3DBCA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 257
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 72
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbcA01
3FMEA 3WZDA 3OW4A 4U97A 4QQTA 3EJ1A 4U43A 4FKGA 4FSQA 1KE6A 4ZS4A 2AYPA 4QQJA 5A4EA 1YI4A 2ZDTA 1CM8A 3U51A 4FOBA 1OPLA 3R73A 4M66A 4Z7HA 2YDJA 3QRUA 2ITUA 4NM5A 3SXFA 1GY3A 4G6OA 4N6YA 3UO6A 2WOUA 3HRCA 4IB3A 2WO6A 5M56A 2YCQA 5KKRB 3ZDIA 4TNBA 3IW8A 3OC1A 5IQGA 4ZK5A 4FK3A 4AA4A 3DBDA 5IQBA 2ZV7A 3R04A 3PIXA 3Q32A 4NH1A 5DH3A 3QA0A 4F9CA 2PVFA 4CVAA 4YC8A 2YISA 1VYZA 4FT0A 2GNJA 2HZNA 2JFLA 4IAZA 4O2ZA 5FP5A 3F9NA 4WNPA 3VW6A 5HGIA 5I0BA 3U55A 1CKIA 3T3UA 3EFKA 3NW7A 3R00A 4V01A 4CRLA 4JJRA 3FMDA 2J0LA 2ONLA 4XS2A 4WRSA 3LM5A 4D2WA 5L3AA 3ZU7A 3MIAA 3ZDUA 3PVBA 5AAFA 5IQCA 3EZRA 3QQUA 2J7TA 3UJGA 3HL7A 3NMUF 2RFNA 3UOHA 4NZWB 3LFSA 5EK7A 4RX5A 4ASDA 4MWHA 3R9HA 2X2KA 3U4UA 5BYYA 5EI8A 4R5YA 4G3FA 4OT6A 4FTLA 4NKSA 3PJ1A 3T8OA 4GIHA 5AM7A 4FKRA 4UWCA 3IDCA 3QYZA 3V8TA 3A99A 1UWJA 4G5JA 4RJ4A 3LKMA 5DVRA 3NEWA 4C59A 2XYUA 4BDCA 2QVSE 2ZB0A 3UPXA 3R9RA 3FI8A 2YJRA 3TEIA 1UU8A 2XK6A 4H58A 4TRLA 4Y5HA 4D9TA 3OWJA 3K3JA 4OAUC 4IFCA 3E8CA 3QHWA 5EQYA 1IR3A 4KIOA 3W18A 5IUGA 4QMLA 2X8EA 3M11A 2B52A 3BZ3A 5CQWA 4L3JA 4L7FA 2DQ7X 2W1FA 3ZUVA 2GQSA 4UEUA 3KMMA 1FOTA 4O91A 1H07A 2C6EA 2UW8A 2WAJA 4Y46A 2UW5A 4XLVA 4CFWA 2JDTA 2XP2A 4FSTA 4DEAA 5BNJA 2P0CA 4LG4A 2W1CA 3MVLA 5CSXA 5EW9A 3ACKA 3ULZA 3AC2A 3MB6A 1QCFA 4D28A 3PJ3A 4FTAA 2YAAA 5I9XA 3OY1A 5A54A 1Y8YA 2OH4A 4FIJA 4DTKA 2XVDA 4PTEA 4AA0A 2WMAA 4D2SA 5JGBA 3F7WA 3L8PA 1XJDA 4FTCA 4QYHA 3OWKA 2ITOA 5HESA 3VW8A 3FEGA 4GFGA 1Q8YA 3C5UA 3H4JA 1R1WA 3Q4ZA 5JEBA 2XRWA 2H96A 4FSZA 2VUWA 3A60A 3F3UA 3O51A 2XEYA 4ALVA 5CF5A 5EM5A 3QYWA 4XG2A 3ZLYA 3BU3A 3BYMA 4D5HA 4EOQA 4IAFA 4WOVA 1R39A 2NPQA 4LL0A 4EH9A 5BPYA 2OZAB 2C3LA 4FGBA 5KZ0A 2VX0A 2XJ2A 2YM5A 3K3IA 5GIPE 4GU6A 4CKRA 4IZYA 2Y6MA 3GU5A 3E7VA 3PLSA 4I21A 4BTFA 3NPCA 4K9YA 5L2QA 4BCIA 1H8FA 3AD6A 3PJ2A 4FV8A 4DE4A 4IC8A 4UMQA 3ALOA 4BDFA 2VWBA 1NVSA 4FYOA 4L44A 2FH9A 3TJCA 5AADA 3W2SA 2UW9A 5HIDA 5IEYA 1JWHA 4TYIA 1GIJA 4D5KA 4FR4A 3FPQA 3RWPA 3GC9A 3NS9A 3SKCA 2G01A 4H1MA 2BKZA 2RF9A 3DAEA 4L46A 3RBWA 5E1EA 3IW7A 4RVKA 1RE8A 3LCDA 2OZAA 4ACDA 4P5QA 1PKGA 3EQBA 4IWPA 4M12A 5KHWA 3KC3A 1GZKA 1Q24A 2XS0A 1OPKA 3UYTA 3GC8A 4FV3A 3R22A 3KXGA 4G17A 3LJ2A 5C4KA 5DEYA 2GMXA 4IADA 4JLCA 4FTTA 1JSUA 2JBPA 3LCKA 2C6MA 4B0GA 1Q4LA 2GS7A 2YABA 1QL6A 2XK9A 4BDHA 4DGOA 5HD4A 2WIHA 4MKCA 5GHVA 2PVKA 2CKEA 4FV6A 1XWSA 2UUEA 4ITJA 2QOIA 4AW5A 5E9EA 3G51A 4MVFA 4ZSGA 2Q83A 1BMKA 1JKTA 4O83A 3ZFMA 2CGUA 5HLWA 3BHHA 3DDPA 3LHJA 2PE0A 3PPKA 4IDTA 2XNMA 4NCTC 4YZBA 3QLGA 1JSTA 3OHTA 2C4GA 3UBDA 4CYIA 2W1IA 2JD5A 2UZBA 3OEZA 4QMTA 1OITA 4EC8A 3CY2A 3EQIA 3OROA 5C01A 3UNKA 4EC9A 3O23A 2O65A 2E9OA 2VTNA 4YPDA 4R5SA 5CXHA 5AX9A 5H3QA 3D15A 1V0PA 4BFMA 2W5BA 4M7IA 3PZEA 4XG4A 2ZYBA 4FTOA 4UB7A 5J5SA 2UW6A 3BHTA 3MJ1A 1K2PA 4HCVA 3VRYA 3I1AA 4FZDB 3NUNA 4BDDA 4HYHA 1LP4A 3W16A 3ORZA 3F61A 3FMNA 2A0CX 2JDOA 4NFMA 1EH4A 5L6PA 3SVVA 5F95A 4PP7A 4JS8A 3Q5IA 5EI6A 4OTRA 4C38A 3G33A 4P4CA 2PZRA 3LMIA 1PXJA 3LXKA 2FUMA 3LOKA 4EJ7A 1W0XC 3BWJA 3LXPA 4DLIA 4QMZA 4QOXA 2KTYA 3OWLA 1YXXA 4AP7A 5KBQA 5F9EA 5IQDA 4FVQA 2FB8A 4NEUA 4AOJA 5K4IA 4USEA 3R63A 3CS9A 2AUHA 3EHAA 2WPAA 4Q5EA 3FBVA 3LE6A 4HOKA 4RVTA 2O5KA 5AJQA 3TCPA 2XBJA 1IEPA 3QZFA 3D2KA 4CG8A 3P0MA 3VS7A 2W5HA 2BDJA 3BRBA 3EFJA 3AMYA 4TZRA 4Y85A 5EYMA 3ZLXA 2W1HA 3NNWA 4AE9A 4L9IA 1YHVA 4XV1A 1SMHA 4AT5A 4IIRA 2Y8OA 3G0FA 5TT7A 3ZO4A 3M42A 3BHUA 1Q8WA 4WO5A 4D9UA 3UIMA 3NUYA 5IQAA 4BWKA 2YM7A 4O6EA 4A9RA 2R0UA 1M2PA 4AGCA 4MEDA 3NNUA 4FYNA 5JRSA 3C4CA 3TZ8A 1U59A 3CCNA 4GT3A 4IW0A 3DFCB 1YI6A 3WI6A 4FV0A 5J7HA 4KKGA 5E4HA 2ZM1A 4EHZA 4YC6A 3NIZA 4OUCA 4EYJA 1H01A 3MJ2A 3AT2A 1YVJA 3GNIB 3VBQA 2VTJA 3VF8A 2GQRA 4BCFA 4F0FA 3TKUA 2F4JA 2XCHA 3KXMA 4AW1A 1JSVA 4LI5A 1YDTE 2PMLX 4E5AX 3E63A 3KXHA 3DCVA 5GZ9A 3TWJA 1UU7A 2YLEA 4O7RA 1ZMUA 2X9FA 1DAWA 3K5UA 4E4LA 4F9BA 3SOCA 4F6SA 5AUVA 1PYEA 5AR4A 1ZYCA 4DH1A 3BGQA 2QOBA 4MF1A 1YWNA 3PY3A 2JEDA 2QOLA 3RTPA 4BCPA 1KSWA 5I9WA 2V5QA 2GS6A 4Y72A 2QHNA 5ANIA 5FTGA 4DTBA 2OIQA 1M52A 2C6DA 2VTMA 2Z02A 4QP9A 1VJYA 3S3IA 4IVDA 3V04A 4CYJA 2QOOA 3PSBA 4PTCA 4ZXTA 3HLLA 4AWIA 2VTIA 4DG2E 4EK6A 4W4YA 3S00A 4UXQA 3QU0A 3R9DA 3EYGA 4NW5A 5FDXA 1I44A 3FHRA 2UW7A 4BCJA 3U6JA 1O6LA 4FV4A 3OY3A 5JK3A 3GENA 5LJJA 3P7AA 5HICA 4WKQA 5HG7A 2Z7SA 3R1SA 1NT2A 2ZV2A 3UOKA 3TV4A 2VO3A 4U6RA 3KK8A 5AV3A 4ORKA 4QPSA 3ORNA 2HZ4A 4JQ7A 4KRDA 4I5HA 3DDQA 4YHTA 3GCVA 4H05A 4MXXA 1SNUA 2W05A 5IZFA 3NUSA 5HO7A 3GCPA 2W4JA 4BTKA 2Z2WA 2NNWB 4YJTA 1GZNA 4O0WA 3LFFA 4O0YA 1UNGA 2RL5A 4WUNA 5HKMA 2BVAA 2W1GA 4MTAA 2JITA 5CI7A 1FPUA 4ANQA 3KXNA 4AQCA 3O17A 4RC3A 4QP4A 3HDMA 2OSCA 5B2KA 4FTIA 4J8NA 1U5RA 3LFQA 4II5A 4D2VA 4PDYA 2UW3A 3R2BA 3KL8A 4ITHA 3VUTA 5BVOA 2WTVA 4A7CA 4D58A 4KBCA 2QODA 2E9VA 2W9ZB 4HJOA 3SG9A 4ZTNA 1UNHA 2W0JA 3N4VA 3U9NA 3MY5A 3OCBA 3V6SA 4HVHA 2EWAA 2P2HA 