3DBLI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
RRASVGSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLQLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
total genus 19
structure length 86
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dblI00
4KZCA 3W1YA 2DAJA 3RUIB 4IG7B 2BYFA 3V6CB 4W9IA 1LFDA 2MBQA 2DYMA 1V81A 2AWTA 2PJHA 2D2QA 3T9LA 1WIAA 3PHXB 3T8MA 1UD7A 2KMCA 2JXXA 2YLMA 1YIWA 2DENB 4IW0A 3TIXA 2GBMA 2DZKA 4IM0A 5G2NA 5LXIB 1RFAA 4GOCA 4TQ1A 3WA0A 4K81A 3V6EB 4GDLB 3M95A 1E8ZA 3PZDA 1V86A 4JL9A 2NVUI 3VHTC 1K8RB 3O65B 1WJ6A 2JVCA 2LVOA 2LZ6A 1EO6A 1P98A 3DVNV 3H1UA 4B95A 4ANXA 2MLBA 3AU4A 4TUUA 1EUVB 4F7ZA 3DBLI 1I42A 3A9KB 1WY8A 4OVUA 2IO1B 1X1MA 4YL8A 4HCPB 1F9JA 1OGWA 2ZJDA 4GDKA 4G11A 4MSQB 4KSKC 1Z5SB 3ZNHB 2CHXA 3ZRFA 4HPMB 1AARA 4NJ7A 4W9HA 4DHZE 2KWCA 4BBNC 1ZKHA 2LVQA 2C7NB 1J0GA 5KHQA 1GUAB 2GMIC 2L00B 1WZ0A 3PSEB 5CHFA 1P3QU 4A3PA 2J7QB 2DYOA 2EMTA 5KHOA 2WYQA 2IZVB 5FR6A 4BKTA 2KDBA 2EMSA 2KFJA 3UINB 2YVCA 2ZNVB 5GMVA 3IBEA 1E5WA 1KJTA 4ANUA 4CO7A 1E8WA 4XX5A 5DPTA 3L0WB 1WXVA 5D2MB 3TMPB 2JF5A 5CHWA 3ZVVA 1ISNA 4MJSB 3RULA 1TZ1A 2IY1B 4F1SA 2ZCBA 3GZNI 2MBEA 2IO2B 4GDLA 3DQVA 4BOSC 3L16A 2J0JA 3B08A 2L05A 2D11A 3DCGA 3M3JA 2XK5A 2KZRA 4GU2A 2N7EA 3APFA 3WIMA 3QC8B 4W9DA 3RCZA 1A5RA 2G45B 2ZPYA 4GN1A 2D3GA 2BYVE 1LXDA 1WX8A 4FA6A 5E6PA 2GBNA 3VQIA 3GOEA 3SD5A 1XD3B 1OTRB 3ZO5B 1J19A 2MP2A 4MGIE 4NPNA 4WJPA 2CS4A 3R66C 3I3TB 3ZNGC 1OEYJ 2ZEQA 3ZW3A 2NPTA 4GGQA 3CF6E 4PYZA 4ASWC 2QHOA 2R2OA 2ZNVC 3NZSA 4II2B 3ZLZA 2RD0A 4LJPB 1G6JA 2MA9B 4EZLA 2O2VA 1Z2MA 2PE6B 2KFKA 2A5UA 4MH0E 1UELA 2K1FA 4HLEA 4P7IA 1VD2A 5C1ZA 1ZGUB 2KX0A 4W9CA 2D07B 2IO3B 2MX2A 2JWZA 2K8CA 2Z59B 4ZRJA 2AL3A 3QQ8B 3ZNID 1SE9A 4AWJA 2HD5B 2HE7A 4EEWA 4FHKA 2HTHA 3JYUA 1E7VA 1GNUA 3PV1A 3ZDTA 4A20A 3PTFC 2DAFA 4DHZB 2C5LC 2R2QA 3L17A 3K9PB 1WMHA 2DYBA 2MBHA 1L2NA 3PRZA 4JGHB 1J8CA 4EUTA 1YD8U 4ICUA 2KWUB 4IWPA 1WH3A 3VH4B 4TQ0A 5AZFA 2ZVOA 3PRMB 4DBGA 2IO0B 1V6EA 2L0TA 4HPLB 3ZNZB 1IYFA 1R4MI 3PLUA 2NBUA 2DZMA 4FJYA 3B0AA 2KLCA 4K7SA 2LVPA 2REXA 1R4NI 4JLCA 3U7DA 3UGBB 3DVGX 2BKRB 3ZRCA 2I1KA 2KXJA 4DDGD 4K7WA 3QAQA 4MJSA 5LXHA 3HM6X 1WFYA 1WJNA 3A9JB 2FCSA 1S3SG 3DOWA 1GC6A 2CHWA 1WX7A 3A9KA 2NBWB 2OJRA 2JT4B 3Q3FA 4HVBA 1WR1A 1WI0A 2LI5A 5E6NA 2GBRA 3KVFB 2DZIA 3V62A 1WF9A 3MTNB 2PE9A 2IBIB 1P1AA 4KZ0A 1WGDA 4MGYE 4DHJB 2MBBB 3VUXA 1WX9A 3KUCB 4HDOA 4E74A 3ECIA 3C0RB 4FN2A 4LDTB 3SHQA 2WX1A 1NBFC 4AOFA 2M1MA 3QA8A 4ZRKA 3OAWA 1XT9B 2N9XA 4LDTD 4FHJA 3ENEA 4XZ4A 2M0XA 2MBOA 2KJ6A 3WAMA 5L83A 2KDEB 3H7PA 3VUYA 2DX5B 5HKHA 1UGMA 3UIPB 1I35A 3H6NA 2KJRA 4W9KA 2BGFA 4HWIB 3MJWA 2KN5A 2ZPNA 1D3ZA 2JUOA 1HE8A 2UYZB 3PPAA 2C60A 4ZRIA 1KLVA 5CHVC 4EZKA 5AEKB 3VAWA 2C7HA 2KC2A 1GJZA 1UZXB 3RT3B 1TBEA 4AUQC 4IWQA 4BFRA 2KHWB 1RRBA 4WWNA 3QX1A 2A4ZA 3PVLA 3NZUA 4HDQA 2JPHA 4PS8A 2KO3A 4MSMB 4NAWA 1S1QB 4MGKE 3WANA 4GB9A 2D10A 4B6WA 5D6JB 2G4DB 4I6NB 1V49A 2N7DA 4X57B 5LLIA 1H8CA 2O2VB 4DDID 2NBVB 1LQBA 4WJQA 5DPSA 3K9OB 4W9EA 4NQLB 3PRPB 4W9JA 4W9GA 2MQJA 1YQBA 5TR5A 2M4NA 1L7YA 3RZWC 2KOXA 3JW0X 4PYUA 2N9EB 2UWQA 3QK0A 1KOTA 1YX6B 2N9PC 4ICVA 3H9DA 4WJOA 4IM2A 4GDKB 1KM7A 3HK0A 1NDDA 2K39A 2XEWA 1E8YA 2K8HA 2WDTB 1WE7A 2LRUA 1M94A 2ZCCA 1WM2A 2KK8A 4KV2A 1WRDB 2K6QA 3KUDB 1E8XA 4DHJD 4B9KA 5J17A 3SU8X 4OVVA 4EZJA 3PHWB 1V2YA 5AZHA 3A4RA 2IY0B 1IP9A 3AI5A 1V9JA 2FIFA 4HCNB 1Q5WB 3TL5A 3ZKJC 4DXAB 2LRWA 3DBHI 3QJZA 1FXTB 1WXMA 2FAZA 3JSVB 2LJ5A 4LJOB 3U30A 5DPRA 5JHAA 3IG3A 1Y8RC 4WQOB 4TKNA 3H7PB 4W9FA 4NY0A 2RSUA 3EECA 2L7RA 2XBBC 4KSLC 4EOYA 4FJZA 1P0RA 2BPSA 2KDIA 4JQWC 4BBNF 3PS6A 4EFOA 4ZDVA 2BF8B 3V61A 3ZTCA 2MWSB 2NCNA 3M63B 4HJKA 1C3TA 2M17A 5AZGA 2M8SA 5J18A 2L0FA 3Q3JA 3UQBA 2NPTB 4KDLB 1T0YA 4M0WB 3LDZE 2JZZA 2KJHB 2WX0A 3VH3B 4FADA 2KDFB 1UBIA 1EF5A 1JRUA 1ZW7A 1E90A 3VFKA 4CYEA 1UBQA 3HM3A 4URKA 3L13A 2EKEC 2W9NA 3PGEA 3AULA 3OJ4B 2LASA 2VRRB 3CMMB 3VVWB 2J0MA 2IYDB 2MSED 2V1YA 3IHPC 3QCAA 3PREA 4G0NB 3MHSD 1WE6A 3QIJA 4EKUA 2GOWA 4HXDA 4NAWB 2HJ8A 1P9DU 4WAAA 2GBKA 3ZDMC 4BOZB 3DVGY 2JRIB 2LGYA 4AJWA 1GC7A 2JY6A 1WGHA 2BWFA 2K8BA 1WR6E 3AXCA 2FCMA 1BT0A 1WJUA 4KDIC 1MG8A 3CSFA 5JZEB 3NS8A 2B3AA 2NS5A 3P2BA 2KVRA 4AJYB 4ANWA 2KKCA 2L3ZA 1YX5B 2V4LA 4M8MA 3N32A 1UH6A 3A4SC 4W9LA 5L95C 2FUHB 4TV3A 4FULA 4CHKA 3ALBA 2N4FA 4GSWA 4RMAA 4G3XB 3RYTA 1OEYA 4FJVB 3R3MA 5E6OA 3TBLD 3KYDD 4II3B 1OQYA 3UQAA 3NHEB 5J2RA 5DCNA 3OLMD 1U4AA 2LGDA 4E71A 3A1QA 3KYCD 4I6LB 1C1YB 4F8CB 3JSVA 4J6IA 2FIDA 2C9WB 4PS7A 1PQSA 4E3CA 1RLFA 2FNJB 5EDSA 3VTVA 2I1JA 2JZ3B 3D32A 3ML9A 4BKSA 4XC2A 2K6DB 4AP4C 4KIKA 5CTRC 3A33B 2Z0DB 4PS3A 3ZTDA 1IPGA 2KQSA 4M8NA 5JHBA 1WYWB 4KIKB 3ZIMA 2LUEA 4DWFA 3KW5B 4MM3A 2FCNA 2O6VA 2KFKB 4ZYNA 4K1RB 3R7RA 4BVUC 4IUMB 1Q0WB 1WGGA 3AU5A 1WGRA 3BINA 3HHMA 1NI2A 3BY4B 3RD2A 2AL6A 2N1VA 1CMXB 1E7UA 3JVZX 3VUWA 3DBSA 4NQKE 3KH0A 2KD0A 3WAPA 2KANA 2LXCA 1TGZB 5IA7A 4MDKE 4FLHA 4I6PA 2PPHA 3L08A 3X0WA 4NJ6A 2RGFA 2KC1A 2FCQA 3WAOA 3B1LX 2Y5BB 3LJ3A 4FBJB 1WMHB 2KX3A 1XQQA 2K25A 4DK5A 3NOBA 4GMVA 4KVGB 2BYEA 4MGZE 3DBRI 3ML8A 2L76A 3N3KB 3VTUA 2G4SA 3PT2B 1RAXA 3EHVA 3ZUNA 1QZEA 2XK5B 2MRPA 4WJNA 1V5OA 3EC8A 3WALA 2KWVB 4GIVA 2RR9A 4ANVA 2KTFA 1EF1A 3VXWA 2G3QB 2CR5A 4IM3A 3VDZA 4BKGA 4RM8A 1VCBA 4N9F4 3L10B 2LGXA 4HK2A 1WZ3A 3ONSA 1WXSA 2O6VD 3W1SA 2DHZA 2AEHA 1H4RA 3W1SC 2LXAA 3NY5A 4G50A 4MEMA 2KNBA 2NR2A 2V3SA 2O6VB 3DDCB 1SGHA 2MP2B 3SDLC 3DVNU 3TJPA 3UF8A 3QHTA 1WM3A 2ZZPB 3PLVA 4GXBA 2N1WA 2OOBB 3S2AA 2MCNB 3UIOB 1GG3A 3APDA 4RM9A 1TTNA 4K7UA 1WXAA 4A3OA 1SIFA 2CHZA 4IWOA 3APCA 3DPDA 3M62B 3CSTA 1WJ4A 1Q1OA 2WWZA 2KMAA 5D7GA 2ASQA 2BWES 2DZJA 2KTRB 5C23A 2J0KA 3VTWA 2MW5A 4MELA 1V80A 3U8ZA 5JH5C 3A1QB 1WGYA 3R7QA 4LCDE 2CKHB 3EFUA 3X23A 4BKSD 2CU1A 1V5TA 2GBJA 2PEAA 2LD9A 2KLGA 1LM8B 5DPWA 3HIZA 4JIOU 2KQ7A 2BKFA 3N30A 3KUZA 3QWZB 2AYOB 2JRHA 5D94A 3QARA 3A9JA 2RPQA 3H7SA 2KTRA 4WWOA 5BO4B 3RZFA 3IFWB 5G55A 4WWPA 3OJ3A 3TCAA 2LWPA 4NNJB 2C7MB 3L54A 3IVFA 2ZVNA 5IAAC 3V60A 5CX3A 2Z0EB 4IC7B 1YJ1A 2L8JA
chains in the Genus database with same CATH superfamily
