3DBCA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 257
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
287
structure length
261
Chain Sequence
b'KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 72
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbcA01
3PY3A 3NYXA 2JDOA 3KVWA 4J53A 4EKKA 2XBJA 3RWQA 4RVTA 1Y8YA 2Q0BA 3TKIA 2C69A 4NEUA 5L8KA 1JNKA 5EM6A 3P7BA 5BUEA 3LQ5A 4I92A 4JX7A 3W2OA 3RPSA 4D0XA 4RVLA 4F1OA 4HVSA 4H1MA 4UMRA 3IW6A 4R8QA 3NWWA 2NP8A 2R7IA 2P3GX 1UNLA 5ACKA 3AG9A 4XG3A 3UVQA 4DFZE 5DMZA 3TEIA 4QMPA 4IC8A 5AP2A 3FXZA 2XH5A 2G2HA 4GT3A 3NUYA 5E9EA 5HU3A 5AUVA 4LGDA 2OH0E 5E4HA 2R3RA 2OJFE 2VWVA 4ANLA 5EYMA 3QCQA 2R3IA 4ENYA 5BVEA 2YM7A 4FKPA 4QTBA 1FPUA 1XKKA 3NEWA 3LCKA 1F0QA 3EN4A 4XG8A 3KVXA 2XIZA 4MXYA 3TTIA 5AUUA 4U3YA 4H05A 4DBXA 4J8NA 5HVYA 5CEQA 5FRIA 3D7TA 5ETIA 4RX7A 1M2QA 3IW8A 4B4LA 2ZV2A 3JS2A 3NUXA 4LFIA 2PWLA 2RSVA 2WIPA 2BRMA 2YLEA 4OR5A 2WMRA 2O63A 3BYVA 3R1NA 4BDBA 4EBWA 3LE6A 4CTCA 2QOBA 4FIIA 5J9LA 3RKBA 3MA3A 4DAWA 2PZ5A 3FI8A 4FT5A 3H0YA 4RLLA 4MYGA 4O7TA 4OAUC 4UXLA 4IVBA 4CMUA 3BYOA 3E93A 1DM2A 4Z7GA 3KY2A 3HLLA 4I0SA 5JGDA 4GFMA 3ZO3A 4Y46A 4RFYA 3BV3A 3CPBA 5M4FA 4U42A 4U3ZA 5EOLA 3UPXA 3VUDA 3OC1A 3VULA 4IVDA 2HXLA 4JDKA 3E3PA 3ZFXA 3H4JA 3AC5A 3QTZA 5EM7A 4F64A 5F1ZA 3I4BA 5FM3A 3HGKA 4N6YA 3TV6A 4DHFA 4YR8A 3AC2A 2WQOA 3MBLA 2GNJA 1PHKA 2YCQA 4XH6A 4ZTQA 1URWA 3AT2A 5DT4A 4C4JA 4OBOA 1R0EA 4BCQA 4BCHA 4F9WA 3T3UA 3BU6A 3OS3A 3AMAA 3OWLA 3UC4A 4WG4A 4DH3A 5FGKA 3POZA 3T3VA 4MK0A 5HGIA 4I93A 3MYGA 2CHLA 4NUSA 1YKRA 3CLYA 5IQIA 2XK9A 1H0WA 4BDJA 5HIEA 2O8YA 4NYEA 3DFCB 4FR4A 4BYJA 2ZV8A 3PG1A 4DEAA 4Y8DA 4E93A 3BPRA 2OXYA 4EOPA 2C1AA 2YCFA 5CAVA 4JG6A 1MRYA 3L9MA 3G0FA 3LXLA 4DEEA 2FSLX 2QURA 3QGYA 2VTOA 5GIPE 4DEIA 4C3PA 3KKVA 2ITOA 4CZUA 5C26A 1CDKA 4ALVA 1GAGA 2QODA 5C01A 2E9NA 3FL4A 4BDAA 5DBXA 4PUZA 3LM0A 2VN9A 2VWWA 2VTTA 3E7VA 3QA0A 3DK7A 4FV4A 4GRBA 3NW6A 4J98A 4YZMA 3PLSA 5HNGA 1UWJA 3FE3A 5DNRA 5EOBA 3V5LA 3RMFA 3ZZWA 3MY5A 3U51A 4ARKA 4BCIA 3DAEA 3PLAE 5AAEA 5J87A 4NM5A 3QKLA 2YWVA 2VWZA 4HVDA 4CT2A 3KL8A 2WTKC 4MXAA 2OFVA 4N4SA 4JBOA 1SMHA 2QLUA 4X3JA 1J91A 2ITTA 3L8XA 1UU3A 3CTQA 2OZOA 3IS5A 3OY3A 1DI9A 4O7SA 4TYHA 3OROA 1ZOEA 3C13A 4MQ2A 5HG7A 4BCOA 3LFAA 3OCGA 3TNIA 1OGUA 3ZC5A 3F2AA 4IADA 2C5YA 3WYXA 3EQCA 3ANQA 4FV8A 5FLFA 4IW0A 1H8FA 3HV7A 2C0IA 3RBWA 3HRBA 5CS6A 1ZYSA 3PVBA 4Z55A 4D2VA 2RIOA 3W2PA 3R9DA 4MBJA 3WOWA 4AOIA 1HCKA 3K2LA 4QYGA 3GQIA 2KULA 3FBVA 3TACA 4DLIA 4F09A 5AR7A 2CNVA 3QTIA 4HVGA 2C6DA 4O6LA 2HCKA 4DEBA 4ZY4A 3KK8A 4IWPA 1U59A 3KXXA 2NPQA 3VN9A 2BAQA 3ZO2A 5J1VA 4ASDA 4XUFA 4QMWA 1XQZA 4M84A 5ANJA 4NKAA 3EB0A 4OTFA 4FIJA 5EHOA 4FA2A 5JSMA 4BVUA 4LV5A 5AP0A 3VWAA 3DB6A 4NSTA 2BZKB 1MRUA 4U41A 4AZTA 2ZOQA 4EORA 5KHWA 2R2PA 5HKMA 5EW8A 4QRCA 4V0GB 5FUTA 5LQFA 3MVLA 4TW9A 4NM0A 5EKOA 3U8WA 4E6DA 3C4ZA 2VO0A 4FT9A 5EYKA 1S9IA 5EI8A 3ANRA 4JAJA 2ETMA 4QPSA 2W1CA 3PZHA 2XF0A 3PUPA 2BRBA 2ZV9A 4KKHA 4ZSAA 5AA9A 2PZRA 4AACA 3HUBA 1XWSA 2XVDA 5LVNA 3PPKA 3FY2A 4YSJA 2OI4X 4QNYA 3WZDA 3FV8A 2WQBA 2JD5A 3CQUA 5HNBA 1IRKA 2JDTA 4QP7A 4KRCA 3F2NA 3OBGA 4A9YA 2OZAA 3Q52A 4X7QA 5FG8A 4EYJA 5JZJA 3QGWA 4YHFA 3Q60A 1JVPP 2SRCA 3AC4A 3KN5A 5DT0A 3ZZEA 1KV2A 2WTIA 4FTJA 4D1SA 4MCVA 4WUAA 4BZNA 5KO1A 5AAFA 4D0WA 3L8SA 3FMLA 3ORZA 3ZOSA 4AXAA 2Z8CA 3BIZA 5HTIA 1ZZ2A 2IW6A 3REPA 3KXNA 5T3QA 2VTHA 3BU3A 4CNHA 4I5MA 4BBMA 4FG9A 3AC3A 2UZOA 2OJJA 3Q4ZA 4IACA 4MNFA 4BICA 5C4LA 4F1MA 3SG8A 4QQCA 4GFGA 5AX9A 4JQEA 4TKSA 4GCJA 4FKVA 5EYCA 3RAKA 3MJ1A 4RVKA 3R9HA 5JGBA 1NXKA 1YOLA 2PL0A 1SYKA 3QUPA 4OTIA 4RPVA 4R5SA 4LUEA 5ETFA 2E9VA 1QPDA 2BRHA 2XP2A 3RINA 2PY3A 3P1AA 1M52A 4O84A 4AGUA 1UU9A 2IWIA 2IW8A 4BIDA 4M14A 4FKRA 1Z5MA 3D2IA 4IZ5A 3MV5A 3D15A 3V3VA 4RBLA 4X2KA 3VS6A 3UO5A 2VTMA 3TJDA 3KMMA 4X2GA 2ZYBA 2XEZA 1LEZA 3MGYA 4TRLA 3W2SA 4DEDA 1NA7A 4UXQA 4D1XA 2QOHA 3G0EA 2XS0A 4UX9A 4WNKA 3OP5A 5HG5A 2W1GA 5DFPA 1F5QA 3R73A 4FX3A 3RCDA 3NLBA 4BGQA 5L8LA 1KOAA 4E4MA 5BQ0A 1OBDA 1MQBA 3HKOA 3QHWA 3TM0A 5CALA 3GENA 1JSTA 2BUJA 5IQAA 3F69A 4C57A 3TZMA 4UMQA 2HZNA 3VBTA 3BHHA 3COIA 3QD2B 2V55A 4IX4A 2C1BA 1GIJA 3FYKX 2W17A 3GU4A 2YDIA 2CNUA 1VEBA 4FKTA 3WZUA 2G2FA 2PMOX 4UEUA 4C8BA 3D4QA 4OTWA 3SD0A 1U46A 2CNQA 4APPA 5IH5A 4CKRA 4G3GA 2GFCA 3MSSA 3ENMA 4QD6A 4CFNA 3NGAA 4ZZOA 4E20A 2V7OA 3P0MA 5CANA 4X3FA 2C68A 2YAAA 4PTCA 5ETCA 3GCPA 3SOAA 4BY9E 3BYMA 4IANA 2PTKA 4BYIA 2UVZA 3MVHA 4RG0A 4CGAA 4BTKA 4H58A 2PZIA 2QO2A 1JAMA 3FLSA 4DFYA 4DGGA 5AUTA 5I9VA 2IPXA 5AADA 2PYWA 3B2WA 3TI1A 2Q83A 4FEXA 1KUTA 4CKIA 4GKIA 5CU6A 5EDQA 1OI9A 4R3RA 2ESMA 4A7CA 5M4CA 4KIQA 3PIZA 4Z16A 3HMNA 2R3LA 1YXUA 4IE9A 3PJ8A 4GG5A 3IOPA 3U87A 1WFCA 3NAYA 1U5RA 3SXSA 3W18A 5HNIX 1UKHA 3RCJA 2GQSA 4IZAA 5M55A 2WTVA 3T9TA 4AW5A 5DPVA 3UOHA 4C4GA 2QG5A 3PVGA 4O2PA 5CY3A 3G9NA 4L8MA 2PE1A 4WHZA 3HA8A 5E1EA 3BHTA 2JGZA 4YP8A 5HLPA 3GGFA 2PVMA 4FV3A 2R9SA 4O22A 4J96A 3R8ZA 3TV7A 4KA3A 5HTCA 5B7VA 3W8LA 2DUVA 1JBPE 4XEYA 5DVRA 4FUYA 4XP2A 5AAGA 3WBLA 2YEXA 