3DBLI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
RRASVGSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLQLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 19
structure length 86
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dblI00
2NVUI 2MX2A 3KW5B 4M0WB 2KO3A 4KV2A 2ZEQA 4RM8A 3UIOB 4WWOA 2XK5A 4E3CA 2KJHB 3AU5A 4B95A 4EZKA 2NBWB 4G0NB 2O2VB 3VHTC 3WAMA 2RGFA 3A9KB 2KTFA 3N32A 4ASWC 3JSVA 1WXAA 4GDKA 4TQ0A 2IO0B 3RUIB 1UBQA 4F8CB 4MDKE 4HCPB 2MBBB 4CHKA 2G4DB 2JVCA 4NQLB 2IZVB 1NBFC 1WJUA 3DQVA 3ML9A 4AJWA 1EF5A 4XX5A 3WA0A 4ANXA 3WIMA 2DZJA 3UF8A 3VVWB 2KLGA 4BKSA 2ZCBA 2LI5A 4II2B 3QJZA 3VDZA 2KFKA 4FJYA 1TTNA 2BF8B 3AULA 3DOWA 1V80A 3NOBA 4BKGA 4KSLC 1KOTA 5JH5C 2G4SA 2JPHA 2EMTA 3QQ8B 2V4LA 3PTFC 4W9DA 3TIXA 4IW0A 3K9OB 2GBJA 3SU8X 1WZ3A 4I6NB 2R2QA 3A1QB 2JXXA 1A5RA 2FCSA 1UZXB 2LVOA 2O6VA 2DX5B 3QA8A 3KUDB 3A9JB 4OVVA 3L54A 1WMHB 3DBHI 2KMAA 2OOBB 2J7QB 4E71A 1D3ZA 2MBOA 1YQBA 3DBLI 1VCBA 3RULA 1WE6A 2Z0EB 3WAPA 2KK8A 2A5UA 4FLHA 1GUAB 2MBHA 1FXTB 2L8JA 3ZKJC 2LZ6A 2MBEA 2M0XA 1Q5WB 3NY5A 1YX5B 3RT3B 1OGWA 4WWNA 2LD9A 4EKUA 3KYDD 3I3TB 4F7ZA 4IM0A 1KM7A 4MEMA 4OVUA 3H7PA 3KH0A 1L7YA 4GN1A 1V81A 4GDLA 2KTRA 2AEHA 2DYMA 1V2YA 2D07B 1P98A 2FIDA 3DVNU 4P7IA 3ZDTA 4HCNB 4W9EA 3V6EB 4CYEA 3PLUA 2M4NA 3CSTA 1R4MI 2N4FA 4TKNA 2D2QA 2IYDB 4IWOA 4GGQA 4PYUA 5TR5A 2AWTA 2KD0A 4JQWC 3APDA 3QCAA 4W9JA 4E74A 3PHXB 3PREA 4MJSA 5FR6A 4FADA 2KJRA 4IWPA 2MP2A 3M3JA 3T9LA 4URKA 1RLFA 4G11A 4A20A 3A9JA 5HKHA 3OLMD 3QK0A 3Q3FA 4GIVA 1UGMA 1RAXA 2C7NB 3GZNI 3H1UA 1ZKHA 3PS6A 2N1WA 3H6NA 4G50A 4IM3A 2KOXA 4HLEA 2ZJDA 5DCNA 1J0GA 2C7MB 2FIFA 3R7QA 2HTHA 4KZCA 3JW0X 1LFDA 1WJ6A 2DENB 2KWUB 2GBKA 4JLCA 1H8CA 3JYUA 4MGIE 3V61A 3Q3JA 4NJ7A 4DDID 2GMIC 3A4RA 2D11A 4LCDE 3VTVA 4XC2A 3OJ3A 2IY1B 2O6VD 3PSEB 2K8CA 3JSVB 1S1QB 4GDKB 2I1KA 4MGYE 1E8ZA 4GMVA 2C9WB 2PPHA 4W9HA 1V49A 4WJNA 3B0AA 2CKHB 4W9GA 3ZNZB 1SGHA 2FNJB 4NAWA 4FA6A 3KUZA 2KXJA 2D3GA 4HK2A 2PJHA 4KZ0A 4EZLA 5KHQA 2KNBA 1R4NI 1WR1A 3VUXA 4IC7B 2G3QB 2HD5B 2JWZA 3KYCD 4NY0A 1GG3A 3C0RB 3QARA 4G3XB 1P9DU 1V86A 4WQOB 3VQIA 4RMAA 2MLBA 3SHQA 1UH6A 1V5OA 2KFKB 3V6CB 4F1SA 2CS4A 4NQKE 1ZGUB 3IG3A 4FHJA 4KDIC 5J2RA 2KC2A 2PE6B 4DHZE 3IVFA 2ZVOA 3M62B 4BOZB 4HVBA 1K8RB 4A3OA 3O65B 4EEWA 4HXDA 4YL8A 5JZEB 1GC6A 2KWCA 3PPAA 2ZPYA 2JY6A 2O6VB 4W9FA 2KX3A 2N9PC 5CHFA 2FUHB 2KQ7A 1AARA 2K8HA 2LASA 1EF1A 1J19A 1GNUA 5CHWA 3PHWB 4IUMB 5E6OA 3U30A 2JRHA 1H4RA 4GU2A 1E5WA 1MG8A 2K6DB 2A4ZA 5CHVC 4HDOA 3QIJA 3QX1A 3CSFA 2LGYA 4K7WA 4ANUA 3H9DA 3ZIMA 5CX3A 1XT9B 2VRRB 3H7PB 2GBNA 1JRUA 4GDLB 2ASQA 2KTRB 5AZFA 4FULA 5E6NA 1WIAA 2HJ8A 3ZRCA 2MRPA 2W9NA 3X23A 1OQYA 3VTUA 2D10A 4B6WA 1V9JA 3NS8A 3VXWA 2FAZA 2FCQA 4BBNC 3TL5A 4PS8A 3ZTDA 2WDTB 5JHBA 2KWVB 3UQBA 4KDLB 4MJSB 4DWFA 2MP2B 5IA7A 2CR5A 3SDLC 2DYOA 2DAJA 4AJYB 1Y8RC 2KLCA 2N9XA 1QZEA 1Q1OA 1WXVA 4EOYA 2YVCA 5AEKB 4AOFA 4EZJA 2MWSB 4I6PA 2ZVNA 2IO2B 4GXBA 4J6IA 1EO6A 2GBMA 3PRZA 4FN2A 2KZRA 3QWZB 2GBRA 1GC7A 3ZNID 5LXIB 2N9EB 4MGZE 4W9KA 1VD2A 1RRBA 5DPRA 2KHWB 2Y5BB 3ZVVA 2RSUA 3BY4B 4ANVA 3VTWA 3VH3B 3CF6E 3HHMA 4I6LB 4NAWB 3WALA 2MW5A 1WRDB 3WAOA 1M94A 4IG7B 4B9KA 2J0KA 2Z59B 1G6JA 3ENEA 4M8NA 4JL9A 2J0JA 4PYZA 2L76A 2NPTA 5C1ZA 2BYVE 1T0YA 2JUOA 3IBEA 4BFRA 5D7GA 2PEAA 3VUWA 3W1YA 5L95C 5LLIA 1WXMA 1WJNA 2LGXA 1YIWA 2NBUA 3W1SA 1WM3A 3MJWA 1LXDA 4JGHB 5AZHA 4GSWA 4A3PA 1IPGA 3R3MA 3EFUA 2JZZA 3HM3A 3PV1A 4IWQA 2LXAA 4KIKA 4LDTD 4MM3A 3B08A 5J18A 1WF9A 3DVGX 1TGZB 4K7SA 1GJZA 3L08A 4W9CA 2GOWA 2DYBA 3NZUA 4NNJB 3PZDA 2WYQA 4BVUC 2L00B 1IYFA 2CHZA 2B3AA 2J0MA 3PVLA 4FHKA 4MSMB 2CU1A 3HIZA 4WJPA 2UWQA 2LWPA 2MSED 1L2NA 1P1AA 4ZDVA 2K1FA 2HE7A 2YLMA 4DBGA 1TZ1A 3AU4A 2MA9B 4AP4C 1HE8A 1WX8A 2RD0A 3N30A 2DZIA 1NDDA 3KVFB 4ICVA 5AZGA 1WY8A 4WAAA 3JVZX 3V62A 4AUQC 2R2OA 2BKFA 3RCZA 1SE9A 2KDIA 3PRMB 4IM2A 4K1RB 4XZ4A 1WFYA 4ICUA 1WX7A 2WWZA 2KJ6A 4ANWA 2LRUA 2BYFA 1I42A 3MTNB 1I35A 1OEYA 2IBIB 3PLVA 2KFJA 4K81A 2K25A 4LDTB 3T8MA 1ZW7A 2LVPA 4ZRJA 1EUVB 2IO1B 1KJTA 4RM9A 2L05A 2BYEA 2BWFA 3DCGA 3EHVA 3UINB 3APCA 4BBNF 2NCNA 1WH3A 3ML8A 3U7DA 3NHEB 1OEYJ 3DBRI 3ZW3A 2EMSA 3DVNV 5G55A 4DXAB 1IP9A 1Z5SB 3QHTA 4BKSD 2KC1A 2PE9A 3EECA 4KSKC 4DDGD 4W9IA 5E6PA 2RR9A 3WANA 3PGEA 3DVGY 2ZPNA 3DDCB 3ECIA 4GB9A 3UIPB 1P0RA 2K39A 2UYZB 4ZRIA 3AXCA 3KUCB 3NZSA 4LJPB 1WX9A 4EFOA 5D94A 1E8WA 2LUEA 4WJQA 3S2AA 2LXCA 1ISNA 1SIFA 2OJRA 1F9JA 3ALBA 3LJ3A 3M95A 3TBLD 2M1MA 3ZTCA 1NI2A 2QHOA 4BOSC 4K7UA 5LXHA 3V60A 2M8SA 3B1LX 3VH4B 2AYOB 3W1SC 5DPSA 3VFKA 2NPTB 3RZWC 2BGFA 2KVRA 3A4SC 1WR6E 3L17A 4NPNA 3ZDMC 3DBSA 2NBVB 3ZO5B 5L83A 3UQAA 4FJVB 4N9F4 3ZNHB 2JRIB 3BINA 2AL6A 3QC8B 2KX0A 3RZFA 5JHAA 3L16A 5DPTA 3L0WB 1WGRA 2BWES 2O2VA 3A9KA 5D2MB 3R66C 3RD2A 4TQ1A 4DHZB 3ONSA 1Z2MA 2XEWA 2KDBA 2N7DA 3GOEA 3IFWB 4DHJD 1C1YB 2JT4B 2WX1A 3QAQA 4KIKB 1UBIA 3CMMB 4AWJA 2EKEC 3PT2B 1WJ4A 4MH0E 3TJPA 1E90A 4NJ6A 2IO3B 4TUUA 2G45B 1WGGA 1WE7A 1WYWB 2CHXA 3ZUNA 3R7RA 3K9PB 3MHSD 1E8YA 1CMXB 1XD3B 3VUYA 1BT0A 3OAWA 1S3SG 2KDFB 2K6QA 4CO7A 5J17A 2REXA 4ZYNA 3HK0A 4LJOB 1YX6B 1KLVA 3HM6X 1WM2A 1WI0A 5IAAC 2DZKA 1V6EA 2AL3A 3H7SA 4JIOU 1Q0WB 4EUTA 2L0FA 2BKRB 1V5TA 2M17A 2KQSA 3A1QA 3EC8A 3APFA 1J8CA 2K8BA 4MGKE 2NS5A 3AI5A 2V3SA 2C60A 3U8ZA 2L0TA 1TBEA 2LRWA 1YD8U 4II3B 1WMHA 2C5LC 2ZZPB 4WJOA 2N7EA 4WWPA 3TCAA 2KN5A 4DHJB 3DPDA 2WX0A 3N3KB 3OJ4B 1LQBA 5BO4B 2JF5A 3M63B 4HWIB 4BKTA 3VAWA 1RFAA 1WXSA 2LVQA 4M8MA 3A33B 4TV3A 1WGHA 4X57B 1OTRB 2BPSA 3PRPB 1PQSA 4FJZA 5DPWA 2XK5B 3ZNGC 1WZ0A 4PS3A 2KMCA 4HPLB 4PS7A 2LGDA 1XQQA 3LDZE 2XBBC 2ZNVC 1LM8B 1X1MA 2DAFA 1UD7A 4W9LA 5EDSA 2IY0B 2KKCA 2RPQA 1WGYA 2Z0DB 4HPMB 1UELA 2L7RA 4MELA 1E7UA 1U4AA 5D6JB 2KANA 3L10B 2FCNA 4KVGB 2N1VA 5G2NA 2MQJA 4FBJB 2CHWA 5GMVA 2DHZA 2MCNB 2V1YA 3RYTA 2MBQA 1WGDA 3D32A 2FCMA 4DK5A 4MSQB 1E7VA 2C7HA 4HDQA 5C23A 2LJ5A 2L3ZA 2ZNVB 2ZCCA 3ZLZA 3UGBB 3ZRFA 2JZ3B 1P3QU 1E8XA 3IHPC 1YJ1A 2NR2A 4HJKA 3P2BA 3SD5A 4ZRKA 5KHOA 3X0WA 4GOCA 3TMPB 1C3TA 2DZMA 2I1JA 3L13A 2KDEB 5CTRC
chains in the Genus database with same CATH superfamily