2INCC 1SSNA 2BYFA 4W9IA 5BYQA 2AWTA 2D2QA 3T9LA 3T8MA 1UD7A 3ABVB 2YLMA 2GBMA 5G2NA 5LXIB 5HI1A 4K81A 4GDLB 1HTOA 3M95A 3H8HA 2WXOA 1WJ6A 3Q3NC 2LVOA 2LZ6A 1SE3A 1EO6A 3J9CA 4ZHPA 4TUUA 4M02A 4KX6B 2IO1B 1TIFA 4PT5A 2IDYA 2JU6X 1Z5SB 1FCLA 4W9HA 4BZAA 2HDEA 2GMIC 2DYOA 2EMTA 5KHOA 1YNTE 1ET6A 3UINB 2W3SA 2ZNVB 4ANUA 1FCCC 5IN7A 4XX5A 2JF5A 5CHWA 1ISNA 3AE9B 4ARCA 2IPKD 1L5PA 2Y5CA 2D11A 3DCGA 3C8YA 4GU2A 2RPVA 2N7EA 3APFA 1QOFA 3RCZA 1PFDA 2D3GA 4FA6A 1UWMA 2Z8LA 1FMAD 4WAFA 2ICIA 4RF1A 3ZNGC 5C2TB 2ZEQA 2WP9B 3CF6E 2QHOA 4J3OD 4II2B 2MJDA 1V1PA 1G6JA 2FBWB 4EZLA 1Z2MA 4RFBA 4W9CA 2D07B 2MX2A 2JWZA 2K8CA 3ZNID 3U2SC 2HD5B 5E6JA 4FHKA 2HTHA 1KF6B 3JYUA 1E7VA 1GNUA 3ZDTA 4DHZB 2C5LC 2JZPA 2R2QA 1M4VA 4EUTA 2PKOA 4TQ0A 4YSZB 4DBGA 3BYTB 2ZW0A 2L0TA 2IGGA 4WIPA 2DZMA 1F77A 2KLCA 1R4NI 2YEPB 3DVGX 1XLNA 3ZRCA 2I1KA 1PGAA 3IAM1 2K22A 2FCSA 1S3SG 2NBWB 1KFYB 1T3QA 2WS3B 1WR1A 2QC8A 1TS3A 2XN9C 3V62A 1WF9A 2IBIB 2MBBB 1VRAB 1I4PA 2E6XA 3KUCB 3ECIA 3HUIA 1T0RC 2MJ3A 2M1MA 2LUMA 5IP4D 4FHJA 3H7PA 3UIPB 1OFFA 1SE2A 2NTTA 5AUIA 1J7AA 3I57A 2D3CA 4YTPB 3AECB 1QKZA 2PVGC 2UYZB 1DOXA 2C7HA 2LJIA 4HJGE 1ZP0B 2OEDA 4AQ7A 3QX1A 2ONQA 4MSMB 4NAWA 4GB9A 4I6NB 2N7DA 5LLIA 2OJWA 4L1BA 1STEA 4W9EA 1UNSA 3MC0B 1UUPA 2M4NA 1L7YA 3RZWC 3N1ZC 2QJLA 4LNIA 1GPXA 2N9PC 3H9DA 4GDKB 3EGRA 4N58A 3GE8C 1YOVB 2K8HA 1WE7A 1WM2A 2KK8A 1WRDB 1JRPA 1L0YB 1TS2A 4OVVA 2CU3A 1V2YA 1ESFA 4K3BA 2LRWA 3DBHI 2FAZA 3JSVB 3U30A 2QCZA 3AE2B 1EWCA 1MFWA 2KT7A 3H7PB 4NY0A 2RSUA 4MT5A 3L4PA 1ZUD2 3M63B 4BAXA 2L0FA 2KJHB 3P4SB 1E90A 4ZYSA 2VZKB 4KKJA 3L13A 2EKEC 1MI0A 1TY0A 1XLQA 2IYDB 3RNGC 2V1YA 3MHSD 1NENB 4HXDA 2GBKA 1FFVA 2LGYA 4AJWA 5IO9A 2BWFA 3AXCA 2DBYA 4KDIC 1T6BX 1LGRA 2KKCA 1RM6C 5L95C 3AE7B 4TV3A 4FULA 3ALBA 1E0ZA 5EE3A 4A8XC 1OEYA 4FJVB 3TBLD 5E6OA 2I38A 3KYDD 4ZRPA 3UQAA 4YXDB 5DCNA 3U4EG 4I6LB 4F8CB 2C9WB 1AW7A 2I1JA 2WHIA 2N7JA 4UDUC 2Z0DB 1F0ZA 5JHBA 3ZIMA 1E7PB 2LUEA 3AE6B 2J53A 3R7RA 2WNMA 3HHMA 4C80A 2N1VA 4JX1C 4US9A 2I2YA 1KLUD 1XCQL 2BBCA 3WAPA 1L0VB 5IA7A 1K51A 2PPHA 2QDFA 4NJ6A 4EE2A 3WAOA 3B1LX 1KLGD 3LXFA 1WYGA 2M19A 1WMHB 4ARIA 2BYEA 4MACA 3B2GA 3VTUA 3FC4A 1HXYD 3NJTA 3PT2B 1D5MC 3EHVA 1PDXA 2XK5B 2RMMA 3AE4B 3KWLA 2MRPA 1V5OA 2KWVB 2RR9A 3SEBA 2L32A 2WXQA 1EF1A 2G3QB 4IM3A 1SEBD 3E9SA 1GOZA 2K5PA 3L10B 4RGMA 1SJED 3U52E 1WXSA 1T0QC 3W1SC 2LXAA 4G50A 1QOBA 1ET9A 2KNBA 4XGAB 1SGHA 3ZJTA 3UF8A 1WM3A 3PLVA 2OOBB 1L6VA 2MCNB 4A3OA 3TEWA 1CJEA 1N5XA 1L4DB 2DZJA 2KTRB 4AS1A 1I4HA 3R7QA 2CKHB 4BKSD 2PEAA 1BUIC 2KLGA 3IAS1 3KUZA 3N20C 3H7SA 4ZOHC 2V0GA 3NRZA 1GAQB 3OJ3A 2C7MB 1A70A 3L54A 3IVFA 3V60A 3W1YA 3RUIB 3PO0A 4IG7B 3NG0A 3GP7A 2MJEA 1YIWA 2LHDA 4IW0A 1V8CA 4TQ1A 3WA0A 4L2YA 4XYCA 1Y56A 5T8IA 4YT0B 3PZDA 2BVCA 3V05A 1K8RB 2JVCA 3DHGC 3DVNV 4B95A 2MLBA 3AU4A 3DBLI 1BMLC 1WY8A 4OVUA 1V97A 1JWMD 1F9JA 1AN8A 3ZNHB 3ZRFA 4HPMB 1AARA 4NJ7A 2KWCA 1ZKHA 2LVQA 2C7NB 1YMHE 3KWVA 2L00B 4A3PA 1N6ZA 1ZOYB 2WYQA 2IZVB 3FKYA 5FR6A 4BKTA 4S17A 1KJTA 4A6QA 5DPTA 5D2MB 4HEA1 3IT6B 3RULA 3NVVA 1K52A 2IY1B 4B0EA 1D5XC 3DQVA 2J0JA 1B1ZA 3E56A 2KZRA 3MFGA 1D5ZC 2NMQA 3QC8B 1A5RA 2ZPYA 1LXDA 1WX8A 2KYWA 3GOEA 2JX5A 1XD3B 2GI9A 2QMTA 3ZO5B 1J19A 4NPNA 4WJPA 2CS4A 3R66C 3I3TB 1RYJA 3ZW3A 4C7YA 2NPTA 2R2OA 3ZLZA 2MA9B 2O2VA 1D4BA 2KFKA 4MH0E 1UELA 1E6EB 1HTQA 1TS5A 2IO3B 2AL3A 2WXGA 1SE9A 4EEWA 4YSYB 1FD6A 3Q8EA 1VZ8A 3PTFC 1DOYA 3P42A 2DYBA 2MBHA 1L2NA 3PRZA 4M0WA 2KMMA 1J8CA 1YD8U 4ICUA 3VH4B 1WH3A 4NAMA 2ZVOA 2IO0B 1V6EA 4RF0A 4N59A 2NBUA 3RI7C 3B0AA 4K7SA 2LVPA 2REXA 1N61A 2WXFA 2TSSA 1JW9D 1E9MA 4MJSA 2WXRA 1WFYA 3HM6X 5LNK1 1HQRD 2BS2B 1GC6A 3HVZA 1Q10A 3AE1B 2OJRA 1WXQA 2GBRA 3KVFB 2FUG1 2JWUA 2YEPF 2PE9A 1P1AA 3T3OA 4MGYE 5HHDG 3VUXA 4HDOA 3VRBB 4LDTB 3SHQA 2WXNA 3OAWA 2KDMA 1RWSA 2N9XA 1ZDXA 2IJ0A 4TMAB 1VZ6A 2KDEB 3VUYA 5HKHA 2DX5B 1UGMA 1YN4A 3H6NA 4Q2JA 4W9KA 2BGFA 4HKZE 1D3ZA 2JUOA 3PPAA 3V3XA 1XXGA 1KLVA 2D5GA 1GJZA 3VAWA 2IGHA 2RDGA 4AUQC 5H8YE 5IOIA 4MGKE 4B6WA 2INDC 1V49A 4X57B 4DDID 2NBVB 1LQBA 4WJQA 3HVDA 5G5HA 4NQLB 2G1EA 3PRPB 1GB1A 5TR5A 4PYUA 1TKGA 1XO3A 3QK0A 3BK2A 1YX6B 2DWQA 4WJOA 4IM2A 4C7ZA 3ZXVA 1F1HA 1C4CA 1ZPSA 4B0MA 5GXGB 2SAKA 2GRIA 5J17A 3AEFB 2IY0B 4D2KA 2KWDA 4HCNB 1Q5WB 1V1OA 3ZKJC 2W82A 1WXMA 2LJ5A 3AM9A 1C9FA 3IT4B 2WXHA 5JHAA 4TKNA 3EECA 2L7RA 2XBBC 4WWMA 4EOYA 2EELA 2BPSA 2BF8B 2MWSB 2M17A 3ZGZA 1K50A 5J18A 1KRHA 4KDLB 4OHJA 3VH3B 4H2AA 1UBQA 4URKA 3RNAC 1D6EC 3OJ4B 3AEBB 3R8BA 2VRRB 3CMMB 3B2FA 3PREA 1WE6A 3QIJA 1ZXIA 1FO4A 3ZDMC 2E3TA 3DVGY 1JQ4A 4OW0A 5JXVA 1C79A 3TSSA 3Q8CA 5MPOA 4C00A 1WJUA 1P7FA 1QOAA 1PGXA 3NS8A 2B3AA 2LHEA 4ANWA 4M8MA 1ACCA 1YX5B 2L3ZA 3A4SC 2N0SB 5G5GA 2N4FA 4GSWA 3MC8A 4RMAA 5BYRA 3CIRB 3R3MA 1OQYA 1I4GA 4HPPA 4E71A 3MHZA 3JSVA 4J6IA 3C19A 1FNVA 3TEYA 1PQSA 4E3CA 2FNJB 4XE0A 3VTVA 2JZ3B 1WSPA 5CTRC 3ZTDA 1P7EA 4NZLB 3TUOA 1WYWB 2X8XX 5D3IB 2FCNA 1C4AA 2O6VA 4K1RB 4IUMB 1Q0WB 1WGGA 3BINA 3BY4B 2WXLA 4RGTA 4MDKE 4I6PA 3X0WA 2LGIA 2R61A 2WGSA 2KC1A 1NI3A 3MC9A 2QSDA 3LJ3A 2W54A 3LYYA 4FBJB 5HG2A 1L0XB 4GMVA 4MGZE 1PYWD 3DBRI 4HKQA 2L76A 4KKIA 3BYYB 1RAXA 1QZEA 3WALA 4OZBA 2HTME 3KQ4A 1AWDA 3VXWA 4BKGA 4N9F4 2AQ3B 3W1SA 2AEHA 1I4QA 4MEMA 5IKCM 1FFUA 3SDLC 3TJPA 2ZZPB 4GXBA 2WQYB 1GG3A 1TTNA 1WXAA 1SIFA 2LMCA 4IKGA 3CSTA 2BB5A 1JCKB 2ASQA 1E10A 1WGKA 1V80A 3VR9B 1WGYA 4LCDE 3EFUA 2CU1A 3N1YC 4LK0M 4DXFA 5DPWA 3N30A 3QWZB 2AYOB 2M0AA 1IGDA 5D94A 3A9JA 1EWYC 2RPQA 5EE0A 2M56B 3RZFA 5BMGA 1YN5A 3UI3A 4NNJB 1L6UA 3P1MA 1J7CA 1FEHA 5CX3A 2WDVB 1TJEA 1YJ1A 3AI5A 2DAJA 4LNNA 2MBQA 2DYMA 2PJHA 2X38A 2LGSA 4RGNA 3RN9C 5I4DA 3GB1A 1RFAA 4GOCA 4YSXB 4TSSA 1E8ZA 1V86A 2NVUI 3O65B 1P98A 3IXSA 1EUVB 1I42A 3DBLB 3A9KB 3WCQA 1X1MA 1HZ5A 4G11A 2ZJDA 4MSQB 4KSKC 2J52A 1MHXA 4DHZE 4XWWA 5KHQA 3RNCC 2J7QB 2KDBA 3NUHB 2Y5PA 2EMSA 2KFJA 5EE9A 5GMVA 3IBEA 1E5WA 1E8WA 1WXVA 3O13A 2WXPA 5BMHA 3N1XC 1TZ1A 1OQQA 2ZCBA 3GZNI 2MBEA 4GDLA 4BOSC 4QAYA 3L16A 1XLOA 2L05A 1I4RA 2XK5A 1VZ7A 2KN4A 2BYVE 3NVYA 5E6PA 3DWMA 3VQIA 3SD5A 1OTRB 4MGIE 4FXCA 3NZSA 2G9HD 2PE6B 3AMZA 2A5UA 2K1FA 1ZGUB 3CWIA 3U7ZA 2Z59B 4AWJA 2HE7A 3EUB2 4KGSA 4A20A 2DAFA 4RCOA 3L17A 1B9RA 3K9PB 4XWTA 2IGDA 4IWPA 1SF0A 1YQ3B 4XDCA 3ZYYX 1J7BA 3N9YC 4LNFA 3PLUA 2L1AA 4LTUA 4FJYA 5C3JB 3U7DA 1YJIA 3UGBB 1QQRA 3HRDD 3ZJUA 4K7WA 3QAQA 5LXHA 1WJNA 3AH7A 2VH1A 3DOWA 4ACFA 1T5XD 1SE4A 1UGJA 3SFEB 3BIID 2LI5A 2DZIA 1CK1A 2H89B 4KZ0A 4DHJB 1WX9A 4E74A 4FN2A 3C0RB 2WX1A 1NBFC 3QA8A 1XT9B 5H92C 4LDTD 3ENEA 4XZ4A 1VR9A 2MBOA 2KJ6A 3WAMA 5L83A 3DHIC 1C77A 1V1PB 4HWIB 2KN5A 2ZPNA 2C60A 4ZRIA 5CHVC 4EZKA 5AEKB 3AE8B 1UZXB 2CJOA 3RT3B 4IWQA 2KHWB 1RRBA 4WWNA 2ZW1A 2A4ZA 1IUEA 3PVLA 2JPHA 4PS8A 2KO3A 3WANA 2D10A 2G4DB 1H8CA 2J4XA 2AQ2B 1F2RC 1QF6A 5DPSA 3BWUD 4W9JA 4NJCA 2MQJA 3Q3MC 3RMKC 4M01A 1ZE3D 4YTMB 1QOGA 1KOTA 4ICVA 5BMIA 4C4VB 2K39A 2LRUA 3DHHC 3EFCA 4KV2A 3URYA 2K6QA 3KUDB 4IOIE 3MJ5A 3PHWB 3A4RA 1IP9A 4A90A 1V9JA 2FIFA 1FXTB 4LNKA 4LJOB 1Y8RC 4W9FA 2KDIA 4JQWC 3PS6A 4P6VF 3V61A 2V3NA 3P63A 4HJKA 1F52A 5AZGA 3BVZA 2JQRB 2QEJC 3Q3JA 3UQBA 1F2RI 4M0WB 4FADA 2KDFB 2WU5B 3VFKA 4CYEA 2QILA 3HM3A 3AULA 2BTEA 2LEKA 4G0NB 1R4NB 4EKUA 2GOWA 1P9DU 1UWXA 4MH8A 4WAAA 1KH0A 3I63C 1GC7A 1PGBA 1WGHA 2K8BA 1WR6E 2FCMA 1BT0A 3NZ3A 1C4PA 5JZEB 3P2BA 2D3AA 2AX5A 2V4LA 3N32A 1UH6A 1I4XA 4W9LA 1VJKA 2FUHB 3W2DA 1C78A 4CHKA 5EE1A 3RYTA 1JWAD 4II3B 1HZ6A 5J2RA 3NHEB 3OLMD 1DGJA 2V9HA 1C1YB 1LO5D 2FIDA 3Q69A 1RLFA 3D32A 3ML9A 3ZQ4A 4USAA 2K6DB 5D3DA 3SR6A 2WXIA 2KVZA 4M8NA 2K9XA 2RDHA 1RFKA 3I5JC 4ZYNA 2KFKB 4BVUC 1ZDVA 3RD2A 3RFZB 1E7UA 3PZ8A 3DBSA 3KH0A 2KD0A 3AEGB 2KANA 2LXCA 1TGZB 5AUKA 4FLHA 2PW9A 3L08A 1JROA 2BW2A 3SFDB 2RGFA 3W9CB 2Y5BB 3VRAB 1YN3A 1XQQA 1VLBA 2K25A 4DK5A 3NOBA 3BVMA 1SIJA 3DBRB 4P1BC 2PTLA 1JMLA 2K3UA 4WJNA 4ANVA 2KTFA 2CR5A 3VDZA 4XDDA 4RM8A 1VCBA 2LGXA 1N5WA 2N9KA 2KACA 3R2TA 1SJHD 1H4RA 2PIAA 4A9AA 3NY5A 3Q3OC 4IDIA 3DDCB 3DVNU 3QHTA 3AV8A 4RM9A 4K7UA 1FPYA 3M62B 1FM0D 4DQOC 5D7GA 2V3PA 3AE5B 1N60A 1L4ZB 2BWES 2N9LA 5C23A 3VTWA 4MELA 3A1QB 3X23A 1XEEA 2LD9A 3OG5A 3FILA 3HIZA 2BKFA 3QARA 2ACZB 2KTRA 1FIQA 3B9JA 3Q6BA 3IFWB 5G55A 4WWPA 3TCAA 2LWPA 1NEKB 2H88B 1YQ4B 3N3KB 