4HCUA 3LFDA 2VTRA 1W83A 2J51A 3P4KA 1IEPA 4UZDA 4D5KA 1YDTE 2JFLA 4BN1A 2C5VA 5FEQA 2Y4IB 2QG7A 1Q8TA 2Y8OA 4W4XA 1O9UA 3ORIA 1W0XC 2CKQA 4NIFA 1LP4A 3G5DA 2ITXA 4YZ9A 4FT0A 4LRKA 2XK6A 3PXZA 3QU0A 5AX3A 1YOMA 4Y95A 5HG9A 4AW2A 2FGIA 3HZTA 4EC9A 3SVVA 3NVMB 3MY1A 4BTFA 3VS7A 5HVJA 4C3FA 3IQ7A 3RJCA 4PMPA 2C6IA 2XMYA 1PXKA 2NO3A 4FSWA 5DOSA 2IW9A 5AV3A 4KBKA 4WD5A 1Q8ZA 3BU5A 5IEYA 1REJA 4QT1A 4RJ6A 4S30A 3O8PA 4OLIA 5FDPA 4K0YA 4FC0A 1V1KA 4BHNA 2ZM4A 4DH5A 3PSDA 2JFMA 3LAUA 5CVHA 5C4KA 3MPTA 4NCTA 4O1OA 5AP7A 3R8VA 4FTCA 5IDNA 4NW5A 4FG8A 4B99A 3WARA 4G3FA 3A7FA 3LMGA 4FTOA 1MUOA 4G3DA 4IB5A 5AP4A 4M3QA 3KGAA 4AUAA 4RSSA 4CZTA 1NVRA 3L9PA 3DKGA 4IEBA 2DQ7X 5FBOA 3SAYA 3SQQA 2A1AB 2EXEA 4YZDA 1KE5A 5IUHA 5D9HA 1BLXA 3DKOA 5BVNA 3S2PA 4ANMA 4FTKA 3C4CA 1H07A 1W84A 4C2VA 2PUUA 4CRLA 4F9YA 5EQYA 4E26A 2PVYA 3HMIA 2PUNA 4HYUA 3MFTA 3GC8A 1W8CA 2H34A 4PDPA 3VAPA 4FKOA 1GZOA 3JVSA 5CEIA 3EN9A 1FOTA 4X0MA 4X6RA 3QRTA 4LOPA 3CPCA 3PXFA 2WO6A 4J95A 3ZLXA 2HK5A 3C1XA 3LHJA 4OBPA 2F7EE 5E8UA 3W2QA 3W2CA 4TNDA 5HLNA 5HQ0A 5HE1A 3A7HA 4JDJA 2XZSA 4N70A 3ZUTA 3FC1X 1CMKE 3M1SA 2YCSA 4M69B 5EM8A 3ZHPC 1ZARA 2PZYA 4C61A 4DA5A 1OIRA 4L3LA 4RIWA 4U7ZA 4PX6A 2F49A 4AU8A 4XV3A 2Y9QA 4DGOA 5JN2A 3KRXA 3U4WA 5CT0A 4EZ5A 1OZ1A 4FTAA 4ANOA 3OCSA 4LL0A 4PPAA 5KMKA 3RTPA 5DGZA 4WA9A 4EH5A 4NU1A 4OTHA 4FK3A 4IAFA 1PJKA 3B8RA 2UV2A 3PRFA 2UZNA 4A9TA 5M07A 2HW6A 3QQGA 1Z57A 4EEVA 4IH8A 4ZJVA 4XG7A 4BGHA 4AS0A 1PMUA 4ACGA 5IA0A 5L4QA 3H30A 3FPQA 1X8BA 3MH2A 4I6HA 4Q2AA 4RIXA 3ID6C 2C5XA 2ZDUA 3ZLSA 1G8AA 4YMJA 2CDZA 4WNMA 4BI1A 3HV6A 5L2TA 5AFVA 2W7XA 4HYSA 2ZV7A 3LCDA 4RVMA 3W32A 2WMBA 3LXKA 4MWIA 5HTBA 3U6IA 4C62A 3QTQA 4XG2A 4R6VA 3AD4A 4UALA 4UBAA 5I9YA 5F20A 4IHPA 5HBJA 3EKNA 3OTUA 4FNYA 4TWCA 3C5IA 4KBAA 3ZDUA 5IA3A 1TQIA 4NWMA 4XV9A 5BUIA 3ALNA 3ZTXA 4A9SA 4XV2A 4DFLA 1AGWA 4RWKA 4D2RA 4DINA 3VS5A 4LGGA 4YTFA 4AA5A 3NMUF 3UBDA 5B2LA 2YN8A 4IWOA 3NNWA 4FTUA 5E8SA 1A48A 3F5UA 4PL3A 2QHNA 4PV0A 5EG3A 2I0EA 3EZRA 5TR6A 4BB4A 3Q04A 5A3XA 3QWKA 3V5WA 4J52A 3HV5A 2VV9A 2UW0A 4FKIA 4OGRA 4F9BA 2IZRA 3UNZA 4D4RA 1AQ1A 4IWDA 4MEDA 4EOLA 1CM8A 3FZSA 3ULIA 4G9RA 4C3RA 3UIXA 1IR3A 1TKIA 2RF9A 3KF7A 2JAVA 4WSYA 4CFVA 3OF0A 5AP1A 3BE9A 2JAMA 3SLSA 5IG1A 3DJ5A 3LFBA 3QXOA 1REKA 4OT5A 4XS2A 4NK9A 2WU7A 3BLQA 4XRJA 3OG7A 3DTCA 5J95A 4K6ZA 4FV0A 4YUQA 4Z7HA 5KZ0A 4TT7A 2GNIA 3SA0A 2XK7A 3LCSA 4JBPA 5ANKA 5HHWA 2GNLA 4FTIA 4PF4A 1H1SA 2XKEA 1PXOA 3OVVA 1H1WA 1Q99A 5IMEA 4EWQA 4QTCA 1LUFA 4BRXA 3BEAA 5AM6A 4C0TA 5A6OA 2ZJWA 4QP4A 5J9YA 2J7TA 4RJ8A 4LQMA 3PJ2A 4EH4A 3ETAA 3BBTB 3GCSA 4TPTA 1XH7A 4FSMA 3ULZA 3BHYA 4U43A 1BKXA 4FEQA 5AEPA 1OKYA 4I22A 3ZS5A 4E4LA 5BX0A 2X7OA 5LARA 2R7BA 4JS8A 1V0PA 4JLCA 5KNJA 3Q5ZA 3D94A 4ONAA 5C8MA 2VWIA 4B0GA 3WI6A 3KU2A 5HE2A 4I20A 4O86A 3A8WA 5D1JA 2R5TA 4BCPA 2JKKA 4PP7A 3O7LD 3LXPA 3QQFA 3Q6UA 4OTPA 4C4EA 4FL1A 4CT1A 4U80A 4JRVA 4FGRA 3IDPA 4EOQA 1Q61A 3ATSA 3PP1A 4WRSA 2FSOX 4QMUA 5CF8A 2QQ7A 4ZIMA 3QCSA 4EK4A 2AYPA 2Y0AA 3THBA 4DITA 4FEUA 4IM3A 2C0OA 3TNHA 2KTYA 4CXAA 2DS1A 3EN5A 4AN3A 3C4FA 4I4FA 3R8LA 3NDMA 2XJ1A 5J5SA 2UZVA 4M7IA 5HO8A 3I5NA 4WBBB 3VC4A 2OLCA 3Q2MA 2F2CB 2X7FA 3UYTA 3FDNA 5J8IA 3HDNA 4EL9A 5K0KA 4EJNA 2W05A 3F5PA 3DB8A 1J3HA 4F7SA 3QD4A 5K9IA 3QQJA 2YM6A 5J7HA 2UVXA 1H4LA 1PMNA 3LOKA 1Y91A 4FSQA 4R3CA 4C59A 3H9OA 3DXQA 3OT3A 2WD1A 4X6QC 1J1CA 5AUXA 2GDOA 1RJBA 1WBPA 3PPJA 3QBNA 3QFVA 5IA1A 2QOIA 4BDCA 3E62A 2EB3A 2CCHA 3FMJA 2AC5A 4I4EA 3EOCA 2ETKA 4O6EA 5KZIA 5A4TA 2YWPA 2C6MA 4O83A 2GS6A 4QYFA 3LFFA 5LMAA 4DLJA 5JFXA 3G33A 3KRRA 4FTTA 4DC2A 5D41A 2JBOA 4XMOA 5CSXA 4CYIA 1Q62A 3RNYA 4EBVA 4Q5HA 4PTGA 3PXQA 3QZGA 3ZRLA 2W1EA 5CAOA 2XKCA 4DFBA 5CF6A 3U4UA 1K3AA 4KS7A 3ZRKA 1EH4A 3MESA 2WAJA 4QTAA 4LI5A 2CMWA 4TXCA 3NRMA 2HY81 3KULB 4CV9A 5ITAA 4HYIA 2R3GA 2WEIA 1JKKA 3EZVA 4YBKA 5C27A 3RAIA 3W16A 2CKOA 2WPAA 5AR5A 4AAAA 5CEPA 3TUCA 3CKWA 3BQCA 1ZYDA 2PU8A 3A61A 3MI9A 3N4TA 1KSWA 3RM7A 5IQBA 2RL5A 4FUXA 3HV4A 3DQWA 5CXHA 3CKXA 2BDWA 3VW8A 4H36A 3ZUUA 3PY0A 4BDIA 4PPBA 3CJGA 3R7IA 2BZIB 4OTRA 4QMTA 5I4NA 2IZSA 2UW9A 2VTQA 2Z60A 2UZEA 4UZHA 2HZIA 4IQ6A 2OJGA 2X2LA 2GMXA 3HDMA 4PMSA 5IQCA 3GVUA 1OL2A 3WZJA 4GSBA 4IVAA 3O50A 4CZYB 3PFQA 2ZM1A 4NM7A 3LJ1A 3SG9A 2G9XA 4RJ5A 2ITZA 1G8SA 4AT5A 1BI7A 1WBTA 3E8EA 1H28A 2H6DA 5IZFA 1PF8A 3QCXA 4ZXTA 4I6FA 2YLFA 2XKDA 4FZAB 4YTCA 3QAME 5A4CA 4V04A 4CFMA 2J0KA 3P08A 2BDFA 4GFOA 3PE1A 1B39A 3F7ZA 2WMVA 2OO8X 2Y6OA 1DAWA 4EYMA 4QMZA 1DS5A 4V0GA 2FVDA 4EHZA 2QOKA 3S3IA 5A4EA 5DWRA 3VUKA 1KV1A 4AZVA 3DNDA 2WQNA 4CQGA 2J0LA 3EN6A 2GNHA 3M2WA 5BVWA 4BFMA 4D4VA 5CF5A 3BWJA 3R04A 3QTXA 4IC7A 5M4IA 3PSBA 5C03A 3FPMA 4UWCA 4BDGA 5CXZA 2EWAA 2AUHA 3CIKA 2B9JA 5E8XA 1BL6A 3VBYA 2GHMA 5CSWA 1IASA 3R9OA 2X6DA 2I1MA 2Y4IC 2W0JA 4IB0A 3W2RA 1WBSA 4NJ3A 5E90A 2YM4A 2X2KA 3ZYAA 1XJDA 3RP9A 4EHEA 5CEOA 3OBJA 3MW1A 2X81A 5J7BA 5M57A 4GH2A 3QZHA 3UOKA 2UZLA 4K11A 3HA6A 4CMOA 5JZNA 4ZJJA 4RGJA 4YZNA 2H8HA 3II5A 4O7LA 4R1VA 4J8MA 2YCRA 1JKTA 4BBEA 1YI6A 4C37A 4F6UA 