3DBLI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
RRASVGSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLQLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 19
structure length 86
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dblI00
2M4NA 3B08A 2Z0EB 3W1SA 1P98A 3TL5A 3QC8B 4LJPB 1P0RA 1OEYA 3A9JA 4WQOB 3PTFC 4DK5A 2AL6A 4HXDA 2DENB 1YIWA 4NQKE 1P1AA 2YLMA 1J19A 3PRPB 5L83A 2KDIA 2KDBA 4B95A 3H9DA 2HE7A 3M62B 1C3TA 1V80A 2KD0A 3ONSA 1V9JA 4JGHB 2M0XA 2AYOB 2L0FA 5DPRA 4IM2A 3UIPB 3EECA 4XC2A 1E90A 2J0JA 4B9KA 3N30A 5AEKB 3H1UA 3VHTC 2OJRA 4GB9A 4P7IA 5JHBA 2WYQA 1GC6A 2FCNA 5D6JB 5E6OA 1UBIA 2JVCA 4CYEA 3AU4A 4ZRKA 2KKCA 1YD8U 1LQBA 5C23A 2CR5A 1YX6B 2ZVNA 2KK8A 2M17A 1OTRB 3WANA 2VRRB 5IA7A 4NAWA 1PQSA 4ANXA 3ECIA 2LWPA 1D3ZA 2FIFA 3L08A 4NQLB 4WJPA 1YQBA 4K7SA 4IM3A 2KX0A 4M8NA 1Y8RC 3WAPA 4AUQC 1H4RA 2AWTA 3A9JB 3APDA 1F9JA 1TZ1A 3H6NA 4K1RB 4K7WA 1R4MI 3JSVB 3DOWA 5L95C 1H8CA 2LRWA 1LFDA 2MX2A 3DQVA 5AZHA 2DYMA 4TUUA 3NOBA 2GBKA 2L00B 3NZUA 2UYZB 3KVFB 1WZ3A 2XBBC 1V5OA 4II3B 5E6NA 2BWES 3DVGX 1J8CA 3ZO5B 2N1WA 1S1QB 2KQ7A 2D3GA 2O6VD 4TV3A 3QHTA 2LVPA 4ZRIA 4GU2A 4GSWA 3V6CB 3KUCB 2ZNVC 2JRIB 2UWQA 4GDLA 2GMIC 4EZKA 4A20A 2N1VA 4W9EA 4RM9A 3PVLA 4W9LA 3QWZB 2YVCA 3DCGA 5FR6A 1WR1A 2K25A 2BGFA 3A4SC 2RD0A 1ZKHA 1WIAA 1UBQA 2D10A 2J7QB 2PEAA 4NAWB 5KHQA 2JUOA 4B6WA 1E7VA 4RM8A 5EDSA 4LJOB 2N9XA 2NCNA 3L54A 1WF9A 2CHZA 1V86A 2V4LA 4K81A 2BF8B 3RUIB 4BBNC 1WJ4A 3L17A 1WGGA 4W9FA 1V6EA 5KHOA 1WX8A 4BOZB 3K9OB 3H7PA 3M63B 2BKRB 1WJUA 2D11A 3LJ3A 2ZZPB 3U30A 3ZUNA 4F7ZA 3B1LX 4MGYE 2BWFA 3L16A 4HLEA 2LI5A 2LZ6A 4HDOA 2KQSA 2R2QA 3WIMA 2W9NA 4GOCA 2HTHA 4ICUA 2KDEB 3RULA 3QIJA 2KNBA 2LXCA 1RLFA 2MW5A 3VTUA 1SGHA 3AI5A 3SU8X 4BKSA 3HM3A 1R4NI 2ZPNA 4LDTD 2IYDB 3CSTA 2HJ8A 1WJ6A 1WRDB 2DZJA 1E8WA 2BKFA 4GDLB 3GOEA 4GIVA 2C7MB 3TIXA 4RMAA 3ZDMC 4GDKA 4FULA 4KIKB 5LLIA 3VH4B 3VTWA 1BT0A 2G4DB 2IO0B 3ZLZA 5DPSA 2A4ZA 3QQ8B 2WX0A 3RZFA 3ZTDA 4EFOA 3OAWA 3ZTCA 1WGDA 3PRZA 2GBRA 4DDGD 3PZDA 3SDLC 1G6JA 3ZRFA 2LXAA 1P9DU 1XD3B 2WWZA 2WDTB 2NVUI 4MEMA 1GUAB 2DAFA 4ASWC 5DPTA 1WXMA 2CS4A 2KX3A 2V3SA 3DBRI 3KW5B 3PPAA 4DHJD 1L2NA 3H7PB 3VDZA 1WFYA 4IC7B 2KJRA 2ZVOA 2L7RA 1EF1A 4JQWC 3A9KA 3KYCD 3PSEB 4IW0A 3TBLD 2DZIA 2OOBB 4DHJB 3KUDB 4G11A 2LD9A 4KVGB 4BKSD 2M1MA 3VUXA 4BKTA 2DAJA 3PV1A 4EZJA 4URKA 1WGRA 2M8SA 3ZVVA 3NY5A 3RT3B 4MJSA 4GDKB 1Z5SB 3VH3B 1WXAA 1WZ0A 1TGZB 2LRUA 4GXBA 3ZNGC 4KDLB 2O6VA 2FCSA 2JRHA 3OJ3A 1WXVA 3HM6X 1T0YA 5CHVC 1E7UA 2L05A 2C7HA 3JVZX 5D94A 4DXAB 2JWZA 2XK5A 3MJWA 5AZFA 1A5RA 1U4AA 4MGKE 2KANA 2C9WB 4ICVA 1LM8B 