4KZCA 1NYRA 2D3BA 3AEEB 3V6CB 1LFDA 1MPEA 1V81A 1WIAA 3PHXB 2KMCA 1AYFA 2JXXA 1FRRA 2DENB 3TIXA 2DZKA 4WH4A 3TEXA 4IM0A 2NTSA 4O1NA 3V6EB 3Q8FA 4M00A 4JL9A 3VHTC 1ZXHA 3H1UA 1QILA 4ANXA 2GLSA 1EU3A 4F7ZA 3P4PB 4YL8A 3MP9A 4HCPB 1OGWA 3W5VB 4GDKA 2HJ1A 2PMVA 4OVZA 2CHXA 3FAHA 4BBNC 2DLBA 1J0GA 3RPFC 1GUAB 5CHFA 1WZ0A 3PSEB 5FK9C 1P3QU 2L52A 1GB4A 3Q8BA 4REZA 2YVCA 3BVGA 2PLPA 4CO7A 3L0WB 3TMPB 1CQVA 3ZVVA 4MJSB 4K3CA 4F1SA 2IO2B 1JWUD 3B08A 3M3JA 2W55A 3WIMA 3DBHB 1WWTA 4W9DA 2G45B 4GN1A 1IBXA 3T3NA 2GBNA 4ITKA 2MP2A 2WXJA 2OHFA 1OEYJ 1CZPA 1T0SC 4GGQA 1TYGB 4PYZA 4ASWC 2ZNVC 1C76A 1WRIA 2RD0A 4LJPB 1DYQA 2SEBD 4HLEA 4P7IA 1VD2A 5C1ZA 2KX0A 1FNWA 4RGOS 4GLSC 4ZRJA 2INPE 3QQ8B 3NVZA 3RNBC 1NVID 3PV1A 2JYTA 1EM7A 1WMHA 4JGHB 2KWUB 2RDBC 5AZFA 3PRMB 4JPSA 3ZNZB 1IYFA 4HPLB 1R4MI 3NS1A 4JLCA 2J42A 3TEZA 1TKYA 2BKRB 4DDGD 2KXJA 2UU7A 3A9JB 2BQQA 1FXIA 2CHWA 1WX7A 1JWBD 3A9KA 3GS2A 2JT4B 1N63A 2DNFA 3AN1A 4HVBA 1WI0A 5E6NA 1I7HA 1FNUA 3MTNB 1EU4A 5TSSA 1WGDA 3DWGC 3P4QB 1XF5L 4AOFA 4ZRKA 2M0XA 1N62A 1I35A 2KJRA 1MHHE 3MJWA 1HE8A 1FRDA 2K0PA 2KC2A 2EKIA 2MH7A 1TS4A 1TBEA 3BZDB 4BFRA 4JWUC 2MEKA 3NZUA 4HDQA 3RNEC 1S1QB 2AQ1B 5D6JB 2L83A 3P4RB 2O2VB 3K9OB 4S0RA 2VZKD 4W9GA 4A55A 1OQRA 1YQBA 2KOXA 3JW0X 3W5UB 2N9EB 2UWQA 2WXMA 4WURA 1MG4A 1UF0A 1JALA 4RNAA 3BK1A 1KM7A 3HK0A 1NDDA 3PZ7A 2XEWA 1E8YA 2WDTB 4C56C 1M94A 2ZCCA 1QLBB 2WDQB 4WQMA 4DHJD 1E8XA 4B9KA 2BS3B 3SU8X 4EZJA 1ENFA 5AZHA 2Q5WD 1ROEA 4PK1A 2WDRB 2CJNA 3TL5A 4DXAB 1JWSD 3QJZA 5DPRA 3IG3A 4ZRQA 4WQOB 1SXTA 2BB6A 4KSLC 4FJZA 1P0RA 3AB5A 3OWEB 1K53A 4BBNF 4EFOA 4ZDVA 3ZTCA 2NCNA 1C3TA 4OZCA 2M8SA 3GE3C 2KQ4X 2NPTB 1T0YA 1YJJA 3LDZE 2JZZA 2WX0A 2MHJA 1UBIA 4HRSA 1EF5A 2JYEA 1JRUA 1ZW7A 4RH6A 3Q8AA 3ZJVA 2GB1A 3PGEA 2W9NA 4DXGA 2LASA 3VVWB 2J0MA 2MSED 3IHPC 2INNE 1TY2A 3QCAA 4L23A 2BYTA 3AEAB 1NYQA 4NAWB 2HJ8A 4LNOA 4BOZB 2W3RA 2JRIB 2JY6A 4LLGM 3RNFC 2WU2B 3AE3B 1MG8A 3CSFA 2NS5A 4AJYB 3LB8C 2KVRA 3ZXRA 2JXTA 2KAJA 4C4VA 3FILB 5HFYA 2Y3AA 2B76B 4G3XB 1IBXB 2LFIA 4MM3B 2WLBA 2JSVX 1U4AA 2LGDA 3A1QA 3KYCD 3EA6A 3R2IA 4PS7A 4KGRA 3AEDB 5EDSA 4P16A 4BKSA 4XC2A 4AP4C 4KIKA 1SB3C 4N6EB 1TZOA 3A33B 4PS3A 1IPGA 2KQSA 4KIKB 4DWFA 3KW5B 4MM3A 1XCTL 4JE3B 3AU5A 1WGRA 1NI2A 2AL6A 1CMXB 5BYSA 3JVZX 4P1CC 1FXAA 3VUWA 4NQKE 1SBBB 1QT9A 2FCQA 2V4IB 5FKAC 1PUTA 2KX3A 2ON8A 4KVGB 4HROA 1KTKA 3ML8A 1R4MB 5FR3A 2G4SA 4OZAA 1TT5B 3ZUNA 2FE8A 2XNAC 3KLSX 4R3DA 3EC8A 4GIVA 4US8A 1R7SA 3ETRA 4HK2A 1WZ3A 3ONSA 4KGTA 2O6VD 2DHZA 2PVOD 3VR8B 2NR2A 2V3SA 2O6VB 1VDVA 2MP2B 1IGCA 1MJDA 2N1WA 3S2AA 3UIOB 3APDA 2CHZA 4IWOA 3NVWA 1TKEA 3APCA 3DPDA 2WXKA 1WJ4A 1Q1OA 2WWZA 2KMAA 1BXTA 3I9V1 2J0KA 2BT6A 1HA5A 2MW5A 1XLPA 2VH2A 3U8ZA 5JH5C 3Q14C 4YWGG 1V5TA 1DOIA 2GBJA 1LM8B 4JIOU 2KQ7A 2JRHA 4CQNA 4WWOA 1HEZE 4JWSC 5BO4B 2BS4B 1MVKA 2ZVNA 4YTNB 5IAAC 3GZNB 3Q2AC 2Z0EB 4IC7B 3Q3FA 2QIEB 4ZHOA 2L8JA
chains in the Genus database with same CATH topology
4KZCA 3W1YA 2DAJA 3RUIB 4IG7B 2BYFA 3V6CB 4W9IA 1LFDA 2MBQA 2DYMA 1V81A 2AWTA 2PJHA 2D2QA 3T9LA 1WIAA 3PHXB 3T8MA 1UD7A 2KMCA 2JXXA 2YLMA 1YIWA 2DENB 4IW0A 3TIXA 2GBMA 2DZKA 4IM0A 5G2NA 5LXIB 1RFAA 4GOCA 4TQ1A 3WA0A 4K81A 3V6EB 4GDLB 3M95A 1E8ZA 3PZDA 1V86A 4JL9A 2NVUI 3VHTC 1K8RB 3O65B 1WJ6A 2JVCA 2LVOA 2LZ6A 1EO6A 1P98A 3DVNV 3H1UA 4B95A 4ANXA 2MLBA 3AU4A 4TUUA 1EUVB 4F7ZA 3DBLI 1I42A 3A9KB 1WY8A 4OVUA 2IO1B 1X1MA 4YL8A 4HCPB 1F9JA 1OGWA 2ZJDA 4GDKA 4G11A 4MSQB 4KSKC 1Z5SB 3ZNHB 2CHXA 3ZRFA 4HPMB 1AARA 4NJ7A 4W9HA 4DHZE 2KWCA 4BBNC 1ZKHA 2LVQA 2C7NB 1J0GA 5KHQA 1GUAB 2GMIC 2L00B 1WZ0A 3PSEB 5CHFA 1P3QU 4A3PA 2J7QB 2DYOA 2EMTA 5KHOA 2WYQA 2IZVB 5FR6A 4BKTA 2KDBA 2EMSA 2KFJA 3UINB 2YVCA 2ZNVB 5GMVA 3IBEA 1E5WA 1KJTA 4ANUA 4CO7A 1E8WA 4XX5A 5DPTA 3L0WB 1WXVA 5D2MB 3TMPB 2JF5A 5CHWA 3ZVVA 1ISNA 4MJSB 3RULA 1TZ1A 2IY1B 4F1SA 2ZCBA 3GZNI 2MBEA 2IO2B 4GDLA 3DQVA 4BOSC 3L16A 2J0JA 3B08A 2L05A 2D11A 3DCGA 3M3JA 2XK5A 2KZRA 4GU2A 2N7EA 3APFA 3WIMA 3QC8B 4W9DA 3RCZA 1A5RA 2G45B 2ZPYA 4GN1A 2D3GA 2BYVE 1LXDA 1WX8A 4FA6A 5E6PA 2GBNA 3VQIA 3GOEA 3SD5A 1XD3B 1OTRB 3ZO5B 1J19A 2MP2A 4MGIE 4NPNA 4WJPA 2CS4A 3R66C 3I3TB 3ZNGC 1OEYJ 2ZEQA 3ZW3A 2NPTA 4GGQA 3CF6E 4PYZA 4ASWC 2QHOA 2R2OA 2ZNVC 3NZSA 4II2B 3ZLZA 2RD0A 4LJPB 1G6JA 2MA9B 4EZLA 2O2VA 1Z2MA 2PE6B 2KFKA 2A5UA 4MH0E 1UELA 2K1FA 4HLEA 4P7IA 1VD2A 5C1ZA 1ZGUB 2KX0A 4W9CA 2D07B 2IO3B 2MX2A 2JWZA 2K8CA 2Z59B 4ZRJA 2AL3A 3QQ8B 3ZNID 1SE9A 4AWJA 2HD5B 2HE7A 4EEWA 4FHKA 2HTHA 3JYUA 1E7VA 1GNUA 3PV1A 3ZDTA 4A20A 3PTFC 2DAFA 4DHZB 2C5LC 2R2QA 3L17A 3K9PB 1WMHA 2DYBA 2MBHA 1L2NA 3PRZA 4JGHB 1J8CA 4EUTA 1YD8U 4ICUA 2KWUB 4IWPA 1WH3A 3VH4B 4TQ0A 5AZFA 2ZVOA 3PRMB 4DBGA 2IO0B 1V6EA 2L0TA 4HPLB 3ZNZB 1IYFA 1R4MI 3PLUA 2NBUA 2DZMA 4FJYA 3B0AA 2KLCA 4K7SA 2LVPA 2REXA 1R4NI 4JLCA 3U7DA 3UGBB 3DVGX 2BKRB 3ZRCA 2I1KA 2KXJA 4DDGD 4K7WA 3QAQA 4MJSA 5LXHA 3HM6X 1WFYA 1WJNA 3A9JB 2FCSA 1S3SG 3DOWA 1GC6A 2CHWA 1WX7A 3A9KA 2NBWB 2OJRA 2JT4B 3Q3FA 4HVBA 1WR1A 1WI0A 2LI5A 5E6NA 2GBRA 3KVFB 2DZIA 3V62A 1WF9A 3MTNB 2PE9A 2IBIB 1P1AA 4KZ0A 1WGDA 4MGYE 4DHJB 2MBBB 3VUXA 1WX9A 3KUCB 4HDOA 4E74A 3ECIA 3C0RB 4FN2A 4LDTB 3SHQA 2WX1A 1NBFC 4AOFA 2M1MA 3QA8A 4ZRKA 3OAWA 1XT9B 2N9XA 4LDTD 4FHJA 3ENEA 4XZ4A 2M0XA 2MBOA 2KJ6A 3WAMA 5L83A 2KDEB 3H7PA 3VUYA 2DX5B 5HKHA 1UGMA 3UIPB 1I35A 3H6NA 2KJRA 4W9KA 2BGFA 4HWIB 3MJWA 2KN5A 2ZPNA 1D3ZA 2JUOA 1HE8A 2UYZB 3PPAA 2C60A 4ZRIA 1KLVA 5CHVC 4EZKA 5AEKB 3VAWA 2C7HA 2KC2A 1GJZA 1UZXB 3RT3B 1TBEA 4AUQC 4IWQA 4BFRA 2KHWB 1RRBA 4WWNA 3QX1A 2A4ZA 3PVLA 3NZUA 4HDQA 2JPHA 4PS8A 2KO3A 4MSMB 4NAWA 1S1QB 4MGKE 3WANA 4GB9A 2D10A 4B6WA 5D6JB 2G4DB 4I6NB 1V49A 2N7DA 4X57B 5LLIA 1H8CA 2O2VB 4DDID 2NBVB 1LQBA 4WJQA 5DPSA 3K9OB 4W9EA 4NQLB 3PRPB 4W9JA 4W9GA 2MQJA 1YQBA 5TR5A 2M4NA 1L7YA 3RZWC 2KOXA 3JW0X 4PYUA 2N9EB 2UWQA 3QK0A 1KOTA 1YX6B 2N9PC 4ICVA 3H9DA 4WJOA 4IM2A 4GDKB 1KM7A 3HK0A 1NDDA 2K39A 2XEWA 1E8YA 2K8HA 2WDTB 1WE7A 2LRUA 1M94A 2ZCCA 1WM2A 2KK8A 4KV2A 1WRDB 2K6QA 3KUDB 1E8XA 4DHJD 4B9KA 5J17A 3SU8X 4OVVA 4EZJA 3PHWB 1V2YA 5AZHA 3A4RA 2IY0B 1IP9A 3AI5A 1V9JA 2FIFA 4HCNB 1Q5WB 3TL5A 3ZKJC 4DXAB 2LRWA 3DBHI 3QJZA 1FXTB 1WXMA 2FAZA 3JSVB 2LJ5A 4LJOB 3U30A 5DPRA 5JHAA 3IG3A 1Y8RC 4WQOB 4TKNA 3H7PB 4W9FA 4NY0A 2RSUA 3EECA 2L7RA 2XBBC 4KSLC 4EOYA 4FJZA 1P0RA 2BPSA 2KDIA 4JQWC 4BBNF 3PS6A 4EFOA 4ZDVA 2BF8B 3V61A 3ZTCA 2MWSB 2NCNA 3M63B 4HJKA 1C3TA 2M17A 5AZGA 2M8SA 5J18A 2L0FA 3Q3JA 3UQBA 2NPTB 4KDLB 1T0YA 4M0WB 3LDZE 2JZZA 2KJHB 2WX0A 3VH3B 4FADA 2KDFB 1UBIA 1EF5A 1JRUA 1ZW7A 1E90A 3VFKA 4CYEA 1UBQA 3HM3A 4URKA 3L13A 2EKEC 2W9NA 3PGEA 3AULA 3OJ4B 2LASA 2VRRB 3CMMB 3VVWB 2J0MA 2IYDB 2MSED 2V1YA 3IHPC 3QCAA 3PREA 4G0NB 3MHSD 1WE6A 3QIJA 4EKUA 2GOWA 4HXDA 4NAWB 2HJ8A 1P9DU 4WAAA 2GBKA 3ZDMC 4BOZB 3DVGY 2JRIB 2LGYA 4AJWA 1GC7A 2JY6A 1WGHA 2BWFA 2K8BA 1WR6E 3AXCA 2FCMA 1BT0A 1WJUA 4KDIC 1MG8A 3CSFA 5JZEB 3NS8A 2B3AA 2NS5A 3P2BA 2KVRA 4AJYB 4ANWA 2KKCA 2L3ZA 1YX5B 2V4LA 4M8MA 3N32A 1UH6A 3A4SC 4W9LA 5L95C 2FUHB 4TV3A 4FULA 4CHKA 3ALBA 2N4FA 4GSWA 4RMAA 4G3XB 3RYTA 1OEYA 4FJVB 3R3MA 5E6OA 3TBLD 3KYDD 4II3B 1OQYA 3UQAA 3NHEB 5J2RA 5DCNA 3OLMD 1U4AA 2LGDA 4E71A 