2I40A 4GVJA 4KB8A 4FT3A 3PRIA 4FKGA 3COHA 4G6OA 4ANBA 3SV0A 4KINA 3RGFA 2YIXA 3OWKA 4DT8A 3QWJA 5CEKA 2XJ0A 4AP7A 1KE8A 3PZEA 4I3ZA 4RIYA 4S33A 3RAHA 2UUEA 2YM8A 1ZOGA 2Z2WA 3NR9A 1YDSE 4YTHA 3FQHA 3VJNA 5KMOA 2C6KA 5CLPA 5HCYA 4U81A 3MFSA 2VUWA 5CENA 4MQ1A 3VRYA 5IPJA 2C6TA 3R71A 1RW8A 4R7BA 2F57A 3V5JA 4XBUA 4FSTA 2PVLA 5BYLA 4H1JA 4U5JA 2QR8A 3CQWA 4I41A 2ZMDA 1RQQA 4YZBA 3JY9A 5EDRA 3QC4A 5DA3A 4FSUA 3P86A 4S32A 2UZTA 3AGLA 5ANGA 2VGOA 3NW7A 4EWHA 3VS2A 2IVUA 4O1PA 4EQUA 5BVOA 2XNMA 5A4LA 4QTEA 4FTMA 5TF9A 4USEA 3UOLA 1ZLTA 2Y7JA 3F7WA 1I44A 3OTVA 4G2FA 4MF1A 5JQ5A 3A4OX 3Q6WA 1VJYA 4FSRA 5DRDA 4CFXA 1KOBA 3I6UA 3Q4UA 2ZB1A 4QQ5A 3ZXZA 4CFUA 4EOJA 3RVGA 4YJSA 1M7QA 4QMSA 4DBNA 4EK8A 2O5KA 5CI7A 5C9CA 4M66A 3OOMA 4IX5A 3V01A 3SXRA 3LFQA 1H01A 4P5QA 3VO3A 3KREA 4O7VA 3QCYA 1XBBA 3A8XA 3O8TA 1SNUA 3I60A 5EW9A 4JQ8A 2HYYA 3MPMA 4BKYA 1M2RA 5ANEA 3PWDA 4GVAA 4ALWA 4QMNA 2QKWB 5GZ8A 1QPCA 1VR2A 3O7LB 4KIKA 5DT3A 1GOLA 4LM5A 4HVIA 1OUKA 1PMVA 3K54A 4CG9A 4C02A 4X3FC 1NY3A 3OCTA 3AOXA 3WF9A 4RZVA 1OB3A 3HP2A 3AT4A 4FKUA 5CSHA 5CZHA 2J4ZA 3LCTA 5FWKK 2B55A 1URCA 4DG2E 2YZAA 2ZAZA 3NIZA 4K77A 4YLLA 3ALOA 3HAVA 3QL8A 4O0VA 1ZMVA 2BTRA 2ZDTA 4AGDA 1WCCA 4EK5A 3HECA 5F4NA 4F63A 1H24A 2OU7A 1XH4A 1WBNA 3QA8A 4MXOA 4L44A 5C1QB 5JGAA 4GT5A 3UZTA 4R3PA 2F2UA 4QYEA 3ZEPA 3BYSA 5AR3A 5A4QA 3PIYA 3WF6A 3L8PA 3ZCLA 3BGQA 2WTJA 2VO7A 4F7JA 2OGVA 3CQEA 3L9NA 4D2PA 2XKFA 4PRJA 3WZEA 3FAAA 3W33A 3O51A 5HICA 4AX8A 3ZC6A 5D12A 4EUTA 4F65A 3C51A 3DA6A 2PUIA 4CRSA 2C5NA 3PSCA 4FKWA 4U8ZA 3GC9A 3QYWA 2QOQA 4EOKA 4UYNA 1PXMA 4HGLA 5GJFA 3UTOA 3UPZA 2PUPA 4RQVA 2FYSA 4YO6A 2OICA 2PPQA 3KEXA 3FXXA 5F9EA 1JKSA 5E8VA 4I94A 5AR2A 3D5VA 3F88A 2FO0A 3QF9A 5L2WA 4L6QA 1W98A 4ANQA 5H9BA 3ORTA 3TKHA 1OKZA 3HL7A 2W4OA 2WEVA 3LKMA 4FZ7A 4RA4A 5FTGA 4O82A 4LUDA 2YA9A 3FC2A 2CLXA 2R3HA 3F3UA 5LWNA 3P9JA 4FKLA 1GIIA 2CGXA 2OXDA 4RC2A 3VUIA 2GQGA 2R3JA 5LCJA 5L3AA 4IAKA 4NCTC 2XA4A 3VQHA 3NZ0A 5GIOE 4GS6A 4QNAA 4DEHA 2WIHA 5BMSA 4IFCA 5IQHA 2FA2A 2VO6A 5E92A 2HWPA 1S9JA 2NRUA 4HJOA 4MX9A 4OTDA 1QCFA 1UVRA 3UP2A 1CTPE 4YPDA 3QRJA 3AMBA 4V05A 5JT2A 4DT9A 1SNXA 3IO7A 4DFXE 2JIVA 4RFMA 2JIUA 2ZB0A 4HZSA 3VBXA 2YAKA 3WZKA 2X1NA 5DR2A 4FNWA 3ACJA 4MD8E 5E1SA 4E8AA 4GL9A 4L68A 2F7XE 2Q0NA 2UZUE 4FKJA 3EL7A 3B8QA 5D11A 2ITQA 4GJ3A 4CTBA 1FVVA 3RALA 3VHKA 2J9MA 2YERA 4BDFA 5I0BA 3ORLA 4FSNA 3FMHA 2VNYA 4Y5HA 5DHJA 1M2PA 1G3NA 4PDYA 4GW8A 4UMPA 3GFEA 4O7RA 3LJ0A 2E9UA 1HOWA 1Q97A 3BE2A 3BGPA 4QP8A 2LGCA 3ZONA 4M69A 1XR1A 4NFNA 2PE2A 3ORXA 2YIWA 3A62A 4HCVA 1Y6AA 1GY3A 4ORKA 1VYWA 2WU6A 4L3PA 2UVYA 1OITA 5AJQA 1GZKA 4UMUA 3BYUA 3CP9A 4M68A 2W1DA 3DCVA 4OUCA 3EIDA 5BUJA 1RDQE 2VWUA 5I3OA 1P5EA 2OG8A 3KMUA 3BEGA 3PJ1A 2GNFA 3DZOA 3GU7A 4FNZA 3UIBA 3FI3A 4OT6A 3I6WA 4EI4A 2CKEA 4XOZA 1UU8A 1Q8YA 5CSPA 3NNVA 4FV2A 4ZS0A 3ZUVA 2ACXA 5EI2A 3EQGA 4P7EA 2A27A 3NYOA 3VUGA 4BCGA 5DR9A 3A7JA 1PKGA 4BL1A 2W1ZA 3DTWA 4L45A 2PVJA 4YO4A 2WKMA 3ORKA 2CGWA 3C0IA 3PXYA 5K0XA 2ITUA 2F9GA 2OK1A 3G6GA 4L43A 2CSNA 4AOJA 4EH6A 5IA2A 1H27A 3EN7A 4Z3VA 4O0WA 4EJ7A 1ZY4A 3PIXA 3K3IA 1J7LA 2QC6A 3E5AA 3PVWA 4YJTA 3RPVA 2OKRA 4DH7A 3IW7A 5FM2A 1KWPA 4FYOA 5LWMA 1TQMA 5IMXA 4IZ7A 4QMYA 3CEKA 4WNPA 2QOFA 2W1FA 5IH6A 3OXIA 2UW6A 5LVPA 4D2TA 4D58A 3Q5IA 2VRXA 3DS6A 4GUBA 5HG8A 4W8DA 1R1WA 1T46A 2X9EA 3C0HA 3F9NA 5J5TA 4II5A 4O27B 5IU2A 2XM8A 1SVEA 2GHLA 3Q4CA 5CQWA 3QTWA 3C4XA 4ANSA 3EH9A 4Y72A 2IVTA 4C4IA 4AFJA 4IB1A 2XIKA 2OXXA 4PNIA 3PDTA 4TWNA 4CCBA 2AC3A 3QKKA 4TYJA 1OUYA 4D4SA 3ZLWA 5KMJA 3R1SA 4BZOA 2W96B 3UMXA 4KBCA 2DWBA 2ERKA 4C35A 4AFEA 4XNEA 4PY1A 5A46A 5LXMA 1UNHA 2ITVA 3CR0A 4CV8A 3EMGA 3Q4TA 5F94A 1R0PA 4HGSA 4P5ZA 1YOJA 4GUEA 3LVPA 2C6OA 5IEVA 1JKLA 3P79A 3H10A 4NH1A 4TWOA 3QX2A 3CSVA 4WSQA 3GOPA 2VD5A 5AV1A 3QUDA 4U9AA 1U4DA 4IAAA 4TN6A 4KIPA 2V62A 4FBXA 1OBGA 3QKMA 4ID7A 2HZ0A 3HMPA 1ZAOA 3KXHA 4I23A 3TKUA 1Q41A 3GXLA 3IGOA 4MNEB 2LAVA 3PWYA 4BDEA 4G6NA 1Q8WA 1YWVA 2R3OA 1ZZLA 2O0UA 3IKAA 3P5KA 4XYFA 5EI6A 4CYJA 3HVCA 4OTGA 3LLAA 5L2IA 3FZPA 2DYLA 3V5QA 5KBQA 4PDOA 3L8VA 3GC7A 4NZWB 2BKZA 3UE4A 4DH1A 5H8EA 5CNOA 4ZZMA 1PYXA 4QMQA 4FIGA 3M42A 4YC3A 2VTLA 3H9FA 2VWYA 3KFAA 4YBJA 4DF3A 3QQHA 1YXTA 3MIAA 2RG5A 2REIA 3I0OA 4QP3A 5AIRA 5CAQA 4QPMA 5J79A 4AW0A 4GYIA 2V7AA 2HY0A 4JJRA 3SDJA 5AA8A 2W1IA 2I0YA 4KSQA 4W4WA 2QU5A 1ZXEA 2X4ZA 2GS7A 3MVMA 5K5NA 3AC8A 3MIYA 4O91A 5K3YA 2RGPA 2XK4A 2R3NA 3F5GA 3M11A 4FMQA 4N6ZA 5CQUA 3TL8A 4CSVA 3TV4A 3EQFA 3A2CA 5CI6A 3DY7A 2GTMA 1XBCA 4XHKB 3SHEA 5I9ZA 2J5FA 3R28A 1W7HA 2UW5A 5C8NA 4C33A 3EHAA 3R9NA 2YISA 2OIQA 3FKLA 3R8MA 3E8DA 4RX5A 5HLWA 3D5UA 4RWLA 2I6LA 2X6EA 3DZQA 4LV8A 4QYHA 5DI1A 3K5VA 4YJQA 5DIAA 3IW5A 5AWMA 3BQRA 4O38A 4ZP5A 2QHMA 4GV1A 3MA6A 4Z9LA 4ZOGA 3IG7A 5H8GA 4AT4A 2A19B 2F7ZE 3EQDA 2JIIA 2QLQA 4KSPA 4WT6A 5EYDA 3NUNA 1YXXA 2XCHA 4G1WA 5L2QA 4YJVA 3QTUA 4A4OA 1JSUA 2WTKB 4O0YA 2PHKA 2XB7A 1OL5A 3FI2A 4WIHA 4FZFB 4ZLYA 4AGWA 2RKUA 3R7YA 4C7TA 5EKNA 3KF4A 1OIYA 4M0YA 4PMTA 2QONA 1YWNA 4MTAA 4EHVA 3CC6A 4HOKA 