2W06A 4NIFA 1ZYLA 1E1VA 4XG9A 3RGFA 3WOWA 3ZS5A 1PY5A 4EH4A 4O84A 1FVTA 4J71A 3Q52A 2IZUA 5CU4A 4F63A 4IH8A 4ZTLA 4ERWA 5HI2A 4ZP5A 2G2FA 2WQEA 2X7GA 4O2PA 2OJ9A 4GIIA 4D1ZA 2R3KA 3EN7A 4UMPA 4HGEA 2OJGA 4BR3A 4GV1A 3BU6A 1GOLA 2WMUA 4IMYA 3DLZA 4QNAA 3G9NA 3DKCA 5EYCA 2EXMA 3F6XA 3ULIA 2X4FA 3LXLA 4S32A 2OFUA 3EQCA 5KBRA 3TNQB 5D10A 4YSMA 3WZEA 1FQ1B 4DH7A 4DEBA 4HGSA 4QMVA 3I6UA 4L6QA 4YO6A 3FI2A 4BBMA 5HU9A 4R7BA 5E7RA 5D1JA 5J8IA 4B4LA 5FBOA 4Y83A 3BLRA 3NNVA 1JLUE 3Q9WA 4J53A 2HY81 4BBFA 1IG1A 4LL5A 3D9VA 3TNWA 2HWPA 2UZUE 5EI2A 3W8QA 4ZLYA 4H3QA 3VBTA 4DEGA 3B2WA 1XR1A 3C1XA 3CGFA 3DNEA 4IM0A 2XKDA 3WF8A 4AX8A 4EOIA 3B2TA 4HVSA 4WG3A 3LJ1A 5TOZA 2WMXA 2ETKA 4YSJA 1OL6A 1ZRZA 3FL4A 5AUYA 3U6IA 5CNOA 2JGZA 2PMNX 4JBPA 2X6DA 3LFBA 5AA8A 1NW1A 4JL9A 5KHXA 2BAJA 4UYAA 4CQEA 4O7TA 2AC5A 3QALE 2FGIA 4X3FC 1ZZ2A 3BPRA 3G6GA 4IM2A 4YJOA 2PE1A 2R3OA 4X21A 3R30A 4D4RA 3GOKA 3D7TB 3C4XA 3TI1A 1Q41A 1ZXEA 3ZBFA 3PWDA 4RA4A 5IQEA 3Q04A 4RX7A 5IKWA 4CTCA 5J9LA 3EFLA 4MQ2A 4RC2A 4HVGA 3FYKX 4MXZA 2C3KA 3DKOA 3BEGA 5KE0A 3C4WA 3TN8A 3RK7A 2FA2A 4MCVA 2LGCA 4DA5A 2BAKA 4FKUA 4FKJA 4TTHB 4CFVA 3FKOA 4FIEA 5DPVA 3PJCA 1M2QA 3MS9A 4MBJA 5AIKA 5H8BA 2F49A 4CCBA 4QYYA 1SVGA 2C0TA 4FTJA 2BAQA 1GIIA 5KMOA 3MSSA 3FLSA 2J5FA 3NGAA 1OBDA 1F5QA 4YMJA 4YR8A 3NYOA 5M07A 3D7TA 1PW2A 2UW0A 3PYYA 4QYGA 4EZ3A 3JVSA 3NUXA 3I79A 4HVDA 1JKSA 4FKTA 4IBMA 2VTAA 4N0SA 3ZM4A 5IA0A 4Y5QA 3UOJA 3PP1A 4RZWA 1TQIA 1A06A 2BZKB 2OH0E 1J7UA 4EK5A 4LFIA 5HIBA 1PXNA 5C8NA 3ZOSA 3HAVA 4LYNA 1KV2A 2QLUA 3O8PA 4N4SA 3Q9XA 4I0SA 3C51A 3EQGA 4DEIA 4E6AA 2OLCA 2BDFA 2FSMX 3SLSA 2XIYA 3EN4A 4ZZMA 5KMJA 3AC1A 3VULA 3FLQA 3BQCA 2W5AA 2JDSA 2PMIA 3BHVA 4MXOA 4EHGA 5L2TA 3HUCA 3QD4A 2Z60A 3UP2A 4X7QA 4EOMA 4M67A 2OXDA 3BE9A 4F1MA 3CC6A 4IX5A 2HK5A 4I6FA 2R7IA 4IVCA 1M2RA 3M1SA 1WVYA 4Q5HA 5AWMA 5JFXA 3DA6A 3AMBA 2C6IA 3Q9ZA 4G34A 4U42A 3ZO1A 4EJNA 3MH0A 4BGGA 2F2UA 1XBCA 1KE7A 2B7AA 4OTQA 1PXLA 1DAYA 1DS5A 2PUUA 3MW1A 2VRXA 3KF4A 2VTPA 3GP0A 3F5UA 3NCZA 4O21A 4ASEA 4HCUA 4CNHA 3H10A 4RPVA 4JQEA 4R1VA 5H9BA 4DGLC 4GW8A 3BHYA 2XIXA 4IJ9A 4A9SA 3Q2MA 2ETRA 2PUNA 4JBOA 5BUIA 2R5TA 3BX5A 2BIYA 1H1QA 4DGMA 2QOCA 2R3JA 4YNEA 5KMLA 5CF6A 3P7BA 2PVJA 3R71A 2YIXA 3CD8A 3MPMA 4JT3A 3HA6A 5CSVA 4BKJA 4QTAA 3VS0A 2B53A 1K3AA 2WU6A 3IQ7A 4QMOA 4D1XA 4ZZOA 3MWUA 2JC6A 4KB8A 3UNZA 4E5BA 1W8CA 3D94A 4RIOA 2H9VA 4YZMA 5DMZA 5M57A 3GCUA 1A9UA 5IQIA 4I22A 1PMEA 2QR7A 2XCKA 4IAAA 4TPTA 5LMAA 4F1OA 2I40A 4OTFA 5M09A 4ARKA 3PXRA 4APPA 2RKUA 3QTXA 2QD9A 4RX9A 4GVJA 3AC3A 4MXCA 2CGWA 2FO0A 2F9GA 3RALA 5F4NA 3RJCA 3ZRMA 2IZSA 1LUFA 2C0IA 3DB8A 3VBXA 3JS2A 3HDNA 4UZDA 4GK3A 4EBWA 4YLLA 3QD3A 5A9UA 5CSPA 2J90A 4FIHA 3O8TA 4NCTA 4TY1A 4I4FA 4WBOA 3ZM9A 3QQHA 4QMUA 5B0XA 4U3ZA 5FTOA 3IOKA 2BFXA 4N6ZA 3VHEA 4U3YA 4NYEA 4XYFA 2VTRA 4QMYA 3PRIA 5IUIA 5DR6A 4C34A 4DH3A 4P7EA 4I24A 2GFSA 3OTUA 4AW0A 3GQIA 3FE3A 3NVMB 4NU1A 3EZVA 2YAKA 3RNYA 2XEZA 2QONA 2GHLA 2UV2A 2JAMA 4BCKA 3R7OA 4JRNA 4USFA 3G9LX 3HNGA 3ZLWA 1VYWA 4ONAA 4DC2A 2CN5A 3HV4A 5E8YA 5JGDA 1H1RA 2WTWA 3FSKA 3BV2A 2OXYA 4A9TA 4BCQA 4BI1A 5M4CA 4Q9SA 1TQMA 2VO7A 3COKA 2YZAA 3ZSIA 4FL1A 1BLXA 4I1ZA 3EB0A 3OTVA 4A9YA 2CNUA 4OR5A 5A4LA 2PK9A 1AQ1A 3MVMA 4YTHA 1STCE 2X2MA 3R7EA 3GC0A 4AT4A 3TDVA 3VNTA 4LOPA 4QPAA 4EOOA 3SC1A 2HIWA 4MX9A 3IOPA 3QWKA 1H00A 2J0JA 1JQHA 1WVXA 1YOMA 3GB2A 4XHKB 3QUDA 3W32A 4J96A 5CX9A 2R3NA 4YJNA 3A8WA 2W96B 4I6HA 2OIBA 4AW2A 1XH6A 4AA5A 2J0IA 2BALA 2VX1A 5HZNA 4FT5A 3LQ3A 5C4LA 3A8XA 4DYMA 4RVMA 1TVOA 4FX3A 4M97A 4YJSA 2Z7QA 1XQZA 3VS5A 3U54A 2QR8A 4CFUA 5CAOA 2VV9A 3P5KA 4I6BA 4RWLA 2OFVA 2YCFA 5EKNA 3OBJA 3SW4A 3PA3A 4FG7A 4Z55A 4AGUA 3OOMA 2VGOA 5I3OA 3WF9A 4UX9A 3ZRKA 5JH6A 4XRLA 2BR1A 4QT1A 3A7JA 2ZB1A 5AAEA 3SXSA 3CJFA 5AP2A 3RPRA 5DN3A 3P1AA 3DAKA 1QPJA 4KS8A 3ET7A 4W8DA 1WBSA 2BROA 2XNEA 2I0EA 4I23A 2JFMA 4U81A 4E3CA 4AZTA 4IX6A 4L01A 4CEGA 3EQHA 1YW2A 4OLIA 3ZC5A 2YCRA 4FEQA 3CSVA 5CZIA 1FGKA 2G2HA 4YJVA 4RBLA 2YN8A 4RMZA 4JDHA 2GCDA 4O6LA 4BN1A 1H0VA 5AP6A 1H26A 5JSMA 2CNQA 5EHYA 3ENMA 4K11A 5DFPA 3EN9A 3C5IA 4X2FA 3ZFXA 4FTRA 4CTBA 5LVNA 2OK1A 4U8ZA 5BMMA 4EH6A 5LWMA 1Q3WA 1UVRA 5EKOA 3POOA 2W4KA 2WQBA 3CQUA 3UGCA 4C4FA 1PHKA 3BV3A 3DB6A 4BCGA 4PMSA 2IPXA 3ENHA 3HKOA 3UE4A 5CU0A 3FJQE 2ITVA 3RZFA 3HVCA 3WF6A 3UIBA 4F9YA 2OBJA 4JBQA 3DV3A 1DI9A 4BGQA 2YCSA 4IFGA 3HV6A 4IM3A 1CMKE 4PL4A 4OGRA 2NP8A 2W99B 2CGVA 5FBNC 3COMA 1ERKA 5FEQA 2WMVA 3ERKA 3OT3A 3ZEPA 3PTGA 5HG9A 4CQGA 2PZIA 3BELA 1FMKA 3FMMA 3R21A 4G6LA 3ACJA 3R2YA 5EM7A 5T3QA 2B54A 3U8WA 4D1SA 2PUIA 2C6TA 3D4QA 4RX8A 2P3GX 1FBNA 4M84A 4XOYA 4MBIA 5DOSA 4DT9A 1MUOA 3FLWA 3UZPA 4EH8A 5AV2A 2C1AA 2XJ0A 4MAOA 5C1QB 3UQGA 5J79A 4BDGA 4PUZA 4I5MA 3CIKA 2QU5A 4V05A 4WD5A 3R01A 4L3PA 4Y95A 4N70A 4GK4A 4MD8E 3S2PA 4LGGA 2YLFA 3S95A 4U44A 1URWA 4BTMA 5AUUA 2QURA 3E62A 4QQ5A 4F99A 4P90A 1LR4A 3ZH8A 1OUYA 3GGFA 2ITTA 3IK3A 2CDZA 2IVTA 5DBXA 2BCJA 4PMTA 4EEVA 1G5SA 4LMNA 4RQVA 5CZHA 4BIDA 3O8UA 5M53A 4YZNA 1TKIA 1Y6BA 1OL2A 5CT0A 