3A1QA 3KYCD 4I6LB 1C1YB 4F8CB 3JSVA 4J6IA 2FIDA 2C9WB 4PS7A 1PQSA 4E3CA 1RLFA 2FNJB 5EDSA 3VTVA 2I1JA 2JZ3B 3D32A 3ML9A 4BKSA 4XC2A 2K6DB 4AP4C 4KIKA 5CTRC 3A33B 2Z0DB 4PS3A 3ZTDA 1IPGA 2KQSA 4M8NA 5JHBA 1WYWB 4KIKB 3ZIMA 2LUEA 4DWFA 3KW5B 4MM3A 2FCNA 2O6VA 2KFKB 4ZYNA 4K1RB 3R7RA 4BVUC 4IUMB 1Q0WB 1WGGA 3AU5A 1WGRA 3BINA 3HHMA 1NI2A 3BY4B 3RD2A 2AL6A 2N1VA 1CMXB 1E7UA 3JVZX 3VUWA 3DBSA 4NQKE 3KH0A 2KD0A 3WAPA 2KANA 2LXCA 1TGZB 5IA7A 4MDKE 4FLHA 4I6PA 2PPHA 3L08A 3X0WA 4NJ6A 2RGFA 2KC1A 2FCQA 3WAOA 3B1LX 2Y5BB 3LJ3A 4FBJB 1WMHB 2KX3A 1XQQA 2K25A 4DK5A 3NOBA 4GMVA 4KVGB 2BYEA 4MGZE 3DBRI 3ML8A 2L76A 3N3KB 3VTUA 2G4SA 3PT2B 1RAXA 3EHVA 3ZUNA 1QZEA 2XK5B 2MRPA 4WJNA 1V5OA 3EC8A 3WALA 2KWVB 4GIVA 2RR9A 4ANVA 2KTFA 1EF1A 3VXWA 2G3QB 2CR5A 4IM3A 3VDZA 4BKGA 4RM8A 1VCBA 4N9F4 3L10B 2LGXA 4HK2A 1WZ3A 3ONSA 1WXSA 2O6VD 3W1SA 2DHZA 2AEHA 1H4RA 3W1SC 2LXAA 3NY5A 4G50A 4MEMA 2KNBA 2NR2A 2V3SA 2O6VB 3DDCB 1SGHA 2MP2B 3SDLC 3DVNU 3TJPA 3UF8A 3QHTA 1WM3A 2ZZPB 3PLVA 4GXBA 2N1WA 2OOBB 3S2AA 2MCNB 3UIOB 1GG3A 3APDA 4RM9A 1TTNA 4K7UA 1WXAA 4A3OA 1SIFA 2CHZA 4IWOA 3APCA 3DPDA 3M62B 3CSTA 1WJ4A 1Q1OA 2WWZA 2KMAA 5D7GA 2ASQA 2BWES 2DZJA 2KTRB 5C23A 2J0KA 3VTWA 2MW5A 4MELA 1V80A 3U8ZA 5JH5C 3A1QB 1WGYA 3R7QA 4LCDE 2CKHB 3EFUA 3X23A 4BKSD 2CU1A 1V5TA 2GBJA 2PEAA 2LD9A 2KLGA 1LM8B 5DPWA 3HIZA 4JIOU 2KQ7A 2BKFA 3N30A 3KUZA 3QWZB 2AYOB 2JRHA 5D94A 3QARA 3A9JA 2RPQA 3H7SA 2KTRA 4WWOA 5BO4B 3RZFA 3IFWB 5G55A 4WWPA 3OJ3A 3TCAA 2LWPA 4NNJB 2C7MB 3L54A 3IVFA 2ZVNA 5IAAC 3V60A 5CX3A 2Z0EB 4IC7B 1YJ1A 2L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZC A;  3W1Y A;  2DAJ A;  3RUI B;  4IG7 B;  2BYF A;  3V6C B;  4W9I A;  1LFD A;  2MBQ A;  2DYM A;  1V81 A;  2AWT A;  2PJH A;  2D2Q A;  3T9L A;  1WIA A;  3PHX B;  3T8M A;  1UD7 A;  2KMC A;  2JXX A;  2YLM A;  1YIW A;  2DEN B;  4IW0 A;  3TIX A;  2GBM A;  2DZK A;  4IM0 A;  5G2N A;  5LXI B;  1RFA A;  4GOC A;  4TQ1 A;  3WA0 A;  4K81 A;  3V6E B;  4GDL B;  3M95 A;  1E8Z A;  3PZD A;  1V86 A;  4JL9 A;  2NVU I;  3VHT C;  1K8R B;  3O65 B;  1WJ6 A;  2JVC A;  2LVO A;  2LZ6 A;  1EO6 A;  1P98 A;  3DVN V;  3H1U A;  4B95 A;  4ANX A;  2MLB A;  3AU4 A;  4TUU A;  1EUV B;  4F7Z A;  3DBL I;  1I42 A;  3A9K B;  1WY8 A;  4OVU A;  2IO1 B;  1X1M A;  4YL8 A;  4HCP B;  1F9J A;  1OGW A;  2ZJD A;  4GDK A;  4G11 A;  4MSQ B;  4KSK C;  1Z5S B;  3ZNH B;  2CHX A;  3ZRF A;  4HPM B;  1AAR A;  4NJ7 A;  4W9H A;  4DHZ E;  2KWC A;  4BBN C;  1ZKH A;  2LVQ A;  2C7N B;  1J0G A;  5KHQ A;  1GUA B;  2GMI C;  2L00 B;  1WZ0 A;  3PSE B;  5CHF A;  1P3Q U;  4A3P A;  2J7Q B;  2DYO A;  2EMT A;  5KHO A;  2WYQ A;  2IZV B;  5FR6 A;  4BKT A;  2KDB A;  2EMS A;  2KFJ A;  3UIN B;  2YVC A;  2ZNV B;  5GMV A;  3IBE A;  1E5W A;  1KJT A;  4ANU A;  4CO7 A;  1E8W A;  4XX5 A;  5DPT A;  3L0W B;  1WXV A;  5D2M B;  3TMP B;  2JF5 A;  5CHW A;  3ZVV A;  1ISN A;  4MJS B;  3RUL A;  1TZ1 A;  2IY1 B;  4F1S A;  2ZCB A;  3GZN I;  2MBE A;  2IO2 B;  4GDL A;  3DQV A;  4BOS C;  3L16 A;  2J0J A;  3B08 A;  2L05 A;  2D11 A;  3DCG A;  3M3J A;  2XK5 A;  2KZR A;  4GU2 A;  2N7E A;  3APF A;  3WIM A;  3QC8 B;  4W9D A;  3RCZ A;  1A5R A;  2G45 B;  2ZPY A;  4GN1 A;  2D3G A;  2BYV E;  1LXD A;  1WX8 A;  4FA6 A;  5E6P A;  2GBN A;  3VQI A;  3GOE A;  3SD5 A;  1XD3 B;  1OTR B;  3ZO5 B;  1J19 A;  2MP2 A;  4MGI E;  4NPN A;  4WJP A;  2CS4 A;  3R66 C;  3I3T B;  3ZNG C;  1OEY J;  2ZEQ A;  3ZW3 A;  2NPT A;  4GGQ A;  3CF6 E;  4PYZ A;  4ASW C;  2QHO A;  2R2O A;  2ZNV C;  3NZS A;  4II2 B;  3ZLZ A;  2RD0 A;  4LJP B;  1G6J A;  2MA9 B;  4EZL A;  2O2V A;  1Z2M A;  2PE6 B;  2KFK A;  2A5U A;  4MH0 E;  1UEL A;  2K1F A;  4HLE A;  4P7I A;  1VD2 A;  5C1Z A;  1ZGU B;  2KX0 A;  4W9C A;  2D07 B;  2IO3 B;  2MX2 A;  2JWZ A;  2K8C A;  2Z59 B;  4ZRJ A;  2AL3 A;  3QQ8 B;  3ZNI D;  1SE9 A;  4AWJ A;  2HD5 B;  2HE7 A;  4EEW A;  4FHK A;  2HTH A;  3JYU A;  1E7V A;  1GNU A;  3PV1 A;  3ZDT A;  4A20 A;  3PTF C;  2DAF A;  4DHZ B;  2C5L C;  2R2Q A;  3L17 A;  3K9P B;  1WMH A;  2DYB A;  2MBH A;  1L2N A;  3PRZ A;  4JGH B;  1J8C A;  4EUT A;  1YD8 U;  4ICU A;  2KWU B;  4IWP A;  1WH3 A;  3VH4 B;  4TQ0 A;  5AZF A;  2ZVO A;  3PRM B;  4DBG A;  2IO0 B;  1V6E A;  2L0T A;  4HPL B;  3ZNZ B;  1IYF A;  1R4M I;  3PLU A;  2NBU A;  2DZM A;  4FJY A;  3B0A A;  2KLC A;  4K7S A;  2LVP A;  2REX A;  1R4N I;  4JLC A;  3U7D A;  3UGB B;  3DVG X;  2BKR B;  3ZRC A;  2I1K A;  2KXJ A;  4DDG D;  4K7W A;  3QAQ A;  4MJS A;  5LXH A;  3HM6 X;  1WFY A;  1WJN A;  3A9J B;  2FCS A;  1S3S G;  3DOW A;  1GC6 A;  2CHW A;  1WX7 A;  3A9K A;  2NBW B;  2OJR A;  2JT4 B;  3Q3F A;  4HVB A;  1WR1 A;  1WI0 A;  2LI5 A;  5E6N A;  2GBR A;  3KVF B;  2DZI A;  3V62 A;  1WF9 A;  3MTN B;  2PE9 A;  2IBI B;  1P1A A;  4KZ0 A;  1WGD A;  4MGY E;  4DHJ B;  2MBB B;  3VUX A;  1WX9 A;  3KUC B;  4HDO A;  4E74 A;  3ECI A;  3C0R B;  4FN2 A;  4LDT B;  3SHQ A;  2WX1 A;  1NBF C;  4AOF A;  2M1M A;  3QA8 A;  4ZRK A;  3OAW A;  1XT9 B;  2N9X A;  4LDT D;  4FHJ A;  3ENE A;  4XZ4 A;  2M0X A;  2MBO A;  2KJ6 A;  3WAM A;  5L83 A;  2KDE B;  3H7P A;  3VUY A;  2DX5 B;  5HKH A;  1UGM A;  3UIP B;  1I35 A;  3H6N A;  2KJR A;  4W9K A;  2BGF A;  4HWI B;  3MJW A;  2KN5 A;  2ZPN A;  1D3Z A;  2JUO A;  1HE8 A;  2UYZ B;  3PPA A;  2C60 A;  4ZRI A;  1KLV A;  5CHV C;  4EZK A;  5AEK B;  3VAW A;  2C7H A;  2KC2 A;  1GJZ A;  1UZX B;  3RT3 B;  1TBE A;  4AUQ C;  4IWQ A;  4BFR A;  2KHW B;  1RRB A;  4WWN A;  3QX1 A;  2A4Z A;  3PVL A;  3NZU A;  4HDQ A;  2JPH A;  4PS8 A;  2KO3 A;  4MSM B;  4NAW A;  1S1Q B;  4MGK E;  3WAN A;  4GB9 A;  2D10 A;  4B6W A;  5D6J B;  2G4D B;  4I6N B;  1V49 A;  2N7D A;  4X57 B;  5LLI A;  1H8C A;  2O2V B;  4DDI D;  2NBV B;  1LQB A;  4WJQ A;  5DPS A;  3K9O B;  4W9E A;  4NQL B;  3PRP B;  4W9J A;  4W9G A;  2MQJ A;  1YQB A;  5TR5 A;  2M4N A;  1L7Y A;  3RZW C;  2KOX A;  3JW0 X;  4PYU A;  2N9E B;  2UWQ A;  3QK0 A;  1KOT A;  1YX6 B;  2N9P C;  4ICV A;  3H9D A;  4WJO A;  4IM2 A;  4GDK B;  1KM7 A;  3HK0 A;  1NDD A;  2K39 A;  2XEW A;  1E8Y A;  2K8H A;  2WDT B;  1WE7 A;  2LRU A;  1M94 A;  2ZCC A;  1WM2 A;  2KK8 A;  4KV2 A;  1WRD B;  2K6Q A;  3KUD B;  1E8X A;  4DHJ D;  4B9K A;  5J17 A;  3SU8 X;  4OVV A;  4EZJ A;  3PHW B;  1V2Y A;  5AZH A;  3A4R A;  2IY0 B;  1IP9 A;  3AI5 A;  1V9J A;  2FIF A;  4HCN B;  1Q5W B;  3TL5 A;  3ZKJ C;  4DXA B;  2LRW A;  3DBH I;  3QJZ A;  1FXT B;  1WXM A;  2FAZ A;  3JSV B;  2LJ5 A;  4LJO B;  3U30 A;  5DPR A;  5JHA A;  3IG3 A;  1Y8R C;  4WQO B;  4TKN A;  3H7P B;  4W9F A;  4NY0 A;  2RSU A;  3EEC A;  2L7R A;  2XBB C;  4KSL C;  4EOY A;  4FJZ A;  1P0R A;  2BPS A;  2KDI A;  4JQW C;  4BBN F;  3PS6 A;  4EFO A;  4ZDV A;  2BF8 B;  3V61 A;  3ZTC A;  2MWS B;  2NCN A;  3M63 B;  4HJK A;  1C3T A;  2M17 A;  5AZG A;  2M8S A;  5J18 A;  2L0F A;  3Q3J A;  3UQB A;  2NPT B;  4KDL B;  1T0Y A;  4M0W B;  3LDZ E;  2JZZ A;  2KJH B;  2WX0 A;  3VH3 B;  4FAD A;  2KDF B;  1UBI A;  1EF5 A;  1JRU A;  1ZW7 A;  1E90 A;  3VFK A;  4CYE A;  1UBQ A;  3HM3 A;  4URK A;  3L13 A;  2EKE C;  2W9N A;  3PGE A;  3AUL A;  3OJ4 B;  2LAS A;  2VRR B;  3CMM B;  3VVW B;  2J0M A;  2IYD B;  2MSE