3ZLYA 2VWBA 1ATPE 5HE0A 5AR4A 5H2UA 3ZEWA 4AW1A 4L00A 4WNOA 4EZ7A 1UA2A 3IDBA 3OW4A 4ACHA 3BI6A 4ERWA 4KWPA 1YHSA 3MH1A 4MKCA 4X2NA 3GP0A 3F5XA 4QOXA 5HESA 1YI3A 2HOGA 3RHXA 4ACCA 4ASXA 4AZSA 4BCNA 3PJ3A 4ZTLA 3ZH8A 3V8TA 3GNIB 5HIBA 2XK8A 3FHRA 2EVAA 5BYYA 1WVXA 1Q24A 2HWOA 1H26A 3HEGA 5I9WA 4KD1A 4I5PA 3RK9A 5TE0A 1FGIA 4YHTA 3FMDA 4R78A 4L52A 2BALA 1OKVA 2Z7QA 2PVFA 3QRUA 2PULA 4JI9A 3ERKA 2A0CX 4FICA 2QR7A 5FTOA 3AC1A 3QD0A 1YRPA 2WMTA 4CG8A 3VRZA 3BELA 1ZYCA 4FK6A 3RWPA 1V0OA 3WYYA 2BR1A 1WZYA 3I5ZA 4S34A 1PXLA 2FSTX 2PMIA 4I0RA 4HNFA 4F1TA 4FOCA 4JR3A 3CJFA 3GBZA 3NYNA 3FMMA 5IA4A 3DDQA 5DE2A 5AV0A 3E88A 4EUUA 2C3KA 4BIBA 2B0QA 4U6RA 3QZFA 2BILB 4AG8A 3HUCA 3RK7A 4KUJA 2BMCA 4O96A 4F0GA 3N51A 2ITPA 2C47A 3G2FA 3UGCA 1QMZA 4B8LA 1R3CA 4YSMA 4PNKA 5IQFA 2OBJA 4R7HA 4UYAA 1ERKA 3BRBA 4XBRA 4E5BA 4L9IA 4BWKA 5IA5A 4FV9A 3O71A 3UQCA 2W5AA 3L1SA 5KX8A 4ZS4A 4PWNA 1JPAA 5LCKA 5IQGA 5HD7A 4E6QA 2R3KA 1OIQA 2OIBA 4BF2A 4J1RA 3DJ6A 3VQUA 1FMOE 4TY1A 5CU3A 1M17A 4ITHA 4CD0A 4U40A 2P0CA 2XEYA 1K2PA 2CLQA 3AQVA 3H3CA 4MHAA 1OMWA 3HP5A 5JEBA 4RFZA 4P4CA 2J6MA 3ODZX 3JVRA 2R3MA 3EQPA 3KMWA 3LZBA 3QTRA 3S4QA 2XRUA 3R21A 4ZJIA 4JIKA 4DTKA 4Q9ZA 3JY0A 2NNWB 3L9LA 4UWYA 1PXJA 1IG1A 4IX3A 4ZLOA 2QI8A 3G6HA 3ODYX 3LM5A 4FKQA 4KAOA 2R3FA 4RZWA 4CCUA 2VTIA 4C4HA 5CASA 1U54B 5I5ZA 3K5UA 4UMTA 2BZJA 1H25A 2J50A 3VUTA 5DN3A 3UODA 3HMMA 4UB7A 4WOVA 5LVLA 3OUKA 4DYMA 5EQEA 3VS3A 2CPKE 4D5HA 1BI8A 3BCEA 5JQ8A 4UWBA 4M8TA 3I1AA 3VF9A 4PQNA 4BTJA 5BNJA 3A99A 3VBQA 4LOQA 3UJGA 5HX8A 5IUGA 2XNEA 5JKGA 4XRLA 1V0BA 5TO8A 2B54A 1YI4A 2ITNA 4Y85A 3R8PA 3O96A 4Q5EA 2P2IA 4GU9A 3ZM4A 4AE9A 4C58A 3LMHA 3HYHA 4L7FA 4W4VA 3ZRMA 4AT3A 4HPUE 3QQKA 4BTMA 5CX9A 5AR8A 1OM1A 2PVRA 3ZSHA 1WVWA 2W5BA 4R5YA 5CAUA 5ETAA 3U55A 1J7UA 4YC8A 4ZK5A 3SKCA 3SXFA 4ASEA 4J97A 3TUBA 3PPZA 1OL6A 3QUEA 2BPMA 5A9UA 1TQPA 4UY9A 2FSMX 2BRGA 5JFVA 4FL2A 1NW1A 1U5QA 4YJPA 4FYNA 4ALUA 2P33A 3TG1A 4KKEA 3VBVA 4RC4A 2P2HA 3SGCA 5CNNA 4USDA 3VNTA 1H00A 1OPKA 3ACKA 1WBOA 2YIRA 3QHRA 4BDHA 3G15A 4E5WA 4EOMA 3SOCA 3KRJA 2O65A 4FF8A 3E64A 4ACDA 2X0GA 4QMXA 3ELJA 3H0ZA 1P4FA 3KXMA 4D2WA 2C0TA 3EYHA 4Y83A 3H9RA 3MTFA 3R30A 4XP3A 2ITYA 4K1BA 2E9PA 3FMNA 2J5EA 4JX3A 4YC6A 3SRVB 4U79A 4H3BA 4QMOA 4QPAA 3EFLA 4A9RA 4ZEGA 3KB7A 2NRYA 3GU8A 3VIDA 4GKHA 2RFEA 1H0VA 4M0ZA 5HD4A 4D4YA 4JAIA 3DPKA 4ERKA 1R78A 3WE8A 1IA8A 3QZIA 3UVPA 3C0GA 3Q96A 4RJ4A 4YLJA 3UMWA 4F6SA 3GOKA 3O2MA 3MY0A 3DU8A 3F3TA 3MH3A 4JIAA 4W8EA 4X21A 3S0OA 3QC9A 3FZOA 5M56A 1R39A 3ORPA 5C8KA 4M13A 3F66A 3FI4A 1SVHA 3NVKI 3RI1A 1FBNA 5DYJA 3QRIA 3UIMA 3R02A 5BVKA 4PMMA 4F4PA 2R3QA 5JH6A 5KMIA 5CU4A 2C5OA 3TXOA 3W1FA 2RFSA 2WGJA 4FTRA 3PXKA 3UG1A 2YHVA 4J71A 2JKQA 2HELA 3V04A 1L8TA 5AM7A 3LW0A 1NT2A 3RPYA 3QTSA 4LG4A 1MP8A 2VWXA 1LEWA 3OD6X 5AP5A 4FIEA 2C3LA 5CVGA 4JRNA 4XLIA 1UV5A 4I21A 3I79A 3P23A 1GZ8A 3S00A 1H08A 2QOOA 4FVRA 5GHVA 4EZ3A 2QU6A 3PVUA 4A4LA 2ERZE 1Q8UA 3QQUA 4XG9A 2BAKA 3R63A 3ZSGA 4GU6A 4OTQA 4WG5A 3BKBA 4ZTNA 4E6CA 2B7AA 4C38A 3LCOA 1HCLA 3LPBA 2FB8A 3A7GA 3MTLA 4AZWA 3MB7A 4F0FA 3ZFYA 4FTLA 1WAKA 2O2UA 3BX5A 5FQDC 1F3MC 1OPJA 3VF8A 1L3RE 2C6EA 2W06A 4CLIA 1BL7A 1ZOHA 2Z7RA 3OWJA 1LR4A 4XLVA 1MRVA 3RM6A 3Q2JA 2H96A 4H3QA 2PK9A 4QMMA 3GFWA 2B9FA 4I0TA 3KCKA 4FSYA 5KKRB 4BI2A 3FZTA 4D55A 5CSVA 4B7TA 5FTQA 4O81A 3F2RA 1CKPA 3DXNA 4ZMEA 2VTSA 2IO6A 2B9HA 4O0UA 3DOGA 3EFJA 3R6XA 4BKZA 3EYGA 3OMVA 3NUSA 4YURA 2QO9A 4AE6A 3LMIA 2B1PA 3MFRA 1ND4A 4YJNA 3PP0A 3UIUA 3ET7A 3D2KA 3K3JA 4MBLA 5J1WA 3KXGA 2C30A 2PMLX 3CD8A 3ZDIA 4ZAUA 3R22A 5M06A 4E7WA 2O3PA 4GK2A 2CCIA 4EOIA 2XYNA 1W82A 2W4JA 4G6LA 4PDSA 4RWIA 4DN5A 2C4GA 4ZTSA 4C36A 3U6JA 3FLQA 4IXPA 4IB3A 3JXWA 3E3BX 4O0RA 4RQKA 3NUPA 2VX0A 1Y6BA 5GZ9A 3CY3A 2I7QA 2BAJA 3I7CA 2IZTA 2QNJA 4J99A 4AN9A 3DBCA 5K5XA 4FV7A 4FV6A 3LFCA 2WOTA 2XNOA 4G3EA 3Q9ZA 3UQFA 2W5HA 5T6KA 1ZYLA 3TZ7A 3C9WA 3AT3A 4O2ZA 3MWUA 5KMNA 3WF7A 4APCA 3UDBA 2QCSA 2CGVA 4Y5QA 4XOYA 3AXWA 4RIOA 3KK9A 4F9AA 3TNQB 4MXCA 5AIKA 4JL9A 4CKJA 5IF1A 2XNNA 4KABA 4WKQA 3FHIA 4XP0A 4ZSLA 1VYZA 3VS1A 3OWPA 3OZ6A 4O7NA 4MF0A 3P7CA 3R01A 4ZY5A 5LVMA 3CTHA 3LIJA 3P78A 4L42A 4EKLA 5ICPA 3C5UA 3F3ZA 1YHWA 2GNGA 4O0TA 2C3JA 3I7BA 4X2JA 1Q4LA 4C2WA 5HU9A 3P7AA 2XYUA 5HO6A 5FEEA 5IQEA 5LOHA 2VTPA 4JT3A 5L6PA 1Y8GA 3RAWA 3OEZA 4V01A 4L46A 3RPOA 2WNTA 4GIHA 4I5CA 3LLTA 4F0IA 4DFUA 1OPLA 2UW3A 3F3VA 4CFFA 5AP6A 5M44A 3MVJA 2JITA 3EQIA 4EQMA 5IEXA 4FI1A 3GT8A 3V51A 2CN5A 3SW7A 3TDWA 5GINE 2RG6A 3LFSA 2IJMA 5TOZA 2UW4A 3KQ7A 3Q32A 2BRNA 3TCPA 3ATTA 4P2KA 3GCQA 3PG3A 3ZMMA 5L2SA 1ZMWA 2BTSA 3D83A 4G17A 4YGAA 3OXTA 5CVFA 4G5JA 1UWHA 4U44A 2C3IB 4LMNA 4DH8A 2R64A 2YDJA 3VUHA 4MD9E 3FXWA 4IJPA 5BVDA 5HVKA 2BKKA 2VO3A 4QMLA 5H3QA 2CN8A 1XHAA 4AF3A 4BI0A 5J9ZA 4GYGA 1APME 3TUDA 4BWPA 3TNWA 4JXFA 5KMMA 2WFYA 4HZRA 5EH0A 2WQEA 3OT8A 4AGCA 5KUPA 5KCVA 3O17A 4FIHA 1O6KA 3O23A 5A6NA 2J0JA 3TJCA 3EQBA 4EOSA 4L7SA 3I81A 3MB6A 4M12A 4HGEA 2Z7LA 4JOAA 4DTAA 1OVEA 3BHUA 3OCBA 3BZ3A 3DDPA 3QLFA 3BGZA 1Q3WA 4HCTA 4J7BA 