3UIOB 2L3ZA 3QCAA 5J2RA 4E3CA 5JHAA 2ZCBA 2FUHB 3DDCB 3PS6A 4WJQA 1LXDA 4HCNB 4HPMB 4W9GA 2RSUA 4A3PA 2L0TA 4MGIE 3M95A 2QHOA 4NY0A 3U8ZA 3A9KB 3PHWB 1E8XA 2JPHA 2R2OA 3DVNU 3ZNHB 4FLHA 4W9KA 3T9LA 4WJOA 4HDQA 4JIOU 1NBFC 1WM3A 3X23A 4PYUA 2HD5B 2ZNVB 4G3XB 4WAAA 2C7NB 2K8CA 2JY6A 4GMVA 2Y5BB 3TJPA 4AWJA 1RFAA 3IHPC 1WMHA 1XQQA 4XX5A 2KO3A 1E8YA 2LGYA 2BYVE 4I6LB 1Q5WB 3MTNB 4MJSB 3IVFA 4HK2A 1JRUA 1EO6A 3DPDA 3OLMD 5C1ZA 3LDZE 5LXHA 2KC2A 4IG7B 2O6VB 3ZDTA 2KTFA 3I3TB 2MP2A 3CMMB 4DBGA 3APCA 2PJHA 2KXJA 2B3AA 3UINB 4A3OA 2DHZA 1RRBA 2KC1A 4CO7A 4KSLC 3CSFA 4NPNA 2FCQA 2XK5B 5DPWA 4JL9A 2REXA 3VTVA 3NHEB 4MSQB 4G50A 1MG8A 1VD2A 2CHXA 2K6QA 4MGZE 4FBJB 2KTRA 1QZEA 3R3MA 4ANVA 5HKHA 4ZYNA 1UD7A 1V49A 3R7QA 4HPLB 3TCAA 4FADA 4AP4C 5JZEB 1UZXB 2NR2A 4FJVB 4TQ1A 2CU1A 4X57B 2G4SA 3V62A 3HIZA 3DBLI 4M0WB 3VUWA 2IY0B 2LJ5A 2I1JA 1WMHB 1GG3A 1TBEA 3H7SA 2RGFA 4ANWA 4KZ0A 2LASA 3PHXB 3AULA 2IZVB 1I42A 1M94A 1OEYJ 2I1KA 1WXSA 3O65B 4W9HA 2N9PC 3ML9A 3V6EB 2JXXA 1V2YA 2K8BA 2IO1B 2KVRA 4LDTB 2FIDA 2KJ6A 4CHKA 1WJNA 4EOYA 1UH6A 1I35A 4MM3A 1Q0WB 3P2BA 2BPSA 3DBSA 4WJNA 2N7EA 2KFKA 2KJHB 2D2QA 2ZJDA 4OVVA 3A1QA 3ZNID 2LVOA 4OVUA 3EHVA 5J18A 3BY4B 1KJTA 2G3QB 3UQBA 1IYFA 5CX3A 2K8HA 2KTRB 3ZNZB 5LXIB 4KSKC 4BKGA 2RR9A 2IY1B 2FAZA 2L76A 2DYBA 2RPQA 1WGYA 4TKNA 4BVUC 3IFWB 3U7DA 5DCNA 4W9DA 1E8ZA 3A33B 4GN1A 3ZKJC 3L13A 3S2AA 1WYWB 4DDID 5J17A 4ZRJA 5G55A 5D2MB 5G2NA 2MA9B 4LCDE 2MCNB 2LVQA 4IWPA 3OJ4B 3PLVA 4HVBA 2CKHB 3V60A 2CHWA 3RCZA 3W1YA 3WA0A 1KM7A 3L0WB 3PREA 2N4FA 2KHWB 3T8MA 3VFKA 4BBNF 5D7GA 3KH0A 2JZZA 2NPTA 4BOSC 1KLVA 5BO4B 1GJZA 3JSVA 3ML8A 4W9IA 2LGXA 2N7DA 3C0RB 2GBJA 2V1YA 2PPHA 3QAQA 4KZCA 3WALA 1OGWA 2L8JA 1V5TA 1VCBA 2KFKB 3PLUA 3QARA 3A1QB 3PT2B 1J0GA 4IWQA 3L10B 4DHZB 2JT4B 2J0MA 2JF5A 2MWSB 1P3QU 3N3KB 4II2B 3M3JA 3EC8A 2K39A 2KFJA 3V61A 1SIFA 2K6DB 2KWCA 4MDKE 1WY8A 2KLGA 4FN2A 1UGMA 4J6IA 3UQAA 1X1MA 3VVWB 4FA6A 3HHMA 2MQJA 4MH0E 3KUZA 3IG3A 3WAOA 1K8RB 2BYEA 4GGQA 3AXCA 2KN5A 3R66C 4N9F4 3SHQA 3UGBB 4PS7A 2NS5A 1RAXA 4I6PA 3K9PB 5E6PA 1Q1OA 3JW0X 3HK0A 4MSMB 4AOFA 1EUVB 2KOXA 1WX7A 4DWFA 2GBNA 1CMXB 5GMVA 3X0WA 5JH5C 1Z2MA 1YX5B 2C60A 2NPTB 1E5WA 1GNUA 2IBIB 2K1FA 2DZKA 2Z59B 2N9EB 3NS8A 3ALBA 4ZDVA 5CHFA 4K7UA 4W9CA 4EUTA 1C1YB 2BYFA 4WWNA 3W1SC 3PGEA 1AARA 2J0KA 1S3SG 2IO3B 1WX9A 3DBHI 4DHZE 1IP9A 2O2VA 1XT9B 2G45B 2EMTA 2KMCA 4NNJB 3IBEA 2ZEQA 2KWVB 3RD2A 3Q3JA 4KDIC 2FCMA 3CF6E 3ZW3A 4F8CB 4MELA 4AJWA 1WE7A 2WX1A 4KV2A 2PE6B 3SD5A 2XEWA 4IUMB 2AL3A 1HE8A 1WR6E 4FJZA 4WWPA 4PYZA 2MBEA 2DX5B 2JZ3B 4FJYA 2MBOA 2MBHA 3VAWA 4HJKA 1ISNA 4M8MA 2ZCCA 