D;  2V1Y A;  3IHP C;  3QCA A;  3PRE A;  4G0N B;  3MHS D;  1WE6 A;  3QIJ A;  4EKU A;  2GOW A;  4HXD A;  4NAW B;  2HJ8 A;  1P9D U;  4WAA A;  2GBK A;  3ZDM C;  4BOZ B;  3DVG Y;  2JRI B;  2LGY A;  4AJW A;  1GC7 A;  2JY6 A;  1WGH A;  2BWF A;  2K8B A;  1WR6 E;  3AXC A;  2FCM A;  1BT0 A;  1WJU A;  4KDI C;  1MG8 A;  3CSF A;  5JZE B;  3NS8 A;  2B3A A;  2NS5 A;  3P2B A;  2KVR A;  4AJY B;  4ANW A;  2KKC A;  2L3Z A;  1YX5 B;  2V4L A;  4M8M A;  3N32 A;  1UH6 A;  3A4S C;  4W9L A;  5L95 C;  2FUH B;  4TV3 A;  4FUL A;  4CHK A;  3ALB A;  2N4F A;  4GSW A;  4RMA A;  4G3X B;  3RYT A;  1OEY A;  4FJV B;  3R3M A;  5E6O A;  3TBL D;  3KYD D;  4II3 B;  1OQY A;  3UQA A;  3NHE B;  5J2R A;  5DCN A;  3OLM D;  1U4A A;  2LGD A;  4E71 A;  3A1Q A;  3KYC D;  4I6L B;  1C1Y B;  4F8C B;  3JSV A;  4J6I A;  2FID A;  2C9W B;  4PS7 A;  1PQS A;  4E3C A;  1RLF A;  2FNJ B;  5EDS A;  3VTV A;  2I1J A;  2JZ3 B;  3D32 A;  3ML9 A;  4BKS A;  4XC2 A;  2K6D B;  4AP4 C;  4KIK A;  5CTR C;  3A33 B;  2Z0D B;  4PS3 A;  3ZTD A;  1IPG A;  2KQS A;  4M8N A;  5JHB A;  1WYW B;  4KIK B;  3ZIM A;  2LUE A;  4DWF A;  3KW5 B;  4MM3 A;  2FCN A;  2O6V A;  2KFK B;  4ZYN A;  4K1R B;  3R7R A;  4BVU C;  4IUM B;  1Q0W B;  1WGG A;  3AU5 A;  1WGR A;  3BIN A;  3HHM A;  1NI2 A;  3BY4 B;  3RD2 A;  2AL6 A;  2N1V A;  1CMX B;  1E7U A;  3JVZ X;  3VUW A;  3DBS A;  4NQK E;  3KH0 A;  2KD0 A;  3WAP A;  2KAN A;  2LXC A;  1TGZ B;  5IA7 A;  4MDK E;  4FLH A;  4I6P A;  2PPH A;  3L08 A;  3X0W A;  4NJ6 A;  2RGF A;  2KC1 A;  2FCQ A;  3WAO A;  3B1L X;  2Y5B B;  3LJ3 A;  4FBJ B;  1WMH B;  2KX3 A;  1XQQ A;  2K25 A;  4DK5 A;  3NOB A;  4GMV A;  4KVG B;  2BYE A;  4MGZ E;  3DBR I;  3ML8 A;  2L76 A;  3N3K B;  3VTU A;  2G4S A;  3PT2 B;  1RAX A;  3EHV A;  3ZUN A;  1QZE A;  2XK5 B;  2MRP A;  4WJN A;  1V5O A;  3EC8 A;  3WAL A;  2KWV B;  4GIV A;  2RR9 A;  4ANV A;  2KTF A;  1EF1 A;  3VXW A;  2G3Q B;  2CR5 A;  4IM3 A;  3VDZ A;  4BKG A;  4RM8 A;  1VCB A;  4N9F 4;  3L10 B;  2LGX A;  4HK2 A;  1WZ3 A;  3ONS A;  1WXS A;  2O6V D;  3W1S A;  2DHZ A;  2AEH A;  1H4R A;  3W1S C;  2LXA A;  3NY5 A;  4G50 A;  4MEM A;  2KNB A;  2NR2 A;  2V3S A;  2O6V B;  3DDC B;  1SGH A;  2MP2 B;  3SDL C;  3DVN U;  3TJP A;  3UF8 A;  3QHT A;  1WM3 A;  2ZZP B;  3PLV A;  4GXB A;  2N1W A;  2OOB B;  3S2A A;  2MCN B;  3UIO B;  1GG3 A;  3APD A;  4RM9 A;  1TTN A;  4K7U A;  1WXA A;  4A3O A;  1SIF A;  2CHZ A;  4IWO A;  3APC A;  3DPD A;  3M62 B;  3CST A;  1WJ4 A;  1Q1O A;  2WWZ A;  2KMA A;  5D7G A;  2ASQ A;  2BWE S;  2DZJ A;  2KTR B;  5C23 A;  2J0K A;  3VTW A;  2MW5 A;  4MEL A;  1V80 A;  3U8Z A;  5JH5 C;  3A1Q B;  1WGY A;  3R7Q A;  4LCD E;  2CKH B;  3EFU A;  3X23 A;  4BKS D;  2CU1 A;  1V5T A;  2GBJ A;  2PEA A;  2LD9 A;  2KLG A;  1LM8 B;  5DPW A;  3HIZ A;  4JIO U;  2KQ7 A;  2BKF A;  3N30 A;  3KUZ A;  3QWZ B;  2AYO B;  2JRH A;  5D94 A;  3QAR A;  3A9J A;  2RPQ A;  3H7S A;  2KTR A;  4WWO A;  5BO4 B;  3RZF A;  3IFW B;  5G55 A;  4WWP A;  3OJ3 A;  3TCA A;  2LWP A;  4NNJ B;  2C7M B;  3L54 A;  3IVF A;  2ZVN A;  5IAA C;  3V60 A;  5CX3 A;  2Z0E B;  4IC7 B;  1YJ1 A;  2L8J A; 
#chains in the Genus database with same CATH topology
 2INC C;  1SSN A;  2BYF A;  4W9I A;  5BYQ A;  2AWT A;  2D2Q A;  3T9L A;  3T8M A;  1UD7 A;  3ABV B;  2YLM A;  2GBM A;  5G2N A;  5LXI B;  5HI1 A;  4K81 A;  4GDL B;  1HTO A;  3M95 A;  3H8H A;  2WXO A;  1WJ6 A;  3Q3N C;  2LVO A;  2LZ6 A;  1SE3 A;  1EO6 A;  3J9C A;  4ZHP A;  4TUU A;  4M02 A;  4KX6 B;  2IO1 B;  1TIF A;  4PT5 A;  2IDY A;  2JU6 X;  1Z5S B;  1FCL A;  4W9H A;  4BZA A;  2HDE A;  2GMI C;  2DYO A;  2EMT A;  5KHO A;  1YNT E;  1ET6 A;  3UIN B;  2W3S A;  2ZNV B;  4ANU A;  1FCC C;  5IN7 A;  4XX5 A;  2JF5 A;  5CHW A;  1ISN A;  3AE9 B;  4ARC A;  2IPK D;  1L5P A;  2Y5C A;  2D11 A;  3DCG A;  3C8Y A;  4GU2 A;  2RPV A;  2N7E A;  3APF A;  1QOF A;  3RCZ A;  1PFD A;  2D3G A;  4FA6 A;  1UWM A;  2Z8L A;  1FMA D;  4WAF A;  2ICI A;  4RF1 A;  3ZNG C;  5C2T B;  2ZEQ A;  2WP9 B;  3CF6 E;  2QHO A;  4J3O D;  4II2 B;  2MJD A;  1V1P A;  1G6J A;  2FBW B;  4EZL A;  1Z2M A;  4RFB A;  4W9C A;  2D07 B;  2MX2 A;  2JWZ A;  2K8C A;  3ZNI D;  3U2S C;  2HD5 B;  5E6J A;  4FHK A;  2HTH A;  1KF6 B;  3JYU A;  1E7V A;  1GNU A;  3ZDT A;  4DHZ B;  2C5L C;  2JZP A;  2R2Q A;  1M4V A;  4EUT A;  2PKO A;  4TQ0 A;  4YSZ B;  4DBG A;  3BYT B;  2ZW0 A;  2L0T A;  2IGG A;  4WIP A;  2DZM A;  1F77 A;  2KLC A;  1R4N I;  2YEP B;  3DVG X;  1XLN A;  3ZRC A;  2I1K A;  1PGA A;  3IAM 1;  2K22 A;  2FCS A;  1S3S G;  2NBW B;  1KFY B;  1T3Q A;  2WS3 B;  1WR1 A;  2QC8 A;  1TS3 A;  2XN9 C;  3V62 A;  1WF9 A;  2IBI B;  2MBB B;  1VRA B;  1I4P A;  2E6X A;  3KUC B;  3ECI A;  3HUI A;  1T0R C;  2MJ3 A;  2M1M A;  2LUM A;  5IP4 D;  4FHJ A;  3H7P A;  3UIP B;  1OFF A;  1SE2 A;  2NTT A;  5AUI A;  1J7A A;  3I57 A;  2D3C A;  4YTP B;  3AEC B;  1QKZ A;  2PVG C;  2UYZ B;  1DOX A;  2C7H A;  2LJI A;  4HJG E;  1ZP0 B;  2OED A;  4AQ7 A;  3QX1 A;  2ONQ A;  4MSM B;  4NAW A;  4GB9 A;  4I6N B;  2N7D A;  5LLI A;  2OJW A;  4L1B A;  1STE A;  4W9E A;  1UNS A;  3MC0 B;  1UUP A;  2M4N A;  1L7Y A;  3RZW C;  3N1Z C;  2QJL A;  4LNI A;  1GPX A;  2N9P C;  3H9D A;  4GDK B;  3EGR A;  4N58 A;  3GE8 C;  1YOV B;  2K8H A;  1WE7 A;  1WM2 A;  2KK8 A;  1WRD B;  1JRP A;  1L0Y B;  1TS2 A;  4OVV A;  2CU3 A;  1V2Y A;  1ESF A;  4K3B A;  2LRW A;  3DBH I;  2FAZ A;  3JSV B;  3U30 A;  2QCZ A;  3AE2 B;  1EWC A;  1MFW A;  2KT7 A;  3H7P B;  4NY0 A;  2RSU A;  4MT5 A;  3L4P A;  1ZUD 2;  3M63 B;  4BAX A;  2L0F A;  2KJH B;  3P4S B;  1E90 A;  4ZYS A;  2VZK B;  4KKJ A;  3L13 A;  2EKE C;  1MI0 A;  1TY0 A;  1XLQ A;  2IYD B;  3RNG C;  2V1Y A;  3MHS D;  1NEN B;  4HXD A;  2GBK A;  1FFV A;  2LGY A;  4AJW A;  5IO9 A;  2BWF A;  3AXC A;  2DBY A;  4KDI C;  1T6B X;  1LGR A;  2KKC A;  1RM6 C;  5L95 C;  3AE7 B;  4TV3 A;  4FUL A;  3ALB A;  1E0Z A;  5EE3 A;  4A8X C;  1OEY A;  4FJV B;  3TBL D;  5E6O A;  2I38 A;  3KYD D;  4ZRP A;  3UQA A;  4YXD B;  5DCN A;  3U4E G;  4I6L B;  4F8C B;  2C9W B;  1AW7 A;  2I1J A;  2WHI A;  2N7J A;  4UDU C;  2Z0D B;  1F0Z A;  5JHB A;  3ZIM A;  1E7P B;  2LUE A;  3AE6 B;  2J53 A;  3R7R A;  2WNM A;  3HHM A;  4C80 A;  2N1V A;  4JX1 C;  4US9 A;  2I2Y A;  1KLU D;  1XCQ L;  2BBC A;  3WAP A;  1L0V B;  5IA7 A;  1K51 A;  2PPH A;  2QDF A;  4NJ6 A;  4EE2 A;  3WAO A;  3B1L X;  1KLG D;  3LXF A;  1WYG A;  2M19 A;  1WMH B;  4ARI A;  2BYE A;  4MAC A;  3B2G A;  3VTU A;  3FC4 A;  1HXY D;  3NJT A;  3PT2 B;  1D5M C;  3EHV A;  1PDX A;  2XK5 B;  2RMM A;  3AE4 B;  3KWL A;  2MRP A;  1V5O A;  2KWV B;  2RR9 A;  3SEB A;  2L32 A;  2WXQ A;  1EF1 A;  2G3Q B;  4IM3 A;  1SEB D;  3E9S A;  1GOZ A;  2K5P A;  3L10 B;  4RGM A;  1SJE D;  3U52 E;  1WXS A;  1T0Q C;  3W1S C;  2LXA A;  4G50 A;  1QOB A;  1ET9 A;  2KNB A;  4XGA B;  1SGH A;  3ZJT A;  3UF8 A;  1WM3 A;  3PLV A;  2OOB B;  1L6V A;  2MCN B;  4A3O A;  3TEW A;  1CJE A;  1N5X A;  1L4D B;  2DZJ A;  2KTR B;  4AS1 A;  1I4H A;  3R7Q A;  2CKH B;  4BKS D;  2PEA A;  1BUI C;  2KLG A;  3IAS 1;  3KUZ A;  3N20 C;  3H7S A;  4ZOH C;  2V0G A;  3NRZ A;  1GAQ B;  3OJ3 A;  2C7M B;  1A70 A;  3L54 A;  3IVF