3DB5A

Crystal structure of methyltransferase domain of human pr domain-containing protein 4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
124
Chain Sequence
PVTFVPDTPIESRARLSLPKQLVLRQSIEVGVWTGETIPVRTCFGPLIGQQSHVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 4.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 4
total genus 22
structure length 124
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3db5A00
4YPEA 3QWWA 5ARFA 3S7JA 4J7IA 4IJ8A 4Z4PA 5EX0A 5KJNA 1MVHA 5F59A 3HNAA 3KMAA 3OXGA 2F69A 2O8JA 3M56A 3S7BA 2IGQA 3N71A 3OXLA 4QENA 4MI0A 3M53A 3S8PA 1XQHA 3VUZA 2R3AA 4YNPA 3DALA 3OOIA 3M55A 3KMTA 3CBPA 3MO5A 4QEOA 2W5YA 3OXFA 5F6LA 3M59A 3PDNA 5CCLA 5F5EA 3RU0A 5T0MA 1ML9A 2G46A 5KJKA 5TEGA 1N3JA 3F9ZA 5JHNA 2JV0A 5LSXA 3QWPA 5HI7A 3SWCA 3RQ4A 4YNMA 1H3IA 3F9WA 1PEGA 3M54A 1N6AA 4MI5A 1N6CA 5JINA 3BO5A 3DB5A 3TG5A 5CCMA 3IHXA 3SW9A 4YPAA 4H12A 4QEPA 5HQ8A 4NJ5A 3RIBA 4J83A 4C1QA 5T0KA 4J7FA 3F9YA 3FPDA 3EP0A 3M5AA 3MO2A 4FMUA 3M58A 4I51A 5T5GA 3RJWA 5LSZA 3K5KA 5CPRB 5JJ0A 3S7FA 3F9XA 3VV0A 5TTFA 3OS5A 5F6KC 4O6FA 4LDGA 4RZ0A 5EX3A 3TG4A 3M57A 4BUPA 3RAYA 4IJDA 5ARGA 1MVXA 1ZKKA 3CBOA 4NVQA 4WUYA 5JIYA 3CBMA 4JDSA 3QWVA 4J8OA 2BQZA 1MT6A 3MEKA 2RFIA 5AYFA 5KJMA 5KJLA 3S7DA 3KMJA 4E47A 4YPUA 2W5ZA 4O30A 3OPEA 3MO0A 5TH7A 1O9SA 4AU7A 1MUFA 2QPWA 5EG2A 4YNDA 4JLGA
chains in the Genus database with same CATH superfamily
4YPEA 3QWWA 5ARFA 3S7JA 4J7IA 4IJ8A 4Z4PA 5EX0A 5KJNA 1MVHA 5F59A 3HNAA 3KMAA 3OXGA 2F69A 2O8JA 3M56A 3S7BA 2IGQA 3N71A 3OXLA 4QENA 4MI0A 3M53A 3S8PA 1XQHA 3VUZA 2R3AA 4YNPA 3DALA 3OOIA 3M55A 3KMTA 3CBPA 3MO5A 4QEOA 2W5YA 3OXFA 5F6LA 3M59A 3PDNA 5CCLA 5F5EA 3RU0A 5T0MA 1ML9A 2G46A 5KJKA 5TEGA 1N3JA 3F9ZA 5JHNA 2JV0A 5LSXA 3QWPA 5HI7A 3SWCA 3RQ4A 4YNMA 1H3IA 3F9WA 1PEGA 3M54A 1N6AA 4MI5A 1N6CA 5JINA 3BO5A 3DB5A 3TG5A 5CCMA 3IHXA 3SW9A 4YPAA 4H12A 4QEPA 5HQ8A 4NJ5A 3RIBA 4J83A 4C1QA 5T0KA 4J7FA 3F9YA 3FPDA 3EP0A 3M5AA 3MO2A 4FMUA 3M58A 4I51A 5T5GA 3RJWA 5LSZA 3K5KA 5CPRB 5JJ0A 3S7FA 3F9XA 3VV0A 5TTFA 3OS5A 5F6KC 4O6FA 4LDGA 4RZ0A 5EX3A 3TG4A 3M57A 4BUPA 3RAYA 4IJDA 5ARGA 1MVXA 1ZKKA 3CBOA 4NVQA 4WUYA 5JIYA 3CBMA 4JDSA 3QWVA 4J8OA 2BQZA 1MT6A 3MEKA 2RFIA 5AYFA 5KJMA 5KJLA 3S7DA 3KMJA 4E47A 4YPUA 2W5ZA 4O30A 3OPEA 3MO0A 5TH7A 1O9SA 4AU7A 1MUFA 2QPWA 5EG2A 4YNDA 4JLGA
chains in the Genus database with same CATH topology