4I6NB 4KIKA 2MRPA 2NBVB 3WAMA 1NDDA 3N32A 4EZLA 3PRMB 2FNJB 4XZ4A 4ANUA 4YL8A 1EF5A 3VQIA 5TR5A 3BINA 3QJZA 3NZSA 4EKUA 3TMPB 3MHSD 2ZPYA 4PS8A 2DZMA 3R7RA 1SE9A 3RZWC 3UF8A 1WE6A 2LUEA 3AU5A 4IM0A 3A4RA 2MP2B 4HWIB 2PE9A 5CTRC 1L7YA 4HCPB 4IWOA 2AEHA 1TTNA 2C5LC 2NBUA 4WWOA 2ASQA 2KZRA 2EMSA 2O2VB 4JLCA 2LGDA 3DVGY 3QX1A 2GBMA 1V81A 1KOTA 3D32A 4TQ0A 4F1SA 1GC7A 3Q3FA 2KMAA 1WH3A 4NJ6A 1ZW7A 3B0AA 2A5UA 3GZNI 3ZRCA 1NI2A 3VXWA 3RYTA 3KYDD 4G0NB 2DYOA 3DVNV 4W9JA 4E71A 2D07B 4AJYB 1ZGUB 2KDFB 2MBBB 3ENEA 4FHKA 2MSED 4NJ7A 1IPGA 5CHWA 1WM2A 1YJ1A 2MBQA 3VUYA 2KWUB 2MLBA 2NBWB 1UELA 5AZGA 3QK0A 2EKEC 3ZIMA 1WGHA 5IAAC 2Z0DB 4BFRA 3JYUA 4E74A 3QA8A 4PS3A 2IO2B 4EEWA 1OQYA 1WI0A 3APFA 2KLCA 1FXTB 4FHJA 2GOWA 3EFUA
chains in the Genus database with same CATH superfamily
2CU3A 3N1YC 4LJPB 1P0RA 4DK5A 3PTFC 4TMAB 2WU2B 2KDBA 2HE7A 1V80A 2L0FA 5DPRA 2AX5A 2X38A 3VR9B 4B9KA 3H1UA 3RN9C 5BYSA 2WQYB 2WYQA 1GC6A 5D6JB 4C7YA 1IUEA 5E6OA 3AMZA 1VJKA 1GB1A 2KKCA 4JX1C 3FAHA 1LQBA 1C4AA 3WANA 5IA7A 1PQSA 2JQRB 1D3ZA 2FIFA 2N0SB 1YQBA 4K7SA 2KX0A 4AUQC 1TKEA 3WAPA 2AWTA 5IKCM 1AWDA 5L95C 1L0YB 1H8CA 2LRWA 4RF0A 3NJTA 5AZHA 3H8HA 4C80A 1WZ3A 1V5OA 4II3B 1J8CA 3DVGX 4M0WA 2JWUA 2JYTA 2EKIA 2N1WA 1FCCC 2KQ7A 2D3GA 1FIQA 1L4ZB 4ZRIA 4GU2A 2BS4B 3U4EG 2UWQA 3Q8BA 3PVLA 2OHFA 3QWZB 3DCGA 2QILA 2J7QB 3PZ7A 4ZHPA 5KHQA 5EDSA 1XLOA 2CHZA 2FBWB 3RUIB 2BF8B 1V6EA 3EA6A 1OQRA 4BOZB 2INPE 3ZUNA 1EWYC 1ZXIA 2BWFA 3ZQ4A 1BMLC 2LZ6A 1EM7A 2R2QA 1KTKA 2W9NA 3GE8C 3RULA 3QIJA 2KNBA 3VTUA 1RLFA 1SGHA 3SU8X 3DWGC 1R4NI 1V97A 3VRBB 1WRDB 2BKFA 2WXKA 1YOVB 2C7MB 4RMAA 4GDKA 3ZLZA 5MPOA 3QQ8B 4EFOA 1XXGA 4LK0M 1C76A 3OAWA 1GAQB 2Q5WD 4BAXA 1JALA 4ASWC 5DPTA 2CS4A 2V3SA 1HEZE 2K9XA 1F77A 2KJRA 2ZVOA 2R61A 4JQWC 1ZDVA 3PSEB 4IW0A 4ZRPA 2DAJA 4EZJA 2BS2B 1L6VA 3NY5A 4GDKB 1PGBA 3ZNGC 2O6VA 3OJ3A 1T0YA 3HRDD 2VZKD 1MJDA 3P63A 3JVZX 1A5RA 2KANA 1HTOA 3B2FA 1LO5D 5JHAA 4WJQA 2WLBA 2Z8LA 4S17A 3M95A 3PHWB 1YMHE 3DVNU 1WRIA 3T9LA 1WM3A 2SEBD 3X23A 2QCZA 3GZNB 1BXTA 4G3XB 4GMVA 3IHPC 3B2GA 2KO3A 1C77A 2LGYA 3Q8FA 3AE5B 1L5PA 4HK2A 2PVGC 1FFVA 2KDMA 1EO6A 3DPDA 4TSSA 2NTSA 2O6VB 2KTFA 2MP2A 3HVZA 1ZUD2 2GB1A 3APCA 2PJHA 2B3AA 5IN7A 4A3OA 1DOXA 4KGSA 1TS5A 2DNFA 3NHEB 4MSQB 1MG8A 2K6QA 1V1PA 4MGZE 1XCTL 2KTRA 2L52A 2FUG1 4ANVA 5HKHA 1UD7A 2WGSA 4FADA 4AP4C 3HUIA 1CJEA 3NVVA 3VUWA 1ET9A 4KZ0A 2LASA 3PHXB 3KQ4A 2I1KA 1DYQA 1WXSA 4W9HA 1I4XA 1SF0A 2JXXA 2K8BA 5HG2A 4LDTB 1WJNA 1UH6A 2I2YA 3P4PB 1V1PB 2LVOA 2KTRB 5LXIB 1YJJA 4KSKC 4TKNA 1KRHA 4BVUC 5DCNA 2FE8A 1TY2A 4GN1A 1WYWB 4DDID 5J17A 3BIID 5D2MB 1PUTA 