1KFYB 2NVUI 2KDMA 2XK5A 2WXJA 4G0NB 2O2VB 3BVGA 3A9KB 3JSVA 1KH0A 3DQVA 4AJWA 2WXFA 3AEDB 3WIMA 2L1AA 3UF8A 2KLGA 3Q8EA 2ZCBA 2BS4B 1E10A 3NOBA 1VZ8A 2G1EA 1UNSA 2G4SA 5EE3A 3PTFC 4MACA 2GBJA 2M0AA 4NJCA 4K3BA 5BYRA 4WH4A 4OVVA 4OW0A 1D3ZA 2HDEA 1YQBA 1VCBA 3U7ZA 1JQ4A 3UI3A 2MBEA 3DBRB 1OGWA 4WWNA 2LD9A 3AB5A 1PGXA 4IM0A 2V3NA 1V81A 2AEHA 4WIPA 3BK1A 3V6EB 1DGJA 2BBCA 3PLUA 1R4MI 2N4FA 4IWOA 2WXPA 2PLPA 4W9JA 4E74A 4FADA 3AEEB 2JQRB 4IWPA 2MP2A 3T9LA 4URKA 1RLFA 4A20A 4ZHOA 1IBXB 3OLMD 4GIVA 3Q3FA 4C7ZA 4EKUA 1T5XD 2N1WA 1YMHE 2VZKD 2KOXA 4HLEA 1GPXA 5DCNA 1J0GA 2C7MB 3R7QA 2KWUB 3I5JC 1STEA 4JLCA 1YQ3B 3A4RA 4LCDE 4XGAB 1WWTA 2K8CA 4MGYE 1IGCA 3NUHB 4LNIA 3KUZA 2KXJA 5KHQA 1I4PA 1WR1A 4IC7B 2JWZA 4NY0A 2TSSA 3C0RB 3QARA 4G3XB 4P6VF 2RPVA 1C79A 3SHQA 2BT6A 1QOFA 3IG3A 1JCKB 4FHJA 2PE6B 4A3OA 2LFIA 3BK2A 1V1PB 5JZEB 1GC6A 2ZPYA 4FXCA 2H88B 2IPKD 2KX3A 5IKCM 2FUHB 1UWXA 4LNKA 2LASA 5CHWA 4GU2A 1DOIA 4L1BA 1MG8A 2SAKA 3QX1A 3NVWA 4K7WA 2FBWB 4C7YA 3ZXRA 5CX3A 3H7PB 1ACCA 2QEJC 1WIAA 3ZRCA 1DOXA 2INDC 4N59A 2V4IB 2HTME 1V9JA 3VXWA 4J3OD 3T3OA 2FAZA 3FAHA 1V1PA 4PS8A 4LNNA 3AEFB 3SDLC 2BYTA 2J53A 2UU7A 3B9JA 2N9XA 2VH1A 4EOYA 4AOFA 4C80A 2ONQA 1M4VA 1FNUA 1VDVA 4FN2A 4ITKA 1JWBD 1L0VB 2N9EB 1VD2A 1OFFA 1RRBA 2Y5BB 3BY4B 4LLGM 3VTWA 4NAWB 2N7JA 5G5HA 5HG2A 1D6EC 1G6JA 4S17A 3AE9B 2BYVE 3TEWA 4BFRA 2MEKA 2JSVX 3O13A 5LLIA 3RMKC 1HZ6A 3GE8C 1YIWA 1WM3A 3MJWA 3Q3NC 1N60A 1XCTL 3N9YC 2WXRA 4A3PA 1YN3A 3R3MA 3PV1A 2Y5PA 3DBLB 3NG0A 1TGZB 4K7SA 4NNJB 2WYQA 1IYFA 3SFEB 2B3AA 2J0MA 4WJPA 2PVOD 4DBGA 2WDVB 2Y3AA 4DXGA 4R3DA 1NDDA 3KVFB 1R7SA 4WAAA 2WLBA 3MJ5A 3U2SC 4XZ4A 5H92C 2WWZA 4K3CA 5JXVA 2LRUA 1OQQA 1I35A 4K81A 1ZUD2 2LVPA 3LYYA 1EUVB 4RM9A 2BYEA 2V3PA 3DCGA 2WXHA 3ML8A 1WH3A 4HPPA 1TT5B 3U7DA 1PGBA 5EE9A 3EECA 4W9IA 1KLGD 2PMVA 2V0GA 3UIPB 3DDCB 4GB9A 1P0RA 3AXCA 3PZ7A 1E8WA 3URYA 1SIFA 1TKYA 2J52A 3AE4B 2M1MA 2KT7A 4K7UA 3B1LX 3RZWC 3VR9B 5I4DA 3ZDMC 3MC9A 2WDRB 3ZO5B 2M56B 4N9F4 3ZNHB 4RNAA 1SF0A 3L16A 3L0WB 1ZXHA 5D2MB 2BB5A 2WP9B 1T0SC 2KAJA 3IFWB 2WX1A 2LMCA 3Q6BA 1ENFA 1K51A 1E90A 4USAA 1NYQA 3P63A 3Q8CA 1WE7A 2CHXA 3ZUNA 1ZPSA 3W9CB 1E8YA 2DLBA 1XD3B 3AV8A 3BWUD 3OWEB 3RNFC 5J17A 4ZYNA 1TS4A 3HK0A 1YX6B 3ABVB 1WI0A 4C56C 4JIOU 1Q0WB 2M17A 2WXNA 3EC8A 1J8CA 1CK1A 2V3SA 4S0RA 1XLOA 5LNK1 3DBHB 2MJ3A 4WJOA 2N7EA 1LQBA 1JWMD 4HWIB 1RFAA 4M8MA 2LVQA 3R2IA 4ZYSA 1OTRB 2IGGA 5IN7A 1WZ0A 1DYQA 3I63C 2XBBC 4YXDB 2IY0B 2Z0DB 1F2RC 2L7RA 4BZAA 1KTKA 2FCNA 2MQJA 2DHZA 2MCNB 1WGDA 1E6EB 3D32A 3GZNB 4ZRQA 2D3CA 2C7HA 2L3ZA 2K0PA 2L83A 4HJKA 2AX5A 1P3QU 3SD5A 3VR8B 5KHOA 1C4AA 4ACFA 4M0WB 2ZEQA 4E3CA 4WWOA 2KJHB 2QILA 4B95A 4HJGE 4EZKA 1GOZA 4HKZE 3VHTC 2RGFA 2KTFA 3FILB 4GDKA 3RNEC 1VZ7A 2D3AA 4MDKE 2X38A 2MBBB 4CHKA 2G4DB 2JVCA 1ESFA 1NBFC 1WJUA 1XEEA 3EGRA 1TS3A 3L4PA 2DZJA 3VVWB 3TSSA 4II2B 5C3JB 3SEBA 2KFKA 2XN9C 1V80A 2CJOA 4QAYA 2D3BA 2MHJA 3TIXA 4W9DA 4IW0A 3K9OB 1JWAD 1Q10A 1WZ3A 4I6NB 3A1QB 3ZYYX 2FCSA 3J9CA 1UZXB 2LVOA 4RCOA 3A9JB 3L54A 3DBHI 2KMAA 2MBOA 2QJLA 2KK8A 1J7BA 2A5UA 1GUAB 3ZKJC 2GI9A 1YX5B 3I3TB 4MEMA 3KH0A 4GN1A 3AEAB 1FXIA 4GDLA 2KTRA 1V2YA 2FIDA 4CYEA 3CSTA 4WAFA 1RFKA 4TKNA 2LUMA 4PYUA 2AWTA 2MJEA 1PUTA 3APDA 3PHXB 3PREA 5FR6A 2KJRA 3A9JA 4JWSC 3PS6A 2C7NB 3GZNI 4G50A 1VR9A 4IM3A 2WU2B 4KZCA 1LFDA 1MG4A 2GBKA 4YTMB 2KYWA 1H8CA 3P4SB 3Q3JA 4NJ7A 1ZP0B 2GMIC 4D2KA 3OJ3A 1QKZA 5HI1A 1B1ZA 4YT0B 1N6ZA 3JSVB 1S1QB 1E8ZA 4GMVA 1V49A 3ZNZB 4W9GA 3AH7A 4KZ0A 2D3GA 2PJHA 1ZOYB 3VUXA 2G3QB 2QCZA 2X8XX 3H8HA 4KGTA 2Y5CA 3ETRA 2AQ2B 1UH6A 1V5OA 3V6CB 4F1SA 1L0XB 2CS4A 3GP7A 1WXQA 1V97A 5HHDG 3IVFA 2ZVOA 1K8RB 2QDFA 3O65B 4EEWA 4HXDA 4YL8A 2KWDA 4WURA 3GS2A 5CHFA 3TUOA 2K8HA 1J19A 1F1HA 1N62A 1L0YB 3PHWB 3U30A 2JRHA 5CHVC 3AE3B 1KLUD 1YQ4B 2WNMA 2K9XA 3ZIMA 2VRRB 1JRUA 5AZFA 1L4DB 5E6NA 2HJ8A 1ZXIA 4B6WA 3C19A 3Q8BA 1T0RC 2MP2B 4JX1C 2K5PA 3BVZA 4B0MA 5BYQA 1Q1OA 3DHIC 2INCC 5AEKB 2IJ0A 2IO2B 4GXBA 3PRZA 2ON8A 3QWZB 3T3NA 2GRIA 3RPFC 2OJWA 4ANVA 4I6LB 3ZJUA 3BYTB 4GLSC 3ENEA 2QSDA 2J0JA 2NPTA 3U52E 2PEAA 3W1YA 3AE8B 4OHJA 2HJ1A 2LGXA 3OG5A 4NAMA 2JYEA 1QQRA 1IPGA 4KIKA 2MJDA 3B08A 3DVGX 2OEDA 2L00B 2CHZA 3PVLA 4MSMB 4ZRPA 2CU1A 1TY2A 4IOIE 2LWPA 2Z8LA 4C4VA 4MH8A 2K1FA 2YLMA 2MA9B 2J4XA 2RD0A 2E3TA 4RGNA 3V62A 3JVZX 4AUQC 3RCZA 1SE9A 4ZOHC 3PRMB 4IM2A 4K1RB 4ANWA 1WFYA 2KJ6A 3DWMA 1I42A 3P42A 1E9MA 3MTNB 4Q2JA 1HQRD 2KFJA 2YEPF 1N5WA 1ZW7A 2IO1B 1SBBB 4WWMA 3RN9C 2J42A 3APCA 1XXGA 3W2DA 5AUIA 4BBNF 3Q8AA 2NCNA 2RMMA 1V1OA 3DBRI 1EWYC 3ZW3A 2EKIA 1I4RA 3FKYA 2KC1A 2PE9A 1JWSD 4KSKC 4US8A 5E6PA 3E9SA 1C9FA 2RR9A 1HA5A 3PGEA 1TS2A 5TSSA 5D3DA 2K39A 1YN4A 2UYZB 4ZRIA 1HZ5A 1R4NB 2RDGA 1WX9A 4XYCA 2NTTA 2LUEA 3MP9A 1NEKB 2LXCA 1ISNA 2OJRA 3ALBA 2YEPB 4BOSC 2M8SA 1IUEA 3VH4B 5DPSA 1BXTA 2BGFA 4NPNA 3L17A 1WR6E 4NZLB 3DBSA 5IOIA 1HTQA 4FJVB 3RZFA 2BWES 3RD2A 4TQ1A 4DHZB 1MI0A 3ONSA 2N7DA 3GOEA 1C1YB 1UBIA 2EKEC 3PT2B 1WJ4A 3HVDA 3TJPA 2IO3B 1WGGA 2LHEA 2IGHA 3MHSD 1I4XA 1MHHE 1CMXB 1DOYA 1FCCC 3OAWA 3W5VB 1S3SG 4CO7A 3RNAC 2L32A 5IAAC 1VRAB 3Q3OC 4JPSA 1V6EA 2L0FA 4HEA1 1C4CA 3N20C 1I4QA 1EWCA 4IDIA 2K8BA 2NS5A 1AN8A 4C00A 4XWWA 1YD8U 1WMHA 2ZZPB 4WWPA 2KVZA 3N3KB 3OJ4B 2QMTA 5HFYA 3LB8C 5BO4B 2JF5A 3M63B 1PYWD 3R2TA 3A33B 4TV3A 4X57B 1NI3A 4A6QA 4PK1A 3NRZA 1C76A 4PS7A 2LGDA 2WXMA 2ZNVC 1X1MA 2DAFA 1UD7A 4W9LA 1L6VA 3I57A 3L10B 2N1VA 5GMVA 1QOAA 3DHHC 4US9A 4DK5A 1GAQB 2NTSA 2LJ5A 2JZ3B 3BVMA 2NR2A 1T0QC 1RM6C 4GOCA 4RGTA 5TR5A 1TZOA 3P4RB 3KW5B 1K52A 2KO3A 3GE3C 3BZDB 3AU5A 2NBWB 4HRSA 1E7PB 3AM9A 1D5XC 3WAMA 3N32A 1WXAA 3RUIB 1UBQA 4F8CB 4HCPB 2CU3A 4P16A 2IZVB 2KMMA 1D5ZC 3ML9A 3WA0A 4AS1A 4BKSA 2LI5A 3VDZA 2BF8B 3AULA 4LTUA 5JH5C 2JPHA 2EMTA 3QQ8B 2V4LA 3DWGC 3SU8X 4M00A 1A5RA 2RDHA 2O6VA 2DX5B 3KUDB 2J7QB 3DBLI 4MT5A 2Z0EB 1HTOA 4XDDA 4FLHA 2WXGA 2MBHA 3AECB 2LZ6A 1TJEA 3NY5A 4F7ZA 2L52A 4OVUA 1WSPA 1YOVB 1L7YA 2DYMA 2D07B 4LNFA 1SB3C 2PW9A 3TEYA 1A70A 1CZPA 4BAXA 4ZHPA 5BMGA 2IYDB 4GGQA 1YNTE 2KD0A 1ROEA 3QCAA 4MJSA 2FUG1 3NVVA 3VRAB 1JW9D 4BKSD 3QK0A 5G2NA 3Q3MC 3H1UA 5T8IA 1ZKHA 3H6NA 3KQ4A 3JYUA 2Q5WD 3B2FA 1JWUD 1P7FA 4MGIE 3V61A 4DDID 3Q14C 2D11A 5IO9A 3VTVA 1QF6A 3AEGB 2KN4A 2O6VD 3PSEB 3KWLA 4GDKB 2I1KA 2RDBC 2C9WB 2PPHA 2CKHB 4FA6A 4EZLA 5E6JA 2KNBA 2JWUA 2HD5B 1MJDA 4RFBA 1MPEA 4YSZB 1P9DU 3IT4B 4RMAA 2MLBA 2KFKB 3NVZA 1FD6A 3HVZA 4KDIC 5J2RA 2KC2A 5GXGB 3U4EG 4BOZB 3EUB2 4A8XC 3Q2AC 1T3QA 2VH2A 1L5PA 1RYJA 1PGAA 4W9FA 2N9PC 2KQ7A 1EF1A 1GNUA 2QIEB 1H4RA 3IAM1 1E5WA 1LO5D 3ZJTA 3P4QB 4RH6A 2OHFA 3QIJA 3CSFA 1I7HA 4ANUA 3I9V1 4GDLB 2KTRB 2BTEA 2MRPA 1JMLA 1OQYA 3NS8A 2WS3B 1XLNA 3ZQ4A 3B2GA 3ZTDA 4OVZA 2KWVB 4KDLB 4KKJA 1Y8RC 1TYGB 2YVCA 1QOBA 1MHXA 2GB1A 2ZVNA 1EO6A 1YJJA 2KZRA 3ZNID 2MH7A 2FE8A 5DPRA 4UDUC 2KHWB 3ZVVA 4P1BC 2LGSA 3HHMA 3VH3B 3WALA 1WRDB 2BB6A 3RNGC 4B0EA 1M94A 4IG7B 4B9KA 2GLSA 4JL9A 3V3XA 4PYZA 3ZJVA 2LEKA 1RWSA 3IBEA 1JROA 3VUWA 2N0SB 5L95C 4LNOA 1J7CA 1WXMA 2V9HA 1SE2A 1WJNA 5EE0A 2NBUA 1LXDA 4JGHB 5AZHA 3EFUA 3HM3A 4IWQA 4LDTD 4MM3A 5J18A 1WF9A 1GJZA 3L08A 1AW7A 5G5GA 2DYBA 2KACA 4M01A 2WXQA 4IKGA 4FHKA 2LJIA 1FEHA 2UWQA 3MHZA 1E0ZA 1L2NA 3NS1A 1P1AA 4ZDVA 2HE7A 1TZ1A 4AP4C 1HE8A 2VZKB 3N30A 3TEZA 3WCQA 2DZIA 4YSXB 4ICVA 5AZGA 1WY8A 1FNWA 2R2OA 2BKFA 1PDXA 2KDIA 1ZDXA 5IA7A 2H89B 1SXTA 1WX7A 4HKQA 2BYFA 1UWMA 2K25A 3T8MA 4RF1A 1NENB 1KJTA 2L05A 2ICIA 2BWFA 3NHEB 2EMSA 2W3RA 3DVNV 3R8BA 2BW2A 4DXAB 1JALA 4DDGD 1FRDA 3WANA 1YJIA 2ZPNA 2ACZB 1SJHD 1XO3A 3NZSA 2INNE 2WGSA 3FC4A 1C4PA 3VRBB 4P1CC 3HUIA 2JXTA 2N9KA 1WRIA 3ZTCA 1BUIC 5LXHA 4H2AA 3VFKA 2NPTB 3A4SC 5H8YE 2NBVB 5L83A 2CJNA 4WQMA 2JRIB 2AL6A 3QC8B 2KX0A 5JHAA 3IAS1 2O2VA 3A9KA 3AN1A 1GB1A 2PVGC 1Z2MA 2KDBA 4DHJD 1FXAA 4N6EB 2WXKA 1FMAD 3QAQA 4KIKB 4MH0E 3MC8A 4NJ6A 4TUUA 4JE3B 2JZPA 3E56A 3AE2B 1F77A 3R7RA 3K9PB 3VUYA 4KX6B 1BT0A 3ZXVA 2BVCA 4C4VB 1SJED 1KLVA 1WM2A 4A9AA 2DZKA 1FFVA 2AL3A 3H7SA 5IP4D 4EUTA 4RGMA 2BKRB 3PO0A 2BQQA 2BS2B 1JRPA 1BMLC 2DWQA 2I2YA 4MGKE 1AWDA 2C60A 1LGRA 2L0TA 1TBEA 2LRWA 2C5LC 3TCAA 2KN5A 1ZDVA 4LK0M 2ZW1A 3VAWA 3NJTA 1WXSA 4REZA 3W5UB 3PRPB 4FJZA 5DPWA 2IGDA 1HEZE 2KMCA 1XQQA 5D3IB 2KKCA 1CQVA 1WGYA 2RPQA 