4YPEA 3QWWA 5ARFA 3S7JA 4J7IA 4IJ8A 4Z4PA 5EX0A 5KJNA 1MVHA 5F59A 3HNAA 3KMAA 3OXGA 2F69A 2O8JA 3M56A 3S7BA 2IGQA 3N71A 3OXLA 4QENA 4MI0A 3M53A 3S8PA 1XQHA 3VUZA 2R3AA 4YNPA 3DALA 3OOIA 3M55A 3KMTA 3CBPA 3MO5A 4QEOA 2W5YA 3OXFA 5F6LA 3M59A 3PDNA 5CCLA 5F5EA 3RU0A 5T0MA 1ML9A 2G46A 5KJKA 5TEGA 1N3JA 3F9ZA 5JHNA 2JV0A 5LSXA 3QWPA 5HI7A 3SWCA 3RQ4A 4YNMA 1H3IA 3F9WA 1PEGA 3M54A 1N6AA 4MI5A 1N6CA 5JINA 3BO5A 3DB5A 3TG5A 5CCMA 3IHXA 3SW9A 4YPAA 4H12A 4QEPA 5HQ8A 4NJ5A 3RIBA 4J83A 4C1QA 5T0KA 4J7FA 3F9YA 3FPDA 3EP0A 3M5AA 3MO2A 4FMUA 3M58A 4I51A 5T5GA 3RJWA 5LSZA 3K5KA 5CPRB 5JJ0A 3S7FA 3F9XA 3VV0A 5TTFA 3OS5A 5F6KC 4O6FA 4LDGA 4RZ0A 5EX3A 3TG4A 3M57A 4BUPA 3RAYA 4IJDA 5ARGA 1MVXA 1ZKKA 3CBOA 4NVQA 4WUYA 5JIYA 3CBMA 4JDSA 3QWVA 4J8OA 2BQZA 1MT6A 3MEKA 2RFIA 5AYFA 5KJMA 5KJLA 3S7DA 3KMJA 4E47A 4YPUA 2W5ZA 4O30A 3OPEA 3MO0A 5TH7A 1O9SA 4AU7A 1MUFA 2QPWA 5EG2A 4YNDA 4JLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPE A;  3QWW A;  5ARF A;  3S7J A;  4J7I A;  4IJ8 A;  4Z4P A;  5EX0 A;  5KJN A;  1MVH A;  5F59 A;  3HNA A;  3KMA A;  3OXG A;  2F69 A;  2O8J A;  3M56 A;  3S7B A;  2IGQ A;  3N71 A;  3OXL A;  4QEN A;  4MI0 A;  3M53 A;  3S8P A;  1XQH A;  3VUZ A;  2R3A A;  4YNP A;  3DAL A;  3OOI A;  3M55 A;  3KMT A;  3CBP A;  3MO5 A;  4QEO A;  2W5Y A;  3OXF A;  5F6L A;  3M59 A;  3PDN A;  5CCL A;  5F5E A;  3RU0 A;  5T0M A;  1ML9 A;  2G46 A;  5KJK A;  5TEG A;  1N3J A;  3F9Z A;  5JHN A;  2JV0 A;  5LSX A;  3QWP A;  5HI7 A;  3SWC A;  3RQ4 A;  4YNM A;  1H3I A;  3F9W A;  1PEG A;  3M54 A;  1N6A A;  4MI5 A;  1N6C A;  5JIN A;  3BO5 A;  3DB5 A;  3TG5 A;  5CCM A;  3IHX A;  3SW9 A;  4YPA A;  4H12 A;  4QEP A;  5HQ8 A;  4NJ5 A;  3RIB A;  4J83 A;  4C1Q A;  5T0K A;  4J7F A;  3F9Y A;  3FPD A;  3EP0 A;  3M5A A;  3MO2 A;  4FMU A;  3M58 A;  4I51 A;  5T5G A;  3RJW A;  5LSZ A;  3K5K A;  5CPR B;  5JJ0 A;  3S7F A;  3F9X A;  3VV0 A;  5TTF A;  3OS5 A;  5F6K C;  4O6F A;  4LDG A;  4RZ0 A;  5EX3 A;  3TG4 A;  3M57 A;  4BUP A;  3RAY A;  4IJD A;  5ARG A;  1MVX A;  1ZKK A;  3CBO A;  4NVQ A;  4WUY A;  5JIY A;  3CBM A;  4JDS A;  3QWV A;  4J8O A;  2BQZ A;  1MT6 A;  3MEK A;  2RFI A;  5AYF A;  5KJM A;  5KJL A;  3S7D A;  3KMJ A;  4E47 A;  4YPU A;  2W5Z A;  4O30 A;  3OPE A;  3MO0 A;  5TH7 A;  1O9S A;  4AU7 A;  1MUF A;  2QPW A;  5EG2 A;  4YND A;  4JLG A; 
#chains in the Genus database with same CATH topology
