0A 1MUFA 4RZ0A 4NVQA 3OPEA 1PEGA 5F59A 1H3IA 3M56A 3VUZA 1MT6A 2W5YA 3KMJA 3F9ZA 3RAYA 2RFIA 1MVXA 2QPWA 3CBPA 4J83A 3M5AA 2F69A 4J7FA 3K5KA 3FPDA 3OXLA 5JIYA 4WUYA 3S7FA 3F9WA 3S7DA 5TTFA 3M55A 3QWVA 5KJMA 3SW9A 2BQZA 5F5EA 1O9SA 5LSZA 3KMAA 1MVHA 3CBOA 4J7IA 3SWCA 4JLGA 5CCMA 4MI5A 5JHNA 4J8OA 1N3JA 4JDSA 5AYFA 3S7BA 4O30A 3F9YA 3HNAA 3IHXA 3RIBA 4BUPA 3CBMA 5F6KC 5T0MA 3M57A 3M58A 5CPRB 4I51A 5KJKA 4IJDA 4YPEA 4QEOA 4C1QA 3TG4A 2G46A 2W5ZA 4H12A 3S7JA 3MO2A 3BO5A 5ARGA 2IGQA 4YPAA 4QENA 5F6LA 5T5GA 3S8PA 1N6CA 3RJWA 5LSXA 5JINA 4YNPA 3M54A 3OXFA 3MO5A 5EX3A 3KMTA 2O8JA 3OXGA 4AU7A 4E47A 3MEKA 4YNDA 3M53A 1XQHA 4QEPA 5JJ0A 3M59A 4Z4PA 3DALA
chains in the Genus database with same CATH superfamily
4NJ5A 1ML9A 5HI7A 3VV0A 5KJLA 3MO0A 3QWPA 1N6AA 2R3AA 5EX0A 5TH7A 4O6FA 3OS5A 5HQ8A 5EG2A 4LDGA 5TEGA 3TG5A 3EP0A 3F9XA 4YNMA 5CCLA 4YPUA 5T0KA 5KJNA 4FMUA 3RQ4A 3DB5A 3QWWA 2JV0A 4MI0A 3PDNA 1ZKKA 4IJ8A 3N71A 5ARFA 3OOIA 3RU0A 1MUFA 4RZ0A 4NVQA 3OPEA 1PEGA 5F59A 1H3IA 3M56A 3VUZA 1MT6A 2W5YA 3KMJA 3F9ZA 3RAYA 2RFIA 1MVXA 2QPWA 3CBPA 4J83A 3M5AA 2F69A 4J7FA 3K5KA 3FPDA 3OXLA 5JIYA 4WUYA 3S7FA 3F9WA 3S7DA 5TTFA 3M55A 3QWVA 5KJMA 3SW9A 2BQZA 5F5EA 1O9SA 5LSZA 3KMAA 1MVHA 3CBOA 4J7IA 3SWCA 4JLGA 5CCMA 4MI5A 5JHNA 4J8OA 1N3JA 4JDSA 5AYFA 3S7BA 4O30A 3F9YA 3HNAA 3IHXA 3RIBA 4BUPA 3CBMA 5F6KC 5T0MA 3M57A 3M58A 5CPRB 4I51A 5KJKA 4IJDA 4YPEA 4QEOA 4C1QA 3TG4A 2G46A 2W5ZA 4H12A 3S7JA 3MO2A 3BO5A 5ARGA 2IGQA 4YPAA 4QENA 5F6LA 5T5GA 3S8PA 1N6CA 3RJWA 5LSXA 5JINA 4YNPA 3M54A 3OXFA 3MO5A 5EX3A 3KMTA 2O8JA 3OXGA 4AU7A 4E47A 3MEKA 4YNDA 3M53A 1XQHA 4QEPA 5JJ0A 3M59A 4Z4PA 3DALA
chains in the Genus database with same CATH topology
4NJ5A 1ML9A 5HI7A 3VV0A 5KJLA 3MO0A 3QWPA 1N6AA 2R3AA 5EX0A 5TH7A 4O6FA 3OS5A 5HQ8A 5EG2A 4LDGA 5TEGA 3TG5A 3EP0A 3F9XA 4YNMA 5CCLA 4YPUA 5T0KA 5KJNA 4FMUA 3RQ4A 3DB5A 3QWWA 2JV0A 4MI0A 3PDNA 1ZKKA 4IJ8A 3N71A 5ARFA 3OOIA 3RU0A 1MUFA 4RZ0A 4NVQA 3OPEA 1PEGA 5F59A 1H3IA 3M56A 3VUZA 1MT6A 2W5YA 3KMJA 3F9ZA 3RAYA 2RFIA 1MVXA 2QPWA 3CBPA 4J83A 3M5AA 2F69A 4J7FA 3K5KA 3FPDA 3OXLA 5JIYA 4WUYA 3S7FA 3F9WA 3S7DA 5TTFA 3M55A 3QWVA 5KJMA 3SW9A 2BQZA 5F5EA 1O9SA 5LSZA 3KMAA 1MVHA 3CBOA 4J7IA 3SWCA 4JLGA 5CCMA 4MI5A 5JHNA 4J8OA 1N3JA 4JDSA 5AYFA 3S7BA 4O30A 3F9YA 3HNAA 3IHXA 3RIBA 