4HPMB 4DQOC 1UELA 1E7UA 1U4AA 5D6JB 2KANA 1C77A 4KVGB 2V1YA 1IBXA 1EM7A 1B9RA 1PFDA 1UF0A 2FCMA 4HDQA 5C23A 1K53A 1D5MC 2ZNVB 2ZCCA 3ZLZA 1SEBD 1E8XA 3P2BA 3X0WA 3P1MA 2DZMA 2JX5A 2MX2A 4RM8A 3UIOB 4KV2A 1FRRA 1ET6A 1FM0D 4ASWC 4TQ0A 1UUPA 5EE1A 2IO0B 4XWTA 4M02A 4NQLB 2AQ1B 1EF5A 4XX5A 4ANXA 2LGIA 3KLSX 3AEBB 2B76B 3QJZA 4FJYA 1MFWA 1TTNA 2WXOA 3DOWA 3N1ZC 4BKGA 4KSLC 1KOTA 3MFGA 1NVID 3RNBC 2R2QA 2JXXA 1FPYA 4YTPB 3QA8A 3HRDD 1WMHB 2OOBB 4E71A 4DXFA 3RULA 1WE6A 3WAPA 3MC0B 3SR6A 1FFUA 1FXTB 2L8JA 2M0XA 1Q5WB 1FNVA 4L2YA 3RT3B 1N63A 1NYRA 2M19A 3KYDD 3CWIA 1KM7A 2WDQB 3H7PA 2PIAA 1P98A 1XLPA 1VLBA 3DVNU 4P7IA 3ZDTA 4HCNB 4W9EA 4XDCA 3RNCC 2M4NA 1FCLA 5BMHA 2D2QA 1F52A 1CJEA 4JQWC 4N58A 5BMIA 1QLBB 3M3JA 4G11A 1SE4A 5HKHA 1UGMA 1RAXA 2ZJDA 2FIFA 2HTHA 3JW0X 1WJ6A 2DENB 4XC2A 2NMQA 2IY1B 4W9HA 4WJNA 5C1ZA 3B0AA 1SGHA 2FNJB 4NAWA 4HK2A 2ZW0A 1SSNA 1R4NI 3RFZB 3KYCD 2SEBD 1GG3A 1V86A 4WQOB 1TKGA 3VQIA 1XF5L 1TY0A 4NQKE 2BS3B 1ZGUB 3IXSA 4PT5A 2W82A 4DHZE 3M62B 5FK9C 4HVBA 3BYYB 2KWCA 3PPAA 2G9HD 3AE1B 3Q69A 2JY6A 2O6VB 4ARIA 4TSSA 1AARA 2KQ4X 5E6OA 4IUMB 2E6XA 1N5XA 1D4BA 3PZ8A 2K6DB 2A4ZA 4HDOA 1KF6B 1ET9A 3TEXA 2LGYA 4O1NA 3H9DA 1IGDA 2IDYA 1XT9B 3V05A 2GBNA 2DNFA 2ASQA 4FULA 1V8CA 2W9NA 1EU4A 3X23A 3VTUA 2D10A 2WXIA 1WYGA 5FR3A 1WGKA 2I38A 2FCQA 4BBNC 3TL5A 2WDTB 5JHBA 3UQBA 4MJSB 4DWFA 2CR5A 2DYOA 2DAJA 4AJYB 2KLCA 1AYFA 1QZEA 1WXVA 2WHIA 4EZJA 2MWSB 4I6PA 1K50A 4J6IA 2GBMA 1QILA 3N1YC 2GBRA 1GC7A 5LXIB 4MGZE 4W9KA 2RSUA 3CF6E 2MW5A 3WAOA 2J0KA 2Z59B 4M8NA 3EFCA 2L76A 3LXFA 1T0YA 2JUOA 1L4ZB 3AE5B 1F2RI 4YTNB 5D7GA 2W54A 5BYSA 2R61A 1VZ6A 3W1SA 2DBYA 4GSWA 1UGJA 2JZZA 2LXAA 1GB4A 1P7EA 4W9CA 4RGOS 2GOWA 3NZUA 4KKIA 3PZDA 4BVUC 2K3UA 2INPE 2W3SA 3HIZA 2MSED 5FKAC 1C78A 3IT6B 3AU4A 2WXLA 1WX8A 2W55A 3P4PB 1N61A 5C2TB 1KRHA 2K22A 2LHDA 4ICUA 1Y56A 4KGRA 3AE6B 2D5GA 4A90A 1OEYA 4YWGG 2IBIB 3PLVA 4TMAB 4LDTB 4OZBA 4AQ7A 4ZRJA 4OZAA 4ARCA 3EHVA 3UINB 1TKEA 2EELA 3NVYA 1OEYJ 4XE0A 4CQNA 1F0ZA 5G55A 1IP9A 1Z5SB 3QHTA 3BIID 2XNAC 1L6UA 1J7AA 3C8YA 3DVGY 3ECIA 2AQ3B 5MPOA 3KUCB 4LJPB 4EFOA 5D94A 3RI7C 4WJQA 3S2AA 4KGSA 1F9JA 3LJ3A 3M95A 1XLQA 3TBLD 1NI2A 2QHOA 2PTLA 3V60A 3W1SC 2AYOB 3Q8FA 2N9LA 2KVRA 3SFDB 3UQAA 4M0WA 1EU3A 1I4HA 3BINA 3CIRB 5DPTA 1WGRA 3FILA 3R66C 4A55A 2XEWA 2JT4B 2WU5B 3CMMB 4MM3B 4AWJA 1I4GA 2G45B 1WYWB 4YSYB 3EA6A 3DHGC 2PKOA 2WQYB 2KDFB 2K6QA 2REXA 4LJOB 3HM6X 1TIFA 1HXYD 1V5TA 2KQSA 3A1QA 3APFA 3AI5A 3AMZA 3U8ZA 1QOGA 3NZ3A 4II3B 4DHJB 3DPDA 2WX0A 1SE3A 2QC8A 4BKTA 1FIQA 1XCQL 3KWVA 1WGHA 2BPSA 4RF0A 4HROA 1PQSA 2XK5B 3GB1A 3ZNGC 3ZGZA 4PS3A 4HPLB 1T6BX 1OQRA 4OZCA 1R4MB 3LDZE 4JWUC 1LM8B 1YN5A 5EDSA 5AUKA 1VJKA 1ZE3D 2JYTA 1SIJA 4MELA 4L23A 1FO4A 1MVKA 1TS5A 1QT9A 3AE7B 3N1XC 4FBJB 2CHWA 3RYTA 2MBQA 4MSQB 1E7VA 4EE2A 3ZRFA 3UGBB 3IHPC 1YJ1A 4ZRKA 3TMPB 1C3TA 2JU6X 2I1JA 3L13A 2KDEB 5CTRC
chains in the Genus database with same CATH topology
2NVUI 2MX2A 3KW5B 4M0WB 2KO3A 4KV2A 2ZEQA 4RM8A 3UIOB 4WWOA 2XK5A 4E3CA 2KJHB 3AU5A 4B95A 4EZKA 2NBWB 4G0NB 2O2VB 3VHTC 3WAMA 2RGFA 3A9KB 2KTFA 3N32A 4ASWC 3JSVA 1WXAA 4GDKA 4TQ0A 2IO0B 3RUIB 1UBQA 4F8CB 4MDKE 4HCPB 2MBBB 4CHKA 2G4DB 2JVCA 4NQLB 2IZVB 1NBFC 1WJUA 3DQVA 3ML9A 4AJWA 1EF5A 4XX5A 3WA0A 4ANXA 3WIMA 2DZJA 3UF8A 3VVWB 2KLGA 4BKSA 2ZCBA 2LI5A 4II2B 3QJZA 3VDZA 2KFKA 4FJYA 1TTNA 2BF8B 3AULA 3DOWA 1V80A 3NOBA 4BKGA 4KSLC 1KOTA 5JH5C 2G4SA 2JPHA 2EMTA 3QQ8B 2V4LA 3PTFC 4W9DA 3TIXA 4IW0A 3K9OB 2GBJA 3SU8X 1WZ3A 4I6NB 2R2QA 3A1QB 2JXXA 1A5RA 2FCSA 1UZXB 2LVOA 2O6VA 2DX5B 3QA8A 3KUDB 3A9JB 4OVVA 3L54A 1WMHB 3DBHI 2KMAA 2OOBB 2J7QB 4E71A 1D3ZA 2MBOA 1YQBA 3DBLI 1VCBA 3RULA 1WE6A 2Z0EB 3WAPA 2KK8A 2A5UA 4FLHA 1GUAB 2MBHA 1FXTB 2L8JA 3ZKJC 2LZ6A 2MBEA 2M0XA 1Q5WB 3NY5A 1YX5B 3RT3B 1OGWA 4WWNA 2LD9A 4EKUA 3KYDD 3I3TB 4F7ZA 4IM0A 1KM7A 4MEMA 4OVUA 3H7PA 3KH0A 1L7YA 4GN1A 1V81A 4GDLA 2KTRA 2AEHA 2DYMA 1V2YA 2D07B 1P98A 2FIDA 3DVNU 4P7IA 3ZDTA 4HCNB 4W9EA 3V6EB 4CYEA 3PLUA 2M4NA 3CSTA 1R4MI 2N4FA 4TKNA 2D2QA 2IYDB 4IWOA 4GGQA 4PYUA 5TR5A 2AWTA 2KD0A 4JQWC 3APDA 3QCAA 4W9JA 4E74A 3PHXB 3PREA 4MJSA 5FR6A 4FADA 2KJRA 4IWPA 2MP2A 3M3JA 3T9LA 4URKA 1RLFA 4G11A 4A20A 3A9JA 5HKHA 3OLMD 3QK0A 3Q3FA 4GIVA 1UGMA 1RAXA 2C7NB 3GZNI 3H1UA 1ZKHA 3PS6A 2N1WA 3H6NA 4G50A 4IM3A 2KOXA 4HLEA 2ZJDA 5DCNA 1J0GA 2C7MB 2FIFA 3R7QA 2HTHA 4KZCA 3JW0X 1LFDA 1WJ6A 2DENB 2KWUB 2GBKA 4JLCA 1H8CA 3JYUA 4MGIE 3V61A 3Q3JA 4NJ7A 4DDID 2GMIC 3A4RA 2D11A 4LCDE 3VTVA 4XC2A 3OJ3A 2IY1B 2O6VD 3PSEB 2K8CA 3JSVB 1S1QB 4GDKB 2I1KA 4MGYE 1E8ZA 4GMVA 2C9WB 2PPHA 4W9HA 1V49A 4WJNA 3B0AA 2CKHB 4W9GA 3ZNZB 1SGHA 2FNJB 4NAWA 4FA6A 3KUZA 2KXJA 2D3GA 4HK2A 2PJHA 4KZ0A 4EZLA 5KHQA 2KNBA 1R4NI 1WR1A 3VUXA 4IC7B 2G3QB 2HD5B 2JWZA 3KYCD 4NY0A 1GG3A 3C0RB 3QARA 4G3XB 1P9DU 1V86A 4WQOB 3VQIA 4RMAA 2MLBA 3SHQA 1UH6A 1V5OA 2KFKB 3V6CB 4F1SA 2CS4A 4NQKE 1ZGUB 3IG3A 4FHJA 4KDIC 5J2RA 2KC2A 2PE6B 4DHZE 3IVFA 2ZVOA 3M62B 4BOZB 4HVBA 1K8RB 4A3OA 3O65B 4EEWA 4HXDA 4YL8A 5JZEB 1GC6A 2KWCA 3PPAA 2ZPYA 2JY6A 2O6VB 4W9FA 2KX3A 2N9PC 5CHFA 2FUHB 2KQ7A 1AARA 2K8HA 2LASA 1EF1A 1J19A 1GNUA 5CHWA 3PHWB 4IUMB 5E6OA 3U30A 2JRHA 1H4RA 4GU2A 1E5WA 1MG8A 2K6DB 2A4ZA 5CHVC 4HDOA 3QIJA 3QX1A 3CSFA 2LGYA 4K7WA 4ANUA 3H9DA 3ZIMA 5CX3A 1XT9B 2VRRB 3H7PB 2GBNA 1JRUA 4GDLB 2ASQA 2KTRB 5AZFA 4FULA 5E6NA 1WIAA 2HJ8A 3ZRCA 2MRPA 2W9NA 3X23A 1OQYA 3VTUA 2D10A 4B6WA 1V9JA 3NS8A 3VXWA 2FAZA 2FCQA 4BBNC 3TL5A 4PS8A 3ZTDA 2WDTB 5JHBA 2KWVB 3UQBA 4KDLB 4MJSB 4DWFA 2MP2B 5IA7A 2CR5A 3SDLC 2DYOA 2DAJA 4AJYB 1Y8RC 2KLCA 2N9XA 1QZEA 1Q1OA 1WXVA 4EOYA 2YVCA 5AEKB 4AOFA 4EZJA 2MWSB 4I6PA 2ZVNA 2IO2B 4GXBA 4J6IA 1EO6A 2GBMA 3PRZA 4FN2A 2KZRA 3QWZB 2GBRA 1GC7A 3ZNID 5LXIB 2N9EB 4MGZE 4W9KA 1VD2A 1RRBA 5DPRA 2KHWB 2Y5BB 3ZVVA 2RSUA 3BY4B 4ANVA 3VTWA 3VH3B 3CF6E 3HHMA 4I6LB 4NAWB 3WALA 2MW5A 1WRDB 3WAOA 1M94A 4IG7B 4B9KA 2J0KA 2Z59B 1G6JA 3ENEA 4M8NA 4JL9A 2J0JA 4PYZA 2L76A 2NPTA 5C1ZA 2BYVE 1T0YA 2JUOA 3IBEA 4BFRA 5D7GA 2PEAA 3VUWA 3W1YA 5L95C 5LLIA 1WXMA 1WJNA 2LGXA 1YIWA 2NBUA 3W1SA 1WM3A 3MJWA 1LXDA 4JGHB 5AZHA 4GSWA 4A3PA 1IPGA 3R3MA 3EFUA 2JZZA 3HM3A 3PV1A 4IWQA 2LXAA 4KIKA 4LDTD 4MM3A 3B08A 5J18A 1WF9A 3DVGX 1TGZB 4K7SA 1GJZA 3L08A 4W9CA 2GOWA 2DYBA 3NZUA 4NNJB 3PZDA 2WYQA 4BVUC 2L00B 1IYFA 2CHZA 2B3AA 2J0MA 3PVLA 4FHKA 4MSMB 2CU1A 3HIZA 4WJPA 2UWQA 2LWPA 2MSED 1L2NA 1P1AA 4ZDVA 2K1FA 2HE7A 2YLMA 4DBGA 1TZ1A 3AU4A 2MA9B 4AP4C 1HE8A 1WX8A 2RD0A 3N30A 2DZIA 1NDDA 3KVFB 4ICVA 5AZGA 1WY8A 4WAAA 3JVZX 3V62A 4AUQC 2R2OA 2BKFA 3RCZA 1SE9A 2KDIA 3PRMB 4IM2A 4K1RB 4XZ4A 1WFYA 4ICUA 1WX7A 2WWZA 2KJ6A 4ANWA 2LRUA 2BYFA 1I42A 3MTNB 1I35A 1OEYA 2IBIB 3PLVA 2KFJA 4K81A 2K25A 4LDTB 3T8MA 1ZW7A 2LVPA 4ZRJA 1EUVB 2IO1B 1KJTA 4RM9A 2L05A 2BYEA 2BWFA 3DCGA 3EHVA 3UINB 3APCA 4BBNF 2NCNA 1WH3A 3ML8A 3U7DA 3NHEB 1OEYJ 3DBRI 3ZW3A 2EMSA 3DVNV 5G55A 4DXAB 1IP9A 1Z5SB 3QHTA 4BKSD 2KC1A 2PE9A 3EECA 4KSKC 4DDGD 4W9IA 5E6PA 2RR9A 3WANA 3PGEA 3DVGY 2ZPNA 3DDCB 3ECIA 4GB9A 3UIPB 1P0RA 2K39A 2UYZB 4ZRIA 3AXCA 3KUCB 3NZSA 4LJPB 1WX9A 4EFOA 5D94A 1E8WA 2LUEA 4WJQA 3S2AA 2LXCA 1ISNA 1SIFA 2OJRA 1F9JA 3ALBA 3LJ3A 3M95A 3TBLD 