3R7VA 4AWIA 5I3RA 4USFA 5JRQA 2JDSA 2PVKA 5FXSA 4FE2A 2R0UA 2XM9A 4DE4A 1DAYA 2IZUA 4I6BA 5E91A 3ZU7A 4DG0E 3WE4A 4K2RA 2E9OA 4TYIA 2OJ9A 2VNWA 5AUWA 4IDTA 4EOOA 4F9CA 4DCAA 4FSZA 5CU2A 2JC6A 1JOWB 3KRWA 4ZSEA 3MDYA 2VTAA 4P90A 4RLKA 3OOGA 4W9XA 3NAXA 5G6VA 3BLRA 4BZDA 3D7TB 1SVGA 2UW7A 5EHLA 2W4KA 3MH0A 3UOJA 2WMQA 4OBQA 4EH3A 3FSFA 2BFYA 4MNEA 3LFNA 4W4YA 1JSVA 3ZFMA 4ZMFA 1J1BA 3ENHA 4ZY6A 3PTGA 2QD9A 3GB2A 5FXQA 5ANIA 1YXVA 2YFXA 4NT4A 3MN3A 5JK3A 2UZBA 3E8CA 4YLKA 4FEWA 4NTTA 5FP6A 4GK3A 4ENXA 1YXSA 2QOCA 1J7IA 4ZLZA 3IGGA 4E3CA 3VVHA 3LJ2A 3ITZA 2BDJA 2OJIA 3DBQA 3CBLA 4E4NA 1GZNA 4A07A 2JEDA 1QL6A 4HVHA 4IAYA 5K4IA 4BCKA 5M09A 5E8TA 4TYEA 3GUBA 3NCGA 3CD3A 2BVAA 3D0EA 3NSZA 3DK3A 3IW4A 5CZIA 4IWQA 2ZMCA 4RIYB 2R0IA 3BHVA 3VJOA 5CAPA 5M08A 1OL1A 5HE3A 2XNGA 2RFDA 2PE0A 4JDIA 3PY1A 4YTIA 4AZFA 4OAVB 2X2MA 4AN2A 3VUMA 4DFNA 4K33A 3FEGA 4XV1A 4EH9A 1OIUA 5BMMA 3ZM9A 3R1QA 4I6QA 3CE3A 5IDPA 1JWHA 3DGKA 1YW2A 3UG2A 2GQRA 4QP9A 3CXWA 3D5WA 3TTJA 4D28A 4DGMA 5HZNA 5M51A 2XIRA 4EK3A 4GIIA 3Q9WA 4B9DA 4QP1A 5HX6A 3TWJA 1ZY5A 3DV3A 5IH4A 4WRGA 3VW6A 4ZTHA 5L8JA 4JR7A 4K9YA 2OF2A 4U0IA 1PKDA 3EFKA 4PL5A 2XCKA 3CY2A 3F3WA 3GI3A 2WTCA 3OW3A 3PA3A 4GJ2A 4QMVA 1LPUA 5EQPA 4AA0A 4RX9A 2HIWA 3T8OA 1O6LA 4DGLC 2W99B 3V8WA 3A4PA 2HZ4A 4IM2A 5LJJA 4YJRA 4K8AA 5CYIA 4YZCA 5GNKA 4FT7A 2H9VA 5IKWA 5CF4A 2WELA 1FQ1B 5E8WA 5GJDA 5CEMA 4GT4A 5CT7A 4C34A 4A4XA 3DBFA 3TT0A 3JPVA 2QKRA 3N4VA 4BCMA 2FUMA 4R77A 3R9RA 4TYHB 3FSKA 5K4JA 2WB8A 2OH4A 4YNOA 2G2IA 3BBWA 2JKMA 3PA5A 2YACA 5AP3A 2VX1A 4JQ7A 3CTJA 1UKIA 1E1VA 5EHYA 1UNGA 3U6HA 3AD6A 4NM3A 4ACMA 4ANNA 3DAKA 4YNEA 2PSQA 3FMEA 3EWHA 2WTWA 4KIKB 3FLWA 5AMNA 4F70A 3U9CA 1B38A 2BHHA 1IAHA 2OW3A 3MPAA 3QRKA 5CTPA 2VZ6A 3HNGA 4GEOA 4RC3A 4IBMA 4Q9SA 3TZ9A 3E92A 4FV1A 1E1XA 2RFNA 4C4FA 5E8ZA 3ORNA 2B53A 2I0HA 3C50A 4DG3E 3CGFA 2EU9A 3FLNC 4U97A 5KHXA 4L67A 3COMA 2WMSA 3R0TA 3G90X 3EL8A 4W9WA 4RA5A 4O21A 4QTDA 4HYHA 4AOTA 2WXVA 1YQJA 4ITJA 5ANDA 3V8SA 3WIKA 4YU2A 1PXNA 4F7NA 2XIXA 1BMKA 2GPHA 5A54A 1Z9XA 3DFAA 2FH9A 5LMBA 3DXPA 4ZSJA 4BBFA 3C7QA 2UZWE 2V5QA 3CGOA 1NVSA 3NNUA 1M7NA 1CSNA 5IQDA 3F82A 4CMTA 4EC8A 3B2TA 4TNBA 4O0XA 3WF8A 3MFUA 2YJRA 4WO5A 1PMEA 3JYAA 3WIGA 3GCUA 1H1QA 3UZRA 3PYYA 1BYGA 2XBAA 5EW3A 5AUZA 2WTDA 5TKDA 1E9HA 4EONA 1K9AA 4HNIA 5AV2A 3WF5A 3D7ZA 3GQLA 3FZ1A 2GFSA 4FV5A 4IX6A 4E4XA 4QP2A 3V5TA 2X8IA 3SX9A 4QO9A 3DLSA 4JG8A 2Z7SA 2ITWA 2GTNA 4N0SA 4TYGA 1AD5A 4G5PA 5D7VA 3FZRA 3AGMA 5TT7A 3VS4A 2OZAB 2XJ2A 1CKJA 3W10A 5T68A 1T45A 4HW7A 2HENA 1OECA 1IA9A 4IAIA 4M15A 3DJ7A 3FY0A 2BHEA 3NX8A 4FG7A 2G01A 4UV0A 2GCDA 3HV3A 5BVFA 3OEFX 1PYEA 4IVCA 3ZSIA 3MJ2A 1WBWA 1U54A 2EUFB 5HO7A 2Y6MA 4L01A 2JDVA 4EK6A 5EDPA 4CVAA 3VBWA 4E6AA 4FODA 5JFSA 3F61A 4ASZA 2XUUA 1PY5A 5H8BA 4D2SA 3SC1A 2WMAA 5B0XA 5GJGA 1OKWA 3OXZA 4BIEA 5KKRC 3GC0A 2P55A 3EKKA 3GCVA 3I0QA 3IONA 3R83A 3PXRA 4G9CA 4EH8A 3NUAA 2P4IA 4KKGA 2XNBA 4L53A 4K18A 5DRBA 1YDRE 4IAZA 4LMUA 2GSFA 3O8UA 2YIYA 4B6LA 5E8YA 3RZBA 4JG7A 4O7ZA 2QVSE 3HRFA 2W9ZB 4GG7A 5D10A 4YJUA 3NCZA 3FYJX 4QP6A 3R7UA 4MAOA 2E2BA 4PP9A 3V6RA 2ONLC 2IN6A 4OW8A 3TN8A 1YVJA 2R4BA 1QPJA 2GHGA 4IDVA 4KIOA 4MBIA 4QYYA 4ZTRA 1TVOA 5M53A 5B2KA 3D5XA 4IM0A 5HBHA 5BPYA 5M4UA 4IMYA 3V6SA 1A06A 2X8EA 3COKA 4R7IA 3ZO1A 1BUHA 5FXRA 4LL5A 2ZVAA 3CS9A 3ZBFA 2BIYA 2X39A 3UZPA 5DEWA 4I24A 4I1ZA 4BDKA 1G5SA 2J0MB 2BROA 2GS2A 3LFEA 3OUNB 3QX4A 1Q5KA 2WMXA 5I9UA 5FD2A 2HW7A 3HMOA 1GNGA 1UU7A 1PXIA 2R3PA 5JMSA 2XRWA 4IFGA 5DR6A 1GIHA 3IPHA 3R00A 4PTEA 4EH7A 4AZEA 5DLSA 4S2ZA 3TZ8A 3OHTA 2A4LA 3NIEA 3DQXA 1ZWSA 4NFMA 5L6OA 4FTNA 4S31A 4WBOA 3KULA 4FIFA 3RNIA 3SRVA 4CFWA 1PXPA 2JBPA 3D9VA 5IUIA 2BIKB 4TTHB 4D1ZA 3CCNA 1GJOA 3FJQE 3KCFA 3QD3A 1STCE 4TZRA 2X4FA 4X3FB 3UP7A 4WUNA 3IECA 4LRMA 4G3CA 5ANOA 2IG7A 4LGHA 1Y57A 3DBEA 4R1YA 4M67A 4O0SA 1KE7A 5I9XA 2WMUA 3EQRA 2WOUA 2YDKA 2J0IA 4F08A 4JDHA 4FVPA 3BLHA 3FLZA 3KA0A 5F95A 3W8QA 3O0GA 1FVTA 4KRDA 3PA4A 5LMKC 3VS0A 4B8MA 4BKJA 4BGGA 4F99A 3DKCA 4RJ3A 3UVRA 4FGBA 4FEVA 1FINA 3OFMA 3DNEA 5E7RA 5HBEA 1A9UA 3NUUA 3R7EA 5DG5A 2A2AA 2YM5A 4XCUA 4AQCA 2PZPA 4RJ7A 2OIDA 2B9IA 5DH3A 2W9FB 4U45A 4ZSGA 5HI2A 4PL4A 5L6WL 1ZYJA 3RZFA 4JBQA 2WHBA 2Z02A 2F4JA 1FMKA 2VGPA 2XIYA 2J2IB 2X9FA 2IVSA 1WVYA 2OSCA 2VX3A 4JVGA 5HEZA 3E87A 4GMYA 3N4UA 3E8NA 3FMKA 5HCZA 2XK3A 3LQ8A 3OY1A 2YM3A 2HXQA 1WBVA 4I5HA 3LXNA 5BYZA 3SW4A 4EQCA 4TL0A 2X8DA 3UNKA 4FNXA 3DKFA 1ZMUA 4NTSA 1NVQA 3GU6A 2CJMA 4NJDA 4FZDB 5AUYA 2Y4PA 2WZJA 3ZBXA 4NKSA 4LOOA 2C6LA 3UYSA 2WMWA 3NPCA 3VHEA 3NYVA 4NIFB 4G34A 3ROCA 4FKSA 4BDDA 5EM5A 4QQJA 4HPTE 1I09A 3QQLA 1JQHA 3F6XA 3DK6A 2UW8A 3GU5A 4X2FA 4ZTMA 4IJ9A 2OF4A 3C4EA 4YJOA 4UN0C 3Q9XA 3PJCA 5GZAA 1YHVA 2V22A 1QPEA 3HAMA 3C4WA 2J90A 2QOLA 2UZDA 3ZXTA 4GK4A 2VTJA 5HOAA 4E73A 2PVNA 4H3PA 4RMZA 4JBVA 4XX9A 2X7GA 3BWFA 2V0DA 5KBRA 3POOA 1FGKA 1P4OA 3ROYA 5JFWA 4G31A 4H39A 3HRCA 4IIRA 4MD7E 3AMYA 5D7AA 3S95A 1Q3DA 4KNBA 2VAGA 4O7YA 3FLYA 1XBAA 4NW6A 5FP5A 1O6YA 3G9LX 4KS8A 4WG3A 3BV2A 1SZMA 1XO2B 2G15A 