2V7OA 1Q8ZA 4UBAA 2YERA 3TNHA 5BYLA 5AR2A 5CU6A 1B39A 3OCSA 3VN9A 4LOQA 3VUMA 4IE9A 5CAVA 1Y57A 2ZAZA 4NJ3A 4FZFB 4N57A 4FV5A 3C13A 2QHMA 4HGTA 4YZCA 5K0KA 5C8KA 1H4LA 1B38A 2XK8A 2WIPA 1YOLA 3NUUA 4XX9A 4KABA 4RJ5A 3E3BX 4FICA 5IH6A 5D12A 3F3VA 4X3FB 3LIJA 1P2AA 4X2GA 4AN9A 2LAVA 4MF0A 5B7VA 3P9JA 2B0QA 3QUEA 3TL8A 3MN3A 4XOZA 3U6HA 4R3CA 2X4ZA 1QPCA 3AGLA 4WSYA 4ZSEA 1ZOEA 3AMAA 3O7LB 4ZJJA 3OS3A 4AZSA 5CEOA 4CKIA 4F7NA 2GTNA 4XG3A 4L00A 2B9IA 3R7IA 4FSNA 2C6KA 3TJDA 4O81A 1G8AA 3LFEA 2EUFB 2YJSA 4K2RA 3EQPA 2VTOA 2WMSA 4IC7A 4I3ZA 4W4WA 4BWXA 4DGGA 3QQGA 4EL9A 4X3FA 4GUBA 3S4QA 4EH5A 4ZMFA 4FL2A 3DJ5A 1V0BA 4F7SA 4FT3A 1IRKA 2BDWA 5EHLA 1WCCA 5FXQA 4WSQA 3RAWA 2GNGA 5E8XA 5C8MA 3DZOA 3DY7A 4PDOA 4J8MA 4RT7A 2ETMA 4UMRA 2R3QA 2HW7A 4L8MA 3WIGA 1T46A 4NK9A 3BYUA 1ZARA 3VF9A 4FKPA 1Q8UA 4JG7A 2ITNA 3W10A 2F7EE 1H1SA 3FLZA 5AAGA 2E9NA 2UVYA 3ROYA 2WEIA 3TIZA 4DINA 5J7BA 5FXRA 3IGOA 4KIKB 3EWHA 4HW7A 3ZTXA 4C61A 4QTEA 2RG5A 2W17A 2WOTA 3KRXA 1FGIA 3PA5A 3OW3A 3LFAA 3V51A 2ITQA 3FLNC 2VTTA 4FEUA 5AP0A 4IX4A 5IQFA 2GU8A 3MY1A 3P86A 5TO8A 3SAYA 5K5XA 5AFVA 2BTRA 1BKXA 2RFSA 2UW4A 3HMMA 1TQPA 1RW8A 4QTBA 3ZRLA 4XH6A 4FE2A 4O7SA 5IMEA 4M3QA 2JKMA 3O2MA 2BILB 2PE2A 2RG6A 3DQWA 2PZ5A 3FHIA 4I92A 4IHPA 5CEQA 3TV6A 2OZOA 3A4PA 3MDYA 1P14A 1XO2B 3QGYA 2E9PA 2XRUA 4E93A 4KS7A 4YLJA 2XKFA 2PVMA 2QOFA 3SV0A 5LXMA 4LGHA 4C57A 3PSCA 3PVGA 4KIKA 4B8LA 3LMHA 3VVHA 3Q53A 4Y73A 3DJ7A 5E8ZA 5HHWA 3SOAA 4C7TA 5AUZA 2XNPA 1A48A 4BKZA 3RCDA 3MVJA 5CU2A 3VUGA 4A07A 2XKEA 4BY9E 4BDAA 4KIQA 2VO0A 5CS6A 5M08A 1U5QA 5TE0A 1M17A 3UYSA 4XRJA 3WIKA 3F5PA 2GTMA 2VWWA 3GXLA 5IISA 3E3PA 1CKPA 4C62A 1WBPA 3GCSA 2VAGA 2I6LA 3FMKA 4YUQA 2IZRA 3MFRA 3DTCA 4LRKA 5EYKA 3RHXA 1I09A 4LV8A 4BHZA 3QCXA 3MI9A 3ZYAA 1JOWB 4U45A 3OVVA 2OKRA 4XNEA 3RKBA 5FUTA 4FNWA 2ERKA 2BHEA 3NVKI 1P5EA 2QOKA 4EQCA 5AP7A 4ZSAA 2QCSA 3ZBXA 3LFDA 4BBEA 3RK5A 4MBLA 4W8EA 3GOPA 5IA1A 3UIUA 1Y91A 3GU8A 5HD7A 4RZVA 4V04A 4C4IA 4PTGA 4YU2A 4BL1A 3KRJA 3QQFA 4EBVA 4JRVA 2WTKC 5ETCA 4J98A 4KBAA 1WZYA 1IASA 2X6EA 3D5XA 3L9MA 1H1WA 4ZIMA 3KY2A 4IACA 1O6YA 2A1AB 4PPAA 4IZAA 2A2AA 4M68A 2B55A 4MXYA 5AP1A 4NW6A 3OCGA 4DCEA 1RQQA 3FZPA 2DS1A 4NT4A 2R0IA 4QD6A 5D7VA 5DGZA 1XBAA 3VUKA 3C9WA 2NRUA 4JG8A 2F7XE 4OBOA 3UDBA 5E8WA 2IVUA 3UTOA 5FQDC 5I3RA 2GHMA 2C5OA 4PDPA 4GJ2A 4IB0A 4M69A 2W1EA 2C3JA 4HPUE 3FWQA 4CZUA 3GVUA 4Q2AA 2QO2A 1FVRA 1M14A 3EL8A 4XP0A 2J51A 1UU9A 4I93A 2VTQA 3LCTA 4KSPA 4D0WA 3HV3A 4J7BA 2YIYA 3MFTA 4UY9A 2XM8A 4LRJA 3ZEWA 3UO4A 2VZ6A 4FSMA 4FK6A 4DTAA 3F82A 5M4IA 4WNMA 2UZVA 3ELJA 2C69A 4C4EA 2PU8A 4MHAA 4RJ6A 1UU3A 4BCHA 4EYMA 3GU6A 3PXZA 3R7GA 4MXAA 3NW6A 4EOJA 2PWLA 3ROCA 3QWJA 5HVKA 4O0SA 4TWPA 4RIWB 3DJ6A 3MBLA 3PVWA 5EOBA 3QHRA 2G15A 1S9JA 5M51A 5CXZA 5KUPA 4R7HA 4TWNA 3ZMMA 2WGJA 3ETAA 3IKAA 2NRYA 2Z7RA 4KKEA 5LCKA 2YACA 3KVXA 5DYJA 2QKRA 5JFVA 3Q96A 5TF9A 5DT4A 2OO8X 3POZA 2VO6A 2YHVA 5DRDA 3I5NA 1PKDA 4QMXA 4RIXB 3SQQA 4RA5A 2PVYA 3A62A 3GEQA 3EYHA 1OGUA 3EQRA 2QO7A 4IWOA 3GFEA 3G90X 5HCYA 5ICPA 3KN5A 5IF1A 4F0GA 4RIWA 3L8SA 2QI8A 5A4QA 1GIHA 3FQSA 3VS3A 5CANA 4ZY6A 4NIFB 4BYIA 3ATTA 1RDQE 3W8LA 3MPTA 3ZXTA 4XG6A 3PVUA 3BEAA 3E8DA 3UMXA 4F7LA 5KX8A 3NWWA 5CVFA 3FXWA 4FOCA 2VWVA 4F7JA 2WQOA 4CMOA 4WG4A 3MH2A 5IDNA 4WNOA 4BC6A 2I7QA 5CYIA 3AGMA 3GQLA 2QG5A 4TYEA 4XV3A 2BRGA 3VS4A 4JQ8A 2YWPA 3WBLA 4CKJA 5HE3A 4CXAA 5LQFA 5M4FA 3QTIA 1WBVA 3OUKA 1OKWA 4RJ3A 4GT4A 4RIXA 5HCXA 4X3JA 5HE1A 3AD4A 3R1NA 5HIEA 4YLKA 4A4XA 5FD2A 4DG3E 2OI4X 5EDRA 4EH7A 4FG8A 5HVYA 4IDVA 1BL6A 3EN5A 2R3MA 3AT3A 4RWJA 2IZTA 3RHKA 4C4HA 4GMYA 4FVRA 3FC2A 4GKHA 3OMVA 4UN0C 3RVGA 3QKMA 1PXPA 4ACGA 3UZRA 4C3FA 1G8SA 3MVHA 1PMUA 2OW3A 2YM6A 3EKNA 3QCSA 1VZOA 5FM3A 3D5UA 5G6VA 5HORA 4GKIA 3KULB 2IN6A 3C4ZA 2P55A 4HGLA 5J87A 1PXMA 3HYHA 4ZAUA 2X8DA 4DBXA 4PV0A 4BI0A 4A06A 2EXEA 3IECA 4O7NA 4H3BA 3I4BA 1QPEA 2RFEA 3HV7A 3P7CA 4H39A 3V01A 2VTSA 5ANJA 2UZDA 3HAMA 2I0YA 1XH4A 5HG8A 5J1VA 1YRPA 1Q97A 3RMFA 5GNKA 4QYFA 2XUUA 2PVNA 4G1WA 1Q3DA 2O8YA 3KFAA 4G3GA 4IVAA 3WZUA 4CMTA 4DEHA 4UMUA 3F69A 3OT8A 4C36A 3PA4A 3R83A 3KXXA 4QTCA 1HCKA 4I0RA 4ENXA 1ZWSA 3KULA 4D4VA 5IA4A 4NM0A 4RWIA 4XV9A 4GT5A 2HXLA 3SRVB 4O86A 2XMYA 5JQ8A 3UOLA 4EKLA 3VS2A 2IWIA 1WBOA 2OJJA 4LV5A 2PPQA 4G3DA 5D7AA 4W4XA 1YI3A 3ZCLA 4ANOA 2BRBA 4EWHA 2FSOX 5GJGA 4TN6A 1NA7A 3FZ1A 2CGXA 3QKLA 4JAIA 4G3CA 4U80A 4WUAA 2A19B 1WMKA 4G3EA 2YDIA 2J6MA 2FSLX 3H9OA 1H28A 3IS5A 3ZSGA 2B9JA 3OXIA 5F20A 3UODA 3P23A 4NTTA 4DFYA 5FLFA 5EW3A 2WMQA 4RSSA 4JR3A 3V8SA 4F4PA 2XIRA 4KA3A 2RSVA 4ZTHA 1SVEA 2CKQA 3SRVA 2Y7JA 2HZ0A 1OKVA 2QKWB 1K9AA 3KRLA 4L68A 4AACA 2JAVA 4CCUA 5HU3A 3FZTA 4EKKA 5DRBA 4AG8A 4FT7A 4QNYA 1YXSA 4L67A 5FRIA 1H25A 3GU4A 3G0EA 3HP5A 2UVZA 1Q5KA 3GC7A 5GZAA 2YM4A 2RGPA 2G9XA 3DT1A 5BVWA 2Q0BA 4MD7E 5A4TA 4WRGA 2VWIA 4AU8A 3QD2B 3ZONA 2IJMA 4ID7A 4IAYA 2VD5A 2WU7A 3I60A 4UWBA 3FZOA 3TKIA 5G1XA 4EWQA 4EZ5A 3DNDA 3LFNA 4PDSA 5DWRA 2ESMA 2J4ZA 5B2LA 2RIOA 5CY3A 4QTDA 4F65A 2PZYA 3PZHA 5AIRA 1YXVA 4FTUA 