2M1MA 3ZTCA 1NI2A 2QHOA 4BOSC 4K7UA 5LXHA 3V60A 2M8SA 3B1LX 3VH4B 2AYOB 3W1SC 5DPSA 3VFKA 2NPTB 3RZWC 2BGFA 2KVRA 3A4SC 1WR6E 3L17A 4NPNA 3ZDMC 3DBSA 2NBVB 3ZO5B 5L83A 3UQAA 4FJVB 4N9F4 3ZNHB 2JRIB 3BINA 2AL6A 3QC8B 2KX0A 3RZFA 5JHAA 3L16A 5DPTA 3L0WB 1WGRA 2BWES 2O2VA 3A9KA 5D2MB 3R66C 3RD2A 4TQ1A 4DHZB 3ONSA 1Z2MA 2XEWA 2KDBA 2N7DA 3GOEA 3IFWB 4DHJD 1C1YB 2JT4B 2WX1A 3QAQA 4KIKB 1UBIA 3CMMB 4AWJA 2EKEC 3PT2B 1WJ4A 4MH0E 3TJPA 1E90A 4NJ6A 2IO3B 4TUUA 2G45B 1WGGA 1WE7A 1WYWB 2CHXA 3ZUNA 3R7RA 3K9PB 3MHSD 1E8YA 1CMXB 1XD3B 3VUYA 1BT0A 3OAWA 1S3SG 2KDFB 2K6QA 4CO7A 5J17A 2REXA 4ZYNA 3HK0A 4LJOB 1YX6B 1KLVA 3HM6X 1WM2A 1WI0A 5IAAC 2DZKA 1V6EA 2AL3A 3H7SA 4JIOU 1Q0WB 4EUTA 2L0FA 2BKRB 1V5TA 2M17A 2KQSA 3A1QA 3EC8A 3APFA 1J8CA 2K8BA 4MGKE 2NS5A 3AI5A 2V3SA 2C60A 3U8ZA 2L0TA 1TBEA 2LRWA 1YD8U 4II3B 1WMHA 2C5LC 2ZZPB 4WJOA 2N7EA 4WWPA 3TCAA 2KN5A 4DHJB 3DPDA 2WX0A 3N3KB 3OJ4B 1LQBA 5BO4B 2JF5A 3M63B 4HWIB 4BKTA 3VAWA 1RFAA 1WXSA 2LVQA 4M8MA 3A33B 4TV3A 1WGHA 4X57B 1OTRB 2BPSA 3PRPB 1PQSA 4FJZA 5DPWA 2XK5B 3ZNGC 1WZ0A 4PS3A 2KMCA 4HPLB 4PS7A 2LGDA 1XQQA 3LDZE 2XBBC 2ZNVC 1LM8B 1X1MA 2DAFA 1UD7A 4W9LA 5EDSA 2IY0B 2KKCA 2RPQA 1WGYA 2Z0DB 4HPMB 1UELA 2L7RA 4MELA 1E7UA 1U4AA 5D6JB 2KANA 3L10B 2FCNA 4KVGB 2N1VA 5G2NA 2MQJA 4FBJB 2CHWA 5GMVA 2DHZA 2MCNB 2V1YA 3RYTA 2MBQA 1WGDA 3D32A 2FCMA 4DK5A 4MSQB 1E7VA 2C7HA 4HDQA 5C23A 2LJ5A 2L3ZA 2ZNVB 2ZCCA 3ZLZA 3UGBB 3ZRFA 2JZ3B 1P3QU 1E8XA 3IHPC 1YJ1A 2NR2A 4HJKA 3P2BA 3SD5A 4ZRKA 5KHOA 3X0WA 4GOCA 3TMPB 1C3TA 2DZMA 2I1JA 3L13A 2KDEB 5CTRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVU I;  2MX2 A;  3KW5 B;  4M0W B;  2KO3 A;  4KV2 A;  2ZEQ A;  4RM8 A;  3UIO B;  4WWO A;  2XK5 A;  4E3C A;  2KJH B;  3AU5 A;  4B95 A;  4EZK A;  2NBW B;  4G0N B;  2O2V B;  3VHT C;  3WAM A;  2RGF A;  3A9K B;  2KTF A;  3N32 A;  4ASW C;  3JSV A;  1WXA A;  4GDK A;  4TQ0 A;  2IO0 B;  3RUI B;  1UBQ A;  4F8C B;  4MDK E;  4HCP B;  2MBB B;  4CHK A;  2G4D B;  2JVC A;  4NQL B;  2IZV B;  1NBF C;  1WJU A;  3DQV A;  3ML9 A;  4AJW A;  1EF5 A;  4XX5 A;  3WA0 A;  4ANX A;  3WIM A;  2DZJ A;  3UF8 A;  3VVW B;  2KLG A;  4BKS A;  2ZCB A;  2LI5 A;  4II2 B;  3QJZ A;  3VDZ A;  2KFK A;  4FJY A;  1TTN A;  2BF8 B;  3AUL A;  3DOW A;  1V80 A;  3NOB A;  4BKG A;  4KSL C;  1KOT A;  5JH5 C;  2G4S A;  2JPH A;  2EMT A;  3QQ8 B;  2V4L A;  3PTF C;  4W9D A;  3TIX A;  4IW0 A;  3K9O B;  2GBJ A;  3SU8 X;  1WZ3 A;  4I6N B;  2R2Q A;  3A1Q B;  2JXX A;  1A5R A;  2FCS A;  1UZX B;  2LVO A;  2O6V A;  2DX5 B;  3QA8 A;  3KUD B;  3A9J B;  4OVV A;  3L54 A;  1WMH B;  3DBH I;  2KMA A;  2OOB B;  2J7Q B;  4E71 A;  1D3Z A;  2MBO A;  1YQB A;  3DBL I;  1VCB A;  3RUL A;  1WE6 A;  2Z0E B;  3WAP A;  2KK8 A;  2A5U A;  4FLH A;  1GUA B;  2MBH A;  1FXT B;  2L8J A;  3ZKJ C;  2LZ6 A;  2MBE A;  2M0X A;  1Q5W B;  3NY5 A;  1YX5 B;  3RT3 B;  1OGW A;  4WWN A;  2LD9 A;  4EKU A;  3KYD D;  3I3T B;  4F7Z A;  4IM0 A;  1KM7 A;  4MEM A;  4OVU A;  3H7P A;  3KH0 A;  1L7Y A;  4GN1 A;  1V81 A;  4GDL A;  2KTR A;  2AEH A;  2DYM A;  1V2Y A;  2D07 B;  1P98 A;  2FID A;  3DVN U;  4P7I A;  3ZDT A;  4HCN B;  4W9E A;  3V6E B;  4CYE A;  3PLU A;  2M4N A;  3CST A;  1R4M I;  2N4F A;  4TKN A;  2D2Q A;  2IYD B;  4IWO A;  4GGQ A;  4PYU A;  5TR5 A;  2AWT A;  2KD0 A;  4JQW C;  3APD A;  3QCA A;  4W9J A;  4E74 A;  3PHX B;  3PRE A;  4MJS A;  5FR6 A;  4FAD A;  2KJR A;  4IWP A;  2MP2 A;  3M3J A;  3T9L A;  4URK A;  1RLF A;  4G11 A;  4A20 A;  3A9J A;  5HKH A;  3OLM D;  3QK0 A;  3Q3F A;  4GIV A;  1UGM A;  1RAX A;  2C7N B;  3GZN I;  3H1U A;  1ZKH A;  3PS6 A;  2N1W A;  3H6N A;  4G50 A;  4IM3 A;  2KOX A;  4HLE A;  2ZJD A;  5DCN A;  1J0G A;  2C7M B;  2FIF A;  3R7Q A;  2HTH A;  4KZC A;  3JW0 X;  1LFD A;  1WJ6 A;  2DEN B;  2KWU B;  2GBK A;  4JLC A;  1H8C A;  3JYU A;  4MGI E;  3V61 A;  3Q3J A;  4NJ7 A;  4DDI D;  2GMI C;  3A4R A;  2D11 A;  4LCD E;  3VTV A;  4XC2 A;  3OJ3 A;  2IY1 B;  2O6V D;  3PSE B;  2K8C A;  3JSV B;  1S1Q B;  4GDK B;  2I1K A;  4MGY E;  1E8Z A;  4GMV A;  2C9W B;  2PPH A;  4W9H A;  1V49 A;  4WJN A;  3B0A A;  2CKH B;  4W9G A;  3ZNZ B;  1SGH A;  2FNJ B;  4NAW A;  4FA6 A;  3KUZ A;  2KXJ A;  2D3G A;  4HK2 A;  2PJH A;  4KZ0 A;  4EZL A;  5KHQ A;  2KNB A;  1R4N I;  1WR1 A;  3VUX A;  4IC7 B;  2G3Q B;  2HD5 B;  2JWZ A;  3KYC D;  4NY0 A;  1GG3 A;  3C0R B;  3QAR A;  4G3X B;  1P9D U;  1V86 A;  4WQO B;  3VQI A;  4RMA A;  2MLB A;  3SHQ A;  1UH6 A;  1V5O A;  2KFK B;  3V6C B;  4F1S A;  2CS4 A;  4NQK E;  1ZGU B;  3IG3 A;  4FHJ A;  4KDI C;  5J2R A;  2KC2 A;  2PE6 B;  4DHZ E;  3IVF A;  2ZVO A;  3M62 B;  4BOZ B;  4HVB A;  1K8R B;  4A3O A;  3O65 B;  4EEW A;  4HXD A;  4YL8 A;  5JZE B;  1GC6 A;  2KWC A;  3PPA A;  2ZPY A;  2JY6 A;  2O6V B;  4W9F A;  2KX3 A;  2N9P C;  5CHF A;  2FUH B;  2KQ7 A;  1AAR A;  2K8H A;  2LAS A;  1EF1 A;  1J19 A;  1GNU A;  5CHW A;  3PHW B;  4IUM B;  5E6O A;  3U30 A;  2JRH A;  1H4R A;  4GU2 A;  1E5W A;  1MG8 A;  2K6D B;  2A4Z A;  5CHV C;  4HDO A;  3QIJ A;  3QX1 A;  3CSF A;  2LGY A;  4K7W A;  4ANU A;  3H9D A;  3ZIM A;  5CX3 A;  1XT9 B;  2VRR B;  3H7P B;  2GBN A;  1JRU A;  4GDL B;  2ASQ A;  2KTR B;  5AZF A;  4FUL A;  5E6N A;  1WIA A;  2HJ8 A;  3ZRC A;  2MRP A;  2W9N A;  3X23 A;  1OQY A;  3VTU A;  2D10 A;  4B6W A;  1V9J A;  3NS8 A;  3VXW A;  2FAZ A;  2FCQ A;  4BBN C;  3TL5 A;  4PS8 A;  3ZTD A;  2WDT B;  5JHB A;  2KWV B;  3UQB A;  4KDL B;  4MJS B;  4DWF A;  2MP2 B;  5IA7 A;  2CR5 A;  3SDL C;  2DYO A;  2DAJ A;  4AJY B;  1Y8R C;  2KLC A;  2N9X A;  1QZE A;  1Q1O A;  1WXV A;  4EOY A;  2YVC A;  5AEK B;  4AOF A;  4EZJ A;  2MWS B;  4I6P A;  2ZVN A;  2IO2 B;  4GXB A;  4J6I A;  1EO6 A;  2GBM A;  3PRZ A;  4FN2 A;  2KZR A;  3QWZ B;  2GBR A;  1GC7 A;  3ZNI D;  5LXI B;  2N9E B;  4MGZ E;  4W9K A;  1VD2 A;  1RRB A;  5DPR A;  2KHW B;  2Y5B B;  3ZVV A;  2RSU A;  3BY4 B;  4ANV A;  3VTW A;  3VH3 B;  3CF6 E;  3HHM A;  4I6L B;  4NAW B;  3WAL A;  2MW5 A;  1WRD B;  3WAO A;  1M94 A;  4IG7 B;  4B9K A;  2J0K A;  2Z59 B;  1G6J A;  3ENE A;  4M8N A;  4JL9 A;  2J0J A;  4PYZ A;  2L76 A;  2NPT A;  5C1Z A;  2BYV E;  1T0Y A;  2JUO A;  3IBE A;  4BFR A;  5D7G A;  2PEA A;  3VUW A;  3W1Y A;  5L95 C;  5LLI A;  1WXM A;  1WJN A;  2LGX A;  1YIW A;  2NBU A;  3W1S A;  1WM3 A;  3MJW A;  1LXD A;  4JGH B;  5AZH A;  4GSW A;  4A3P A;  1IPG A;  3R3M A;  3EFU A;  2JZZ A;  3HM3 A;  3PV1 A;  4IWQ A;  2LXA A;  4KIK A;  4LDT D;  4MM3 A;  3B08 A;  5J18 A;  1WF9 A;  3DVG X;  1TGZ B;  4K7S A;  1GJZ A;  3L08 A;  4W9C A;  2GOW A;  2DYB A;  3NZU A;  4NNJ B;  3PZD A;  2WYQ A;  4BVU C;  2L00 B;  1IYF A;  2CHZ A;  2B3A A;  2J0M A;  3PVL A;  4FHK A;  4MSM B;  2CU1 A;  3HIZ A;  4WJP A;  2UWQ A;  2LWP A;  2MSE D;  1L2N A;  1P1A A;  4ZDV A;  2K1F A;  2HE7 A;  2YLM A;  4DBG A;  1TZ1 A;  3AU4 A;  2MA9 B;  4AP4 C;  1HE8 A;  1WX8 A;  2RD0 A;  3N30 A;  2DZI A;  1NDD A;  3KVF B;  4ICV A;  5AZG A;  1WY8 A;  4WAA A;  3JVZ X;  3V62 A;  4AUQ C;  2R2O A;  2BKF A;  3RCZ A;  1SE9 A;  2KDI A;  3PRM B;  4IM2 A;  4K1R B;  4XZ4 A;  1WFY A;  4ICU A;  1WX7 A;  2WWZ A;  2KJ6 A;  4ANW A;  2LRU A;  2BYF A;  1I42 A;  3MTN B;  1I35 