2CKPA 3ORMA 4XG4A 4BHZA 5FDXA 4FL3A 3RK5A 3TIYA 3TIZA 4EHGA 1P14A 2BCJA 5KE0A 3FUPA 2JLDA 3DT1A 5HORA 1KE6A 2CGUA 3DLZA 3JUHA 4CLJA 2ZM3A 3GEQA 5JRSA 3N9XA 2OFUA 3EQHA 5LVOA 4FZ6A 1H1PA 2ONLA 3AD5A 3DAJA 1KE9A 4DEGA 3EFWA 3RHKA 1OL7A 4IZYA 3WILA 3KRLA 3NS9A 4F6WA 2JKOA 2YABA 4PPCA 2HAKA 3Q3BA 3QLGA 1BX6A 2GU8A 2ETRA 4RT7A 3D14A 4RX8A 3TNPC 3MS9A 4YHJA 4Y73A 3UQGA 2XNPA 1FVRA 1WMKA 5ACBC 3R1YA 4LRJA 4RWJA 3NNXA 3FKNA 3V5PA 1XH5A 2B52A 4BC6A 4O7WA 3RPRA 5DEYA 4MWHA 3QXPA 3HX4A 2IVVA 3EJ1A 1XH6A 2B4SB 2BFXA 2EXCX 3FWQA 4A06A 3R8UA 4FOBA 4BWXA 4NL0A 2EB2A 3FL5A 2BZHB 2JDRA 4YPSA 1CKIA 3Q53A 1B6CB 4RIWB 5B2MA 2WQMA 5G1XA 3KC3A 4CEGA 1VZOA 3R2BA 4DGNA 4JNWA 3PE2A 4HGTA 4AA4A 2YZLA 4ZZNA 3KN6A 4BCJA 3FQSA 4L3JA 4E5AX 5A14A 1SM2A 3KXZA 5KMLA 5FBNC 1M14A 4E1ZA 4MXXA 2EXMA 4MH7A 1P2AA 3JR1A 4XJ0A 5CWZA 4DCEA 1MQ4A 3E63A 1XH9A 3W55A 3LQ3A 4LYNA 4F7LA 3IDCA 2O64A 4XG6A 4CQEA 4FTQA 3IOKA 1ZRZA 5AV4A 3S1HA 3IK3A 5CU0A 2VTNA 2VU3A 4MVFA 4RIXB 1IAJA 3E7OA 1H1RA 4TWPA 3TDVA 3UO4A 2W1HA 1JLUE 4MXZA 5EFQA 5LMKA 3U54A 3A7IA 4BR3A 4DTBA 3Q9YA 2I0VA 1RE8A 3UNJA 3UO6A 1PW2A 4G16A 4RRVA 1PRYA 1XH8A 4D9TA 2PMNX 3ZO4A 5FEDA 3T9IA 3U9NA 3FQEA 4N57A 1YWRA 3FKOA 4QQTA 3A60A 5HCXA 3R7GA 4EH2A 5EK7A 2G1TA 2OWBA 3G51A 2YIQA 4A9UA 5HIDA 1DI8A 2YJSA 4FVQA 4ITIA 4M97A 3UC3A 2QO7A 4BCFA 3DBDA 2YITA 4D9UA 5IISA 3QALE 2PVHA 3R2YA 3QYZA 3R7OA 3NW5A
chains in the Genus database with same CATH superfamily
3PY3A 3NYXA 2JDOA 3KVWA 4J53A 4EKKA 2XBJA 3RWQA 4RVTA 1Y8YA 2Q0BA 3TKIA 2C69A 4NEUA 5L8KA 1JNKA 5EM6A 3P7BA 2AEGA 5BUEA 3LQ5A 4I92A 4JX7A 3W2OA 3RPSA 4D0XA 4RVLA 4F1OA 4HVSA 4H1MA 4UMRA 3IW6A 4R8QA 3NWWA 2NP8A 3KIOC 2R7IA 2P3GX 1UNLA 5ACKA 3AG9A 4XG3A 3UVQA 4DFZE 5DMZA 3TEIA 4QMPA 4IC8A 5AP2A 3FXZA 2XH5A 2G2HA 4GT3A 3NUYA 5E9EA 5HU3A 5AUVA 4LGDA 2OH0E 5E4HA 2R3RA 2OJFE 2VWVA 4ANLA 5EYMA 3QCQA 2R3IA 4ENYA 5BVEA 2YM7A 4FKPA 4QTBA 1FPUA 1XKKA 3NEWA 3LCKA 1F0QA 3EN4A 4XG8A 3KVXA 2XIZA 4MXYA 3TTIA 5AUUA 4U3YA 1TFFA 4H05A 4DBXA 4J8NA 5HVYA 5CEQA 5FRIA 3D7TA 5ETIA 4RX7A 1M2QA 3IW8A 4B4LA 2ZV2A 3JS2A 3NUXA 4LFIA 2PWLA 2RSVA 3PUFC 2WIPA 2BRMA 2YLEA 4OR5A 2WMRA 2O63A 3BYVA 3R1NA 4BDBA 4EBWA 3LE6A 4CTCA 2QOBA 4FIIA 5J9LA 3RKBA 3MA3A 4DAWA 2PZ5A 3FI8A 4FT5A 3H0YA 4RLLA 4MYGA 2XANA 4O7TA 4OAUC 4AXFA 4UXLA 4IVBA 4CMUA 3BYOA 3E93A 1DM2A 4Z7GA 3KY2A 3HLLA 4I0SA 5JGDA 4GFMA 3ZO3A 4Y46A 4RFYA 3BV3A 3CPBA 5M4FA 4U42A 4U3ZA 5EOLA 3UPXA 3VUDA 3OC1A 3VULA 4IVDA 2HXLA 4JDKA 3E3PA 3ZFXA 3H4JA 3AC5A 3QTZA 5EM7A 4F64A 5F1ZA 3I4BA 5FM3A 3HGKA 4N6YA 3TV6A 4DHFA 4YR8A 1ST4A 3AC2A 2WQOA 3MBLA 2GNJA 1PHKA 2YCQA 4XH6A 4ZTQA 1URWA 3AT2A 5DT4A 4C4JA 4OBOA 1R0EA 4BCQA 4BCHA 4F9WA 3T3UA 3BU6A 3OS3A 3AMAA 3OWLA 3UC4A 4WG4A 4DH3A 5FGKA 3POZA 3T3VA 4MK0A 5HGIA 4I93A 3MYGA 2CHLA 4NUSA 1YKRA 3CLYA 5IQIA 2XK9A 1H0WA 4BDJA 5HIEA 2O8YA 4NYEA 3DFCB 4FR4A 4BYJA 2ZV8A 3PG1A 4DEAA 4Y8DA 4E93A 3BPRA 2OXYA 4EOPA 2C1AA 2YCFA 5CAVA 4JG6A 1MRYA 3L9MA 3G0FA 3LXLA 4DEEA 2FSLX 2QURA 3QGYA 2VTOA 5GIPE 4LDTA 4DEIA 4C3PA 3KKVA 2ITOA 4CZUA 5C26A 1CDKA 4ALVA 1GAGA 2QODA 5C01A 2E9NA 3FL4A 4BDAA 5DBXA 4PUZA 3LM0A 2VN9A 2VWWA 2VTTA 3E7VA 3QA0A 3DK7A 4FV4A 4GRBA 3NW6A 4J98A 4YZMA 3PLSA 5HNGA 1UWJA 3FE3A 5DNRA 5EOBA 3V5LA 4DHJA 3RMFA 3ZZWA 3MY5A 3U51A 4ARKA 4BCIA 3W0MA 3DAEA 3PLAE 5AAEA 5J87A 4NM5A 3QKLA 2YWVA 2VWZA 4HVDA 4CT2A 3KL8A 2WTKC 4MXAA 2OFVA 4N4SA 4JBOA 1SMHA 2QLUA 4X3JA 1J91A 2ITTA 3L8XA 1UU3A 3CTQA 2OZOA 3IS5A 3OY3A 1DI9A 4O7SA 4TYHA 3OROA 1ZOEA 3C13A 4MQ2A 5HG7A 4BCOA 3LFAA 3OCGA 3TNIA 1OGUA 3ZC5A 3F2AA 4IADA 2C5YA 3WYXA 3EQCA 3ANQA 4FV8A 5FLFA 4IW0A 1H8FA 3HV7A 2C0IA 3RBWA 3HRBA 5CS6A 1ZYSA 3PVBA 4Z55A 4D2VA 2RIOA 3W2PA 3R9DA 4MBJA 3WOWA 4AOIA 1HCKA 3K2LA 4QYGA 3GQIA 2KULA 3FBVA 3TACA 4DLIA 4F09A 5AR7A 2CNVA 3QTIA 4HVGA 2C6DA 4O6LA 2HCKA 4DEBA 4ZY4A 3KK8A 4IWPA 1U59A 3KXXA 2NPQA 3VN9A 2BAQA 3ZO2A 5J1VA 4ASDA 4XUFA 4QMWA 1XQZA 4M84A 5ANJA 4NKAA 3EB0A 4OTFA 4FIJA 5EHOA 4FA2A 5JSMA 4BVUA 4LV5A 5AP0A 3VWAA 3DB6A 4NSTA 2BZKB 1MRUA 4U41A 4AZTA 2ZOQA 4EORA 5KHWA 2R2PA 5HKMA 5EW8A 4QRCA 4V0GB 5FUTA 5LQFA 3MVLA 4TW9A 4NM0A 5EKOA 3U8WA 4E6DA 3C4ZA 2VO0A 4FT9A 5EYKA 1S9IA 5EI8A 3ANRA 4JAJA 2ETMA 4QPSA 2W1CA 3PZHA 2XF0A 3PUPA 2BRBA 2ZV9A 4KKHA 4ZSAA 5AA9A 2PZRA 4AACA 3HUBA 1XWSA 2XVDA 5LVNA 3PPKA 3FY2A 4YSJA 2OI4X 4QNYA 3WZDA 3FV8A 2WQBA 2JD5A 3CQUA 5HNBA 1IRKA 2JDTA 3W0OA 4QP7A 4KRCA 3F2NA 3OBGA 4A9YA 2OZAA 3Q52A 4X7QA 5FG8A 4EYJA 5JZJA 3QGWA 4YHFA 3Q60A 2A98A 1JVPP 2SRCA 3AC4A 3KN5A 5DT0A 3ZZEA 1KV2A 2WTIA 4FTJA 4D1SA 4MCVA 4WUAA 4BZNA 5KO1A 5AAFA 4D0WA 3L8SA 3FMLA 3ORZA 3ZOSA 4AXAA 2Z8CA 3BIZA 5HTIA 1ZZ2A 2IW6A 3REPA 3KXNA 5T3QA 2VTHA 3BU3A 4CNHA 4I5MA 4BBMA 4FG9A 3AC3A 2UZOA 2OJJA 3Q4ZA 4IACA 4MNFA 4BICA 5C4LA 4F1MA 3SG8A 4QQCA 4GFGA 5AX9A 4JQEA 4TKSA 4GCJA 4FKVA 5EYCA 3RAKA 3MJ1A 4RVKA 3R9HA 5JGBA 1NXKA 1YOLA 2PL0A 1SYKA 3QUPA 4OTIA 4RPVA 4R5SA 4LUEA 5ETFA 2E9VA 1QPDA 2BRHA 2XP2A 3RINA 4QDEA 2PY3A 3P1AA 1M52A 4O84A 4AGUA 1UU9A 2IWIA 2IW8A 4BIDA 4M14A 4FKRA 1Z5MA 3D2IA 4IZ5A 3MV5A 3D15A 3V3VA 