A;  3V60 A;  3W1Y A;  3RUI B;  3PO0 A;  4IG7 B;  3NG0 A;  3GP7 A;  2MJE A;  1YIW A;  2LHD A;  4IW0 A;  1V8C A;  4TQ1 A;  3WA0 A;  4L2Y A;  4XYC A;  1Y56 A;  5T8I A;  4YT0 B;  3PZD A;  2BVC A;  3V05 A;  1K8R B;  2JVC A;  3DHG C;  3DVN V;  4B95 A;  2MLB A;  3AU4 A;  3DBL I;  1BML C;  1WY8 A;  4OVU A;  1V97 A;  1JWM D;  1F9J A;  1AN8 A;  3ZNH B;  3ZRF A;  4HPM B;  1AAR A;  4NJ7 A;  2KWC A;  1ZKH A;  2LVQ A;  2C7N B;  1YMH E;  3KWV A;  2L00 B;  4A3P A;  1N6Z A;  1ZOY B;  2WYQ A;  2IZV B;  3FKY A;  5FR6 A;  4BKT A;  4S17 A;  1KJT A;  4A6Q A;  5DPT A;  5D2M B;  4HEA 1;  3IT6 B;  3RUL A;  3NVV A;  1K52 A;  2IY1 B;  4B0E A;  1D5X C;  3DQV A;  2J0J A;  1B1Z A;  3E56 A;  2KZR A;  3MFG A;  1D5Z C;  2NMQ A;  3QC8 B;  1A5R A;  2ZPY A;  1LXD A;  1WX8 A;  2KYW A;  3GOE A;  2JX5 A;  1XD3 B;  2GI9 A;  2QMT A;  3ZO5 B;  1J19 A;  4NPN A;  4WJP A;  2CS4 A;  3R66 C;  3I3T B;  1RYJ A;  3ZW3 A;  4C7Y A;  2NPT A;  2R2O A;  3ZLZ A;  2MA9 B;  2O2V A;  1D4B A;  2KFK A;  4MH0 E;  1UEL A;  1E6E B;  1HTQ A;  1TS5 A;  2IO3 B;  2AL3 A;  2WXG A;  1SE9 A;  4EEW A;  4YSY B;  1FD6 A;  3Q8E A;  1VZ8 A;  3PTF C;  1DOY A;  3P42 A;  2DYB A;  2MBH A;  1L2N A;  3PRZ A;  4M0W A;  2KMM A;  1J8C A;  1YD8 U;  4ICU A;  3VH4 B;  1WH3 A;  4NAM A;  2ZVO A;  2IO0 B;  1V6E A;  4RF0 A;  4N59 A;  2NBU A;  3RI7 C;  3B0A A;  4K7S A;  2LVP A;  2REX A;  1N61 A;  2WXF A;  2TSS A;  1JW9 D;  1E9M A;  4MJS A;  2WXR A;  1WFY A;  3HM6 X;  5LNK 1;  1HQR D;  2BS2 B;  1GC6 A;  3HVZ A;  1Q10 A;  3AE1 B;  2OJR A;  1WXQ A;  2GBR A;  3KVF B;  2FUG 1;  2JWU A;  2YEP F;  2PE9 A;  1P1A A;  3T3O A;  4MGY E;  5HHD G;  3VUX A;  4HDO A;  3VRB B;  4LDT B;  3SHQ A;  2WXN A;  3OAW A;  2KDM A;  1RWS A;  2N9X A;  1ZDX A;  2IJ0 A;  4TMA B;  1VZ6 A;  2KDE B;  3VUY A;  5HKH A;  2DX5 B;  1UGM A;  1YN4 A;  3H6N A;  4Q2J A;  4W9K A;  2BGF A;  4HKZ E;  1D3Z A;  2JUO A;  3PPA A;  3V3X A;  1XXG A;  1KLV A;  2D5G A;  1GJZ A;  3VAW A;  2IGH A;  2RDG A;  4AUQ C;  5H8Y E;  5IOI A;  4MGK E;  4B6W A;  2IND C;  1V49 A;  4X57 B;  4DDI D;  2NBV B;  1LQB A;  4WJQ A;  3HVD A;  5G5H A;  4NQL B;  2G1E A;  3PRP B;  1GB1 A;  5TR5 A;  4PYU A;  1TKG A;  1XO3 A;  3QK0 A;  3BK2 A;  1YX6 B;  2DWQ A;  4WJO A;  4IM2 A;  4C7Z A;  3ZXV A;  1F1H A;  1C4C A;  1ZPS A;  4B0M A;  5GXG B;  2SAK A;  2GRI A;  5J17 A;  3AEF B;  2IY0 B;  4D2K A;  2KWD A;  4HCN B;  1Q5W B;  1V1O A;  3ZKJ C;  2W82 A;  1WXM A;  2LJ5 A;  3AM9 A;  1C9F A;  3IT4 B;  2WXH A;  5JHA A;  4TKN A;  3EEC A;  2L7R A;  2XBB C;  4WWM A;  4EOY A;  2EEL A;  2BPS A;  2BF8 B;  2MWS B;  2M17 A;  3ZGZ A;  1K50 A;  5J18 A;  1KRH A;  4KDL B;  4OHJ A;  3VH3 B;  4H2A A;  1UBQ A;  4URK A;  3RNA C;  1D6E C;  3OJ4 B;  3AEB B;  3R8B A;  2VRR B;  3CMM B;  3B2F A;  3PRE A;  1WE6 A;  3QIJ A;  1ZXI A;  1FO4 A;  3ZDM C;  2E3T A;  3DVG Y;  1JQ4 A;  4OW0 A;  5JXV A;  1C79 A;  3TSS A;  3Q8C A;  5MPO A;  4C00 A;  1WJU A;  1P7F A;  1QOA A;  1PGX A;  3NS8 A;  2B3A A;  2LHE A;  4ANW A;  4M8M A;  1ACC A;  1YX5 B;  2L3Z A;  3A4S C;  2N0S B;  5G5G A;  2N4F A;  4GSW A;  3MC8 A;  4RMA A;  5BYR A;  3CIR B;  3R3M A;  1OQY A;  1I4G A;  4HPP A;  4E71 A;  3MHZ A;  3JSV A;  4J6I A;  3C19 A;  1FNV A;  3TEY A;  1PQS A;  4E3C A;  2FNJ B;  4XE0 A;  3VTV A;  2JZ3 B;  1WSP A;  5CTR C;  3ZTD A;  1P7E A;  4NZL B;  3TUO A;  1WYW B;  2X8X X;  5D3I B;  2FCN A;  1C4A A;  2O6V A;  4K1R B;  4IUM B;  1Q0W B;  1WGG A;  3BIN A;  3BY4 B;  2WXL A;  4RGT A;  4MDK E;  4I6P A;  3X0W A;  2LGI A;  2R61 A;  2WGS A;  2KC1 A;  1NI3 A;  3MC9 A;  2QSD A;  3LJ3 A;  2W54 A;  3LYY A;  4FBJ B;  5HG2 A;  1L0X B;  4GMV A;  4MGZ E;  1PYW D;  3DBR I;  4HKQ A;  2L76 A;  4KKI A;  3BYY B;  1RAX A;  1QZE A;  3WAL A;  4OZB A;  2HTM E;  3KQ4 A;  1AWD A;  3VXW A;  4BKG A;  4N9F 4;  2AQ3 B;  3W1S A;  2AEH A;  1I4Q A;  4MEM A;  5IKC M;  1FFU A;  3SDL C;  3TJP A;  2ZZP B;  4GXB A;  2WQY B;  1GG3 A;  1TTN A;  1WXA A;  1SIF A;  2LMC A;  4IKG A;  3CST A;  2BB5 A;  1JCK B;  2ASQ A;  1E10 A;  1WGK A;  1V80 A;  3VR9 B;  1WGY A;  4LCD E;  3EFU A;  2CU1 A;  3N1Y C;  4LK0 M;  4DXF A;  5DPW A;  3N30 A;  3QWZ B;  2AYO B;  2M0A A;  1IGD A;  5D94 A;  3A9J A;  1EWY C;  2RPQ A;  5EE0 A;  2M56 B;  3RZF A;  5BMG A;  1YN5 A;  3UI3 A;  4NNJ B;  1L6U A;  3P1M A;  1J7C A;  1FEH A;  5CX3 A;  2WDV B;  1TJE A;  1YJ1 A;  3AI5 A;  2DAJ A;  4LNN A;  2MBQ A;  2DYM A;  2PJH A;  2X38 A;  2LGS A;  4RGN A;  3RN9 C;  5I4D A;  3GB1 A;  1RFA A;  4GOC A;  4YSX B;  4TSS A;  1E8Z A;  1V86 A;  2NVU I;  3O65 B;  1P98 A;  3IXS A;  1EUV B;  1I42 A;  3DBL B;  3A9K B;  3WCQ A;  1X1M A;  1HZ5 A;  4G11 A;  2ZJD A;  4MSQ B;  4KSK C;  2J52 A;  1MHX A;  4DHZ E;  4XWW A;  5KHQ A;  3RNC C;  2J7Q B;  2KDB A;  3NUH B;  2Y5P A;  2EMS A;  2KFJ A;  5EE9 A;  5GMV A;  3IBE A;  1E5W A;  1E8W A;  1WXV A;  3O13 A;  2WXP A;  5BMH A;  3N1X C;  1TZ1 A;  1OQQ A;  2ZCB A;  3GZN I;  2MBE A;  4GDL A;  4BOS C;  4QAY A;  3L16 A;  1XLO A;  2L05 A;  1I4R A;  2XK5 A;  1VZ7 A;  2KN4 A;  2BYV E;  3NVY A;  5E6P A;  3DWM A;  3VQI A;  3SD5 A;  1OTR B;  4MGI E;  4FXC A;  3NZS A;  2G9H D;  2PE6 B;  3AMZ A;  2A5U A;  2K1F A;  1ZGU B;  3CWI A;  3U7Z A;  2Z59 B;  4AWJ A;  2HE7 A;  3EUB 2;  4KGS A;  4A20 A;  2DAF A;  4RCO A;  3L17 A;  1B9R A;  3K9P B;  4XWT A;  2IGD A;  4IWP A;  1SF0 A;  1YQ3 B;  4XDC A;  3ZYY X;  1J7B A;  3N9Y C;  4LNF A;  3PLU A;  2L1A A;  4LTU A;  4FJY A;  5C3J B;  3U7D A;  1YJI A;  3UGB B;  1QQR A;  3HRD D;  3ZJU A;  4K7W A;  3QAQ A;  5LXH A;  1WJN A;  3AH7 A;  2VH1 A;  3DOW A;  4ACF A;  1T5X D;  1SE4 A;  1UGJ A;  3SFE B;  3BII D;  2LI5 A;  2DZI A;  1CK1 A;  2H89 B;  4KZ0 A;  4DHJ B;  1WX9 A;  4E74 A;  4FN2 A;  3C0R B;  2WX1 A;  1NBF C;  3QA8 A;  1XT9 B;  5H92 C;  4LDT D;  3ENE A;  4XZ4 A;  1VR9 A;  2MBO A;  2KJ6 A;  3WAM A;  5L83 A;  3DHI C;  1C77 A;  1V1P B;  4HWI B;  2KN5 A;  2ZPN A;  2C60 A;  4ZRI A;  5CHV C;  4EZK A;  5AEK B;  3AE8 B;  1UZX B;  2CJO A;  3RT3 B;  4IWQ A;  2KHW B;  1RRB A;  4WWN A;  2ZW1 A;  2A4Z A;  1IUE A;  3PVL A;  2JPH A;  4PS8 A;  2KO3 A;  3WAN A;  2D10 A;  2G4D B;  1H8C A;  2J4X A;  2AQ2 B;  1F2R C;  1QF6 A;  5DPS A;  3BWU D;  4W9J A;  4NJC A;  2MQJ A;  3Q3M C;  3RMK C;  4M01 A;  1ZE3 D;  4YTM B;  1QOG A;  1KOT A;  4ICV A;  5BMI A;  4C4V B;  2K39 A;  2LRU A;  3DHH C;  3EFC A;  4KV2 A;  3URY A;  2K6Q A;  3KUD B;  4IOI E;  3MJ5 A;  3PHW B;  3A4R A;  1IP9 A;  4A90 A;  1V9J A;  2FIF A;  1FXT B;  4LNK A;  4LJO B;  1Y8R C;  4W9F A;  2KDI A;  4JQW C;  3PS6 A;  4P6V F;  3V61 A;  2V3N A;  3P63 A;  4HJK A;  1F52 A;  5AZG A;  3BVZ A;  2JQR B;  2QEJ C;  3Q3J A;  3UQB A;  1F2R I;  4M0W B;  4FAD A;  2KDF B;  2WU5 B;  3VFK A;  4CYE A;  2QIL A;  3HM3 A;  3AUL A;  2BTE A;  2LEK A;  4G0N B;  1R4N B;  4EKU A;  2GOW A;  1P9D U;  1UWX A;  4MH8 A;  4WAA A;  1KH0 A;  3I63 C;  1GC7 A;  1PGB A;  1WGH A;  2K8B A;  1WR6 E;  2FCM A;  1BT0 A;  3NZ3 A;  1C4P A;  5JZE B;  3P2B A;  2D3A A;  2AX5 A;  2V4L A;  3N32 A;  1UH6 A;  1I4X A;  4W9L A;  1VJK A;  2FUH B;  3W2D A;  1C78 A;  4CHK A;  5EE1 A;  3RYT A;  1JWA D;  4II3 B;  1HZ6 A;  5J2R A;  3NHE B;  