A;  1OEY A;  2IBI B;  3PLV A;  2KFJ A;  4K81 A;  2K25 A;  4LDT B;  3T8M A;  1ZW7 A;  2LVP A;  4ZRJ A;  1EUV B;  2IO1 B;  1KJT A;  4RM9 A;  2L05 A;  2BYE A;  2BWF A;  3DCG A;  3EHV A;  3UIN B;  3APC A;  4BBN F;  2NCN A;  1WH3 A;  3ML8 A;  3U7D A;  3NHE B;  1OEY J;  3DBR I;  3ZW3 A;  2EMS A;  3DVN V;  5G55 A;  4DXA B;  1IP9 A;  1Z5S B;  3QHT A;  4BKS D;  2KC1 A;  2PE9 A;  3EEC A;  4KSK C;  4DDG D;  4W9I A;  5E6P A;  2RR9 A;  3WAN A;  3PGE A;  3DVG Y;  2ZPN A;  3DDC B;  3ECI A;  4GB9 A;  3UIP B;  1P0R A;  2K39 A;  2UYZ B;  4ZRI A;  3AXC A;  3KUC B;  3NZS A;  4LJP B;  1WX9 A;  4EFO A;  5D94 A;  1E8W A;  2LUE A;  4WJQ A;  3S2A A;  2LXC A;  1ISN A;  1SIF A;  2OJR A;  1F9J A;  3ALB A;  3LJ3 A;  3M95 A;  3TBL D;  2M1M A;  3ZTC A;  1NI2 A;  2QHO A;  4BOS C;  4K7U A;  5LXH A;  3V60 A;  2M8S A;  3B1L X;  3VH4 B;  2AYO B;  3W1S C;  5DPS A;  3VFK A;  2NPT B;  3RZW C;  2BGF A;  2KVR A;  3A4S C;  1WR6 E;  3L17 A;  4NPN A;  3ZDM C;  3DBS A;  2NBV B;  3ZO5 B;  5L83 A;  3UQA A;  4FJV B;  4N9F 4;  3ZNH B;  2JRI B;  3BIN A;  2AL6 A;  3QC8 B;  2KX0 A;  3RZF A;  5JHA A;  3L16 A;  5DPT A;  3L0W B;  1WGR A;  2BWE S;  2O2V A;  3A9K A;  5D2M B;  3R66 C;  3RD2 A;  4TQ1 A;  4DHZ B;  3ONS A;  1Z2M A;  2XEW A;  2KDB A;  2N7D A;  3GOE A;  3IFW B;  4DHJ D;  1C1Y B;  2JT4 B;  2WX1 A;  3QAQ A;  4KIK B;  1UBI A;  3CMM B;  4AWJ A;  2EKE C;  3PT2 B;  1WJ4 A;  4MH0 E;  3TJP A;  1E90 A;  4NJ6 A;  2IO3 B;  4TUU A;  2G45 B;  1WGG A;  1WE7 A;  1WYW B;  2CHX A;  3ZUN A;  3R7R A;  3K9P B;  3MHS D;  1E8Y A;  1CMX B;  1XD3 B;  3VUY A;  1BT0 A;  3OAW A;  1S3S G;  2KDF B;  2K6Q A;  4CO7 A;  5J17 A;  2REX A;  4ZYN A;  3HK0 A;  4LJO B;  1YX6 B;  1KLV A;  3HM6 X;  1WM2 A;  1WI0 A;  5IAA C;  2DZK A;  1V6E A;  2AL3 A;  3H7S A;  4JIO U;  1Q0W B;  4EUT A;  2L0F A;  2BKR B;  1V5T A;  2M17 A;  2KQS A;  3A1Q A;  3EC8 A;  3APF A;  1J8C A;  2K8B A;  4MGK E;  2NS5 A;  3AI5 A;  2V3S A;  2C60 A;  3U8Z A;  2L0T A;  1TBE A;  2LRW A;  1YD8 U;  4II3 B;  1WMH A;  2C5L C;  2ZZP B;  4WJO A;  2N7E A;  4WWP A;  3TCA A;  2KN5 A;  4DHJ B;  3DPD A;  2WX0 A;  3N3K B;  3OJ4 B;  1LQB A;  5BO4 B;  2JF5 A;  3M63 B;  4HWI B;  4BKT A;  3VAW A;  1RFA A;  1WXS A;  2LVQ A;  4M8M A;  3A33 B;  4TV3 A;  1WGH A;  4X57 B;  1OTR B;  2BPS A;  3PRP B;  1PQS A;  4FJZ A;  5DPW A;  2XK5 B;  3ZNG C;  1WZ0 A;  4PS3 A;  2KMC A;  4HPL B;  4PS7 A;  2LGD A;  1XQQ A;  3LDZ E;  2XBB C;  2ZNV C;  1LM8 B;  1X1M A;  2DAF A;  1UD7 A;  4W9L A;  5EDS A;  2IY0 B;  2KKC A;  2RPQ A;  1WGY A;  2Z0D B;  4HPM B;  1UEL A;  2L7R A;  4MEL A;  1E7U A;  1U4A A;  5D6J B;  2KAN A;  3L10 B;  2FCN A;  4KVG B;  2N1V A;  5G2N A;  2MQJ A;  4FBJ B;  2CHW A;  5GMV A;  2DHZ A;  2MCN B;  2V1Y A;  3RYT A;  2MBQ A;  1WGD A;  3D32 A;  2FCM A;  4DK5 A;  4MSQ B;  1E7V A;  2C7H A;  4HDQ A;  5C23 A;  2LJ5 A;  2L3Z A;  2ZNV B;  2ZCC A;  3ZLZ A;  3UGB B;  3ZRF A;  2JZ3 B;  1P3Q U;  1E8X A;  3IHP C;  1YJ1 A;  2NR2 A;  4HJK A;  3P2B A;  3SD5 A;  4ZRK A;  5KHO A;  3X0W A;  4GOC A;  3TMP B;  1C3T A;  2DZM A;  2I1J A;  3L13 A;  2KDE B;  5CTR C; 
#chains in the Genus database with same CATH topology
 1KFY B;  2NVU I;  2KDM A;  2XK5 A;  2WXJ A;  4G0N B;  2O2V B;  3BVG A;  3A9K B;  3JSV A;  1KH0 A;  3DQV A;  4AJW A;  2WXF A;  3AED B;  3WIM A;  2L1A A;  3UF8 A;  2KLG A;  3Q8E A;  2ZCB A;  2BS4 B;  1E10 A;  3NOB A;  1VZ8 A;  2G1E A;  1UNS A;  2G4S A;  5EE3 A;  3PTF C;  4MAC A;  2GBJ A;  2M0A A;  4NJC A;  4K3B A;  5BYR A;  4WH4 A;  4OVV A;  4OW0 A;  1D3Z A;  2HDE A;  1YQB A;  1VCB A;  3U7Z A;  1JQ4 A;  3UI3 A;  2MBE A;  3DBR B;  1OGW A;  4WWN A;  2LD9 A;  3AB5 A;  1PGX A;  4IM0 A;  2V3N A;  1V81 A;  2AEH A;  4WIP A;  3BK1 A;  3V6E B;  1DGJ A;  2BBC A;  3PLU A;  1R4M I;  2N4F A;  4IWO A;  2WXP A;  2PLP A;  4W9J A;  4E74 A;  4FAD A;  3AEE B;  2JQR B;  4IWP A;  2MP2 A;  3T9L A;  4URK A;  1RLF A;  4A20 A;  4ZHO A;  1IBX B;  3OLM D;  4GIV A;  3Q3F A;  4C7Z A;  4EKU A;  1T5X D;  2N1W A;  1YMH E;  2VZK D;  2KOX A;  4HLE A;  1GPX A;  5DCN A;  1J0G A;  2C7M B;  3R7Q A;  2KWU B;  3I5J C;  1STE A;  4JLC A;  1YQ3 B;  3A4R A;  4LCD E;  4XGA B;  1WWT A;  2K8C A;  4MGY E;  1IGC A;  3NUH B;  4LNI A;  3KUZ A;  2KXJ A;  5KHQ A;  1I4P A;  1WR1 A;  4IC7 B;  2JWZ A;  4NY0 A;  2TSS A;  3C0R B;  3QAR A;  4G3X B;  4P6V F;  2RPV A;  1C79 A;  3SHQ A;  2BT6 A;  1QOF A;  3IG3 A;  1JCK B;  4FHJ A;  2PE6 B;  4A3O A;  2LFI A;  3BK2 A;  1V1P B;  5JZE B;  1GC6 A;  2ZPY A;  4FXC A;  2H88 B;  2IPK D;  2KX3 A;  5IKC M;  2FUH B;  1UWX A;  4LNK A;  2LAS A;  5CHW A;  4GU2 A;  1DOI A;  4L1B A;  1MG8 A;  2SAK A;  3QX1 A;  3NVW A;  4K7W A;  2FBW B;  4C7Y A;  3ZXR A;  5CX3 A;  3H7P B;  1ACC A;  2QEJ C;  1WIA A;  3ZRC A;  1DOX A;  2IND C;  4N59 A;  2V4I B;  2HTM E;  1V9J A;  3VXW A;  4J3O D;  3T3O A;  2FAZ A;  3FAH A;  1V1P A;  4PS8 A;  4LNN A;  3AEF B;  3SDL C;  2BYT A;  2J53 A;  2UU7 A;  3B9J A;  2N9X A;  2VH1 A;  4EOY A;  4AOF A;  4C80 A;  2ONQ A;  1M4V A;  1FNU A;  1VDV A;  4FN2 A;  4ITK A;  1JWB D;  1L0V B;  2N9E B;  1VD2 A;  1OFF A;  1RRB A;  2Y5B B;  3BY4 B;  4LLG M;  3VTW A;  4NAW B;  2N7J A;  5G5H A;  5HG2 A;  1D6E C;  1G6J A;  4S17 A;  3AE9 B;  2BYV E;  3TEW A;  4BFR A;  2MEK A;  2JSV X;  3O13 A;  5LLI A;  3RMK C;  1HZ6 A;  3GE8 C;  1YIW A;  1WM3 A;  3MJW A;  3Q3N C;  1N60 A;  1XCT L;  3N9Y C;  2WXR A;  4A3P A;  1YN3 A;  3R3M A;  3PV1 A;  2Y5P A;  3DBL B;  3NG0 A;  1TGZ B;  4K7S A;  4NNJ B;  2WYQ A;  1IYF A;  3SFE B;  2B3A A;  2J0M A;  4WJP A;  2PVO D;  4DBG A;  2WDV B;  2Y3A A;  4DXG A;  4R3D A;  1NDD A;  3KVF B;  1R7S A;  4WAA A;  2WLB A;  3MJ5 A;  3U2S C;  4XZ4 A;  5H92 C;  2WWZ A;  4K3C A;  5JXV A;  2LRU A;  1OQQ A;  1I35 A;  4K81 A;  1ZUD 2;  2LVP A;  3LYY A;  1EUV B;  4RM9 A;  2BYE A;  2V3P A;  3DCG A;  2WXH A;  3ML8 A;  1WH3 A;  4HPP A;  1TT5 B;  3U7D A;  1PGB A;  5EE9 A;  3EEC A;  4W9I A;  1KLG D;  2PMV A;  2V0G A;  3UIP B;  3DDC B;  4GB9 A;  1P0R A;  3AXC A;  3PZ7 A;  1E8W A;  3URY A;  1SIF A;  1TKY A;  2J52 A;  3AE4 B;  2M1M A;  2KT7 A;  4K7U A;  3B1L X;  3RZW C;  3VR9 B;  5I4D A;  3ZDM C;  3MC9 A;  2WDR B;  3ZO5 B;  2M56 B;  4N9F 4;  3ZNH B;  4RNA A;  1SF0 A;  3L16 A;  3L0W B;  1ZXH A;  5D2M B;  2BB5 A;  2WP9 B;  1T0S C;  2KAJ A;  3IFW B;  2WX1 A;  2LMC A;  3Q6B A;  1ENF A;  1K51 A;  1E90 A;  4USA A;  1NYQ A;  3P63 A;  3Q8C A;  1WE7 A;  2CHX A;  3ZUN A;  1ZPS A;  3W9C B;  1E8Y A;  2DLB A;  1XD3 B;  3AV8 A;  3BWU D;  3OWE B;  3RNF C;  5J17 A;  4ZYN A;  1TS4 A;  3HK0 A;  1YX6 B;  3ABV B;  1WI0 A;  4C56 C;  4JIO U;  1Q0W B;  2M17 A;  2WXN A;  3EC8 A;  1J8C A;  1CK1 A;  2V3S A;  4S0R A;  1XLO A;  5LNK 1;  3DBH B;  2MJ3 A;  4WJO A;  2N7E A;  1LQB A;  1JWM D;  4HWI B;  1RFA A;  4M8M A;  2LVQ A;  3R2I A;  4ZYS A;  1OTR B;  2IGG A;  5IN7 A;  1WZ0 A;  1DYQ A;  3I63 C;  2XBB C;  4YXD B;  2IY0 B;  2Z0D B;  1F2R C;  2L7R A;  4BZA A;  1KTK A;  2FCN A;  2MQJ A;  2DHZ A;  2MCN B;  1WGD A;  1E6E B;  3D32 A;  3GZN B;  4ZRQ A;  2D3C A;  2C7H A;  2L3Z A;  2K0P A;  2L83 A;  4HJK A;  2AX5 A;  1P3Q U;  3SD5 A;  3VR8 B;  5KHO A;  1C4A A;  