4ANBA 3W2PA 5JQ5A 4C2VA 2R3LA 3DPKA 3V5JA 2FVDA 4U7ZA 5FGKA 5HG5A 3E88A 5BVDA 4BF2A 1IA9A 1OECA 5EDQA 5EW8A 4YGAA 3I7BA 3FMLA 3ZSHA 2XBAA 4BI2A 3MTFA 3NDMA 2ITYA 3FZRA 4UYNA 2E2BA 5EYDA 3QXPA 4UWYA 1W84A 5DA3A 2P4IA 3QX4A 3VHKA 5HNIX 4QP1A 4QMPA 4F6UA 3L9NA 5JZJA 4FSWA 1NY3A 5T68A 3GCQA 1LPUA 3BE2A 4TKSA 3RINA 4U40A 5EQEA 1XH9A 4R3RA 2QOQA 3Q60A 3R28A 4L42A 5L4QA 2WMTA 4FTNA 3HMPA 3F2RA 1GJOA 2GS2A 4JR7A 3NAYA 3QQJA 3DQXA 5ANDA 1ZZLA 3A7GA 4XG7A 5E91A 1CKJA 3KK9A 4XMOA 4NM3A 3CY3A 1OBGA 4OAVB 2Z8CA 3OG7A 4MQ1A 4LMUA 3RZBA 5CTPA 3E93A 2EB2A 2JDVA 5I9ZA 3PXYA 4G5PA 4FV7A 3F66A 2J50A 2YITA 5LVOA 4R78A 3KXZA 4GYIA 4DCAA 4LUDA 4NSTA 4BDIA 4AFEA 5DR2A 4MK0A 1B6CB 2R3PA 3LFCA 4V0GB 2QLQA 4XEYA 3FY2A 5IG1A 3FKLA 3JUHA 4FEXA 2R2PA 4K8AA 2OGVA 3FQHA 4P2KA 3TZ7A 4RG0A 5JMSA 3AC8A 5J9YA 3A7HA 3H0ZA 4IQ6A 3L1SA 3TKHA 1UKIA 3VUIA 5ACKA 5J5TA 4W4VA 5IPJA 4PL3A 4IJPA 5FWKK 3VUHA 5AX3A 3WZKA 3KRWA 3OOGA 4ZEGA 1P4FA 5A6OA 2ZOQA 1L8TA 4CFMA 2UZLA 2REIA 3DAJA 3OF0A 2CN8A 3MA3A 3QRIA 2YEXA 4IZ7A 3EFWA 4U41A 4AUAA 3DK3A 3UMWA 4M14A 4V0GA 5HBHA 3Q6WA 5HTBA 3RPSA 3KREA 4PX6A 5CQUA 5K4JA 4KUJA 2ZVAA 3G2FA 2V22A 3NYNA 5DG5A 4FVPA 3VS1A 3RK9A 5IDPA 3B8RA 4IAKA 5K0XA 4FUYA 3KCKA 3BBTB 3PP0A 5FEEA 3OWPA 2QO9A 4ACCA 3R7VA 1IA8A 4DFLA 3W1FA 4RFMA 5CT7A 3OD6X 2YM8A 3TUCA 3NZ0A 4JG6A 3WZJA 2ZM3A 2OG8A 3F3WA 2HOGA 3HV5A 3V5QA 5BVFA 3HMNA 2XNGA 1OL7A 3KQ7A 4FV2A 4O38A 4AE6A 5ACBC 1J1CA 4JX7A 2CCHA 3OEFX 4BWPA 4I0TA 2WXVA 3H30A 4XP3A 4FV9A 2CSNA 1YHSA 3IW6A 2WMRA 1ZY5A 1WBTA 4GS6A 1KE8A 3COHA 3JY0A 3ORKA 4FNXA 3E8NA 3LLTA 4DEDA 4H3PA 4F64A 5M06A 5HE2A 2B4SB 2WTKB 3QLFA 3ID6C 4RGJA 2H8HA 5HBJA 1O6KA 4RWKA 3UVRA 3BYOA 4AZEA 2GHGA 3QUPA 4BCNA 2Y9QA 3CGOA 3VJOA 2QU6A 3VQHA 1FVVA 1KUTA 1PJKA 4O27B 4O7ZA 3IG7A 5IU2A 4E8AA 3CQWA 3OBGA 4GJ3A 5LWNA 4O22A 2O2UA 3R8VA 1WAKA 4AZVA 3VWAA 3KEXA 1IAJA 2E9UA 1UWHA 4FUXA 1YXUA 4I5CA 2X0GA 2VWXA 4CT2A 5L2WA 5H8GA 5F94A 2XK4A 5AUTA 2ITZA 3LW0A 3E5AA 3QRJA 4KNBA 4OTWA 4AOIA 4BYJA 4YZ9A 3IGGA 4I94A 2PYWA 3U87A 2XB7A 3RM6A 2HYYA 2BFYA 4W9XA 5CENA 3PE2A 2HENA 2W7XA 5HQ0A 3KU2A 4XBUA 2ACXA 3A4OX 4E5WA 5CEKA 3SGCA 3CTJA 5EG3A 4C37A 2BRHA 3LAUA 4QQCA 3R8MA 1KE9A 3ORTA 1U4DA 4G6NA 3ORMA 4EZ7A 3WF5A 2WTIA 5EOLA 4CV9A 2PSQA 4KD1A 3EH9A 3IDBA 3CEKA 1YHWA 1VR2A 1OL5A 3I6WA 5HEZA 3ZUTA 5A6NA 4RLKA 3DLSA 1OMWA 4QO9A 3VS6A 4B6LA 5L6OA 3OUNB 2H6DA 4DG0E 4F08A 4DGNA 1M7NA 3TXOA 4FG9A 3FC1X 5CWZA 4OT5A 5DR9A 4CT1A 3W2CA 2CKPA 2EB3A 3GUBA 3ANRA 3THBA 1ZYJA 3DTWA 1ZAOA 3SD0A 3WYXA 4CV8A 3PPJA 3ORXA 2NO3A 4HCTA 4AXAA 2HXQA 3ODZX 3U4WA 5GZ8A 3C0GA 2BZIB 4FIFA 4ZY4A 1R78A 3HA8A 4K77A 3G6HA 3TZMA 4DLJA 1OKYA 4ZS0A 2OJIA 3Q3BA 4IX3A 1M7QA 4OBQA 3RAIA 3LMGA 2ZDUA 1DM2A 3L8XA 2JKKA 5AV1A 2CLXA 4GSBA 5C26A 1RJBA 2WFYA 1O9UA 4PNIA 3I81A 2XIZA 3BYSA 3AQVA 4QP3A 4ACMA 4ANMA 3TUDA 5ANKA 2VNYA 4NM7A 4OTDA 4BDKA 4FEVA 3NCGA 5HVJA 5I9YA 4C3PA 3G5DA 4ZTQA 4JIAA 3A7IA 1SYKA 3D83A 3KB7A 4K18A 4S34A 4EORA 5HX8A 3F7ZA 2UZOA 3ALNA 3A61A 3QC4A 4OTPA 4RJ7A 3R9NA 3WILA 4AS0A 4IB5A 3P4KA 5CALA 1PXIA 1ZY4A 4G9CA 4YTIA 1UV5A 1SZMA 4R6VA 4YC3A 3R1QA 4S30A 5CLPA 2C6LA 4O7LA 3H3CA 4AFJA 4ANSA 5K3YA 1J3HA 2BZHB 5D9HA 4BTJA 4Z7GA 2AC3A 2R64A 3TNPC 3NUAA 3QRTA 4BRXA 2XA4A 3NYVA 1PYXA 2C1BA 3ATSA 3UC3A 3FDNA 4ALUA 4E73A 4MNEB 4BVUA 3MFSA 2PULA 3AOXA 4JI9A 3KGAA 4E7WA 4UV0A 4C35A 5L8KA 4ERKA 4M13A 4PY1A 2CHLA 4E4MA 3G15A 1BX6A 4H36A 5D11A 1PF8A 3ZXZA 2IW8A 5E8SA 5HLPA 4YJUA 1ZMVA 4F70A 2VX3A 4PP9A 4WT6A 3UVQA 4ANNA 3MESA 2CNVA 2QOHA 4C8BA 4L45A 4FSRA 3SHEA 2XNNA 5LVMA 4DFUA 4GL9A 2YIWA 3JYAA 3Q4TA 3HP2A 4I41A 4JDKA 4ZTSA 5HO8A 1BUHA 2BRNA 2KULA 3BQRA 2UVXA 2J0KA 5ANGA 4EHEA 4MH7A 3UP7A 1KWPA 1MRYA 2C3IB 2C5XA 2CLQA 1XH5A 3FUPA 3ITZA 4MNEA 3FXXA 3RPOA 3V6RA 4O7YA 4BCOA 1W82A 3AXWA 2O3PA 5JFSA 3Q6UA 4RRVA 4K6ZA 5FP6A 4C4GA 2WHBA 2GFCA 1OIYA 3PFQA 4R3PA 4WA9A 5AUXA 4AZWA 2GNIA 3BLHA 3L8VA 3RAHA 4KWPA 1BI8A 1LEZA 3MIYA 3R8UA 4DT8A 3TTIA 3HGKA 4EOKA 4XJ0A 4F1TA 4I20A 4BZNA 1JVPP 2UZTA 3BKBA 3QF9A 2JKQA 1APME 4FKSA 3IDPA 2G2IA 2XH5A 1HOWA 4YHJA 1Z57A 4JVGA 3R7YA 2GPHA 3PY1A 5LMBA 3NLBA 2V62A 4DEEA 3S0OA 5J1WA 4E6QA 4YPSA 1QMZA 2C47A 4ANLA 2CJMA 1H08A 3T9IA 3I7CA 4EH2A 3LCSA 5LCJA 2WKMA 5A46A 5HTIA 2PTKA 3MPAA 4L53A 4O7VA 4DF3A 3SW7A 3EQFA 5JN2A 5JRQA 5AP4A 4E4NA 3LQ5A 5AP3A 5KMIA 3EMGA 4FI1A 1XHAA 3VO3A 4A9UA 4UXLA 5AMNA 5FM2A 2YWVA 1QPDA 4YNOA 4YBKA 2R3RA 2YA9A 1OUKA 3N4UA 3TG1A 3R8ZA 3ZC6A 2SRCA 3HX4A 1P4OA 1GZOA 1PMVA 2F2CB 3JVRA 3KN6A 3L9PA 4FKLA 3C50A 1KOAA 3KMWA 2BHHA 4DITA 3CLYA 3DK6A 1Q99A 3AD5A 4WBBB 1PMNA 4GU9A 5IUHA 4PPBA 3BCEA 4A4OA 4ZLZA 2YM3A 2HW6A 3BYVA 5K5NA 4X2JA 4GUEA 4J99A 5DI1A 4AGWA 1OIUA 5M55A 3GBZA 3KA0A 4MWIA 5EQPA 4CGAA 4CSVA 1F3MC 4IAIA 3W55A 3T9TA 2EVAA 2BMCA 2GNFA 2X2LA 3D5WA 4PPCA 5JFWA 4APCA 3CPCA 5L8LA 4JDJA 3TNIA 1JKLA 2O63A 2JDRA 2C5YA 2QQ7A 2I1MA 1W83A 3FYJX 3PG3A 4I5PA 4JNWA 4KIPA 3MH1A 4S31A 2IW9A 2IVVA 3IPHA 3TIYA 3CD3A 4UZHA 4C58A 3KMUA 2HY0A 3COIA 3PXFA 4G9RA 2OWBA 5CNNA 2WD1A 3UO5A 3O96A 4D4SA 4R8QA 5CVHA 