4BUPA 3CBMA 5F6KC 5T0MA 3M57A 3M58A 5CPRB 4I51A 5KJKA 4IJDA 4YPEA 4QEOA 4C1QA 3TG4A 2G46A 2W5ZA 4H12A 3S7JA 3MO2A 3BO5A 5ARGA 2IGQA 4YPAA 4QENA 5F6LA 5T5GA 3S8PA 1N6CA 3RJWA 5LSXA 5JINA 4YNPA 3M54A 3OXFA 3MO5A 5EX3A 3KMTA 2O8JA 3OXGA 4AU7A 4E47A 3MEKA 4YNDA 3M53A 1XQHA 4QEPA 5JJ0A 3M59A 4Z4PA 3DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  1ML9 A;  5HI7 A;  3VV0 A;  5KJL A;  3MO0 A;  3QWP A;  1N6A A;  2R3A A;  5EX0 A;  5TH7 A;  4O6F A;  3OS5 A;  5HQ8 A;  5EG2 A;  4LDG A;  5TEG A;  3TG5 A;  3EP0 A;  3F9X A;  4YNM A;  5CCL A;  4YPU A;  5T0K A;  5KJN A;  4FMU A;  3RQ4 A;  3DB5 A;  3QWW A;  2JV0 A;  4MI0 A;  3PDN A;  1ZKK A;  4IJ8 A;  3N71 A;  5ARF A;  3OOI A;  3RU0 A;  1MUF A;  4RZ0 A;  4NVQ A;  3OPE A;  1PEG A;  5F59 A;  1H3I A;  3M56 A;  3VUZ A;  1MT6 A;  2W5Y A;  3KMJ A;  3F9Z A;  3RAY A;  2RFI A;  1MVX A;  2QPW A;  3CBP A;  4J83 A;  3M5A A;  2F69 A;  4J7F A;  3K5K A;  3FPD A;  3OXL A;  5JIY A;  4WUY A;  3S7F A;  3F9W A;  3S7D A;  5TTF A;  3M55 A;  3QWV A;  5KJM A;  3SW9 A;  2BQZ A;  5F5E A;  1O9S A;  5LSZ A;  3KMA A;  1MVH A;  3CBO A;  4J7I A;  3SWC A;  4JLG A;  5CCM A;  4MI5 A;  5JHN A;  4J8O A;  1N3J A;  4JDS A;  5AYF A;  3S7B A;  4O30 A;  3F9Y A;  3HNA A;  3IHX A;  3RIB A;  4BUP A;  3CBM A;  5F6K C;  5T0M A;  3M57 A;  3M58 A;  5CPR B;  4I51 A;  5KJK A;  4IJD A;  4YPE A;  4QEO A;  4C1Q A;  3TG4 A;  2G46 A;  2W5Z A;  4H12 A;  3S7J A;  3MO2 A;  3BO5 A;  5ARG A;  2IGQ A;  4YPA A;  4QEN A;  5F6L A;  5T5G A;  3S8P A;  1N6C A;  3RJW A;  5LSX A;  5JIN A;  4YNP A;  3M54 A;  3OXF A;  3MO5 A;  5EX3 A;  3KMT A;  2O8J A;  3OXG A;  4AU7 A;  4E47 A;  3MEK A;  4YND A;  3M53 A;  1XQH A;  4QEP A;  5JJ0 A;  3M59 A;  4Z4P A;  3DAL A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  1ML9 A;  5HI7 A;  3VV0 A;  5KJL A;  3MO0 A;  3QWP A;  1N6A A;  2R3A A;  5EX0 A;  5TH7 A;  4O6F A;  3OS5 A;  5HQ8 A;  5EG2 A;  4LDG A;  5TEG A;  3TG5 A;  3EP0 A;  3F9X A;  4YNM A;  5CCL A;  4YPU A;  5T0K A;  5KJN A;  4FMU A;  3RQ4 A;  3DB5 A;  3QWW A;  2JV0 A;  4MI0 A;  3PDN A;  1ZKK A;  4IJ8 A;  3N71 A;  5ARF A;  3OOI A;  3RU0 A;  1MUF A;  4RZ0 A;  4NVQ A;  3OPE A;  1PEG A;  5F59 A;  1H3I A;  3M56 A;  3VUZ A;  1MT6 A;  2W5Y A;  3KMJ A;  3F9Z A;  3RAY A;  2RFI A;  1MVX A;  2QPW A;  3CBP A;  4J83 A;  3M5A