2MA9B 2ZW0A 2BTEA 3W1YA 2KHWB 4BBNF 4BOSC 1GJZA 3NVWA 2N7DA 2KAJA 2MJ3A 1V5TA 1SSNA 2I38A 2J0MA 2MWSB 4USAA 1HZ5A 3EC8A 3V61A 1SIFA 2KT7A 3E9SA 2PIAA 1UGMA 2M56B 1NYRA 1QILA 2BYEA 1SEBD 3R66C 4PS7A 2NS5A 1ZOYB 1RAXA 3K9PB 3JW0X 4AOFA 2KOXA 4DWFA 1F2RC 3AE7B 3LB8C 2IBIB 1N5XA 3N1ZC 1JWBD 4K7UA 2BQQA 1C1YB 1OQQA 2J0KA 1ACCA 3RMKC 1SB3C 4HKQA 1C4PA 2V9HA 5D3DA 4ITKA 3Q3JA 3CF6E 2EELA 4Q2JA 4KV2A 2PE6B 2DLBA 3R2TA 5JXVA 4WWPA 4PYZA 2MBOA 4HJKA 1A70A 2N9KA 4I6NB 4WH4A 5TR5A 4EKUA 3MHSD 2ZPYA 3R7RA 1QOAA 3AU5A 3A4RA 2M0AA 3L4PA 2C5LC 3EGRA 2EMSA 2LGDA 4OZBA 5C2TB 1KOTA 5H8YE 1XO3A 4TQ0A 2XN9C 4ZRQA 1GC7A 1WH3A 1ZW7A 3B0AA 2A5UA 5E6JA 3VXWA 3RYTA 3KYDD 3DVNV 4W9JA 3ZGZA 4YTNB 4FHKA 3TUOA 2K22A 5CHWA 1N63A 4S0RA 2NBWB 3MC8A 3ZIMA 3AEFB 1WGHA 5IAAC 1T0SC 1I4HA 1I4PA 4EEWA 3APFA 2KLCA 5EE9A 2VH1A 3BYYB 4FHJA 2NTTA 3TL5A 1L6UA 1OEYA 1EU3A 1HXYD 2B76B 2VH2A 4LNIA 4C56C 1ENFA 5BMIA 1F52A 4NQKE 1P1AA 2QJLA 2KVZA 2YLMA 5L83A 4ZOHC 4GLSC 3I5JC 1PDXA 1V9JA 5HFYA 4M00A 2AYOB 3UIPB 3EECA 4L2YA 1E90A 3N30A 1I7HA 5AEKB 4GB9A 5JHBA 4P6VF 1QKZA 2INCC 3CIRB 2CR5A 2ZVNA 2QIEB 3ECIA 2LWPA 2KWDA 1TKYA 1TZ1A 3BK2A 1C79A 3JSVB 3N20C 2JX5A 3RPFC 2MX2A 4HEA1 2GBKA 1IGCA 3NZUA 4KX6B 3RNFC 3RNAC 3ZO5B 2LGSA 2N7JA 2O6VD 2MJEA 2LVPA 3AE4B 3V6CB 4GDLA 4EZKA 4A20A 2N1VA 2INNE 1WR1A 3A4SC 2N9XA 1SJED 2NCNA 1WF9A 3W9CB 4K81A 4BBNC 1SBBB 3R8BA 1WX8A 1RWSA 4XE0A 2W55A 2BKRB 3U30A 1QOFA 2WP9B 1PYWD 3Q69A 1IBXA 1KFYB 4HLEA 2LI5A 1NENB 3IXSA 2IDYA 1VRAB 3AI5A 4BKSA 2BW2A 2ZPNA 3I57A 4LDTD 3Q8CA 4GDLB 4OVZA 3GOEA 4GIVA 3E56A 3TIXA 4JWSC 3VH4B 3VTWA 1BT0A 1YN4A 1T0RC 2A4ZA 3RZFA 2WX0A 1ESFA 3BVZA 3SDLC 3ZRFA 2LHEA 2LXAA 3B9JA 3BVGA 4N59A 2WWZA 2WDTB 4KKJA 3AECB 3P42A 2KX3A 2WXIA 4DHJD 3VDZA 1TY0A 3AEEB 4WWMA 1IBXB 2LMCA 3RFZB 1PGAA 2LD9A 4KVGB 2J4XA 1I4GA 4XDCA 3VUXA 4BKTA 2L32A 1UWMA 1FXIA 3W5UB 5AUKA 1SJHD 1Z5SB 3VH3B 1TGZB 2BS3B 3HM6X 4RGMA 2LHDA 3KWVA 3RNCC 4DXAB 2XK5A 5AZFA 1U4AA 2C9WB 3AB5A 3UIOB 4WQMA 5J2RA 4E3CA 3DDCB 3PS6A 3AEAB 4HCNB 2RSUA 4L1BA 2QHOA 1E8XA 4US8A 4WJOA 1SE3A 4HDQA 4JIOU 3BWUD 2HD5B 4AWJA 1RFAA 4I6LB 3IVFA 1MHHE 3OLMD 3URYA 1I4QA 3I3TB 4IKGA 4RGNA 4H2AA 2KXJA 4HRSA 2DHZA 2KC1A 4KSLC 3CSFA 2XK5B 1L0VB 4JL9A 3ZXVA 1B1ZA 2CHXA 1FXAA 4FBJB 2ON8A 3DBRB 4BZAA 2ICIA 3R3MA 3T3NA 1HZ6A 4QAYA 1RM6C 5JZEB 3MFGA 1UZXB 3MP9A 4RCOA 3ZJVA 2NR2A 5AUIA 1WGKA 1MPEA 3V62A 4M0WB 2E6XA 2LJ5A 1GG3A 2RGFA 4ANWA 3U2SC 2WXMA 3AN1A 3O65B 2N9PC 3ML9A 1VZ8A 3V6EB 3C8YA 1TS4A 1V2YA 1C78A 2KVRA 3NRZA 2KJ6A 4CHKA 3ZJUA 1I35A 2J53A 1Q0WB 2Y5CA 2N7EA 2ZJDA 4OVVA 3A1QA 2WS3B 4OVUA 4A55A 3UQBA 3BY4B 2V4IB 4YTPB 