4ACHA 3NX8A 3Q4CA 5IEVA 5CSHA 4AN3A 2ITXA 1ND4A 4XV2A 3R0TA 2OXXA 4FV1A 4B9DA 1XH8A 4DFBA 3AC4A 4ZTRA 4UMTA 3DXNA 3QKKA 4WIHA 1PXKA 5AR7A 2IVSA 4NJDA 4AAAA 4CZTA 3QXOA 2IG7A 2B1PA 2Y4IC 1GNGA 4FT9A 4FL3A 3O0GA 3CTHA 5BUEA 4MD9E 1JPAA 2CMWA 5LMKC 2HCKA 4HYUA 3RAKA 2BIKB 5CU3A 4J52A 2PL0A 2YIRA 4PNKA 3FSFA 4YO4A 4S2ZA 5J9ZA 3PXQA 3PXKA 4ZSLA 4E6CA 2HELA 2GSFA 3HECA 4FMQA 4O0VA 2Y6OA 3MH3A 3CJGA 3U9CA 3JR1A 1AD5A 2R3GA 4G2FA 3D2IA 4IANA 3QL8A 5CAQA 4K1BA 5T6KA 4XLIA 4ITIA 3QZIA 4BKYA 5KMNA 2BKKA 3BGZA 3QD0A 5C03A 1ZOGA 4EOLA 5L8JA 3TZ9A 3CQEA 3ORPA 3QTZA 4L52A 4E1ZA 4BB4A 1WBNA 3C0HA 4BIEA 3GT8A 3PY0A 3FV8A 2WMWA 3UQCA 3KRRA 4BICA 4CD0A 1F0QA 4HZSA 5HBEA 3UC4A 4QP7A 1UNLA 5KZIA 4PMPA 3EN6A 4Z9LA 3KF7A 4AF3A 4HVIA 2VWZA 3FI4A 5FDPA 5HX6A 2VNWA 5A3XA 3ZUUA 2BZJA 4OTGA 3QGWA 4F9WA 1Q61A 4O0RA 4M69B 4AGDA 4O1PA 4R77A 3ORIA 1URCA 1YOJA 4DH8A 5A4CA 4TYJA 4I4EA 4WHZA 5E8VA 2C30A 1L3RE 1PXOA 5EDPA 2X8IA 5HCZA 1MRVA 3R7UA 2JIUA 3PDTA 3V5WA 3A7FA 5H2UA 4D55A 5CAUA 2GDOA 2YDKA 3H0YA 4MNFA 4O96A 3DXQA 1Y6AA 4CFFA 3LQ8A 3NR9A 5AUWA 2PHKA 3F2AA 3ORLA 2BUJA 5I5ZA 5BVKA 4JXFA 2HWOA 3SX9A 3PIYA 4I6QA 3QFVA 4GG5A 4PRJA 4FEWA 3PWYA 3P08A 3C0IA 4HPTE 2HZIA 4QMMA 3FMHA 5I9UA 3Q9YA 3JXWA 3UIXA 1DI8A 1WBWA 4ZSJA 3ZFYA 4DBNA 3LCOA 4GK2A 4KRCA 3VUDA 4HZRA 4EI4A 2ZJWA 1OB3A 1JKKA 1G3NA 2J5EA 3R9OA 2UZEA 5GJDA 3UNJA 2FSTX 3R6XA 4HNFA 3TUBA 4ZY5A 5ANOA 4XG8A 4Y8DA 4UALA 2ITWA 3IW5A 4D2TA 2BPMA 1IAHA 3CR0A 3BLQA 3PUPA 4HYSA 3VBVA 3R8LA 3RCJA 4IXPA 3C4FA 4OBPA 3EKKA 4FF8A 2WELA 2R7BA 3FMJA 4YP8A 4ASZA 5IH4A 3K2LA 5AA9A 4M15A 2ZMCA 1H1PA 5AP5A 1ZMWA 2XKCA 4EK8A 2PZPA 1XH7A 2ZV8A 3GI3A 4E6DA 2EXCX 3W2RA 4BIBA 4RJ8A 3QAME 3CKXA 4AZFA 3ODYX 3HUBA 1JBPE 4RVLA 4TYGA 4GYGA 4O7WA 2HAKA 2WQMA 4BDEA 2C0OA 4MYGA 2J2IB 3E7OA 3NNXA 1MQBA 1OPJA 3P79A 2WTDA 5BQ0A 3NAXA 5TR6A 4GVAA 2OJFE 4DH5A 3W33A 4D2RA 2EU9A 5FEDA 4IZ5A 1GAGA 5AR8A 3QC9A 3PE1A 5EHOA 4DFNA 1CTPE 2QC6A 4YZDA 2P33A 3V5PA 3BIZA 5KNJA 4NFNA 1UA2A 4F6WA 4IWDA 3QX2A 5IA2A 2JKOA 2PVRA 4CZYB 3FXZA 3HRFA 3UQFA 4CG9A 4W9WA 3PPZA 2ONLC 3AG9A 5JT2A 3QRKA 4E26A 1NVQA 3KCFA 4FZ6A 4J1RA 3NSZA 4TXCA 4YURA 5IMXA 3FQEA 3VQUA 3IO7A 4J97A 3TT0A 4EUUA 1YWRA 4IWQA 5KKRC 5CSWA 1CSNA 4Q9ZA 4FC0A 4KAOA 1BYGA 3MA6A 3TACA 5IA3A 1OKZA 4HNIA 3QCYA 5AEPA 2JIVA 3DBFA 4FKWA 3QZHA 3R8PA 4KINA 3M2WA 3UG2A 5BMSA 1S9IA 3DBCA 4BZOA 2XM9A 3DKFA 1MQ4A 4TYHB 5K9IA 3UVPA 1YDSE 3CE3A 2C68A 2XZSA 4EUTA 4KBKA 1ZYSA 4FODA 3UG1A 3FAAA 5H8EA 2W9FB 4BCMA 4ENYA 2R3HA 5DIAA 2WMBA 2VGPA 3OCTA 3DBEA 3QQKA 5ETIA 4LOOA 4GH2A 5AR3A 3DS6A 4TWOA 2V0DA 4E4XA 3I0QA 4L43A 4RC4A 5AR5A 3NYXA 3OZ6A 4C02A 1FINA 2GNLA 3CP9A 4FIIA 1R3CA 2WNTA 4IB1A 2CPKE 3QCQA 4X6RA 3DZQA 2WQNA 3LJ0A 2XYNA 4FBXA 4TYHA 1J1BA 3WE4A 3PRFA 4XUFA 5DT0A 4GRBA 5DNRA 4DAWA 3TM0A 1CDKA 2VTHA 4XP2A 3VIDA 2QNJA 2CCIA 5JKGA 5KMMA 5IH5A 5E8UA 3R1YA 2WZJA 4RQKA 3MY0A 5CF4A 5JZNA 4Z3VA 3GFWA 3K54A 3DK7A 3D0EA 2Z7LA 2ZV9A 3BGPA 4TL0A 4QP6A 5GINE 2H34A 3DFAA 4NUSA 4OTHA 3Q2JA 5FTQA 4JIKA 4EQUA 3BU5A 3QZGA 2IO6A 1R0EA 4RFYA 4TNDA 2UZWE 2PVHA 4X0MA 3GU7A 2J0MB 4QYEA 1XBBA 2YFXA 4AN2A 3SA0A 5IA5A 2XK3A 4J95A 1VEBA 3P78A 3KVWA 2C6OA 1HCLA 3QA8A 5GIOE 4JBVA 4FKQA 4B99A 3V8WA 4LM5A 3Q5ZA 1Q8TA 2XF0A 4U5JA 2BTSA 4U79A 2ZMDA 4FTMA 4QRCA 2PY3A 3OFMA 2B9HA 5D41A 3F3ZA 1XKKA 4M0ZA 4EK3A 2X39A 4FSUA 2J9MA 2O0UA 5FG8A 5TKDA 5HE0A 3EOCA 4ZJVA 4H1JA 5KCVA 4CRSA 2CKOA 4HYIA 5B2MA 3HMIA 2X81A 5I4NA 2WEVA 5CI6A 4QMWA 4GCJA 2XIKA 2OICA 4OTIA 2OU7A 5M44A 1W7HA 1J7IA 4O82A 4WNKA 4FGRA 2V7AA 3OXTA 3O7LD 3WYYA 3NIEA 4B8MA 3V3VA 3VJNA 3PG1A 4O0TA 3D5VA 2I0HA 4FZ7A 3VC4A 3FY0A 3W2QA 4EOPA 3WE8A 5KO1A 3T3VA 4LQMA 4WG5A 5C27A 5I9VA 5KMKA 3IONA 3QQLA 4KKHA 4EQMA 4RFZA 1OM1A 3WF7A 3ZHPC 3AT4A 1H24A 3F88A 4O0UA 3A2CA 4PL5A 5EH0A 5EM8A 4AOTA 4FZAB 3MYGA 4PWNA 1UKHA 3NUPA 2JLDA 4F09A 1ATPE 2X7FA 3MTLA 4FTQA 5LVPA 1X8BA 2WTJA 3F2NA 4TW9A 5HOAA 3RPVA 4D4YA 4ZTMA 4YHFA 5DE2A 3ZZWA 4QP2A 5HTCA 3F5GA 3PIZA 1JNKA 3DGKA 3F3TA 5HNGA 1OIRA 1KV1A 4X6QC 1J7LA 2YZLA 4DFZE 3JPVA 1W98A 4G31A 4LUEA 5CEMA 2PMOX 1H27A 2Q0NA 5DT3A 4AT3A 5ETFA 4RLLA 3PLAE 2VTLA 1BI7A 1YWVA 1LEWA 4FNZA 2OF4A 4YJQA 4U0IA 4U9AA 4FTKA 1SM2A 2XJ1A 3QTRA 2V55A 3DBQA 4K0YA 5LOHA 2BRMA 5E92A 5CVGA 3I5ZA 4X2KA 2B9FA 2XNOA 2VWUA 3K5VA 4G16A 4C33A 4F0IA 1JAMA 2C5NA 1R0PA 3QTUA 4IVBA 3TDWA 3NW5A 4BGHA 4ZMEA 3D7ZA 5A14A 3C4EA 4OW8A 1Q62A 4TWCA 2C5VA 3I0OA 4O0XA 4CFNA 2FYSA 3E87A 5BYZA 3RP9A 2JIIA 1E9HA 2GNHA 4LGDA 4GFMA 4XBRA 2Y4PA 4B7TA 4FIGA 4FSYA 2W1ZA 1YDRE 4JDIA 2GQGA 1Y8GA 3PJ8A 3HEGA 3O50A 4NWMA 4C0TA 3ANQA 3II5A 4BHNA 4DN5A 4EOSA 1KE5A 3N4TA 4PQNA 1REKA 3ZO3A 5BX0A 2Y4IB 2OIDA 3SXRA 3DU8A 4D2PA 4BDJA 5E8TA 4JOAA 2VWYA 1OI9A 1YQJA 1OZ1A 3FKNA 3QTQA 4S33A 3UPZA 3DKGA 1PRYA 4GFOA 4YBJA 5HNBA 4O1OA 3H9RA 1FMOE 4YJPA 3RWQA 4X2NA 2ITPA 2ZM4A 3R02A 3BBWA 3N9XA 1SNXA 3EL7A 5ANEA 3ZLSA 1AGWA 1Z5MA 2O64A 2WB8A 1OL1A 4NTSA 1MP8A 3TV7A 3SDJA 3B8QA 3EIDA 2R3FA 2IW6A 4L7SA 5F1ZA 4Z16A 3OP5A 3RPYA 3KKVA 2DYLA 3NRMA 4QPMA 5CASA 5L2SA 5E1SA 3JY9A 