A;  2F69 A;  4J7F A;  3K5K A;  3FPD A;  3OXL A;  5JIY A;  4WUY A;  3S7F A;  3F9W A;  3S7D A;  5TTF A;  3M55 A;  3QWV A;  5KJM A;  3SW9 A;  2BQZ A;  5F5E A;  1O9S A;  5LSZ A;  3KMA A;  1MVH A;  3CBO A;  4J7I A;  3SWC A;  4JLG A;  5CCM A;  4MI5 A;  5JHN A;  4J8O A;  1N3J A;  4JDS A;  5AYF A;  3S7B A;  4O30 A;  3F9Y A;  3HNA A;  3IHX A;  3RIB A;  4BUP A;  3CBM A;  5F6K C;  5T0M A;  3M57 A;  3M58 A;  5CPR B;  4I51 A;  5KJK A;  4IJD A;  4YPE A;  4QEO A;  4C1Q A;  3TG4 A;  2G46 A;  2W5Z A;  4H12 A;  3S7J A;  3MO2 A;  3BO5 A;  5ARG A;  2IGQ A;  4YPA A;  4QEN A;  5F6L A;  5T5G A;  3S8P A;  1N6C A;  3RJW A;  5LSX A;  5JIN A;  4YNP A;  3M54 A;  3OXF A;  3MO5 A;  5EX3 A;  3KMT A;  2O8J A;  3OXG A;  4AU7 A;  4E47 A;  3MEK A;  4YND A;  3M53 A;  1XQH A;  4QEP A;  5JJ0 A;  3M59 A;  4Z4P A;  3DAL A; 
#chains in the Genus database with same CATH homology
 4NJ5 A;  1ML9 A;  5HI7 A;  3VV0 A;  5KJL A;  3MO0 A;  3QWP A;  1N6A A;  2R3A A;  5EX0 A;  5TH7 A;  4O6F A;  3OS5 A;  5HQ8 A;  5EG2 A;  4LDG A;  5TEG A;  3TG5 A;  3EP0 A;  3F9X A;  4YNM A;  5CCL A;  4YPU A;  5T0K A;  5KJN A;  4FMU A;  3RQ4 A;  3DB5 A;  3QWW A;  2JV0 A;  4MI0 A;  3PDN A;  1ZKK A;  4IJ8 A;  3N71 A;  5ARF A;  3OOI A;  3RU0 A;  1MUF A;  4RZ0 A;  4NVQ A;  3OPE A;  1PEG A;  5F59 A;  1H3I A;  3M56 A;  3VUZ A;  1MT6 A;  2W5Y A;  3KMJ A;  3F9Z A;  3RAY A;  2RFI A;  1MVX A;  2QPW A;  3CBP A;  4J83 A;  3M5A A;  2F69 A;  4J7F A;  3K5K A;  3FPD A;  3OXL A;  5JIY A;  4WUY A;  3S7F A;  3F9W A;  3S7D A;  5TTF A;  3M55 A;  3QWV A;  5KJM A;  3SW9 A;  2BQZ A;  5F5E A;  1O9S A;  5LSZ A;  3KMA A;  1MVH A;  3CBO A;  4J7I A;  3SWC A;  4JLG A;  5CCM A;  4MI5 A;  5JHN A;  4J8O A;  1N3J A;  4JDS A;  5AYF A;  3S7B A;  4O30 A;  3F9Y A;  3HNA A;  3IHX A;  3RIB A;  4BUP A;  3CBM A;  5F6K C;  5T0M A;  3M57 A;  3M58 A;  5CPR B;  4I51 A;  5KJK A;  4IJD A;  4YPE A;  4QEO A;  4C1Q A;  3TG4 A;  2G46 A;  2W5Z A;  4H12 A;  3S7J A;  3MO2 A;  3BO5 A;  5ARG A;  2IGQ A;  4YPA A;  4QEN A;  5F6L A;  5T5G A;  3S8P A;  1N6C A;  3RJW A;  5LSX A;  5JIN A;  4YNP A;  3M54 A;  3OXF A;  3MO5 A;  5EX3 A;  3KMT A;  2O8J A;  3OXG A;  4AU7 A;  4E47 A;  3MEK A;  4YND A;  3M53 A;  1XQH A;  4QEP A;  5JJ0 A;  3M59 A;  4Z4P A;  3DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...