4RBLA 4X2KA 3VS6A 3UO5A 2VTMA 3AKKA 3TJDA 3KMMA 4X2GA 2ZYBA 2XEZA 1LEZA 3MGYA 4TRLA 3W2SA 4DEDA 1NA7A 4UXQA 4D1XA 2QOHA 3G0EA 2XS0A 4UX9A 4WNKA 3OP5A 5HG5A 2W1GA 5DFPA 1F5QA 3R73A 4FX3A 3RCDA 3NLBA 4BGQA 5L8LA 1KOAA 4E4MA 5BQ0A 1OBDA 1MQBA 3HKOA 3QHWA 3TM0A 5CALA 3GENA 1JSTA 2BUJA 5IQAA 3F69A 4C57A 3TZMA 4UMQA 2HZNA 3VBTA 3BHHA 3COIA 3QD2B 2V55A 4IX4A 2C1BA 1GIJA 3FYKX 2W17A 3GU4A 2YDIA 2CNUA 1VEBA 4FKTA 3WZUA 2G2FA 2PMOX 4O4FA 4UEUA 4C8BA 3D4QA 4OTWA 3SD0A 1U46A 2CNQA 4APPA 5IH5A 4CKRA 4G3GA 2GFCA 3MSSA 3ENMA 4QD6A 4CFNA 3NGAA 4ZZOA 4E20A 2V7OA 3P0MA 5CANA 4X3FA 2C68A 2YAAA 4PTCA 4O4DA 5ETCA 3GCPA 3SOAA 4BY9E 3BYMA 4IANA 2PTKA 4BYIA 2UVZA 3MVHA 4RG0A 4CGAA 4BTKA 4H58A 2PZIA 2QO2A 1JAMA 3FLSA 4DFYA 4DGGA 5AUTA 5I9VA 2IPXA 5AADA 2PYWA 3B2WA 3TI1A 2Q83A 4FEXA 1KUTA 4CKIA 4GKIA 5CU6A 5EDQA 1OI9A 4R3RA 2ESMA 4A7CA 5M4CA 4KIQA 3PIZA 3UDTA 4Z16A 3HMNA 2R3LA 1YXUA 4IE9A 3PJ8A 4GG5A 3IOPA 3U87A 1WFCA 3NAYA 1U5RA 3SXSA 3W18A 5HNIX 1UKHA 3RCJA 2GQSA 4IZAA 5M55A 2WTVA 3T9TA 4AW5A 5DPVA 3UOHA 4C4GA 2QG5A 3PVGA 4O2PA 5CY3A 3G9NA 4L8MA 2PE1A 4WHZA 3HA8A 5E1EA 3BHTA 2JGZA 4YP8A 5HLPA 3GGFA 2PVMA 4FV3A 2R9SA 4O22A 4J96A 3R8ZA 3TV7A 4KA3A 5HTCA 3O5AA 5B7VA 3W8LA 2DUVA 1JBPE 4XEYA 5DVRA 4FUYA 4XP2A 5AAGA 3WBLA 2YEXA 4HCUA 3LFDA 2VTRA 1W83A 2J51A 3P4KA 1IEPA 4UZDA 4D5KA 1YDTE 2JFLA 4BN1A 2C5VA 5FEQA 2Y4IB 2QG7A 1Q8TA 2Y8OA 4W4XA 1O9UA 3ORIA 1W0XC 2CKQA 4NIFA 1LP4A 3G5DA 2ITXA 4YZ9A 4FT0A 4LRKA 2XK6A 3PXZA 3QU0A 5AX3A 1YOMA 4Y95A 5HG9A 4AW2A 2FGIA 3HZTA 4EC9A 3SVVA 3NVMB 3MY1A 4BTFA 3VS7A 5HVJA 4C3FA 3IQ7A 3RJCA 4PMPA 2XMYA 2AQXA 2C6IA 1PXKA 2NO3A 4FSWA 5DOSA 2IW9A 5AV3A 4KBKA 4WD5A 1Q8ZA 3BU5A 5IEYA 1REJA 4QT1A 4RJ6A 4S30A 3O8PA 4OLIA 5FDPA 4K0YA 4FC0A 1V1KA 4BHNA 2ZM4A 4DH5A 3PSDA 2JFMA 3LAUA 5CVHA 5C4KA 3MPTA 4NCTA 4O1OA 5AP7A 3R8VA 4FTCA 5IDNA 4NW5A 4FG8A 4B99A 3WARA 4G3FA 3A7FA 3LMGA 4FTOA 1MUOA 4G3DA 4IB5A 5AP4A 4M3QA 3KGAA 4AUAA 4RSSA 4CZTA 1NVRA 3L9PA 3DKGA 4IEBA 2DQ7X 5FBOA 3SAYA 3SQQA 2A1AB 2EXEA 4YZDA 1KE5A 5IUHA 5D9HA 1BLXA 3DKOA 5BVNA 3S2PA 4ANMA 4FTKA 3C4CA 1H07A 1W84A 4C2VA 2PUUA 4CRLA 4F9YA 5EQYA 4E26A 2PVYA 3HMIA 2PUNA 4HYUA 3MFTA 3GC8A 1W8CA 2H34A 4PDPA 3VAPA 4FKOA 1GZOA 3JVSA 5CEIA 3EN9A 1FOTA 4X0MA 4X6RA 3QRTA 4LOPA 3CPCA 3PXFA 2WO6A 4J95A 3ZLXA 3W0RA 2HK5A 3C1XA 3LHJA 4OBPA 2F7EE 5E8UA 3W2QA 3W2CA 4TNDA 5HLNA 5HQ0A 4MUQA 5HE1A 3A7HA 4JDJA 2XZSA 4N70A 3ZUTA 3FC1X 1CMKE 3M1SA 2YCSA 4M69B 5EM8A 3ZHPC 1ZARA 2PZYA 4C61A 4DA5A 1OIRA 4L3LA 4RIWA 4U7ZA 4PX6A 2F49A 4AU8A 4XV3A 2Y9QA 4DGOA 5JN2A 3KRXA 3U4WA 5CT0A 4EZ5A 1OZ1A 4FTAA 4ANOA 3OCSA 4LL0A 4PPAA 5KMKA 3RTPA 5DGZA 4WA9A 4EH5A 1XMMA 4NU1A 4OTHA 4FK3A 3BL9A 4IAFA 1PJKA 3B8RA 2UV2A 3PRFA 2UZNA 4A9TA 5M07A 2HW6A 3QQGA 1Z57A 4EEVA 4IH8A 4ZJVA 4XG7A 4BGHA 4AS0A 1PMUA 4ACGA 5IA0A 5L4QA 3H30A 3FPQA 1X8BA 3MH2A 4I6HA 4Q2AA 4RIXA 3ID6C 2C5XA 2ZDUA 3ZLSA 1G8AA 4YMJA 2XAMA 2CDZA 4WNMA 4BI1A 3HV6A 5L2TA 5AFVA 2W7XA 4HYSA 2ZV7A 3LCDA 4RVMA 3W32A 2WMBA 3LXKA 4MWIA 5HTBA 3U6IA 4C62A 3QTQA 4XG2A 4R6VA 3AD4A 4UALA 4UBAA 5I9YA 5F20A 4IHPA 5HBJA 3EKNA 3OTUA 4FNYA 4TWCA 3C5IA 4KBAA 3ZDUA 5IA3A 1TQIA 4NWMA 4XV9A 5BUIA 3ALNA 3ZTXA 4A9SA 4XV2A 4DFLA 1AGWA 4RWKA 4D2RA 4DINA 3VS5A 4LGGA 4YTFA 4AA5A 3NMUF 3UBDA 5B2LA 2YN8A 4IWOA 3NNWA 4FTUA 5E8SA 1A48A 1G8JA 3F5UA 4PL3A 2QHNA 4PV0A 5EG3A 2I0EA 3EZRA 5TR6A 4BB4A 3Q04A 5A3XA 3QWKA 3V5WA 4J52A 3HV5A 2VV9A 2UW0A 4FKIA 4OGRA 4F9BA 2IZRA 3UNZA 4D4RA 1AQ1A 4IWDA 4MEDA 4EOLA 1CM8A 3FZSA 3ULIA 4G9RA 4C3RA 3UIXA 1IR3A 1TKIA 2RF9A 3KF7A 2JAVA 4WSYA 4CFVA 3OF0A 5AP1A 3BE9A 2JAMA 3SLSA 5IG1A 3DJ5A 3LFBA 3QXOA 1REKA 4OT5A 4XS2A 4NK9A 2WU7A 3BLQA 4XRJA 3OG7A 3DTCA 5J95A 4K6ZA 4FV0A 4YUQA 4Z7HA 5KZ0A 4DHZA 4TT7A 2GNIA 3SA0A 2XK7A 3LCSA 4JBPA 5ANKA 5HHWA 2GNLA 4FTIA 4PF4A 1H1SA 2XKEA 1PXOA 3OVVA 1H1WA 1Q99A 5IMEA 4EWQA 4QTCA 1LUFA 4BRXA 3BEAA 5AM6A 4C0TA 5A6OA 2ZJWA 4O4EA 4QP4A 5J9YA 2J7TA 4RJ8A 4LQMA 3PJ2A 4EH4A 3ETAA 3BBTB 3GCSA 4TPTA 1XH7A 4FSMA 3ULZA 3BHYA 4U43A 1BKXA 4FEQA 5AEPA 1OKYA 4I22A 3ZS5A 4E4LA 5BX0A 2X7OA 5LARA 2R7BA 4JS8A 1V0PA 4JLCA 5KNJA 3Q5ZA 3D94A 4ONAA 5C8MA 2VWIA 4B0GA 3WI6A 3KU2A 5HE2A 4I20A 4O86A 3A8WA 5D1JA 2R5TA 4BCPA 2JKKA 4PP7A 3O7LD 3LXPA 3QQFA 3Q6UA 4OTPA 4C4EA 4FL1A 4CT1A 4U80A 4JRVA 4FGRA 3IDPA 4EOQA 1Q61A 3ATSA 3PP1A 4WRSA 2FSOX 4QMUA 5CF8A 2QQ7A 4ZIMA 3QCSA 4EK4A 2AYPA 2Y0AA 3THBA 4DITA 4FEUA 4IM3A 2C0OA 3TNHA 2KTYA 4CXAA 2DS1A 3EN5A 4AN3A 3C4FA 4I4FA 3R8LA 3NDMA 2XJ1A 5J5SA 2UZVA 4M7IA 5HO8A 3I5NA 4WBBB 3VC4A 2OLCA 3Q2MA 2F2CB 2X7FA 3UYTA 3FDNA 5J8IA 3HDNA 4EL9A 5K0KA 4EJNA 2W05A 4O4BB 3F5PA 3DB8A 1J3HA 4F7SA 3QD4A 5K9IA 3QQJA 2YM6A 5J7HA 2UVXA 1H4LA 1PMNA 3LOKA 1Y91A 4FSQA 4R3CA 4C59A 3H9OA 3DXQA 3OT3A 2WD1A 3UDZA 4X6QC 1J1CA 5AUXA 2GDOA 1RJBA 1WBPA 3PPJA 3QBNA 3QFVA 5IA1A 2QOIA 4BDCA 3E62A 2EB3A 2CCHA 3FMJA 2AC5A 4I4EA 3EOCA 2ETKA 4O6EA 5KZIA 5A4TA 2YWPA 2C6MA 4O83A 2GS6A 4QYFA 3LFFA 5LMAA 4DLJA 5JFXA 3G33A 2ZFYA 3KRRA 4FTTA 4DC2A 5D41A 2JBOA 4XMOA 5CSXA 4CYIA 1Q62A 3RNYA 4EBVA 4Q5HA 4PTGA 3PXQA 3QZGA 