4K33A 4M8TA 3CPBA 5LMKA 3S1HA 3QTWA 3HRBA 3REPA 2R3IA 3CXWA 3LPBA 5DHJA 5EM6A 3LM0A 4GG7A 1H0WA 4FKVA 1OVEA 1U54B 2A27A 4XCUA 4PF4A 5CEIA 5J95A 4NKAA 3N51A 4TT7A 3Q4UA 3RNIA 3ZO2A 5IEXA 5L2IA 3SG8A 3MGYA 5CEPA 5JGAA 3FZSA 2W1DA 4BZDA 4D0XA 1YXTA 4FA2A 3FLYA 1KOBA 3MB7A 5LARA 2X9EA 4DHFA 2X1NA 3O71A 2UZNA 3VBWA 3BWFA 3L9LA 3LVPA 5AV0A 5EFQA 4P5ZA 4CLJA 3CBLA 1Z9XA 4FKOA 1E1XA 1ZLTA 1J91A 1BL7A 4A4LA 2WTCA 2A4LA 4QP8A 3VRZA 3W2OA 4EHVA 3IW4A 2X7OA 3DOGA 4F9AA 4YTCA 4YTFA 2F57A 2VN9A 4RIYB 1U54A 5HLNA 2QG7A 3QTSA 1V0OA 2W4OA 4R1YA 2XK7A 4FNYA 5BVEA 4ASXA 3C7QA 1T45A 4C4JA 5CAPA 5IQHA 3CTQA 2I0VA 2XNBA 3ZZEA 5DLSA 2PVLA 3H9FA 4JX3A 5LVLA 4LRMA 3V5LA 4ZJIA 4GEOA 2G1TA 1WFCA 1NXKA 4C2WA 4CLIA 4IEBA 3EQDA 3PSDA 1NVRA 4QMNA 5ETAA 5BVNA 5HO6A 3FI3A 4RIYA 1REJA 1ZOHA 3E64A 4R7IA 5M4UA 3UZTA 5E90A 4M0YA 5FXSA 4FKIA 3V5TA 2ERZE 1V1KA 3VAPA 3HMOA 4QMSA 5AV4A 2DUVA 3HZTA 4BDBA 4JAJA 1U46A 4KSQA 5L6WL 5BUJA 2PUPA 3QBNA 5DEWA 3VBYA 2RFDA 3RI1A 2YIQA 5C9CA 4EK4A 4NL0A 3TTJA 5ITAA 3FPMA 4PMMA 2VU3A 2OF2A 3WARA 3CKWA 3D14A 5GJFA 1YKRA 4CFXA 4EONA 4QMQA 3OXZA 1GZ8A 4ZLOA 3FL5A 2JBOA 4YJRA 4ALWA 3AC5A 1MRUA 4L3LA 3LZBA 5AM6A 2R9SA 3MV5A 4C3RA 3BI6A 3E8EA 1SVHA 3LXNA 3MFUA 3RM7A 4E20A 4DFXE 4EH3A 3DXPA 2R4BA 2DWBA 4CMUA 1WVWA 4ZZNA 3F5XA 5CF8A 2F7ZE 3LLAA 3E92A 1ZYDA 2Y0AA 4USDA 4ZOGA 2P2IA 1OIQA
chains in the Genus database with same CATH superfamily
3FMEA 3WZDA 3OW4A 4U97A 4QQTA 3EJ1A 4U43A 4FKGA 4FSQA 1KE6A 4ZS4A 2AYPA 4QQJA 5A4EA 1YI4A 2ZDTA 1CM8A 3U51A 4FOBA 1OPLA 3R73A 4M66A 4Z7HA 2YDJA 3QRUA 2ITUA 4NM5A 3SXFA 1GY3A 4G6OA 4N6YA 3UO6A 2WOUA 3HRCA 4IB3A 2WO6A 5M56A 2YCQA 3AKJA 5KKRB 3ZDIA 4TNBA 3IW8A 3OC1A 5IQGA 4ZK5A 4FK3A 4AA4A 3DBDA 5IQBA 4AAYA 2ZV7A 3R04A 3PIXA 3Q32A 4NH1A 5DH3A 3QA0A 4F9CA 2PVFA 4CVAA 4YC8A 2YISA 1VYZA 4FT0A 2GNJA 2HZNA 2JFLA 4IAZA 4O2ZA 5FP5A 3F9NA 4WNPA 3VW6A 5HGIA 5I0BA 3U55A 1CKIA 3T3UA 3EFKA 3NW7A 3R00A 4V01A 4CRLA 4JJRA 3FMDA 2J0LA 2ONLA 4XS2A 4WRSA 3LM5A 4D2WA 5L3AA 3ZU7A 3MIAA 3ZDUA 3PVBA 5AAFA 5IQCA 3EZRA 3QQUA 2J7TA 3UJGA 3HL7A 3NMUF 2RFNA 3UOHA 4NZWB 3LFSA 5EK7A 4RX5A 4ASDA 4MWHA 3R9HA 2X2KA 3U4UA 5BYYA 5EI8A 4R5YA 4G3FA 4OT6A 4FTLA 4NKSA 3PJ1A 3T8OA 4GIHA 5AM7A 4FKRA 4UWCA 3IDCA 3QYZA 3V8TA 3A99A 1UWJA 4G5JA 4RJ4A 3LKMA 5DVRA 3NEWA 4C59A 2XYUA 4BDCA 2QVSE 2ZB0A 3UPXA 3R9RA 3FI8A 2YJRA 3TEIA 1UU8A 2XK6A 4H58A 4TRLA 4Y5HA 4D9TA 3OWJA 3K3JA 4OAUC 4IFCA 3E8CA 3QHWA 5EQYA 1IR3A 4KIOA 3W18A 5IUGA 4QMLA 2X8EA 3M11A 2B52A 3BZ3A 5CQWA 4L3JA 4L7FA 2DQ7X 2W1FA 3ZUVA 2GQSA 4UEUA 3KMMA 1FOTA 4O91A 1H07A 2C6EA 2UW8A 2WAJA 4Y46A 2UW5A 4XLVA 4CFWA 2JDTA 2XP2A 4FSTA 4DEAA 5BNJA 2P0CA 4LG4A 2W1CA 3MVLA 5CSXA 5EW9A 3ACKA 3ULZA 3AC2A 3MB6A 1QCFA 4D28A 3PJ3A 4FTAA 2YAAA 5I9XA 3OY1A 5A54A 1Y8YA 2OH4A 4FIJA 4DTKA 2XVDA 4PTEA 4AA0A 2WMAA 4D2SA 5JGBA 3F7WA 3L8PA 1XJDA 4FTCA 4QYHA 3OWKA 2ITOA 5HESA 3VW8A 3FEGA 4GFGA 1Q8YA 3C5UA 3H4JA 1R1WA 3Q4ZA 5JEBA 2XRWA 2H96A 4FSZA 2VUWA 3A60A 3F3UA 3O51A 2XEYA 4ALVA 5CF5A 4AXDA 5EM5A 3QYWA 4XG2A 3ZLYA 3BU3A 3BYMA 4D5HA 4EOQA 4IAFA 2AEGA 3W0SA 4WOVA 1R39A 2NPQA 4LL0A 4EH9A 5BPYA 2OZAB 2C3LA 4FGBA 5KZ0A 2IF8A 2VX0A 2XJ2A 2YM5A 3K3IA 2NYAA 4GU6A 4CKRA 5GIPE 4IZYA 2Y6MA 3GU5A 3E7VA 3PLSA 4I21A 4BTFA 3NPCA 4K9YA 5L2QA 4BCIA 1H8FA 3AD6A 3PJ2A 4FV8A 4DE4A 4IC8A 4UMQA 3ALOA 4BDFA 2VWBA 1NVSA 4FYOA 4L44A 2FH9A 3TJCA 5AADA 3W2SA 2UW9A 5HIDA 5IEYA 1JWHA 4TYIA 1GIJA 4D5KA 4FR4A 3FPQA 3RWPA 3GC9A 3NS9A 3SKCA 2G01A 4H1MA 2BKZA 2RF9A 3DAEA 4L46A 3RBWA 5E1EA 3IW7A 4RVKA 1RE8A 3LCDA 2OZAA 4ACDA 4P5QA 1PKGA 3EQBA 4IWPA 4M12A 5KHWA 3KC3A 1GZKA 1Q24A 2XS0A 1OPKA 3UYTA 3GC8A 4FV3A 3R22A 3KXGA 4G17A 3LJ2A 5C4KA 5DEYA 4DHJA 2GMXA 4IADA 4JLCA 4FTTA 1JSUA 2JBPA 3LCKA 2C6MA 4B0GA 1Q4LA 2GS7A 2YABA 1QL6A 2XK9A 4BDHA 4DGOA 5HD4A 2WIHA 4MKCA 5GHVA 2PVKA 2CKEA 4FV6A 1XWSA 2UUEA 4ITJA 2QOIA 4AW5A 5E9EA 3G51A 4MVFA 4ZSGA 2Q83A 1BMKA 1JKTA 4O83A 3ZFMA 2CGUA 5HLWA 3BHHA 3DDPA 3LHJA 2PE0A 3PPKA 4IDTA 2XNMA 4NCTC 4YZBA 3QLGA 1JSTA 3OHTA 2C4GA 3UBDA 4CYIA 2W1IA 2JD5A 2UZBA 3OEZA 4QMTA 1OITA 4EC8A 4AXEA 3CY2A 3EQIA 3OROA 5C01A 3UNKA 4EC9A 3O23A 2O65A 2E9OA 2VTNA 4YPDA 4R5SA 5CXHA 5AX9A 5H3QA 3D15A 1V0PA 4BFMA 2W5BA 4M7IA 3PZEA 4XG4A 2ZYBA 4FTOA 4UB7A 5J5SA 2UW6A 3BHTA 3MJ1A 1K2PA 4HCVA 3VRYA 3I1AA 4FZDB 3NUNA 4BDDA 4HYHA 1LP4A 3W16A 3ORZA 3F61A 3FMNA 2A0CX 2JDOA 4NFMA 1EH4A 5L6PA 3PFYA 3SVVA 5F95A 4PP7A 4JS8A 3Q5IA 5EI6A 4OTRA 4C38A 3G33A 4P4CA 2PZRA 3LMIA 4O4CA 1PXJA 3LXKA 2FUMA 3LOKA 4EJ7A 1W0XC 3BWJA 3LXPA 4DLIA 4QMZA 4QOXA 2KTYA 3OWLA 1YXXA 4AP7A 5KBQA 5F9EA 5IQDA 4FVQA 2FB8A 4NEUA 4AOJA 5K4IA 4USEA 3R63A 3CS9A 2AUHA 3EHAA 2WPAA 4Q5EA 3FBVA 3LE6A 4HOKA 4RVTA 2O5KA 5AJQA 3TCPA 2XBJA 1IEPA 3QZFA 3D2KA 4CG8A 3P0MA 3VS7A 2W5HA 2BDJA 3BRBA 3EFJA 3AMYA 4TZRA 4Y85A 5EYMA 3ZLXA 2W1HA 3NNWA 4AE9A 4L9IA 1YHVA 4XV1A 1SMHA 4AT5A 4IIRA 2Y8OA 3G0FA 5TT7A 3ZO4A 3M42A 3BHUA 1Q8WA 4WO5A 4AQKA 4D9UA 3UIMA 1XMLA 3NUYA 5IQAA 4BWKA 2YM7A 4O6EA 4A9RA 2R0UA 1M2PA 4AGCA 4MEDA 3NNUA 4FYNA 5JRSA 3C4CA 3TZ8A 1U59A 