4ACF A;  4M0W B;  2ZEQ A;  4E3C A;  4WWO A;  2KJH B;  2QIL A;  4B95 A;  4HJG E;  4EZK A;  1GOZ A;  4HKZ E;  3VHT C;  2RGF A;  2KTF A;  3FIL B;  4GDK A;  3RNE C;  1VZ7 A;  2D3A A;  4MDK E;  2X38 A;  2MBB B;  4CHK A;  2G4D B;  2JVC A;  1ESF A;  1NBF C;  1WJU A;  1XEE A;  3EGR A;  1TS3 A;  3L4P A;  2DZJ A;  3VVW B;  3TSS A;  4II2 B;  5C3J B;  3SEB A;  2KFK A;  2XN9 C;  1V80 A;  2CJO A;  4QAY A;  2D3B A;  2MHJ A;  3TIX A;  4W9D A;  4IW0 A;  3K9O B;  1JWA D;  1Q10 A;  1WZ3 A;  4I6N B;  3A1Q B;  3ZYY X;  2FCS A;  3J9C A;  1UZX B;  2LVO A;  4RCO A;  3A9J B;  3L54 A;  3DBH I;  2KMA A;  2MBO A;  2QJL A;  2KK8 A;  1J7B A;  2A5U A;  1GUA B;  3ZKJ C;  2GI9 A;  1YX5 B;  3I3T B;  4MEM A;  3KH0 A;  4GN1 A;  3AEA B;  1FXI A;  4GDL A;  2KTR A;  1V2Y A;  2FID A;  4CYE A;  3CST A;  4WAF A;  1RFK A;  4TKN A;  2LUM A;  4PYU A;  2AWT A;  2MJE A;  1PUT A;  3APD A;  3PHX B;  3PRE A;  5FR6 A;  2KJR A;  3A9J A;  4JWS C;  3PS6 A;  2C7N B;  3GZN I;  4G50 A;  1VR9 A;  4IM3 A;  2WU2 B;  4KZC A;  1LFD A;  1MG4 A;  2GBK A;  4YTM B;  2KYW A;  1H8C A;  3P4S B;  3Q3J A;  4NJ7 A;  1ZP0 B;  2GMI C;  4D2K A;  3OJ3 A;  1QKZ A;  5HI1 A;  1B1Z A;  4YT0 B;  1N6Z A;  3JSV B;  1S1Q B;  1E8Z A;  4GMV A;  1V49 A;  3ZNZ B;  4W9G A;  3AH7 A;  4KZ0 A;  2D3G A;  2PJH A;  1ZOY B;  3VUX A;  2G3Q B;  2QCZ A;  2X8X X;  3H8H A;  4KGT A;  2Y5C A;  3ETR A;  2AQ2 B;  1UH6 A;  1V5O A;  3V6C B;  4F1S A;  1L0X B;  2CS4 A;  3GP7 A;  1WXQ A;  1V97 A;  5HHD G;  3IVF A;  2ZVO A;  1K8R B;  2QDF A;  3O65 B;  4EEW A;  4HXD A;  4YL8 A;  2KWD A;  4WUR A;  3GS2 A;  5CHF A;  3TUO A;  2K8H A;  1J19 A;  1F1H A;  1N62 A;  1L0Y B;  3PHW B;  3U30 A;  2JRH A;  5CHV C;  3AE3 B;  1KLU D;  1YQ4 B;  2WNM A;  2K9X A;  3ZIM A;  2VRR B;  1JRU A;  5AZF A;  1L4D B;  5E6N A;  2HJ8 A;  1ZXI A;  4B6W A;  3C19 A;  3Q8B A;  1T0R C;  2MP2 B;  4JX1 C;  2K5P A;  3BVZ A;  4B0M A;  5BYQ A;  1Q1O A;  3DHI C;  2INC C;  5AEK B;  2IJ0 A;  2IO2 B;  4GXB A;  3PRZ A;  2ON8 A;  3QWZ B;  3T3N A;  2GRI A;  3RPF C;  2OJW A;  4ANV A;  4I6L B;  3ZJU A;  3BYT B;  4GLS C;  3ENE A;  2QSD A;  2J0J A;  2NPT A;  3U52 E;  2PEA A;  3W1Y A;  3AE8 B;  4OHJ A;  2HJ1 A;  2LGX A;  3OG5 A;  4NAM A;  2JYE A;  1QQR A;  1IPG A;  4KIK A;  2MJD A;  3B08 A;  3DVG X;  2OED A;  2L00 B;  2CHZ A;  3PVL A;  4MSM B;  4ZRP A;  2CU1 A;  1TY2 A;  4IOI E;  2LWP A;  2Z8L A;  4C4V A;  4MH8 A;  2K1F A;  2YLM A;  2MA9 B;  2J4X A;  2RD0 A;  2E3T A;  4RGN A;  3V62 A;  3JVZ X;  4AUQ C;  3RCZ A;  1SE9 A;  4ZOH C;  3PRM B;  4IM2 A;  4K1R B;  4ANW A;  1WFY A;  2KJ6 A;  3DWM A;  1I42 A;  3P42 A;  1E9M A;  3MTN B;  4Q2J A;  1HQR D;  2KFJ A;  2YEP F;  1N5W A;  1ZW7 A;  2IO1 B;  1SBB B;  4WWM A;  3RN9 C;  2J42 A;  3APC A;  1XXG A;  3W2D A;  5AUI A;  4BBN F;  3Q8A A;  2NCN A;  2RMM A;  1V1O A;  3DBR I;  1EWY C;  3ZW3 A;  2EKI A;  1I4R A;  3FKY A;  2KC1 A;  2PE9 A;  1JWS D;  4KSK C;  4US8 A;  5E6P A;  3E9S A;  1C9F A;  2RR9 A;  1HA5 A;  3PGE A;  1TS2 A;  5TSS A;  5D3D A;  2K39 A;  1YN4 A;  2UYZ B;  4ZRI A;  1HZ5 A;  1R4N B;  2RDG A;  1WX9 A;  4XYC A;  2NTT A;  2LUE A;  3MP9 A;  1NEK B;  2LXC A;  1ISN A;  2OJR A;  3ALB A;  2YEP B;  4BOS C;  2M8S A;  1IUE A;  3VH4 B;  5DPS A;  1BXT A;  2BGF A;  4NPN A;  3L17 A;  1WR6 E;  4NZL B;  3DBS A;  5IOI A;  1HTQ A;  4FJV B;  3RZF A;  2BWE S;  3RD2 A;  4TQ1 A;  4DHZ B;  1MI0 A;  3ONS A;  2N7D A;  3GOE A;  1C1Y B;  1UBI A;  2EKE C;  3PT2 B;  1WJ4 A;  3HVD A;  3TJP A;  2IO3 B;  1WGG A;  2LHE A;  2IGH A;  3MHS D;  1I4X A;  1MHH E;  1CMX B;  1DOY A;  1FCC C;  3OAW A;  3W5V B;  1S3S G;  4CO7 A;  3RNA C;  2L32 A;  5IAA C;  1VRA B;  3Q3O C;  4JPS A;  1V6E A;  2L0F A;  4HEA 1;  1C4C A;  3N20 C;  1I4Q A;  1EWC A;  4IDI A;  2K8B A;  2NS5 A;  1AN8 A;  4C00 A;  4XWW A;  1YD8 U;  1WMH A;  2ZZP B;  4WWP A;  2KVZ A;  3N3K B;  3OJ4 B;  2QMT A;  5HFY A;  3LB8 C;  5BO4 B;  2JF5 A;  3M63 B;  1PYW D;  3R2T A;  3A33 B;  4TV3 A;  4X57 B;  1NI3 A;  4A6Q A;  4PK1 A;  3NRZ A;  1C76 A;  4PS7 A;  2LGD A;  2WXM A;  2ZNV C;  1X1M A;  2DAF A;  1UD7 A;  4W9L A;  1L6V A;  3I57 A;  3L10 B;  2N1V A;  5GMV A;  1QOA A;  3DHH C;  4US9 A;  4DK5 A;  1GAQ B;  2NTS A;  2LJ5 A;  2JZ3 B;  3BVM A;  2NR2 A;  1T0Q C;  1RM6 C;  4GOC A;  4RGT A;  5TR5 A;  1TZO A;  3P4R B;  3KW5 B;  1K52 A;  2KO3 A;  3GE3 C;  3BZD B;  3AU5 A;  2NBW B;  4HRS A;  1E7P B;  3AM9 A;  1D5X C;  3WAM A;  3N32 A;  1WXA A;  3RUI B;  1UBQ A;  4F8C B;  4HCP B;  2CU3 A;  4P16 A;  2IZV B;  2KMM A;  1D5Z C;  3ML9 A;  3WA0 A;  4AS1 A;  4BKS A;  2LI5 A;  3VDZ A;  2BF8 B;  3AUL A;  4LTU A;  5JH5 C;  2JPH A;  2EMT A;  3QQ8 B;  2V4L A;  3DWG C;  3SU8 X;  4M00 A;  1A5R A;  2RDH A;  2O6V A;  2DX5 B;  3KUD B;  2J7Q B;  3DBL I;  4MT5 A;  2Z0E B;  1HTO A;  4XDD A;  4FLH A;  2WXG A;  2MBH A;  3AEC B;  2LZ6 A;  1TJE A;  3NY5 A;  4F7Z A;  2L52 A;  4OVU A;  1WSP A;  1YOV B;  1L7Y A;  2DYM A;  2D07 B;  4LNF A;  1SB3 C;  2PW9 A;  3TEY A;  1A70 A;  1CZP A;  4BAX A;  4ZHP A;  5BMG A;  2IYD B;  4GGQ A;  1YNT E;  2KD0 A;  1ROE A;  3QCA A;  4MJS A;  2FUG 1;  3NVV A;  3VRA B;  1JW9 D;  4BKS D;  3QK0 A;  5G2N A;  3Q3M C;  3H1U A;  5T8I A;  1ZKH A;  3H6N A;  3KQ4 A;  3JYU A;  2Q5W D;  3B2F A;  1JWU D;  1P7F A;  4MGI E;  3V61 A;  4DDI D;  3Q14 C;  2D11 A;  5IO9 A;  3VTV A;  1QF6 A;  3AEG B;  2KN4 A;  2O6V D;  3PSE B;  3KWL A;  4GDK B;  2I1K A;  2RDB C;  2C9W B;  2PPH A;  2CKH B;  4FA6 A;  4EZL A;  5E6J A;  2KNB A;  2JWU A;  2HD5 B;  1MJD A;  4RFB A;  1MPE A;  4YSZ B;  1P9D U;  3IT4 B;  4RMA A;  2MLB A;  2KFK B;  3NVZ A;  1FD6 A;  3HVZ A;  4KDI C;  5J2R A;  2KC2 A;  5GXG B;  3U4E G;  4BOZ B;  3EUB 2;  4A8X C;  3Q2A C;  1T3Q A;  2VH2 A;  1L5P A;  1RYJ A;  1PGA A;  4W9F A;  2N9P C;  2KQ7 A;  1EF1 A;  1GNU A;  2QIE B;  1H4R A;  3IAM 1;  1E5W A;  1LO5 D;  3ZJT A;  3P4Q B;  4RH6 A;  2OHF A;  3QIJ A;  3CSF A;  1I7H A;  4ANU A;  3I9V 1;  4GDL B;  2KTR B;  2BTE A;  2MRP A;  1JML A;  1OQY A;  3NS8 A;  2WS3 B;  1XLN A;  3ZQ4 A;  3B2G A;  3ZTD A;  4OVZ A;  2KWV B;  4KDL B;  4KKJ A;  1Y8R C;  1TYG B;  2YVC A;  1QOB A;  1MHX A;  2GB1 A;  2ZVN A;  1EO6 A;  1YJJ A;  2KZR A;  3ZNI D;  2MH7 A;  2FE8 A;  5DPR A;  4UDU C;  2KHW B;  3ZVV A;  4P1B C;  2LGS A;  3HHM A;  3VH3 B;  3WAL A;  1WRD B;  2BB6 A;  3RNG C;  4B0E A;  1M94 A;  4IG7 B;  4B9K A;  2GLS A;  4JL9 A;  3V3X A;  4PYZ A;  3ZJV A;  2LEK A;  1RWS A;  3IBE A;  1JRO A;  3VUW A;  2N0S B;  5L95 C;  4LNO A;  1J7C A;  1WXM A;  2V9H A;  1SE2 A;  1WJN A;  5EE0 A;  2NBU A;  1LXD A;  4JGH B;  5AZH A;  3EFU A;  3HM3 A;  4IWQ A;  4LDT D;  4MM3 A;  5J18 A;  1WF9 A;  1GJZ A;  3L08 A;  1AW7 A;  5G5G A;  2DYB A;  2KAC A;  4M01 A;  2WXQ A;  4IKG A;  4FHK A;  2LJI A;  1FEH A;  2UWQ A;  3MHZ A;  1E0Z A;  1L2N A;  3NS1 A;  1P1A A;  4ZDV A;  2HE7 A;  1TZ1 A;  4AP4 C;  1HE8 A;  2VZK B;  3N30 A;  3TEZ A;  3WCQ A;  2DZI A;  4YSX B;  4ICV A;  5AZG A;  1WY8 A;  1FNW A;  2R2O A;  2BKF A;  1PDX A;  2KDI A;  1ZDX A;  5IA7 A;  2H89 B;  1SXT A;  1WX7 A;  4HKQ A;  2BYF A;  1UWM A;  2K25 A;  3T8M A;  4RF1 A;  1NEN B;  1KJT A;  2L05 A;  2ICI A;  2BWF A;  3NHE