3OLM D;  1DGJ A;  2V9H A;  1C1Y B;  1LO5 D;  2FID A;  3Q69 A;  1RLF A;  3D32 A;  3ML9 A;  3ZQ4 A;  4USA A;  2K6D B;  5D3D A;  3SR6 A;  2WXI A;  2KVZ A;  4M8N A;  2K9X A;  2RDH A;  1RFK A;  3I5J C;  4ZYN A;  2KFK B;  4BVU C;  1ZDV A;  3RD2 A;  3RFZ B;  1E7U A;  3PZ8 A;  3DBS A;  3KH0 A;  2KD0 A;  3AEG B;  2KAN A;  2LXC A;  1TGZ B;  5AUK A;  4FLH A;  2PW9 A;  3L08 A;  1JRO A;  2BW2 A;  3SFD B;  2RGF A;  3W9C B;  2Y5B B;  3VRA B;  1YN3 A;  1XQQ A;  1VLB A;  2K25 A;  4DK5 A;  3NOB A;  3BVM A;  1SIJ A;  3DBR B;  4P1B C;  2PTL A;  1JML A;  2K3U A;  4WJN A;  4ANV A;  2KTF A;  2CR5 A;  3VDZ A;  4XDD A;  4RM8 A;  1VCB A;  2LGX A;  1N5W A;  2N9K A;  2KAC A;  3R2T A;  1SJH D;  1H4R A;  2PIA A;  4A9A A;  3NY5 A;  3Q3O C;  4IDI A;  3DDC B;  3DVN U;  3QHT A;  3AV8 A;  4RM9 A;  4K7U A;  1FPY A;  3M62 B;  1FM0 D;  4DQO C;  5D7G A;  2V3P A;  3AE5 B;  1N60 A;  1L4Z B;  2BWE S;  2N9L A;  5C23 A;  3VTW A;  4MEL A;  3A1Q B;  3X23 A;  1XEE A;  2LD9 A;  3OG5 A;  3FIL A;  3HIZ A;  2BKF A;  3QAR A;  2ACZ B;  2KTR A;  1FIQ A;  3B9J A;  3Q6B A;  3IFW B;  5G55 A;  4WWP A;  3TCA A;  2LWP A;  1NEK B;  2H88 B;  1YQ4 B;  3N3K B;  4KZC A;  1NYR A;  2D3B A;  3AEE B;  3V6C B;  1LFD A;  1MPE A;  1V81 A;  1WIA A;  3PHX B;  2KMC A;  1AYF A;  2JXX A;  1FRR A;  2DEN B;  3TIX A;  2DZK A;  4WH4 A;  3TEX A;  4IM0 A;  2NTS A;  4O1N A;  3V6E B;  3Q8F A;  4M00 A;  4JL9 A;  3VHT C;  1ZXH A;  3H1U A;  1QIL A;  4ANX A;  2GLS A;  1EU3 A;  4F7Z A;  3P4P B;  4YL8 A;  3MP9 A;  4HCP B;  1OGW A;  3W5V B;  4GDK A;  2HJ1 A;  2PMV A;  4OVZ A;  2CHX A;  3FAH A;  4BBN C;  2DLB A;  1J0G A;  3RPF C;  1GUA B;  5CHF A;  1WZ0 A;  3PSE B;  5FK9 C;  1P3Q U;  2L52 A;  1GB4 A;  3Q8B A;  4REZ A;  2YVC A;  3BVG A;  2PLP A;  4CO7 A;  3L0W B;  3TMP B;  1CQV A;  3ZVV A;  4MJS B;  4K3C A;  4F1S A;  2IO2 B;  1JWU D;  3B08 A;  3M3J A;  2W55 A;  3WIM A;  3DBH B;  1WWT A;  4W9D A;  2G45 B;  4GN1 A;  1IBX A;  3T3N A;  2GBN A;  4ITK A;  2MP2 A;  2WXJ A;  2OHF A;  1OEY J;  1CZP A;  1T0S C;  4GGQ A;  1TYG B;  4PYZ A;  4ASW C;  2ZNV C;  1C76 A;  1WRI A;  2RD0 A;  4LJP B;  1DYQ A;  2SEB D;  4HLE A;  4P7I A;  1VD2 A;  5C1Z A;  2KX0 A;  1FNW A;  4RGO S;  4GLS C;  4ZRJ A;  2INP E;  3QQ8 B;  3NVZ A;  3RNB C;  1NVI D;  3PV1 A;  2JYT A;  1EM7 A;  1WMH A;  4JGH B;  2KWU B;  2RDB C;  5AZF A;  3PRM B;  4JPS A;  3ZNZ B;  1IYF A;  4HPL B;  1R4M I;  3NS1 A;  4JLC A;  2J42 A;  3TEZ A;  1TKY A;  2BKR B;  4DDG D;  2KXJ A;  2UU7 A;  3A9J B;  2BQQ A;  1FXI A;  2CHW A;  1WX7 A;  1JWB D;  3A9K A;  3GS2 A;  2JT4 B;  1N63 A;  2DNF A;  3AN1 A;  4HVB A;  1WI0 A;  5E6N A;  1I7H A;  1FNU A;  3MTN B;  1EU4 A;  5TSS A;  1WGD A;  3DWG C;  3P4Q B;  1XF5 L;  4AOF A;  4ZRK A;  2M0X A;  1N62 A;  1I35 A;  2KJR A;  1MHH E;  3MJW A;  1HE8 A;  1FRD A;  2K0P A;  2KC2 A;  2EKI A;  2MH7 A;  1TS4 A;  1TBE A;  3BZD B;  4BFR A;  4JWU C;  2MEK A;  3NZU A;  4HDQ A;  3RNE C;  1S1Q B;  2AQ1 B;  5D6J B;  2L83 A;  3P4R B;  2O2V B;  3K9O B;  4S0R A;  2VZK D;  4W9G A;  4A55 A;  1OQR A;  1YQB A;  2KOX A;  3JW0 X;  3W5U B;  2N9E B;  2UWQ A;  2WXM A;  4WUR A;  1MG4 A;  1UF0 A;  1JAL A;  4RNA A;  3BK1 A;  1KM7 A;  3HK0 A;  1NDD A;  3PZ7 A;  2XEW A;  1E8Y A;  2WDT B;  4C56 C;  1M94 A;  2ZCC A;  1QLB B;  2WDQ B;  4WQM A;  4DHJ D;  1E8X A;  4B9K A;  2BS3 B;  3SU8 X;  4EZJ A;  1ENF A;  5AZH A;  2Q5W D;  1ROE A;  4PK1 A;  2WDR B;  2CJN A;  3TL5 A;  4DXA B;  1JWS D;  3QJZ A;  5DPR A;  3IG3 A;  4ZRQ A;  4WQO B;  1SXT A;  2BB6 A;  4KSL C;  4FJZ A;  1P0R A;  3AB5 A;  3OWE B;  1K53 A;  4BBN F;  4EFO A;  4ZDV A;  3ZTC A;  2NCN A;  1C3T A;  4OZC A;  2M8S A;  3GE3 C;  2KQ4 X;  2NPT B;  1T0Y A;  1YJJ A;  3LDZ E;  2JZZ A;  2WX0 A;  2MHJ A;  1UBI A;  4HRS A;  1EF5 A;  2JYE A;  1JRU A;  1ZW7 A;  4RH6 A;  3Q8A A;  3ZJV A;  2GB1 A;  3PGE A;  2W9N A;  4DXG A;  2LAS A;  3VVW B;  2J0M A;  2MSE D;  3IHP C;  2INN E;  1TY2 A;  3QCA A;  4L23 A;  2BYT A;  3AEA B;  1NYQ A;  4NAW B;  2HJ8 A;  4LNO A;  4BOZ B;  2W3R A;  2JRI B;  2JY6 A;  4LLG M;  3RNF C;  2WU2 B;  3AE3 B;  1MG8 A;  3CSF A;  2NS5 A;  4AJY B;  3LB8 C;  2KVR A;  3ZXR A;  2JXT A;  2KAJ A;  4C4V A;  3FIL B;  5HFY A;  2Y3A A;  2B76 B;  4G3X B;  1IBX B;  2LFI A;  4MM3 B;  2WLB A;  2JSV X;  1U4A A;  2LGD A;  3A1Q A;  3KYC D;  3EA6 A;  3R2I A;  4PS7 A;  4KGR A;  3AED B;  5EDS A;  4P16 A;  4BKS A;  4XC2 A;  4AP4 C;  4KIK A;  1SB3 C;  4N6E B;  1TZO A;  3A33 B;  4PS3 A;  1IPG A;  2KQS A;  4KIK B;  4DWF A;  3KW5 B;  4MM3 A;  1XCT L;  4JE3 B;  3AU5 A;  1WGR A;  1NI2 A;  2AL6 A;  1CMX B;  5BYS A;  3JVZ X;  4P1C C;  1FXA A;  3VUW A;  4NQK E;  1SBB B;  1QT9 A;  2FCQ A;  2V4I B;  5FKA C;  1PUT A;  2KX3 A;  2ON8 A;  4KVG B;  4HRO A;  1KTK A;  3ML8 A;  1R4M B;  5FR3 A;  2G4S A;  4OZA A;  1TT5 B;  3ZUN A;  2FE8 A;  2XNA C;  3KLS X;  4R3D A;  3EC8 A;  4GIV A;  4US8 A;  1R7S A;  3ETR A;  4HK2 A;  1WZ3 A;  3ONS A;  4KGT A;  2O6V D;  2DHZ A;  2PVO D;  3VR8 B;  2NR2 A;  2V3S A;  2O6V B;  1VDV A;  2MP2 B;  1IGC A;  1MJD A;  2N1W A;  3S2A A;  3UIO B;  3APD A;  2CHZ A;  4IWO A;  3NVW A;  1TKE A;  3APC A;  3DPD A;  2WXK A;  1WJ4 A;  1Q1O A;  2WWZ A;  2KMA A;  1BXT A;  3I9V 1;  2J0K A;  2BT6 A;  1HA5 A;  2MW5 A;  1XLP A;  2VH2 A;  3U8Z A;  5JH5 C;  3Q14 C;  4YWG G;  1V5T A;  1DOI A;  2GBJ A;  1LM8 B;  4JIO U;  2KQ7 A;  2JRH A;  4CQN A;  4WWO A;  1HEZ E;  4JWS C;  5BO4 B;  2BS4 B;  1MVK A;  2ZVN A;  4YTN B;  5IAA C;  3GZN B;  3Q2A C;  2Z0E B;  4IC7 B;  3Q3F A;  2QIE B;  4ZHO A;  2L8J A; 
#chains in the Genus database with same CATH homology
 4KZC A;  3W1Y A;  2DAJ A;  3RUI B;  4IG7 B;  2BYF A;  3V6C B;  4W9I A;  1LFD A;  2MBQ A;  2DYM A;  1V81 A;  2AWT A;  2PJH A;  2D2Q A;  3T9L A;  1WIA A;  3PHX B;  3T8M A;  1UD7 A;  2KMC A;  2JXX A;  2YLM A;  1YIW A;  2DEN B;  4IW0 A;  3TIX A;  2GBM A;  2DZK A;  4IM0 A;  5G2N A;  5LXI B;  1RFA A;  4GOC A;  4TQ1 A;  3WA0 A;  4K81 A;  3V6E B;  4GDL B;  3M95 A;  1E8Z A;  3PZD A;  1V86 A;  4JL9 A;  2NVU I;  3VHT C;  1K8R B;  3O65 B;  1WJ6 A;  2JVC A;  2LVO A;  2LZ6 A;  1EO6 A;  1P98 A;  3DVN V;  3H1U A;  4B95 A;  4ANX A;  2MLB A;  3AU4 A;  4TUU A;  1EUV B;  4F7Z A;  3DBL I;  1I42 A;  3A9K B;  1WY8 A;  4OVU A;  2IO1 B;  1X1M A;  4YL8 A;  4HCP B;  1F9J A;  1OGW A;  2ZJD A;  4GDK A;  4G11 A;  4MSQ B;  4KSK C;  1Z5S B;  3ZNH B;  2CHX A;  3ZRF A;  4HPM B;  1AAR A;  4NJ7 A;  4W9H A;  4DHZ E;  2KWC A;  4BBN C;  1ZKH A;  2LVQ A;  2C7N B;  1J0G A;  5KHQ A;  1GUA B;  2GMI C;  2L00 B;  1WZ0 A;  3PSE B;  5CHF A;  1P3Q U;  4A3P A;  2J7Q B;  2DYO A;  2EMT A;  5KHO A;  2WYQ A;  2IZV B;  5FR6 A;  4BKT A;  2KDB A;  2EMS A;  2KFJ A;  3UIN B;  2YVC A;  2ZNV B;  5GMV A;  3IBE A;  1E5W A;  1KJT A;  4ANU A;  4CO7 A;  1E8W A;  4XX5 A;  5DPT A;  3L0W B;  1WXV A;  5D2M B;  3TMP B;  2JF5 A;  5CHW A;  3ZVV A;  1ISN A;  4MJS B;  3RUL A;  1TZ1 A;  2IY1 B;  4F1S A;  2ZCB A;  3GZN I;  2MBE A;  2IO2 B;  4GDL A;  3DQV A;  4BOS C;  3L16 A;  2J0J A;  3B08 A;  2L05 A;  2D11 A;  3DCG A;  3M3J A;  2XK5 A;  2KZR A;  4GU2 A;  2N7E A;  3APF A;  3WIM A;  3QC8 B;  4W9D A;  3RCZ A;  1A5R