3ZNZB 4WURA 3PZ8A 2IY1B 2FAZA 3P4QB 1P7EA 1NEKB 2JU6X 1YN5A 2XNAC 3MHZA 3SR6A 1FRDA 3ZKJC 1K53A 5G55A 1N5WA 2V3NA 3OJ4B 3PLVA 4HVBA 2CHWA 3RCZA 3FILA 1KLGD 3T8MA 3VFKA 4LLGM 2LGXA 3C0RB 3WALA 3T3OA 3A1QB 3PT2B 1B9RA 2JT4B 1P3QU 3N3KB 4II2B 3M3JA 1JMLA 2K6DB 4MDKE 4FN2A 2W54A 4UDUC 1PFDA 4J6IA 3UQAA 1N61A 1ZE3D 3LXFA 3WAOA 2MQJA 4MH0E 3IG3A 4GGQA 3AXCA 4WAFA 3SHQA 4N9F4 3UGBB 4KKIA 1Q1OA 4MSMB 1EUVB 1WX7A 3FILB 3PO0A 2GBNA 5GMVA 2C60A 1E5WA 2QC8A 2K1FA 3Q14C 2N9EB 3P4SB 4ZDVA 4W9CA 4HROA 4DXFA 4A9AA 4WWNA 3W1SC 1AARA 1S3SG 1WX9A 2G45B 3GS2A 2IGDA 1JWUD 2WXLA 3IBEA 2ZEQA 4RH6A 4F8CB 4MELA 4AJWA 2WX1A 1FMAD 3SD5A 2H89B 4IUMB 4ARIA 1ISNA 4M8MA 4OZCA 2J52A 4KIKA 3AE9B 3AEBB 1T3QA 1HQRD 3VQIA 1F2RI 2Y3AA 4OHJA 2RMMA 1J7AA 1UGJA 4PS8A 2DZMA 3UF8A 2MP2B 3I63C 4HWIB 2PE9A 1FCLA 3AV8A 4HCPB 2AEHA 4HPPA 3DVGY 3QX1A 2D3BA 5FR3A 1V81A 5IO9A 4RF1A 2KMAA 4G0NB 3KLSX 2D07B 2MBBB 2IJ0A 1L0XB 1SXTA 3VUYA 3QK0A 2EKEC 2Z0DB 2YEPF 3JYUA 3QA8A 4R3DA 5EE1A 1OQYA 5EE0A 1FXTB 2GOWA 3EFUA 3B08A 2Z0EB 3W1SA 3QC8B 4WQOB 1VR9A 1E6EB 3DBHB 2KYWA 2DENB 1YIWA 5BMHA 1HTQA 1UUPA 2BYTA 4XYCA 4O1NA 3M62B 3DHIC 4K3CA 2KD0A 3ONSA 4IM2A 4XC2A 1SE2A 3BZDB 3SEBA 3VHTC 2BBCA 4NJCA 1UBIA 4JE3B 2KN4A 4CYEA 3AU4A 4ZRKA 1YD8U 4D2KA 1YX6B 3TEZA 2M17A 1OTRB 4AS1A 3NS1A 3RI7C 1FRRA 2K0PA 2WXHA 2K5PA 4IM3A 2MH7A 4M8NA 2QSDA 1E9MA 1H4RA 3MJ5A 3APDA 4K7WA 2M19A 1J7CA 1R4MI 3IT4B 5G5HA 1WYGA 2W3SA 3DOWA 3DHHC 2MHJA 2DYMA 4TUUA 3NOBA 2HDEA 1XEEA 2L00B 2UYZB 2XBBC 2RPVA 1AW7A 2BWES 4C7ZA 1QOGA 1NI3A 1FM0D 3QHTA 1MFWA 1KLUD 3KUCB 2ZNVC 3IAM1 2JRIB 4DXGA 4W9EA 4RM9A 2BVCA 2YVCA 5FR6A 2UU7A 1WIAA 1UBQA 2D10A 2IGGA 2PEAA 2JUOA 1E7VA 4C4VA 4LJOB 1MVKA 2N9LA 2V4LA 4NAMA 4LTUA 3IT6B 1WGGA 5KHOA 5IOIA 3H7PA 1WJUA 1J7BA 2ZZPB 4F7ZA 1VZ6A 3C19A 2QMTA 4MGYE 3L16A 1RFKA 4HDOA 3WIMA 1ZP0B 4M02A 2KDEB 3NUHB 2LXCA 2WXOA 2DBYA 2WXRA 2PLPA 2IYDB 2G1EA 1WJ6A 1UWXA 2DZJA 1E8WA 1QOBA 3ZDMC 1TKGA 5LLIA 1XLQA 2IO0B 1V8CA 3ZXRA 4DDGD 3PZDA 1T5XD 1VDVA 1XD3B 1TJEA 1AN8A 4RGTA 5HHDG 3I9V1 3Q3NC 3EUB2 4MEMA 3KW5B 3DBRI 1L2NA 3PPAA 3H7PB 1WFYA 4IC7B 2L7RA 1EF1A 4KGRA 3KYCD 4US9A 3TBLD 3KUDB 4G11A 4DQOC 3RNEC 2ZW1A 1JQ4A 1F1HA 4P1CC 2BB6A 3PV1A 3RNBC 4URKA 1WGRA 4B0EA 2AQ1B 4MJSA 3CWIA 1WXAA 5IP4D 1WZ0A 2KQ4X 4HJGE 3OWEB 2FCSA 1AYFA 1EWCA 1N60A 2L05A 2C7HA 5D94A 4MGKE 4ICVA 5BYQA 2L3ZA 3QCAA 2ZCBA 2FUHB 2PMVA 4A3PA 2TSSA 2L0TA 4MGIE 2JPHA 2R2OA 3KWLA 1NBFC 1VZ7A 1STEA 3AH7A 1F0ZA 2ZNVB 4WAAA 2K8CA 2Y5BB 3TJPA 2GI9A 2LGIA 4XX5A 4MT5A 2JYEA 2NMQA 2BYVE 3AE6B 4MJSB 4EE2A 1JRUA 3LDZE 3ZDTA 4IG7B 1D4BA 3CMMB 4DBGA 3UINB 1DOIA 1RYJA 1RRBA 