B;  2EMS A;  2W3R A;  3DVN V;  3R8B A;  2BW2 A;  4DXA B;  1JAL A;  4DDG D;  1FRD A;  3WAN A;  1YJI A;  2ZPN A;  2ACZ B;  1SJH D;  1XO3 A;  3NZS A;  2INN E;  2WGS A;  3FC4 A;  1C4P A;  3VRB B;  4P1C C;  3HUI A;  2JXT A;  2N9K A;  1WRI A;  3ZTC A;  1BUI C;  5LXH A;  4H2A A;  3VFK A;  2NPT B;  3A4S C;  5H8Y E;  2NBV B;  5L83 A;  2CJN A;  4WQM A;  2JRI B;  2AL6 A;  3QC8 B;  2KX0 A;  5JHA A;  3IAS 1;  2O2V A;  3A9K A;  3AN1 A;  1GB1 A;  2PVG C;  1Z2M A;  2KDB A;  4DHJ D;  1FXA A;  4N6E B;  2WXK A;  1FMA D;  3QAQ A;  4KIK B;  4MH0 E;  3MC8 A;  4NJ6 A;  4TUU A;  4JE3 B;  2JZP A;  3E56 A;  3AE2 B;  1F77 A;  3R7R A;  3K9P B;  3VUY A;  4KX6 B;  1BT0 A;  3ZXV A;  2BVC A;  4C4V B;  1SJE D;  1KLV A;  1WM2 A;  4A9A A;  2DZK A;  1FFV A;  2AL3 A;  3H7S A;  5IP4 D;  4EUT A;  4RGM A;  2BKR B;  3PO0 A;  2BQQ A;  2BS2 B;  1JRP A;  1BML C;  2DWQ A;  2I2Y A;  4MGK E;  1AWD A;  2C60 A;  1LGR A;  2L0T A;  1TBE A;  2LRW A;  2C5L C;  3TCA A;  2KN5 A;  1ZDV A;  4LK0 M;  2ZW1 A;  3VAW A;  3NJT A;  1WXS A;  4REZ A;  3W5U B;  3PRP B;  4FJZ A;  5DPW A;  2IGD A;  1HEZ E;  2KMC A;  1XQQ A;  5D3I B;  2KKC A;  1CQV A;  1WGY A;  2RPQ A;  4HPM B;  4DQO C;  1UEL A;  1E7U A;  1U4A A;  5D6J B;  2KAN A;  1C77 A;  4KVG B;  2V1Y A;  1IBX A;  1EM7 A;  1B9R A;  1PFD A;  1UF0 A;  2FCM A;  4HDQ A;  5C23 A;  1K53 A;  1D5M C;  2ZNV B;  2ZCC A;  3ZLZ A;  1SEB D;  1E8X A;  3P2B A;  3X0W A;  3P1M A;  2DZM A;  2JX5 A;  2MX2 A;  4RM8 A;  3UIO B;  4KV2 A;  1FRR A;  1ET6 A;  1FM0 D;  4ASW C;  4TQ0 A;  1UUP A;  5EE1 A;  2IO0 B;  4XWT A;  4M02 A;  4NQL B;  2AQ1 B;  1EF5 A;  4XX5 A;  4ANX A;  2LGI A;  3KLS X;  3AEB B;  2B76 B;  3QJZ A;  4FJY A;  1MFW A;  1TTN A;  2WXO A;  3DOW A;  3N1Z C;  4BKG A;  4KSL C;  1KOT A;  3MFG A;  1NVI D;  3RNB C;  2R2Q A;  2JXX A;  1FPY A;  4YTP B;  3QA8 A;  3HRD D;  1WMH B;  2OOB B;  4E71 A;  4DXF A;  3RUL A;  1WE6 A;  3WAP A;  3MC0 B;  3SR6 A;  1FFU A;  1FXT B;  2L8J A;  2M0X A;  1Q5W B;  1FNV A;  4L2Y A;  3RT3 B;  1N63 A;  1NYR A;  2M19 A;  3KYD D;  3CWI A;  1KM7 A;  2WDQ B;  3H7P A;  2PIA A;  1P98 A;  1XLP A;  1VLB A;  3DVN U;  4P7I A;  3ZDT A;  4HCN B;  4W9E A;  4XDC A;  3RNC C;  2M4N A;  1FCL A;  5BMH A;  2D2Q A;  1F52 A;  1CJE A;  4JQW C;  4N58 A;  5BMI A;  1QLB B;  3M3J A;  4G11 A;  1SE4 A;  5HKH A;  1UGM A;  1RAX A;  2ZJD A;  2FIF A;  2HTH A;  3JW0 X;  1WJ6 A;  2DEN B;  4XC2 A;  2NMQ A;  2IY1 B;  4W9H A;  4WJN A;  5C1Z A;  3B0A A;  1SGH A;  2FNJ B;  4NAW A;  4HK2 A;  2ZW0 A;  1SSN A;  1R4N I;  3RFZ B;  3KYC D;  2SEB D;  1GG3 A;  1V86 A;  4WQO B;  1TKG A;  3VQI A;  1XF5 L;  1TY0 A;  4NQK E;  2BS3 B;  1ZGU B;  3IXS A;  4PT5 A;  2W82 A;  4DHZ E;  3M62 B;  5FK9 C;  4HVB A;  3BYY B;  2KWC A;  3PPA A;  2G9H D;  3AE1 B;  3Q69 A;  2JY6 A;  2O6V B;  4ARI A;  4TSS A;  1AAR A;  2KQ4 X;  5E6O A;  4IUM B;  2E6X A;  1N5X A;  1D4B A;  3PZ8 A;  2K6D B;  2A4Z A;  4HDO A;  1KF6 B;  1ET9 A;  3TEX A;  2LGY A;  4O1N A;  3H9D A;  1IGD A;  2IDY A;  1XT9 B;  3V05 A;  2GBN A;  2DNF A;  2ASQ A;  4FUL A;  1V8C A;  2W9N A;  1EU4 A;  3X23 A;  3VTU A;  2D10 A;  2WXI A;  1WYG A;  5FR3 A;  1WGK A;  2I38 A;  2FCQ A;  4BBN C;  3TL5 A;  2WDT B;  5JHB A;  3UQB A;  4MJS B;  4DWF A;  2CR5 A;  2DYO A;  2DAJ A;  4AJY B;  2KLC A;  1AYF A;  1QZE A;  1WXV A;  2WHI A;  4EZJ A;  2MWS B;  4I6P A;  1K50 A;  4J6I A;  2GBM A;  1QIL A;  3N1Y C;  2GBR A;  1GC7 A;  5LXI B;  4MGZ E;  4W9K A;  2RSU A;  3CF6 E;  2MW5 A;  3WAO A;  2J0K A;  2Z59 B;  4M8N A;  3EFC A;  2L76 A;  3LXF A;  1T0Y A;  2JUO A;  1L4Z B;  3AE5 B;  1F2R I;  4YTN B;  5D7G A;  2W54 A;  5BYS A;  2R61 A;  1VZ6 A;  3W1S A;  2DBY A;  4GSW A;  1UGJ A;  2JZZ A;  2LXA A;  1GB4 A;  1P7E A;  4W9C A;  4RGO S;  2GOW A;  3NZU A;  4KKI A;  3PZD A;  4BVU C;  2K3U A;  2INP E;  2W3S A;  3HIZ A;  2MSE D;  5FKA C;  1C78 A;  3IT6 B;  3AU4 A;  2WXL A;  1WX8 A;  2W55 A;  3P4P B;  1N61 A;  5C2T B;  1KRH A;  2K22 A;  2LHD A;  4ICU A;  1Y56 A;  4KGR A;  3AE6 B;  2D5G A;  4A90 A;  1OEY A;  4YWG G;  2IBI B;  3PLV A;  4TMA B;  4LDT B;  4OZB A;  4AQ7 A;  4ZRJ A;  4OZA A;  4ARC A;  3EHV A;  3UIN B;  1TKE A;  2EEL A;  3NVY A;  1OEY J;  4XE0 A;  4CQN A;  1F0Z A;  5G55 A;  1IP9 A;  1Z5S B;  3QHT A;  3BII D;  2XNA C;  1L6U A;  1J7A A;  3C8Y A;  3DVG Y;  3ECI A;  2AQ3 B;  5MPO A;  3KUC B;  4LJP B;  4EFO A;  5D94 A;  3RI7 C;  4WJQ A;  3S2A A;  4KGS A;  1F9J A;  3LJ3 A;  3M95 A;  1XLQ A;  3TBL D;  1NI2 A;  2QHO A;  2PTL A;  3V60 A;  3W1S C;  2AYO B;  3Q8F A;  2N9L A;  2KVR A;  3SFD B;  3UQA A;  4M0W A;  1EU3 A;  1I4H A;  3BIN A;  3CIR B;  5DPT A;  1WGR A;  3FIL A;  3R66 C;  4A55 A;  2XEW A;  2JT4 B;  2WU5 B;  3CMM B;  4MM3 B;  4AWJ A;  1I4G A;  2G45 B;  1WYW B;  4YSY B;  3EA6 A;  3DHG C;  2PKO A;  2WQY B;  2KDF B;  2K6Q A;  2REX A;  4LJO B;  3HM6 X;  1TIF A;  1HXY D;  1V5T A;  2KQS A;  3A1Q A;  3APF A;  3AI5 A;  3AMZ A;  3U8Z A;  1QOG A;  3NZ3 A;  4II3 B;  4DHJ B;  3DPD A;  2WX0 A;  1SE3 A;  2QC8 A;  4BKT A;  1FIQ A;  1XCQ L;  3KWV A;  1WGH A;  2BPS A;  4RF0 A;  4HRO A;  1PQS A;  2XK5 B;  3GB1 A;  3ZNG C;  3ZGZ A;  4PS3 A;  4HPL B;  1T6B X;  1OQR A;  4OZC A;  1R4M B;  3LDZ E;  4JWU C;  1LM8 B;  1YN5 A;  5EDS A;  5AUK A;  1VJK A;  1ZE3 D;  2JYT A;  1SIJ A;  4MEL A;  4L23 A;  1FO4 A;  1MVK A;  1TS5 A;  1QT9 A;  3AE7 B;  3N1X C;  4FBJ B;  2CHW A;  3RYT A;  2MBQ A;  4MSQ B;  1E7V A;  4EE2 A;  3ZRF A;  3UGB B;  3IHP C;  1YJ1 A;  4ZRK A;  3TMP B;  1C3T A;  2JU6 X;  2I1J A;  3L13 A;  2KDE B;  5CTR C; 
#chains in the Genus database with same CATH homology
 2NVU I;  2MX2 A;  3KW5 B;  4M0W B;  2KO3 A;  4KV2 A;  2ZEQ A;  4RM8 A;  3UIO B;  4WWO A;  2XK5 A;  4E3C A;  2KJH B;  3AU5 A;  4B95 A;  4EZK A;  2NBW B;  4G0N B;  2O2V B;  3VHT C;  3WAM A;  2RGF A;  3A9K B;  2KTF A;  3N32 A;  4ASW C;  3JSV A;  1WXA A;  4GDK A;  4TQ0 A;  2IO0 B;  3RUI B;  1UBQ A;  4F8C B;  4MDK E;  4HCP B;  2MBB B;  4CHK A;  2G4D B;  2JVC A;  4NQL B;  2IZV B;  1NBF C;  1WJU A;  3DQV A;  3ML9 A;  4AJW A;  1EF5 A;  4XX5 A;  3WA0 A;  4ANX A;  3WIM A;  2DZJ A;  3UF8 A;  3VVW B;  2KLG A;  4BKS A;  2ZCB A;  2LI5 A;  4II2 B;  3QJZ A;  3VDZ A;  2KFK A;  4FJY A;  1TTN A;  2BF8 B;  3AUL A;  3DOW A;  1V80 A;  3NOB A;  4BKG A;  4KSL C;  1KOT A;  5JH5 C;  2G4S A;  2JPH A;  2EMT A;  3QQ8 B;  2V4L A;  3PTF C;  4W9D A;  3TIX A;  4IW0 A;  3K9O B;  2GBJ A;  3SU8 X;  1WZ3 A;  4I6N B;  2R2Q A;  3A1Q B;  2JXX A;  1A5R A;  2FCS A;  1UZX B;  2LVO A;  2O6V A;  2DX5 B;  3QA8 A;  3KUD B;  3A9J B;  4OVV A;  3L54 A;  1WMH B;  3DBH I;  2KMA A;  2OOB B;  2J7Q B;  4E71 A;  1D3Z A;  2MBO A;  1YQB A;  3DBL I;  1VCB A;  3RUL A;  1WE6 A;  2Z0E B;  3WAP A;  2KK8 A;  2A5U A;  4FLH A;  1GUA B;  2MBH A;  1FXT B;  2L8J A;  3ZKJ C;  2LZ6 A;  2MBE A;  2M0X A;  1Q5W B;  3NY5 A;  1YX5 B;  3RT3 B;  1OGW A;  4WWN A;  2LD9 A;  4EKU A;  3KYD D;  3I3T B;  4F7Z A;  4IM0 A;  1KM7 A;  4MEM A;  4OVU A;  3H7P A;  3KH0 A;  1L7Y A;  4GN1 A;  1V81 A;  4GDL A;  2KTR A;  2AEH A;  2DYM A;  1V2Y A;  2D07 B;  1P98 A;  2FID A;  3DVN U;  4P7I A;  3ZDT A;  4HCN B;  4W9E A;  3V6E B;  4CYE A;  