3ZRLA 2W1EA 5CAOA 2XKCA 4DFBA 5CF6A 3U4UA 1K3AA 4KS7A 3ZRKA 1EH4A 3MESA 2WAJA 4QTAA 4LI5A 2CMWA 4TXCA 3NRMA 2HY81 3KULB 4CV9A 5ITAA 4HYIA 2R3GA 2WEIA 1JKKA 3EZVA 4YBKA 5C27A 3RAIA 3W16A 2CKOA 2WPAA 5AR5A 4AAAA 5CEPA 3TUCA 3CKWA 3BQCA 1ZYDA 2PU8A 3A61A 3MI9A 3N4TA 1KSWA 3RM7A 5IQBA 2RL5A 4FUXA 3HV4A 3DQWA 5CXHA 3CKXA 2BDWA 4DDIA 3VW8A 4H36A 3ZUUA 3PY0A 4BDIA 4PPBA 3CJGA 3R7IA 2BZIB 4OTRA 4QMTA 5I4NA 2IZSA 2UW9A 2VTQA 2Z60A 2UZEA 4UZHA 2HZIA 4IQ6A 2OJGA 2X2LA 2GMXA 3HDMA 4PMSA 5IQCA 3GVUA 1OL2A 3WZJA 4GSBA 4IVAA 1W2CA 3O50A 4CZYB 3PFQA 2ZM1A 4NM7A 3LJ1A 3SG9A 2G9XA 4RJ5A 2ITZA 1G8SA 4AT5A 1BI7A 1WBTA 3E8EA 1H28A 2H6DA 5IZFA 1PF8A 3QCXA 4ZXTA 4I6FA 2YLFA 2XKDA 4FZAB 4YTCA 3QAME 5A4CA 4V04A 4CFMA 2J0KA 3P08A 2BDFA 4GFOA 3PE1A 1B39A 3F7ZA 2WMVA 2OO8X 2Y6OA 1DAWA 4EYMA 4QMZA 1DS5A 4V0GA 2FVDA 4EHZA 2QOKA 3S3IA 5A4EA 5DWRA 3VUKA 1KV1A 4AZVA 3DNDA 2WQNA 4CQGA 2J0LA 3EN6A 2GNHA 3M2WA 5BVWA 4BFMA 4D4VA 5CF5A 3BWJA 3R04A 3QTXA 4IC7A 5M4IA 3PSBA 5C03A 3FPMA 4UWCA 4BDGA 5CXZA 2EWAA 2AUHA 4F78A 3CIKA 2B9JA 5E8XA 1BL6A 3VBYA 2GHMA 5CSWA 1IASA 3R9OA 2X6DA 2I1MA 2Y4IC 2W0JA 4IB0A 3W2RA 1WBSA 4NJ3A 5E90A 2YM4A 2X2KA 3ZYAA 1XJDA 3RP9A 4EHEA 5CEOA 3OBJA 3MW1A 2X81A 5J7BA 5M57A 4GH2A 3QZHA 3UOKA 2UZLA 4K11A 3HA6A 4CMOA 5JZNA 4ZJJA 4RGJA 4YZNA 2H8HA 3II5A 4O7LA 4R1VA 4J8MA 2YCRA 1JKTA 4BBEA 1YI6A 4C37A 4F6UA 1G8KA 2I40A 4GVJA 5BV3A 4KB8A 4FT3A 3PRIA 4FKGA 1TZDA 3COHA 4G6OA 4ANBA 3SV0A 4KINA 3RGFA 2YIXA 3OWKA 4DT8A 3QWJA 5CEKA 2XJ0A 4AP7A 1KE8A 3PZEA 4I3ZA 4RIYA 4S33A 3RAHA 2UUEA 2YM8A 1ZOGA 2Z2WA 3NR9A 1YDSE 4YTHA 3FQHA 3VJNA 5KMOA 2C6KA 5CLPA 5HCYA 4U81A 3MFSA 2VUWA 5CENA 4MQ1A 3VRYA 5IPJA 2C6TA 3R71A 1RW8A 4R7BA 2F57A 3V5JA 4XBUA 4FSTA 2PVLA 5BYLA 4H1JA 4U5JA 2QR8A 3CQWA 4I41A 2ZMDA 1RQQA 4YZBA 3JY9A 5EDRA 3QC4A 5DA3A 4FSUA 3P86A 4S32A 1XMLA 2UZTA 3AGLA 5ANGA 2VGOA 3NW7A 4EWHA 3VS2A 2IVUA 4O1PA 4EQUA 5BVOA 2XNMA 5A4LA 4QTEA 4FTMA 5TF9A 4USEA 3UOLA 1ZLTA 2Y7JA 3F7WA 1I44A 3OTVA 4G2FA 4MF1A 5JQ5A 3VONA 3A4OX 3Q6WA 1VJYA 4FSRA 5DRDA 4CFXA 1KOBA 3I6UA 3Q4UA 2ZB1A 4QQ5A 3ZXZA 4CFUA 4EOJA 3RVGA 4YJSA 1M7QA 4QMSA 4DBNA 4EK8A 2O5KA 5CI7A 5C9CA 4M66A 3OOMA 4IX5A 3V01A 3SXRA 3LFQA 1H01A 4P5QA 3VO3A 3KREA 4O7VA 3QCYA 1XBBA 3A8XA 3O8TA 1SNUA 3I60A 5EW9A 4JQ8A 2HYYA 3MPMA 4BKYA 1M2RA 5ANEA 3PWDA 4GVAA 4ALWA 4QMNA 2QKWB 5GZ8A 1QPCA 1VR2A 3O7LB 4KIKA 5DT3A 1GOLA 4LM5A 4HVIA 1OUKA 1PMVA 3K54A 4CG9A 4C02A 2XAOA 4X3FC 1NY3A 3OCTA 3AOXA 3WF9A 4RZVA 1OB3A 3HP2A 3AT4A 4FKUA 5CSHA 5CZHA 2J4ZA 3LCTA 5FWKK 2B55A 1URCA 4DG2E 2YZAA 2ZAZA 3NIZA 4K77A 2NYAA 4YLLA 3ALOA 3HAVA 3QL8A 4O0VA 1ZMVA 2BTRA 4BJJB 2ZDTA 4AGDA 1WCCA 4EK5A 3HECA 5F4NA 4F63A 1H24A 2OU7A 1XH4A 1WBNA 3QA8A 4MXOA 4L44A 5C1QB 5JGAA 4GT5A 3UZTA 4R3PA 2F2UA 4QYEA 3ZEPA 3BYSA 5AR3A 5A4QA 3PIYA 3WF6A 3L8PA 3ZCLA 3BGQA 2WTJA 2VO7A 4F7JA 2OGVA 3CQEA 3L9NA 4D2PA 2XKFA 4PRJA 3WZEA 3FAAA 3W33A 3O51A 5HICA 4AX8A 3ZC6A 5D12A 4EUTA 4F65A 3C51A 3DA6A 2PUIA 4CRSA 2C5NA 3PSCA 4FKWA 4U8ZA 3GC9A 3QYWA 2QOQA 4EOKA 4UYNA 1PXMA 4HGLA 5GJFA 3UTOA 3UPZA 2PUPA 4RQVA 2FYSA 4YO6A 2OICA 2PPQA 3KEXA 3FXXA 5F9EA 1JKSA 5E8VA 4I94A 5AR2A 3D5VA 3F88A 2FO0A 3QF9A 5L2WA 4L6QA 1W98A 4ANQA 5H9BA 3ORTA 3TKHA 1OKZA 3HL7A 2W4OA 2WEVA 3LKMA 4FZ7A 4RA4A 5FTGA 4O82A 4LUDA 2YA9A 3FC2A 2CLXA 2R3HA 3F3UA 5LWNA 3P9JA 4FKLA 1GIIA 2CGXA 2OXDA 4RC2A 3VUIA 2GQGA 2R3JA 5LCJA 5L3AA 4IAKA 4NCTC 2XA4A 3VQHA 3NZ0A 5GIOE 4GS6A 4QNAA 4DEHA 2WIHA 5BMSA 4IFCA 5IQHA 2FA2A 2VO6A 5E92A 2HWPA 1S9JA 2NRUA 4HJOA 4MX9A 4OTDA 1QCFA 1UVRA 3UP2A 1CTPE 4YPDA 3QRJA 3AMBA 4V05A 5JT2A 4DT9A 1SNXA 3IO7A 4DFXE 2JIVA 4RFMA 2JIUA 2ZB0A 4HZSA 3VBXA 2YAKA 3WZKA 2X1NA 5DR2A 4FNWA 3ACJA 4MD8E 5E1SA 4E8AA 4GL9A 4L68A 2F7XE 2Q0NA 2UZUE 4FKJA 3EL7A 3B8QA 5D11A 2ITQA 4GJ3A 4CTBA 1FVVA 3RALA 3VHKA 2J9MA 2YERA 4BDFA 5I0BA 3ORLA 4FSNA 3FMHA 2VNYA 4Y5HA 5DHJA 1M2PA 1G3NA 4PDYA 4GW8A 4UMPA 3GFEA 4O7RA 3LJ0A 2X0QA 2E9UA 1HOWA 1Q97A 3BE2A 3BGPA 4QP8A 2LGCA 3ZONA 4M69A 1XR1A 4NFNA 2PE2A 3ORXA 2YIWA 3A62A 4HCVA 1Y6AA 1GY3A 4ORKA 1VYWA 2WU6A 4L3PA 2UVYA 1OITA 5AJQA 1GZKA 4UMUA 3BYUA 3CP9A 4M68A 2W1DA 3DCVA 4OUCA 3EIDA 5BUJA 1RDQE 2VWUA 5I3OA 1P5EA 2OG8A 3KMUA 3BEGA 3PJ1A 2GNFA 3DZOA 3GU7A 4FNZA 3UIBA 3FI3A 4OT6A 3I6WA 4EI4A 2CKEA 4XOZA 1UU8A 1Q8YA 5CSPA 3NNVA 4FV2A 4ZS0A 3ZUVA 2ACXA 5EI2A 3EQGA 4P7EA 2A27A 3NYOA 3VUGA 4BCGA 5DR9A 3A7JA 1PKGA 4BL1A 2W1ZA 3UDSA 3DTWA 4L45A 2PVJA 4YO4A 2WKMA 4JMQA 3ORKA 2CGWA 3C0IA 3PXYA 5K0XA 2ITUA 2F9GA 2OK1A 3G6GA 4L43A 2CSNA 4AOJA 4EH6A 5IA2A 1H27A 3EN7A 4Z3VA 4O0WA 4EJ7A 1ZY4A 3PIXA 3K3IA 1J7LA 2QC6A 3E5AA 3PVWA 4YJTA 3RPVA 2OKRA 4DH7A 3IW7A 5FM2A 1KWPA 4FYOA 5LWMA 1TQMA 5IMXA 4IZ7A 4QMYA 3CEKA 4WNPA 2QOFA 2W1FA 5IH6A 3OXIA 2UW6A 5LVPA 4D2TA 4D58A 3Q5IA 2VRXA 3DS6A 4GUBA 5HG8A 4W8DA 1R1WA 1T46A 2X9EA 3C0HA 3F9NA 5J5TA 4II5A 4O27B 5IU2A 2XM8A 1SVEA 2GHLA 3Q4CA 5CQWA 3QTWA 3C4XA 4ANSA 3EH9A 4Y72A 2IVTA 4C4IA 4AFJA 4IB1A 2XIKA 2OXXA 4PNIA 3PDTA 4TWNA 4CCBA 2AC3A 3QKKA 4TYJA 1OUYA 4D4SA 3ZLWA 5KMJA 3R1SA 4BZOA 2W96B 3UMXA 4KBCA 2DWBA