4CO7A 4NPNA 2FCQA 5DPWA 1T6BX 1K52A 2CJOA 4G50A 5C3JB 1SIJA 2WDQB 3AE1B 3GP7A 4N6EB 4ZYNA 3OG5A 1V49A 4FJVB 2CU1A 3DBLI 5FKAC 2JSVX 3AULA 2IZVB 1I42A 1M94A 1OEYJ 3EFCA 3LYYA 1QF6A 1E0ZA 5TSSA 2IPKD 4MM3A 3P2BA 3Q8AA 3TSSA 1FEHA 2D2QA 4L23A 5J18A 1KJTA 2G3QB 2MEKA 4LNNA 5CX3A 4A6QA 3AE2B 1XCQL 1QLBB 1R4MB 4XGAB 4BKGA 1WGYA 1CQVA 1ZXHA 4REZA 4ZRJA 1T0QC 5G2NA 4LCDE 2LVQA 3Q3MC 4IWPA 2QEJC 2WXFA 2GLSA 2KACA 3WA0A 2N4FA 5D7GA 3KH0A 2JZZA 2NPTA 5HI1A 3ML8A 4MM3B 4W9IA 2WHIA 2V1YA 3QAQA 4KZCA 2L8JA 4IWQA 3V3XA 4DHZB 2WXGA 2K39A 2Y5PA 2KLGA 3ZJTA 1X1MA 4OW0A 2WXQA 3HHMA 3KUZA 1K50A 4A90A 1BUIC 1YJIA 4I6PA 5E6PA 3HK0A 2V3PA 2YEPB 3X0WA 1Z2MA 4C00A 2NPTB 1QQRA 3NVYA 4J3OD 2DZKA 1MI0A 3NS8A 2GRIA 2AQ3B 5CHFA 4EUTA 3PGEA 3DBHI 4JPSA 1IP9A 1D5MC 1XT9B 2EMTA 1ZPSA 4NNJB 2L83A 1FO4A 4ZHOA 2KWVB 2RDBC 1WE7A 2XEWA 2AL3A 1WR6E 4FJZA 2JZ3B 4FJYA 2MBHA 3VAWA 1KF6B 3ETRA 1HA5A 2ZCCA 2MRPA 1NDDA 2FNJB 4ANUA 4YL8A 1EF5A 4PK1A 3BINA 3QJZA 2WDRB 3TMPB 1EU4A 2LEKA 1M4VA 1WE6A 2LUEA 4IM0A 4HKZE 4P1BC 2RDHA 5CTRC 3AEDB 2ASQA 4JLCA 3D32A 4F1SA 4RNAA 3Q3FA 1NI2A 4P16A 1JWAD 3N9YC 4E71A 5BYRA 4AJYB 1ZGUB 5GXGB 1WM2A 1SE4A 1YJ1A 2MBQA 2KWUB 1MHXA 2WDVB 1UELA 5AZGA 4BFRA 3FC4A 4E74A 4PS3A 3AM9A 2IO2B 1WI0A 3HVDA 1JCKB 1V1OA 2M4NA 3SFEB 1P98A 1YQ4B 3R2IA 3AE3B 3A9JA 2AL6A 2E3TA 4HXDA 1WXQA 3TEWA 4YSZB 3U7ZA 4ZYSA 1J19A 3IAS1 3PRPB 2JXTA 2KDIA 4B95A 1C3TA 3H9DA 4JGHB 2M0XA 3N1XC 2J0JA 3MC9A 2OJRA 4P7IA 2FCNA 2JVCA 3DBLB 2W82A 5C23A 2CJNA 2KK8A 3NG0A 2VRRB 4NAWA 4ANXA 1K51A 3L08A 2D3CA 4NQLB 2PKOA 4WJPA 4MH8A 1Y8RC 3A9JB 4K1RB 1F9JA 3H6NA 5G5GA 4LNFA 1LFDA 3DQVA 3KVFB 2D5GA 5E6NA 1S1QB 4TV3A 3AEGB 4GSWA 2GMIC 4IOIE 4W9LA 2K25A 3TEXA 2BGFA 2LJIA 1ZKHA 2RD0A 3P1MA 4WIPA 4NAWB 4B6WA 4RM8A 2D3AA 5BMGA 3L54A 2IGHA 1V86A 1WJ4A 3L17A 3AE8B 4W9FA 3RNGC 4YTMB 3K9OB 3M63B 3LJ3A 2D11A 5D3IB 3B1LX 2KQSA 4GOCA 2HTHA 4ICUA 2V0GA 2HTME 2MW5A 4IDIA 3HM3A 3CSTA 2ACZB 2HJ8A 2W3RA 4FULA 4KIKB 1DOYA 2G4DB 1YNTE 5DPSA 3ZTDA 2WU5B 2LFIA 3ZTCA 1XLNA 1WGDA 3PRZA 2GBRA 1G6JA 2JZPA 1P9DU 5I4DA 1GPXA 1TIFA 2NVUI 1OFFA 1GUAB 2DAFA 3BYTB 2BB5A 1WXMA 3Q6BA 3U52E 4DHJB 3A9KA 2DZIA 1GOZA 2OOBB 2X8XX 2WXNA 4CQNA 2L1AA 4BKSD 1WWTA 2PVOD 2M1MA 1TYGB 1NVID 1N62A 2K3UA 2J42A 1NYQA 5FK9C 2M8SA 3ZVVA 1D5XC 3RT3B 1FNUA 2PTLA 2LRUA 4GXBA 4KDLB 2JRHA 1WXVA 1E10A 3BVMA 2PW9A 5CHVC 1E7UA 4ARCA 2WNMA 3J9CA 2JWZA 3MJWA 4YXDB 1JW9D 4RFBA 1LM8B 1LXDA 4HPMB 4W9GA 4NY0A 4LNKA 3U8ZA 3A9KB 4NZLB 3ZNHB 4FLHA 4W9KA 4ACFA 1P7FA 4PYUA 1Q10A 2C7NB 2JY6A 4JWUC 1R4NB 1WMHA 1XQQA 1E8YA 3O13A 1TT5B 1JRPA 1Q5WB 1XF5L 3MTNB 2WXJA 4XDDA 4YT0B 5C1ZA 4PT5A 