3PLU A;  2M4N A;  3CST A;  1R4M I;  2N4F A;  4TKN A;  2D2Q A;  2IYD B;  4IWO A;  4GGQ A;  4PYU A;  5TR5 A;  2AWT A;  2KD0 A;  4JQW C;  3APD A;  3QCA A;  4W9J A;  4E74 A;  3PHX B;  3PRE A;  4MJS A;  5FR6 A;  4FAD A;  2KJR A;  4IWP A;  2MP2 A;  3M3J A;  3T9L A;  4URK A;  1RLF A;  4G11 A;  4A20 A;  3A9J A;  5HKH A;  3OLM D;  3QK0 A;  3Q3F A;  4GIV A;  1UGM A;  1RAX A;  2C7N B;  3GZN I;  3H1U A;  1ZKH A;  3PS6 A;  2N1W A;  3H6N A;  4G50 A;  4IM3 A;  2KOX A;  4HLE A;  2ZJD A;  5DCN A;  1J0G A;  2C7M B;  2FIF A;  3R7Q A;  2HTH A;  4KZC A;  3JW0 X;  1LFD A;  1WJ6 A;  2DEN B;  2KWU B;  2GBK A;  4JLC A;  1H8C A;  3JYU A;  4MGI E;  3V61 A;  3Q3J A;  4NJ7 A;  4DDI D;  2GMI C;  3A4R A;  2D11 A;  4LCD E;  3VTV A;  4XC2 A;  3OJ3 A;  2IY1 B;  2O6V D;  3PSE B;  2K8C A;  3JSV B;  1S1Q B;  4GDK B;  2I1K A;  4MGY E;  1E8Z A;  4GMV A;  2C9W B;  2PPH A;  4W9H A;  1V49 A;  4WJN A;  3B0A A;  2CKH B;  4W9G A;  3ZNZ B;  1SGH A;  2FNJ B;  4NAW A;  4FA6 A;  3KUZ A;  2KXJ A;  2D3G A;  4HK2 A;  2PJH A;  4KZ0 A;  4EZL A;  5KHQ A;  2KNB A;  1R4N I;  1WR1 A;  3VUX A;  4IC7 B;  2G3Q B;  2HD5 B;  2JWZ A;  3KYC D;  4NY0 A;  1GG3 A;  3C0R B;  3QAR A;  4G3X B;  1P9D U;  1V86 A;  4WQO B;  3VQI A;  4RMA A;  2MLB A;  3SHQ A;  1UH6 A;  1V5O A;  2KFK B;  3V6C B;  4F1S A;  2CS4 A;  4NQK E;  1ZGU B;  3IG3 A;  4FHJ A;  4KDI C;  5J2R A;  2KC2 A;  2PE6 B;  4DHZ E;  3IVF A;  2ZVO A;  3M62 B;  4BOZ B;  4HVB A;  1K8R B;  4A3O A;  3O65 B;  4EEW A;  4HXD A;  4YL8 A;  5JZE B;  1GC6 A;  2KWC A;  3PPA A;  2ZPY A;  2JY6 A;  2O6V B;  4W9F A;  2KX3 A;  2N9P C;  5CHF A;  2FUH B;  2KQ7 A;  1AAR A;  2K8H A;  2LAS A;  1EF1 A;  1J19 A;  1GNU A;  5CHW A;  3PHW B;  4IUM B;  5E6O A;  3U30 A;  2JRH A;  1H4R A;  4GU2 A;  1E5W A;  1MG8 A;  2K6D B;  2A4Z A;  5CHV C;  4HDO A;  3QIJ A;  3QX1 A;  3CSF A;  2LGY A;  4K7W A;  4ANU A;  3H9D A;  3ZIM A;  5CX3 A;  1XT9 B;  2VRR B;  3H7P B;  2GBN A;  1JRU A;  4GDL B;  2ASQ A;  2KTR B;  5AZF A;  4FUL A;  5E6N A;  1WIA A;  2HJ8 A;  3ZRC A;  2MRP A;  2W9N A;  3X23 A;  1OQY A;  3VTU A;  2D10 A;  4B6W A;  1V9J A;  3NS8 A;  3VXW A;  2FAZ A;  2FCQ A;  4BBN C;  3TL5 A;  4PS8 A;  3ZTD A;  2WDT B;  5JHB A;  2KWV B;  3UQB A;  4KDL B;  4MJS B;  4DWF A;  2MP2 B;  5IA7 A;  2CR5 A;  3SDL C;  2DYO A;  2DAJ A;  4AJY B;  1Y8R C;  2KLC A;  2N9X A;  1QZE A;  1Q1O A;  1WXV A;  4EOY A;  2YVC A;  5AEK B;  4AOF A;  4EZJ A;  2MWS B;  4I6P A;  2ZVN A;  2IO2 B;  4GXB A;  4J6I A;  1EO6 A;  2GBM A;  3PRZ A;  4FN2 A;  2KZR A;  3QWZ B;  2GBR A;  1GC7 A;  3ZNI D;  5LXI B;  2N9E B;  4MGZ E;  4W9K A;  1VD2 A;  1RRB A;  5DPR A;  2KHW B;  2Y5B B;  3ZVV A;  2RSU A;  3BY4 B;  4ANV A;  3VTW A;  3VH3 B;  3CF6 E;  3HHM A;  4I6L B;  4NAW B;  3WAL A;  2MW5 A;  1WRD B;  3WAO A;  1M94 A;  4IG7 B;  4B9K A;  2J0K A;  2Z59 B;  1G6J A;  3ENE A;  4M8N A;  4JL9 A;  2J0J A;  4PYZ A;  2L76 A;  2NPT A;  5C1Z A;  2BYV E;  1T0Y A;  2JUO A;  3IBE A;  4BFR A;  5D7G A;  2PEA A;  3VUW A;  3W1Y A;  5L95 C;  5LLI A;  1WXM A;  1WJN A;  2LGX A;  1YIW A;  2NBU A;  3W1S A;  1WM3 A;  3MJW A;  1LXD A;  4JGH B;  5AZH A;  4GSW A;  4A3P A;  1IPG A;  3R3M A;  3EFU A;  2JZZ A;  3HM3 A;  3PV1 A;  4IWQ A;  2LXA A;  4KIK A;  4LDT D;  4MM3 A;  3B08 A;  5J18 A;  1WF9 A;  3DVG X;  1TGZ B;  4K7S A;  1GJZ A;  3L08 A;  4W9C A;  2GOW A;  2DYB A;  3NZU A;  4NNJ B;  3PZD A;  2WYQ A;  4BVU C;  2L00 B;  1IYF A;  2CHZ A;  2B3A A;  2J0M A;  3PVL A;  4FHK A;  4MSM B;  2CU1 A;  3HIZ A;  4WJP A;  2UWQ A;  2LWP A;  2MSE D;  1L2N A;  1P1A A;  4ZDV A;  2K1F A;  2HE7 A;  2YLM A;  4DBG A;  1TZ1 A;  3AU4 A;  2MA9 B;  4AP4 C;  1HE8 A;  1WX8 A;  2RD0 A;  3N30 A;  2DZI A;  1NDD A;  3KVF B;  4ICV A;  5AZG A;  1WY8 A;  4WAA A;  3JVZ X;  3V62 A;  4AUQ C;  2R2O A;  2BKF A;  3RCZ A;  1SE9 A;  2KDI A;  3PRM B;  4IM2 A;  4K1R B;  4XZ4 A;  1WFY A;  4ICU A;  1WX7 A;  2WWZ A;  2KJ6 A;  4ANW A;  2LRU A;  2BYF A;  1I42 A;  3MTN B;  1I35 A;  1OEY A;  2IBI B;  3PLV A;  2KFJ A;  4K81 A;  2K25 A;  4LDT B;  3T8M A;  1ZW7 A;  2LVP A;  4ZRJ A;  1EUV B;  2IO1 B;  1KJT A;  4RM9 A;  2L05 A;  2BYE A;  2BWF A;  3DCG A;  3EHV A;  3UIN B;  3APC A;  4BBN F;  2NCN A;  1WH3 A;  3ML8 A;  3U7D A;  3NHE B;  1OEY J;  3DBR I;  3ZW3 A;  2EMS A;  3DVN V;  5G55 A;  4DXA B;  1IP9 A;  1Z5S B;  3QHT A;  4BKS D;  2KC1 A;  2PE9 A;  3EEC A;  4KSK C;  4DDG D;  4W9I A;  5E6P A;  2RR9 A;  3WAN A;  3PGE A;  3DVG Y;  2ZPN A;  3DDC B;  3ECI A;  4GB9 A;  3UIP B;  1P0R A;  2K39 A;  2UYZ B;  4ZRI A;  3AXC A;  3KUC B;  3NZS A;  4LJP B;  1WX9 A;  4EFO A;  5D94 A;  1E8W A;  2LUE A;  4WJQ A;  3S2A A;  2LXC A;  1ISN A;  1SIF A;  2OJR A;  1F9J A;  3ALB A;  3LJ3 A;  3M95 A;  3TBL D;  2M1M A;  3ZTC A;  1NI2 A;  2QHO A;  4BOS C;  4K7U A;  5LXH A;  3V60 A;  2M8S A;  3B1L X;  3VH4 B;  2AYO B;  3W1S C;  5DPS A;  3VFK A;  2NPT B;  3RZW C;  2BGF A;  2KVR A;  3A4S C;  1WR6 E;  3L17 A;  4NPN A;  3ZDM C;  3DBS A;  2NBV B;  3ZO5 B;  5L83 A;  3UQA A;  4FJV B;  4N9F 4;  3ZNH B;  2JRI B;  3BIN A;  2AL6 A;  3QC8 B;  2KX0 A;  3RZF A;  5JHA A;  3L16 A;  5DPT A;  3L0W B;  1WGR A;  2BWE S;  2O2V A;  3A9K A;  5D2M B;  3R66 C;  3RD2 A;  4TQ1 A;  4DHZ B;  3ONS A;  1Z2M A;  2XEW A;  2KDB A;  2N7D A;  3GOE A;  3IFW B;  4DHJ D;  1C1Y B;  2JT4 B;  2WX1 A;  3QAQ A;  4KIK B;  1UBI A;  3CMM B;  4AWJ A;  2EKE C;  3PT2 B;  1WJ4 A;  4MH0 E;  3TJP A;  1E90 A;  4NJ6 A;  2IO3 B;  4TUU A;  2G45 B;  1WGG A;  1WE7 A;  1WYW B;  2CHX A;  3ZUN A;  3R7R A;  3K9P B;  3MHS D;  1E8Y A;  1CMX B;  1XD3 B;  3VUY A;  1BT0 A;  3OAW A;  1S3S G;  2KDF B;  2K6Q A;  4CO7 A;  5J17 A;  2REX A;  4ZYN A;  3HK0 A;  4LJO B;  1YX6 B;  1KLV A;  3HM6 X;  1WM2 A;  1WI0 A;  5IAA C;  2DZK A;  1V6E A;  2AL3 A;  3H7S A;  4JIO U;  1Q0W B;  4EUT A;  2L0F A;  2BKR B;  1V5T A;  2M17 A;  2KQS A;  3A1Q A;  3EC8 A;  3APF A;  1J8C A;  2K8B A;  4MGK E;  2NS5 A;  3AI5 A;  2V3S A;  2C60 A;  3U8Z A;  2L0T A;  1TBE A;  2LRW A;  1YD8 U;  4II3 B;  1WMH A;  2C5L C;  2ZZP B;  4WJO A;  2N7E A;  4WWP A;  3TCA A;  2KN5 A;  4DHJ B;  3DPD A;  2WX0 A;  3N3K B;  3OJ4 B;  1LQB A;  5BO4 B;  2JF5 A;  3M63 B;  4HWI B;  4BKT A;  3VAW A;  1RFA A;  1WXS A;  2LVQ A;  4M8M A;  3A33 B;  4TV3 A;  1WGH A;  4X57 B;  1OTR B;  2BPS A;  3PRP B;  1PQS A;  4FJZ A;  5DPW A;  2XK5 B;  3ZNG C;  1WZ0 A;  4PS3 A;  2KMC A;  4HPL B;  4PS7 A;  2LGD A;  1XQQ A;  3LDZ E;  2XBB C;  2ZNV C;  1LM8 B;  1X1M A;  2DAF A;  1UD7 A;  4W9L A;  5EDS A;  2IY0 B;  2KKC A;  2RPQ A;  1WGY A;  2Z0D B;  4HPM B;  1UEL A;  2L7R A;  4MEL A;  1E7U A;  1U4A A;  5D6J B;  2KAN A;  3L10 B;  2FCN A;  4KVG B;  2N1V A;  5G2N A;  2MQJ A;  4FBJ B;  2CHW A;  5GMV A;  2DHZ A;  2MCN B;  2V1Y A;  3RYT A;  2MBQ A;  1WGD A;  3D32 A;  2FCM A;  4DK5 A;  4MSQ B;  1E7V A;  2C7H A;  4HDQ A;  5C23 A;  2LJ5 A;  2L3Z A;  2ZNV B;  2ZCC A;  3ZLZ A;  3UGB B;  3ZRF A;  2JZ3 B;  1P3Q U;  1E8X A;  3IHP C;  1YJ1 A;  2NR2 A;  4HJK A;  3P2B A;  3SD5 A;  4ZRK A;  5KHO A;  3X0W A;  4GOC A;  3TMP B;  1C3T A;  2DZM A;  2I1J A;  3L13 A;  2KDE B;  5CTR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...