A;  2G45 B;  2ZPY A;  4GN1 A;  2D3G A;  2BYV E;  1LXD A;  1WX8 A;  4FA6 A;  5E6P A;  2GBN A;  3VQI A;  3GOE A;  3SD5 A;  1XD3 B;  1OTR B;  3ZO5 B;  1J19 A;  2MP2 A;  4MGI E;  4NPN A;  4WJP A;  2CS4 A;  3R66 C;  3I3T B;  3ZNG C;  1OEY J;  2ZEQ A;  3ZW3 A;  2NPT A;  4GGQ A;  3CF6 E;  4PYZ A;  4ASW C;  2QHO A;  2R2O A;  2ZNV C;  3NZS A;  4II2 B;  3ZLZ A;  2RD0 A;  4LJP B;  1G6J A;  2MA9 B;  4EZL A;  2O2V A;  1Z2M A;  2PE6 B;  2KFK A;  2A5U A;  4MH0 E;  1UEL A;  2K1F A;  4HLE A;  4P7I A;  1VD2 A;  5C1Z A;  1ZGU B;  2KX0 A;  4W9C A;  2D07 B;  2IO3 B;  2MX2 A;  2JWZ A;  2K8C A;  2Z59 B;  4ZRJ A;  2AL3 A;  3QQ8 B;  3ZNI D;  1SE9 A;  4AWJ A;  2HD5 B;  2HE7 A;  4EEW A;  4FHK A;  2HTH A;  3JYU A;  1E7V A;  1GNU A;  3PV1 A;  3ZDT A;  4A20 A;  3PTF C;  2DAF A;  4DHZ B;  2C5L C;  2R2Q A;  3L17 A;  3K9P B;  1WMH A;  2DYB A;  2MBH A;  1L2N A;  3PRZ A;  4JGH B;  1J8C A;  4EUT A;  1YD8 U;  4ICU A;  2KWU B;  4IWP A;  1WH3 A;  3VH4 B;  4TQ0 A;  5AZF A;  2ZVO A;  3PRM B;  4DBG A;  2IO0 B;  1V6E A;  2L0T A;  4HPL B;  3ZNZ B;  1IYF A;  1R4M I;  3PLU A;  2NBU A;  2DZM A;  4FJY A;  3B0A A;  2KLC A;  4K7S A;  2LVP A;  2REX A;  1R4N I;  4JLC A;  3U7D A;  3UGB B;  3DVG X;  2BKR B;  3ZRC A;  2I1K A;  2KXJ A;  4DDG D;  4K7W A;  3QAQ A;  4MJS A;  5LXH A;  3HM6 X;  1WFY A;  1WJN A;  3A9J B;  2FCS A;  1S3S G;  3DOW A;  1GC6 A;  2CHW A;  1WX7 A;  3A9K A;  2NBW B;  2OJR A;  2JT4 B;  3Q3F A;  4HVB A;  1WR1 A;  1WI0 A;  2LI5 A;  5E6N A;  2GBR A;  3KVF B;  2DZI A;  3V62 A;  1WF9 A;  3MTN B;  2PE9 A;  2IBI B;  1P1A A;  4KZ0 A;  1WGD A;  4MGY E;  4DHJ B;  2MBB B;  3VUX A;  1WX9 A;  3KUC B;  4HDO A;  4E74 A;  3ECI A;  3C0R B;  4FN2 A;  4LDT B;  3SHQ A;  2WX1 A;  1NBF C;  4AOF A;  2M1M A;  3QA8 A;  4ZRK A;  3OAW A;  1XT9 B;  2N9X A;  4LDT D;  4FHJ A;  3ENE A;  4XZ4 A;  2M0X A;  2MBO A;  2KJ6 A;  3WAM A;  5L83 A;  2KDE B;  3H7P A;  3VUY A;  2DX5 B;  5HKH A;  1UGM A;  3UIP B;  1I35 A;  3H6N A;  2KJR A;  4W9K A;  2BGF A;  4HWI B;  3MJW A;  2KN5 A;  2ZPN A;  1D3Z A;  2JUO A;  1HE8 A;  2UYZ B;  3PPA A;  2C60 A;  4ZRI A;  1KLV A;  5CHV C;  4EZK A;  5AEK B;  3VAW A;  2C7H A;  2KC2 A;  1GJZ A;  1UZX B;  3RT3 B;  1TBE A;  4AUQ C;  4IWQ A;  4BFR A;  2KHW B;  1RRB A;  4WWN A;  3QX1 A;  2A4Z A;  3PVL A;  3NZU A;  4HDQ A;  2JPH A;  4PS8 A;  2KO3 A;  4MSM B;  4NAW A;  1S1Q B;  4MGK E;  3WAN A;  4GB9 A;  2D10 A;  4B6W A;  5D6J B;  2G4D B;  4I6N B;  1V49 A;  2N7D A;  4X57 B;  5LLI A;  1H8C A;  2O2V B;  4DDI D;  2NBV B;  1LQB A;  4WJQ A;  5DPS A;  3K9O B;  4W9E A;  4NQL B;  3PRP B;  4W9J A;  4W9G A;  2MQJ A;  1YQB A;  5TR5 A;  2M4N A;  1L7Y A;  3RZW C;  2KOX A;  3JW0 X;  4PYU A;  2N9E B;  2UWQ A;  3QK0 A;  1KOT A;  1YX6 B;  2N9P C;  4ICV A;  3H9D A;  4WJO A;  4IM2 A;  4GDK B;  1KM7 A;  3HK0 A;  1NDD A;  2K39 A;  2XEW A;  1E8Y A;  2K8H A;  2WDT B;  1WE7 A;  2LRU A;  1M94 A;  2ZCC A;  1WM2 A;  2KK8 A;  4KV2 A;  1WRD B;  2K6Q A;  3KUD B;  1E8X A;  4DHJ D;  4B9K A;  5J17 A;  3SU8 X;  4OVV A;  4EZJ A;  3PHW B;  1V2Y A;  5AZH A;  3A4R A;  2IY0 B;  1IP9 A;  3AI5 A;  1V9J A;  2FIF A;  4HCN B;  1Q5W B;  3TL5 A;  3ZKJ C;  4DXA B;  2LRW A;  3DBH I;  3QJZ A;  1FXT B;  1WXM A;  2FAZ A;  3JSV B;  2LJ5 A;  4LJO B;  3U30 A;  5DPR A;  5JHA A;  3IG3 A;  1Y8R C;  4WQO B;  4TKN A;  3H7P B;  4W9F A;  4NY0 A;  2RSU A;  3EEC A;  2L7R A;  2XBB C;  4KSL C;  4EOY A;  4FJZ A;  1P0R A;  2BPS A;  2KDI A;  4JQW C;  4BBN F;  3PS6 A;  4EFO A;  4ZDV A;  2BF8 B;  3V61 A;  3ZTC A;  2MWS B;  2NCN A;  3M63 B;  4HJK A;  1C3T A;  2M17 A;  5AZG A;  2M8S A;  5J18 A;  2L0F A;  3Q3J A;  3UQB A;  2NPT B;  4KDL B;  1T0Y A;  4M0W B;  3LDZ E;  2JZZ A;  2KJH B;  2WX0 A;  3VH3 B;  4FAD A;  2KDF B;  1UBI A;  1EF5 A;  1JRU A;  1ZW7 A;  1E90 A;  3VFK A;  4CYE A;  1UBQ A;  3HM3 A;  4URK A;  3L13 A;  2EKE C;  2W9N A;  3PGE A;  3AUL A;  3OJ4 B;  2LAS A;  2VRR B;  3CMM B;  3VVW B;  2J0M A;  2IYD B;  2MSE D;  2V1Y A;  3IHP C;  3QCA A;  3PRE A;  4G0N B;  3MHS D;  1WE6 A;  3QIJ A;  4EKU A;  2GOW A;  4HXD A;  4NAW B;  2HJ8 A;  1P9D U;  4WAA A;  2GBK A;  3ZDM C;  4BOZ B;  3DVG Y;  2JRI B;  2LGY A;  4AJW A;  1GC7 A;  2JY6 A;  1WGH A;  2BWF A;  2K8B A;  1WR6 E;  3AXC A;  2FCM A;  1BT0 A;  1WJU A;  4KDI C;  1MG8 A;  3CSF A;  5JZE B;  3NS8 A;  2B3A A;  2NS5 A;  3P2B A;  2KVR A;  4AJY B;  4ANW A;  2KKC A;  2L3Z A;  1YX5 B;  2V4L A;  4M8M A;  3N32 A;  1UH6 A;  3A4S C;  4W9L A;  5L95 C;  2FUH B;  4TV3 A;  4FUL A;  4CHK A;  3ALB A;  2N4F A;  4GSW A;  4RMA A;  4G3X B;  3RYT A;  1OEY A;  4FJV B;  3R3M A;  5E6O A;  3TBL D;  3KYD D;  4II3 B;  1OQY A;  3UQA A;  3NHE B;  5J2R A;  5DCN A;  3OLM D;  1U4A A;  2LGD A;  4E71 A;  3A1Q A;  3KYC D;  4I6L B;  1C1Y B;  4F8C B;  3JSV A;  4J6I A;  2FID A;  2C9W B;  4PS7 A;  1PQS A;  4E3C A;  1RLF A;  2FNJ B;  5EDS A;  3VTV A;  2I1J A;  2JZ3 B;  3D32 A;  3ML9 A;  4BKS A;  4XC2 A;  2K6D B;  4AP4 C;  4KIK A;  5CTR C;  3A33 B;  2Z0D B;  4PS3 A;  3ZTD A;  1IPG A;  2KQS A;  4M8N A;  5JHB A;  1WYW B;  4KIK B;  3ZIM A;  2LUE A;  4DWF A;  3KW5 B;  4MM3 A;  2FCN A;  2O6V A;  2KFK B;  4ZYN A;  4K1R B;  3R7R A;  4BVU C;  4IUM B;  1Q0W B;  1WGG A;  3AU5 A;  1WGR A;  3BIN A;  3HHM A;  1NI2 A;  3BY4 B;  3RD2 A;  2AL6 A;  2N1V A;  1CMX B;  1E7U A;  3JVZ X;  3VUW A;  3DBS A;  4NQK E;  3KH0 A;  2KD0 A;  3WAP A;  2KAN A;  2LXC A;  1TGZ B;  5IA7 A;  4MDK E;  4FLH A;  4I6P A;  2PPH A;  3L08 A;  3X0W A;  4NJ6 A;  2RGF A;  2KC1 A;  2FCQ A;  3WAO A;  3B1L X;  2Y5B B;  3LJ3 A;  4FBJ B;  1WMH B;  2KX3 A;  1XQQ A;  2K25 A;  4DK5 A;  3NOB A;  4GMV A;  4KVG B;  2BYE A;  4MGZ E;  3DBR I;  3ML8 A;  2L76 A;  3N3K B;  3VTU A;  2G4S A;  3PT2 B;  1RAX A;  3EHV A;  3ZUN A;  1QZE A;  2XK5 B;  2MRP A;  4WJN A;  1V5O A;  3EC8 A;  3WAL A;  2KWV B;  4GIV A;  2RR9 A;  4ANV A;  2KTF A;  1EF1 A;  3VXW A;  2G3Q B;  2CR5 A;  4IM3 A;  3VDZ A;  4BKG A;  4RM8 A;  1VCB A;  4N9F 4;  3L10 B;  2LGX A;  4HK2 A;  1WZ3 A;  3ONS A;  1WXS A;  2O6V D;  3W1S A;  2DHZ A;  2AEH A;  1H4R A;  3W1S C;  2LXA A;  3NY5 A;  4G50 A;  4MEM A;  2KNB A;  2NR2 A;  2V3S A;  2O6V B;  3DDC B;  1SGH A;  2MP2 B;  3SDL C;  3DVN U;  3TJP A;  3UF8 A;  3QHT A;  1WM3 A;  2ZZP B;  3PLV A;  4GXB A;  2N1W A;  2OOB B;  3S2A A;  2MCN B;  3UIO B;  1GG3 A;  3APD A;  4RM9 A;  1TTN A;  4K7U A;  1WXA A;  4A3O A;  1SIF A;  2CHZ A;  4IWO A;  3APC A;  3DPD A;  3M62 B;  3CST A;  1WJ4 A;  1Q1O A;  2WWZ A;  2KMA A;  5D7G A;  2ASQ A;  2BWE S;  2DZJ A;  2KTR B;  5C23 A;  2J0K A;  3VTW A;  2MW5 A;  4MEL A;  1V80 A;  3U8Z A;  5JH5 C;  3A1Q B;  1WGY A;  3R7Q A;  4LCD E;  2CKH B;  3EFU A;  3X23 A;  4BKS D;  2CU1 A;  1V5T A;  2GBJ A;  2PEA A;  2LD9 A;  2KLG A;  1LM8 B;  5DPW A;  3HIZ A;  4JIO U;  2KQ7 A;  2BKF A;  3N30 A;  3KUZ A;  3QWZ B;  2AYO B;  2JRH A;  5D94 A;  3QAR A;  3A9J A;  2RPQ A;  3H7S A;  2KTR A;  4WWO A;  5BO4 B;  3RZF A;  3IFW B;  5G55 A;  4WWP A;  3OJ3 A;  3TCA A;  2LWP A;  4NNJ B;  2C7M B;  3L54 A;  3IVF A;  2ZVN A;  5IAA C;  3V60 A;  5CX3 A;  2Z0E B;  4IC7 B;  1YJ1 A;  2L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...