1ET6A 5LXHA 2AQ2B 2KC2A 1E7PB 3BK1A 4XWWA 4YWGG 4M01A 2REXA 2KMMA 2WXPA 3VTVA 1YN3A 1VD2A 1Y56A 1QZEA 1C4CA 2H88B 5H92C 3R7QA 3ZYYX 4HPLB 3TCAA 3GE3C 4AQ7A 1FD6A 4TQ1A 3V05A 4X57B 2G4SA 1I4RA 3HIZA 2IY0B 2I1JA 1N6ZA 1WMHB 1TBEA 3H7SA 3MC0B 4A8XC 1JWMD 1ROEA 1VLBA 5LNK1 4N58A 2IO1B 3W5VB 2FIDA 4B0MA 4EOYA 1WSPA 2BPSA 3DBSA 4WJNA 2INDC 2KFKA 2KJHB 4C4VB 3ZNID 2RDGA 3EHVA 1IYFA 4XWTA 2K8HA 1FFUA 2G9HD 1DGJA 2RR9A 2L76A 2DYBA 2RPQA 3IFWB 3U7DA 1JWSD 4W9DA 1E8ZA 3A33B 3L13A 3S2AA 4FXCA 1ZDXA 2MCNB 1QT9A 2LUMA 3VR8B 2CKHB 3V60A 4YSXB 5T8IA 1KM7A 3L0WB 3PREA 1JROA 2MJDA 1TS3A 1UF0A 5BO4B 1KLVA 3JSVA 2GBJA 2PPHA 1OGWA 3QARA 1VCBA 2KFKB 3PLUA 3Q2AC 1J0GA 1PGXA 3Q8EA 1D6EC 3L10B 3FKYA 2JF5A 2VZKB 2SAKA 2ONQA 2KFJA 2KWCA 1WY8A 1GB4A 4MACA 3NVZA 3DHGC 3VRAB 1KH0A 3VVWB 4FA6A 1K8RB 3NZ3A 4OZAA 2KN5A 1XLPA 3Q3OC 1FPYA 3P4RB 1R7SA 1CMXB 1YQ3B 5JH5C 1D5ZC 1YX5B 1GNUA 1UNSA 2Z59B 1TS2A 3ALBA 1IGDA 2BYFA 4DHZE 2IO3B 2O2VA 4KGTA 2OJWA 2KMCA 3RD2A 3TEYA 4KDIC 2FCMA 3ZW3A 1MG4A 3UI3A 1HE8A 2MBEA 2DX5B 4LNOA 2NBVB 3WAMA 3N32A 1LGRA 1TZOA 3PRMB 3WCQA 4XZ4A 4EZLA 1FNVA 3NZSA 4YSYB 1CK1A 1C9FA 1SE9A 3RZWC 2OEDA 5EE3A 4K3BA 1L7YA 2QDFA 4IWOA 1TTNA 2NBUA 4WWOA 2KZRA 2BT6A 2O2VB 3GB1A 2GBMA 3ABVB 3DWMA 3SFDB 4NJ6A 4RGOS 3GZNI 3ZRCA 2DYOA 2KDFB 2HJ1A 3ENEA 4NJ7A 2MSED 1FNWA 1L4DB 1IPGA 1CZPA 3W2DA 2MLBA 2DWQA
chains in the Genus database with same CATH topology
2M4NA 3B08A 2Z0EB 3W1SA 1P98A 3TL5A 3QC8B 4LJPB 1P0RA 1OEYA 3A9JA 4WQOB 3PTFC 4DK5A 2AL6A 4HXDA 2DENB 1YIWA 4NQKE 1P1AA 2YLMA 1J19A 3PRPB 5L83A 2KDIA 2KDBA 4B95A 3H9DA 2HE7A 3M62B 1C3TA 1V80A 2KD0A 3ONSA 1V9JA 4JGHB 2M0XA 2AYOB 2L0FA 5DPRA 4IM2A 3UIPB 3EECA 4XC2A 1E90A 2J0JA 4B9KA 3N30A 5AEKB 3H1UA 3VHTC 2OJRA 4GB9A 4P7IA 5JHBA 2WYQA 1GC6A 2FCNA 5D6JB 5E6OA 1UBIA 2JVCA 4CYEA 3AU4A 4ZRKA 2KKCA 1YD8U 1LQBA 5C23A 2CR5A 1YX6B 2ZVNA 2KK8A 2M17A 1OTRB 3WANA 2VRRB 5IA7A 4NAWA 1PQSA 4ANXA 3ECIA 2LWPA 1D3ZA 2FIFA 3L08A 4NQLB 4WJPA 1YQBA 4K7SA 4IM3A 2KX0A 4M8NA 1Y8RC 3WAPA 4AUQC 1H4RA 2AWTA 3A9JB 3APDA 1F9JA 1TZ1A 3H6NA 4K1RB 4K7WA 1R4MI 3JSVB 3DOWA 5L95C 1H8CA 2LRWA 1LFDA 2MX2A 3DQVA 5AZHA 2DYMA 4TUUA 3NOBA 2GBKA 2L00B 3NZUA 2UYZB 3KVFB 1WZ3A 2XBBC 1V5OA 4II3B 5E6NA 2BWES 3DVGX 1J8CA 3ZO5B 2N1WA 1S1QB 2KQ7A 2D3GA 2O6VD 4TV3A 3QHTA 2LVPA 4ZRIA 4GU2A 4GSWA 3V6CB 3KUCB 2ZNVC 2JRIB 2UWQA 4GDLA 2GMIC 4EZKA 4A20A 2N1VA 4W9EA 4RM9A 3PVLA 4W9LA 3QWZB 2YVCA 3DCGA 5FR6A 1WR1A 2K25A 2BGFA 3A4SC 2RD0A 1ZKHA 1WIAA 1UBQA 2D10A 2J7QB 2PEAA 4NAWB 5KHQA 2JUOA 4B6WA 1E7VA 4RM8A 5EDSA 4LJOB 2N9XA 2NCNA 3L54A 1WF9A 2CHZA 1V86A 2V4LA 4K81A 2BF8B 3RUIB 4BBNC 