 4YPE A;  3QWW A;  5ARF A;  3S7J A;  4J7I A;  4IJ8 A;  4Z4P A;  5EX0 A;  5KJN A;  1MVH A;  5F59 A;  3HNA A;  3KMA A;  3OXG A;  2F69 A;  2O8J A;  3M56 A;  3S7B A;  2IGQ A;  3N71 A;  3OXL A;  4QEN A;  4MI0 A;  3M53 A;  3S8P A;  1XQH A;  3VUZ A;  2R3A A;  4YNP A;  3DAL A;  3OOI A;  3M55 A;  3KMT A;  3CBP A;  3MO5 A;  4QEO A;  2W5Y A;  3OXF A;  5F6L A;  3M59 A;  3PDN A;  5CCL A;  5F5E A;  3RU0 A;  5T0M A;  1ML9 A;  2G46 A;  5KJK A;  5TEG A;  1N3J A;  3F9Z A;  5JHN A;  2JV0 A;  5LSX A;  3QWP A;  5HI7 A;  3SWC A;  3RQ4 A;  4YNM A;  1H3I A;  3F9W A;  1PEG A;  3M54 A;  1N6A A;  4MI5 A;  1N6C A;  5JIN A;  3BO5 A;  3DB5 A;  3TG5 A;  5CCM A;  3IHX A;  3SW9 A;  4YPA A;  4H12 A;  4QEP A;  5HQ8 A;  4NJ5 A;  3RIB A;  4J83 A;  4C1Q A;  5T0K A;  4J7F A;  3F9Y A;  3FPD A;  3EP0 A;  3M5A A;  3MO2 A;  4FMU A;  3M58 A;  4I51 A;  5T5G A;  3RJW A;  5LSZ A;  3K5K A;  5CPR B;  5JJ0 A;  3S7F A;  3F9X A;  3VV0 A;  5TTF A;  3OS5 A;  5F6K C;  4O6F A;  4LDG A;  4RZ0 A;  5EX3 A;  3TG4 A;  3M57 A;  4BUP A;  3RAY A;  4IJD A;  5ARG A;  1MVX A;  1ZKK A;  3CBO A;  4NVQ A;  4WUY A;  5JIY A;  3CBM A;  4JDS A;  3QWV A;  4J8O A;  2BQZ A;  1MT6 A;  3MEK A;  2RFI A;  5AYF A;  5KJM A;  5KJL A;  3S7D A;  3KMJ A;  4E47 A;  4YPU A;  2W5Z A;  4O30 A;  3OPE A;  3MO0 A;  5TH7 A;  1O9S A;  4AU7 A;  1MUF A;  2QPW A;  5EG2 A;  4YND A;  4JLG A; 
#chains in the Genus database with same CATH homology
 4YPE A;  3QWW A;  5ARF A;  3S7J A;  4J7I A;  4IJ8 A;  4Z4P A;  5EX0 A;  5KJN A;  1MVH A;  5F59 A;  3HNA A;  3KMA A;  3OXG A;  2F69 A;  2O8J A;  3M56 A;  3S7B A;  2IGQ A;  3N71 A;  3OXL A;  4QEN A;  4MI0 A;  3M53 A;  3S8P A;  1XQH A;  3VUZ A;  2R3A A;  4YNP A;  3DAL A;  3OOI A;  3M55 A;  3KMT A;  3CBP A;  3MO5 A;  4QEO A;  2W5Y A;  3OXF A;  5F6L A;  3M59 A;  3PDN A;  5CCL A;  5F5E A;  3RU0 A;  5T0M A;  1ML9 A;  2G46 A;  5KJK A;  5TEG A;  1N3J A;  3F9Z A;  5JHN A;  2JV0 A;  5LSX A;  3QWP A;  5HI7 A;  3SWC A;  3RQ4 A;  4YNM A;  1H3I A;  3F9W A;  1PEG A;  3M54 A;  1N6A A;  4MI5 A;  1N6C A;  5JIN A;  3BO5 A;  3DB5 A;  3TG5 A;  5CCM A;  3IHX A;  3SW9 A;  4YPA A;  4H12 A;  4QEP A;  5HQ8 A;  4NJ5 A;  3RIB A;  4J83 A;  4C1Q A;  5T0K A;  4J7F A;  3F9Y A;  3FPD A;  3EP0 A;  3M5A A;  3MO2 A;  4FMU A;  3M58 A;  4I51 A;  5T5G A;  3RJW A;  5LSZ A;  3K5K A;  5CPR B;  5JJ0 A;  3S7F A;  3F9X A;  3VV0 A;  5TTF A;  3OS5 A;  5F6K C;  4O6F A;  4LDG A;  4RZ0 A;  5EX3 A;  3TG4 A;  3M57 A;  4BUP A;  3RAY A;  4IJD A;  5ARG A;  1MVX A;  1ZKK A;  3CBO A;  4NVQ A;  4WUY A;  5JIY A;  3CBM A;  4JDS A;  3QWV A;  4J8O A;  2BQZ A;  1MT6 A;  3MEK A;  2RFI A;  5AYF A;  5KJM A;  5KJL A;  3S7D A;  3KMJ A;  4E47 A;  4YPU A;  2W5Z A;  4O30 A;  3OPE A;  3MO0 A;  5TH7 A;  1O9S A;  4AU7 A;  1MUF A;  2QPW A;  5EG2 A;  4YND A;  4JLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...