3CCNA 4GT3A 4IW0A 3DFCB 1YI6A 3WI6A 3BL9A 4FV0A 5J7HA 1ST0A 4KKGA 5E4HA 2ZM1A 4EHZA 4YC6A 3NIZA 4OUCA 4EYJA 1H01A 3MJ2A 3AT2A 1YVJA 3GNIB 3VBQA 2VTJA 3VF8A 2GQRA 4BCFA 4F0FA 3TKUA 2F4JA 2XCHA 3KXMA 4AW1A 1JSVA 4LI5A 1YDTE 2PMLX 4E5AX 3E63A 3KXHA 3DCVA 5GZ9A 3TWJA 1UU7A 2YLEA 4O7RA 1ZMUA 2X9FA 1DAWA 3K5UA 4E4LA 4F9BA 3SOCA 4F6SA 5AUVA 1PYEA 5AR4A 1ZYCA 4DH1A 3BGQA 2QOBA 4MF1A 1YWNA 3PY3A 2JEDA 2QOLA 3RTPA 4BCPA 2ZFYA 1KSWA 5I9WA 2V5QA 2GS6A 4Y72A 2QHNA 5ANIA 5FTGA 4DTBA 2OIQA 1M52A 2C6DA 2VTMA 2Z02A 4QP9A 1VJYA 3S3IA 4IVDA 3V04A 4CYJA 2QOOA 3PSBA 4PTCA 4ZXTA 3HLLA 4AWIA 2VTIA 4DG2E 4EK6A 4W4YA 3S00A 1G8JA 4UXQA 3QU0A 3R9DA 3EYGA 4NW5A 5FDXA 1I44A 3FHRA 2UW7A 4BCJA 3U6JA 1O6LA 4FV4A 3OY3A 5JK3A 3GENA 5LJJA 3P7AA 5HICA 4WKQA 5HG7A 2Z7SA 3R1SA 1NT2A 2ZV2A 3UOKA 3TV4A 2VO3A 4U6RA 3KK8A 5AV3A 4ORKA 4QPSA 3ORNA 2HZ4A 4JQ7A 4KRDA 4I5HA 3DDQA 4YHTA 3GCVA 4H05A 4MXXA 1SNUA 2W05A 5IZFA 3NUSA 5HO7A 3GCPA 2W4JA 4BTKA 2Z2WA 2NNWB 4YJTA 1GZNA 4O0WA 3LFFA 4O0YA 1UNGA 2RL5A 4WUNA 5HKMA 2BVAA 2W1GA 4MTAA 2JITA 5CI7A 1FPUA 4ANQA 3KXNA 4AQCA 3O17A 4RC3A 4QP4A 3HDMA 2OSCA 5B2KA 4FTIA 4J8NA 1U5RA 3LFQA 4II5A 4D2VA 4PDYA 2UW3A 3R2BA 3KL8A 4ITHA 3VUTA 5BVOA 2WTVA 1TZDA 4A7CA 4D58A 4KBCA 2QODA 2E9VA 2W9ZB 4HJOA 3SG9A 4ZTNA 1UNHA 2W0JA 3N4VA 3U9NA 3MY5A 3OCBA 3V6SA 4HVHA 2EWAA 2P2HA 2W06A 4NIFA 1ZYLA 1E1VA 4XG9A 3RGFA 3WOWA 3ZS5A 1PY5A 4EH4A 4O84A 1FVTA 4J71A 3Q52A 2IZUA 5CU4A 4F63A 4IH8A 2X0PA 4ZTLA 4ERWA 5HI2A 4ZP5A 2G2FA 2WQEA 2X7GA 4O2PA 2OJ9A 4GIIA 4D1ZA 2R3KA 3EN7A 4UMPA 4HGEA 2OJGA 4BR3A 4GV1A 3BU6A 1GOLA 2WMUA 4IMYA 3DLZA 4QNAA 3G9NA 3DKCA 5EYCA 2EXMA 3F6XA 3ULIA 2X4FA 3LXLA 4S32A 2OFUA 3EQCA 5KBRA 3TNQB 5D10A 4YSMA 3WZEA 1FQ1B 4DH7A 4DEBA 4HGSA 4QMVA 3I6UA 4L6QA 4YO6A 3FI2A 4BBMA 3O5AA 5HU9A 4R7BA 5E7RA 5D1JA 5J8IA 4B4LA 1XMMA 5FBOA 4Y83A 1G8KA 3BLRA 3NNVA 1JLUE 3Q9WA 4J53A 2HY81 4BBFA 1IG1A 4LL5A 3D9VA 3TNWA 2HWPA 2UZUE 5EI2A 3W8QA 4ZLYA 4H3QA 3VBTA 4DEGA 3B2WA 1XR1A 3C1XA 3CGFA 3DNEA 4IM0A 2XKDA 3WF8A 4AX8A 4EOIA 3B2TA 4HVSA 4WG3A 3LJ1A 5TOZA 2WMXA 2ETKA 4YSJA 1OL6A 1ZRZA 3FL4A 5AUYA 3U6IA 5CNOA 2JGZA 2PMNX 4JBPA 2X6DA 3LFBA 5AA8A 1NW1A 2AQXA 4JL9A 5KHXA 2BAJA 4UYAA 4CQEA 4O7TA 2AC5A 3QALE 2FGIA 4X3FC 1ZZ2A 3BPRA 4O4EA 3G6GA 4IM2A 4YJOA 2PE1A 2R3OA 4X21A 3R30A 4D4RA 3GOKA 3D7TB 3C4XA 3TI1A 1Q41A 1ZXEA 3ZBFA 3PWDA 4RA4A 5IQEA 3Q04A 4RX7A 5IKWA 4CTCA 5J9LA 3EFLA 4MQ2A 4RC2A 4HVGA 3FYKX 4MXZA 2C3KA 3DKOA 3BEGA 5KE0A 3C4WA 3TN8A 3RK7A 2FA2A 4MCVA 2LGCA 4DA5A 2BAKA 4FKUA 4FKJA 4TTHB 4CFVA 3FKOA 4FIEA 5DPVA 3PJCA 1M2QA 3MS9A 4MBJA 5AIKA 5H8BA 2F49A 4CCBA 4QYYA 1SVGA 2C0TA 4FTJA 2BAQA 1GIIA 5KMOA 3MSSA 3AKKA 3FLSA 2J5FA 3NGAA 1OBDA 1F5QA 4YMJA 4YR8A 3NYOA 5M07A 3D7TA 1PW2A 2UW0A 3PYYA 4QYGA 4EZ3A 3JVSA 3NUXA 3I79A 4HVDA 1JKSA 4LV7A 4FKTA 4IBMA 2VTAA 4N0SA 3ZM4A 5IA0A 4Y5QA 3UOJA 3PP1A 4RZWA 1TQIA 1A06A 2BZKB 2OH0E 1J7UA 4EK5A 4LFIA 5HIBA 1PXNA 5C8NA 3ZOSA 3HAVA 4LYNA 1KV2A 2QLUA 3O8PA 4N4SA 3Q9XA 4I0SA 3C51A 3EQGA 4DEIA 4E6AA 2OLCA 2BDFA 2FSMX 3SLSA 2XIYA 3EN4A 4ZZMA 5KMJA 4O4DA 3AC1A 3VULA 3FLQA 3BQCA 2W5AA 2JDSA 2PMIA 3BHVA 4AXFA 4MXOA 4EHGA 5L2TA 3HUCA 3QD4A 3P5JC 2Z60A 3UP2A 4X7QA 4EOMA 4DHZA 4M67A 2OXDA 1W2CA 3BE9A 4F1MA 3CC6A 4IX5A 2HK5A 4O4BB 4I6FA 2R7IA 4IVCA 1M2RA 3M1SA 1WVYA 4Q5HA 5AWMA 5JFXA 3DA6A 3AMBA 2C6IA 3Q9ZA 4G34A 4U42A 3ZO1A 4EJNA 3MH0A 4BGGA 2F2UA 1XBCA 1KE7A 2B7AA 4OTQA 1PXLA 1DAYA 1DS5A 2PUUA 3MW1A 2VRXA 3KF4A 2VTPA 3GP0A 3F5UA 3NCZA 4O21A 4ASEA 4HCUA 4CNHA 3H10A 4RPVA 4JQEA 4R1VA 5H9BA 4DGLC 4GW8A 3BHYA 2XIXA 4IJ9A 4A9SA 3Q2MA 2ETRA 2PUNA 4JBOA 5BUIA 2R5TA 3BX5A 2BIYA 1H1QA 4DGMA 2QOCA 2R3JA 4YNEA 5KMLA 5CF6A 3P7BA 2PVJA 3R71A 2YIXA 3CD8A 3MPMA 4JT3A 3HA6A 5CSVA 4BKJA 4QTAA 3VS0A 2B53A 1K3AA 2WU6A 3IQ7A 4QMOA 4D1XA 4ZZOA 3MWUA 2JC6A 4KB8A 3UNZA 4E5BA 1W8CA 3D94A 4RIOA 2H9VA 4YZMA 5DMZA 5M57A 3GCUA 1A9UA 5IQIA 4I22A 1PMEA 2QR7A 2XCKA 4IAAA 4TPTA 5LMAA 4F1OA 2I40A 4OTFA 5M09A 4ARKA 3PXRA 4APPA 2RKUA 3QTXA 2QD9A 4RX9A 4GVJA 3AC3A 4MXCA 2CGWA 2FO0A 2F9GA 3RALA 5F4NA 3RJCA 3ZRMA 2IZSA 1LUFA 2C0IA 3DB8A 3VBXA 3JS2A 3HDNA 4UZDA 4GK3A 4EBWA 4YLLA 3QD3A 5A9UA 5CSPA 2J90A 4FIHA 3O8TA 4NCTA 4TY1A 4I4FA 4WBOA 3ZM9A 3QQHA 4QMUA 5B0XA 4U3ZA 5FTOA 3IOKA 2BFXA 4N6ZA 3VHEA 4U3YA 4NYEA 4XYFA 2VTRA 4QMYA 3PRIA 5IUIA 5DR6A 3NFFB 4C34A 4DH3A 4P7EA 4I24A 2GFSA 3OTUA 4AW0A 3GQIA 3FE3A 3NVMB 4NU1A 3EZVA 2YAKA 3RNYA 2XEZA 2QONA 2GHLA 2UV2A 2JAMA 4BCKA 3R7OA 4JRNA 4USFA 3G9LX 3HNGA 3ZLWA 1VYWA 4ONAA 4DC2A 2CN5A 3HV4A 5E8YA 5JGDA 1H1RA 2WTWA 3FSKA 3BV2A 2OXYA 4A9TA 4BCQA 4BI1A 5M4CA 4Q9SA 1TQMA 2VO7A 3COKA 2YZAA 3ZSIA 4FL1A 1BLXA 3NFGB 4I1ZA 3EB0A 3OTVA 4A9YA 2CNUA 4OR5A 5A4LA 2PK9A 1AQ1A 3MVMA 4YTHA 1STCE 2X2MA 3R7EA 3GC0A 4AT4A 3TDVA 3VNTA 4LOPA 4QPAA 4EOOA 3SC1A 2HIWA 4MX9A 3IOPA 3QWKA 1H00A 2J0JA 1JQHA 1WVXA 1YOMA 3GB2A 4O4FA 3QUDA 4XHKB 3W32A 4J96A 5CX9A 2R3NA 4YJNA 3A8WA 2W96B 4I6HA 2OIBA 4AW2A 2XAMA 1XH6A 4AA5A 2J0IA 2BALA 2VX1A 5HZNA 4FT5A 3LQ3A 5C4LA 3A8XA 4DYMA 4RVMA 1TVOA 4FX3A 4M97A 4YJSA 2Z7QA 1XQZA 3VS5A 3U54A 2QR8A 4CFUA 5CAOA 2VV9A 3P5KA 4I6BA 4RWLA 2OFVA 2YCFA 5EKNA 3OBJA 3SW4A 3PA3A 4FG7A 4Z55A 4AGUA 3OOMA 2VGOA 5I3OA 3WF9A 4UX9A 3ZRKA 5JH6A 4I6LA 4XRLA 2BR1A 4QT1A 3A7JA 2ZB1A 5AAEA 3SXSA 3CJFA 5AP2A 3RPRA 5DN3A 3P1AA 3DAKA 1QPJA 4KS8A 3ET7A 4W8DA 1WBSA 2BROA 2XNEA 2I0EA 4I23A 2JFMA 4U81A 4E3CA 4AZTA 4IX6A 4L01A 4CEGA 3EQHA 1YW2A 4OLIA 3ZC5A 2YCRA 4FEQA 3CSVA 5CZIA 1FGKA 2G2HA 4YJVA 4RBLA 2YN8A 4RMZA 4JDHA 2GCDA 4O6LA 4BN1A 1H0VA 5AP6A 1H26A 5JSMA 2CNQA 5EHYA 3ENMA 4K11A 5DFPA 3EN9A 3C5IA 4X2FA 3ZFXA 4FTRA 4CTBA 5LVNA 2OK1A 4U8ZA 5BMMA 4EH6A 5LWMA 3TMOA 1Q3WA 1UVRA 5EKOA 3POOA 2W4KA 2WQBA 3CQUA 3UGCA 4C4FA 1PHKA 3BV3A 3DB6A 4BCGA 4PMSA 2IPXA 3ENHA 3HKOA 3UE4A 5CU0A 3FJQE 2ITVA 3RZFA 3HVCA 3WF6A 3UIBA 4F9YA 2OBJA 4JBQA 3DV3A 1DI9A 3W0RA 4QDVA 4BGQA 2YCSA 3W0MA 4IFGA 3HV6A 4IM3A 1CMKE 4PL4A 4OGRA 2NP8A 2W99B 2CGVA 5FBNC 3COMA 1ERKA 5FEQA 2WMVA 3ERKA 3OT3A 3ZEPA 3PTGA 5HG9A 4CQGA 2PZIA 3BELA 1FMKA 3FMMA 3R21A 4G6LA 3ACJA 3R2YA 5EM7A 5T3QA 2B54A 3U8WA 4D1SA 2PUIA 2C6TA 3D4QA 4RX8A 2P3GX 1FBNA 4M84A 4XOYA 4MBIA 5DOSA 4DT9A 1MUOA 3FLWA 3UZPA 4EH8A 5AV2A 2C1AA 2XJ0A 4MAOA 5C1QB 3UQGA 5J79A 4BDGA 4PUZA 4I5MA 3CIKA 2QU5A 4V05A 4WD5A 3R01A 4L3PA 4Y95A 4N70A 4GK4A 4MD8E 3S2PA 4LGGA 2YLFA 3S95A 4U44A 1URWA 4BTMA 5AUUA 2QURA 3E62A 4QQ5A 4F99A 4P90A 1LR4A 3ZH8A 1OUYA 3GGFA 2ITTA 3IK3A 2CDZA 2IVTA 5DBXA 2BCJA 4PMTA 4EEVA 1G5SA 4LMNA 4RQVA 5CZHA 4BIDA 3O8UA 5M53A 4YZNA 1TKIA 1Y6BA 1OL2A 5CT0A 2V7OA 1Q8ZA 4UBAA 2YERA 3TNHA 5BYLA 5AR2A 5CU6A 1B39A 3OCSA 3VN9A 4LOQA 3VUMA 4IE9A 5CAVA 1Y57A 2ZAZA 4NJ3A 4FZFB 4N57A 4FV5A 3C13A 2QHMA 4HGTA 4YZCA 5K0KA 5C8KA 1H4LA 1B38A 2XK8A 2WIPA 1YOLA 3NUUA 4XX9A 4KABA 4RJ5A 3E3BX 4FICA 5IH6A 5D12A 3F3VA 4X3FB 3LIJA 1P2AA 4X2GA 4AN9A 2LAVA 4MF0A 5B7VA 3P9JA 2B0QA 3UDZA 3QUEA 3TL8A 3MN3A 4XOZA 3U6HA 4R3CA 2X4ZA 1QPCA 3AGLA 4WSYA 4ZSEA 1ZOEA 3AMAA 3O7LB 4ZJJA 3OS3A 4AZSA 5CEOA 4CKIA 4F7NA 2GTNA 4XG3A 4L00A 2B9IA 3R7IA 4FSNA 2C6KA 3TJDA 4O81A 1G8AA 3LFEA 2EUFB 2YJSA 4K2RA 3EQPA 2VTOA 2WMSA 4IC7A 4I3ZA 4W4WA 4BWXA 2IEWA 4DGGA 3QQGA 4EL9A 4X3FA 4GUBA 3S4QA 4EH5A 4ZMFA 4FL2A 3DJ5A 1V0BA 4F7SA 4FT3A 1IRKA 2BDWA 5EHLA 1WCCA 5FXQA 4WSQA 3RAWA 2GNGA 5E8XA 5C8MA 3DZOA 3DY7A 4PDOA 4J8MA 4RT7A 2ETMA 4UMRA 2R3QA 2HW7A 4L8MA 3WIGA 1T46A 4NK9A 3BYUA 1ZARA 3VF9A 4FKPA 1Q8UA 4JG7A 2ITNA 3W10A 2F7EE 1H1SA 3FLZA 5AAGA 2E9NA 2UVYA 3ROYA 2WEIA 3TIZA 4DINA 5J7BA 5FXRA 3IGOA 4KIKB 3EWHA 4HW7A 3ZTXA 4C61A 4QTEA 2RG5A 2W17A 2WOTA 3KRXA 1FGIA 3PA5A 3OW3A 3LFAA 3V51A 2ITQA 3FLNC 2VTTA 4FEUA 5AP0A 4IX4A 5IQFA 2GU8A 3MY1A 3P86A 5TO8A 3SAYA 5K5XA 5AFVA 2BTRA 1BKXA 2RFSA 2UW4A 3HMMA 1TQPA 1RW8A 4QTBA 3ZRLA 4XH6A 4FE2A 4O7SA 5IMEA 4M3QA 2JKMA 3O2MA 2BILB 2PE2A 2RG6A 3DQWA 2PZ5A 3FHIA 4I92A 4IHPA 5CEQA 3TV6A 2OZOA 3A4PA 3MDYA 1P14A 1XO2B 3QGYA 2E9PA 2XRUA 4E93A 4KS7A 4YLJA 2XKFA 2PVMA 2QOFA 3SV0A 5LXMA 4LGHA 4C57A 3PSCA 3PVGA 4KIKA 4B8LA 3LMHA 3VVHA 3Q53A 4Y73A 3DJ7A 5E8ZA 5HHWA 3SOAA 4C7TA 5AUZA 2XNPA 1A48A 4BKZA 3RCDA 4DHIB 3MVJA 5CU2A 3VUGA 4A07A 2XKEA 4BY9E 4BDAA 4KIQA 2VO0A 5CS6A 5M08A 1U5QA 5TE0A 1M17A 3UYSA 4XRJA 3WIKA 3F5PA 2GTMA 2VWWA 3GXLA 5IISA 3E3PA 1CKPA 4C62A 1WBPA 3GCSA 2VAGA 2I6LA 3FMKA 4YUQA 2IZRA 3MFRA 3DTCA 4LRKA 5EYKA 3RHXA 1I09A 4LV8A 4BHZA 3QCXA 3MI9A 3ZYAA 1JOWB 4U45A 3OVVA 2OKRA 4XNEA 3RKBA 5FUTA 4FNWA 2ERKA 2BHEA 3NVKI 1P5EA 2QOKA 4EQCA 2X0QA 5AP7A 4ZSAA 2QCSA 3ZBXA 3LFDA 4BBEA 3RK5A 4MBLA 4W8EA 3GOPA 5IA1A 3UIUA 1Y91A 3GU8A 5HD7A 4RZVA 4V04A 4C4IA 4PTGA 4YU2A 4BL1A 3KRJA 3QQFA 4EBVA 4JRVA 2WTKC 5ETCA 4FJVA 4J98A 4KBAA 1WZYA 1IASA 2X6EA 3D5XA 1VLRA 3L9MA 1H1WA 4ZIMA 3KY2A 4IACA 1O6YA 2A1AB 4PPAA 4IZAA 2A2AA 4M68A 2B55A 4MXYA 5AP1A 4NW6A 3OCGA 4DCEA 1RQQA 3FZPA 2DS1A 4NT4A 2R0IA 4QD6A 5D7VA 5DGZA 1XBAA 3VUKA 3C9WA 2NRUA 4JG8A 2F7XE 4OBOA 3UDBA 5E8WA 2IVUA 3UTOA 5FQDC 5I3RA 2GHMA 2C5OA 4PDPA 4GJ2A 4IB0A 4M69A 2W1EA 2C3JA 4HPUE 3FWQA 4CZUA 3GVUA 4Q2AA 2QO2A 1FVRA 1M14A 3EL8A 4FRFA 4XP0A 2J51A 1UU9A 4I93A 2VTQA 3LCTA 4KSPA 4D0WA 3HV3A 4J7BA 2YIYA 2X0OA 3MFTA 4UY9A 2XM8A 4LRJA 3ZEWA 3UO4A 2VZ6A 4FSMA 4FK6A 4DTAA 3F82A 5M4IA 4WNMA 2UZVA 3ELJA 2C69A 4C4EA 2PU8A 4MHAA 4RJ6A 1UU3A 4BCHA 4EYMA 3GU6A 3PXZA 3R7GA 4MXAA 3NW6A 4EOJA 2PWLA 3ROCA 3QWJA 5HVKA 4O0SA 4TWPA 4RIWB 3DJ6A 3MBLA 3PVWA 5EOBA 3QHRA 2G15A 1S9JA 5M51A 5CXZA 5KUPA 4R7HA 4TWNA 3ZMMA 2WGJA 3ETAA 3IKAA 2NRYA 2Z7RA 4KKEA 5LCKA 2YACA 3KVXA 4QDEA 5DYJA 2QKRA 5JFVA 3Q96A 5TF9A 5DT4A 2OO8X 3POZA 2VO6A 2YHVA 5DRDA 3I5NA 1PKDA 4QMXA 4RIXB 3SQQA 4RA5A 2PVYA 3A62A 3GEQA 3EYHA 1OGUA 3EQRA 2QO7A 4IWOA 3GFEA 3G90X 5HCYA 5ICPA 3KN5A 5IF1A 4F0GA 4RIWA 3L8SA 2QI8A 5A4QA 1GIHA 3FQSA 3VS3A 5CANA 4ZY6A 4NIFB 4BYIA 3ATTA 1RDQE 3W8LA 3MPTA 3ZXTA 4XG6A 3PVUA 3BEAA 3E8DA 3UMXA 4F7LA 5KX8A 3NWWA 5CVFA 3FXWA 4FOCA 2VWVA 4F7JA 2WQOA 4CMOA 4WG4A 3MH2A 5IDNA 4WNOA 4BC6A 2I7QA 5CYIA 3AGMA 3GQLA 2QG5A 4TYEA 4XV3A 2BRGA 3VS4A 4JQ8A 2YWPA 3WBLA 4CKJA 5HE3A 4CXAA 5LQFA 5M4FA 3QTIA 1WBVA 3OUKA 1OKWA 4RJ3A 4GT4A 4RIXA 5HCXA 4X3JA 5HE1A 3AD4A