1WJ4A 3L17A 1WGGA 4W9FA 1V6EA 5KHOA 1WX8A 4BOZB 3K9OB 3H7PA 3M63B 2BKRB 1WJUA 2D11A 3LJ3A 2ZZPB 3U30A 3ZUNA 4F7ZA 3B1LX 4MGYE 2BWFA 3L16A 4HLEA 2LI5A 2LZ6A 4HDOA 2KQSA 2R2QA 3WIMA 2W9NA 4GOCA 2HTHA 4ICUA 2KDEB 3RULA 3QIJA 2KNBA 2LXCA 1RLFA 2MW5A 3VTUA 1SGHA 3AI5A 3SU8X 4BKSA 3HM3A 1R4NI 2ZPNA 4LDTD 2IYDB 3CSTA 2HJ8A 1WJ6A 1WRDB 2DZJA 1E8WA 2BKFA 4GDLB 3GOEA 4GIVA 2C7MB 3TIXA 4RMAA 3ZDMC 4GDKA 4FULA 4KIKB 5LLIA 3VH4B 3VTWA 1BT0A 2G4DB 2IO0B 3ZLZA 5DPSA 2A4ZA 3QQ8B 2WX0A 3RZFA 3ZTDA 4EFOA 3OAWA 3ZTCA 1WGDA 3PRZA 2GBRA 4DDGD 3PZDA 3SDLC 1G6JA 3ZRFA 2LXAA 1P9DU 1XD3B 2WWZA 2WDTB 2NVUI 4MEMA 1GUAB 2DAFA 4ASWC 5DPTA 1WXMA 2CS4A 2KX3A 2V3SA 3DBRI 3KW5B 3PPAA 4DHJD 1L2NA 3H7PB 3VDZA 1WFYA 4IC7B 2KJRA 2ZVOA 2L7RA 1EF1A 4JQWC 3A9KA 3KYCD 3PSEB 4IW0A 3TBLD 2DZIA 2OOBB 4DHJB 3KUDB 4G11A 2LD9A 4KVGB 4BKSD 2M1MA 3VUXA 4BKTA 2DAJA 3PV1A 4EZJA 4URKA 1WGRA 2M8SA 3ZVVA 3NY5A 3RT3B 4MJSA 4GDKB 1Z5SB 3VH3B 1WXAA 1WZ0A 1TGZB 2LRUA 4GXBA 3ZNGC 4KDLB 2O6VA 2FCSA 2JRHA 3OJ3A 1WXVA 3HM6X 1T0YA 5CHVC 1E7UA 2L05A 2C7HA 3JVZX 5D94A 4DXAB 2JWZA 2XK5A 3MJWA 5AZFA 1A5RA 1U4AA 4MGKE 2KANA 2C9WB 4ICVA 1LM8B 3UIOB 2L3ZA 3QCAA 5J2RA 4E3CA 5JHAA 2ZCBA 2FUHB 3DDCB 3PS6A 4WJQA 1LXDA 4HCNB 4HPMB 4W9GA 2RSUA 4A3PA 2L0TA 4MGIE 3M95A 2QHOA 4NY0A 3U8ZA 3A9KB 3PHWB 1E8XA 2JPHA 2R2OA 3DVNU 3ZNHB 4FLHA 4W9KA 3T9LA 4WJOA 4HDQA 4JIOU 1NBFC 1WM3A 3X23A 4PYUA 2HD5B 2ZNVB 4G3XB 4WAAA 2C7NB 2K8CA 2JY6A 4GMVA 2Y5BB 3TJPA 4AWJA 1RFAA 3IHPC 1WMHA 1XQQA 4XX5A 2KO3A 1E8YA 2LGYA 2BYVE 4I6LB 1Q5WB 3MTNB 4MJSB 3IVFA 4HK2A 1JRUA 1EO6A 3DPDA 3OLMD 5C1ZA 3LDZE 5LXHA 2KC2A 4IG7B 2O6VB 3ZDTA 2KTFA 3I3TB 2MP2A 3CMMB 4DBGA 3APCA 2PJHA 2KXJA 2B3AA 3UINB 4A3OA 2DHZA 1RRBA 2KC1A 4CO7A 4KSLC 3CSFA 4NPNA 2FCQA 2XK5B 5DPWA 4JL9A 2REXA 3VTVA 3NHEB 4MSQB 4G50A 1MG8A 1VD2A 2CHXA 2K6QA 4MGZE 4FBJB 2KTRA 1QZEA 3R3MA 4ANVA 5HKHA 4ZYNA 1UD7A 1V49A 3R7QA 4HPLB 3TCAA 4FADA 4AP4C 5JZEB 1UZXB 2NR2A 4FJVB 4TQ1A 2CU1A 4X57B 2G4SA 3V62A 3HIZA 3DBLI 4M0WB 3VUWA 2IY0B 2LJ5A 2I1JA 1WMHB 1GG3A 1TBEA 3H7SA 2RGFA 4ANWA 4KZ0A 2LASA 3PHXB 3AULA 2IZVB 1I42A 1M94A 1OEYJ 2I1KA 1WXSA 3O65B 4W9HA 2N9PC 3ML9A 3V6EB 2JXXA 1V2YA 2K8BA 2IO1B 2KVRA 4LDTB 2FIDA 2KJ6A 4CHKA 1WJNA 4EOYA 1UH6A 1I35A 4MM3A 1Q0WB 3P2BA 2BPSA 3DBSA 4WJNA 2N7EA 2KFKA 2KJHB 2D2QA 2ZJDA 4OVVA 3A1QA 3ZNID 2LVOA 4OVUA 3EHVA 5J18A 3BY4B 1KJTA 2G3QB 3UQBA 1IYFA 5CX3A 2K8HA 2KTRB 3ZNZB 5LXIB 4KSKC 4BKGA 2RR9A 2IY1B 2FAZA 2L76A 2DYBA 2RPQA 1WGYA 4TKNA 4BVUC 3IFWB 3U7DA 5DCNA 4W9DA 1E8ZA 3A33B 4GN1A 3ZKJC 3L13A 3S2AA 1WYWB 4DDID 5J17A 4ZRJA 5G55A 5D2MB 5G2NA 2MA9B 4LCDE 2MCNB 2LVQA 4IWPA 3OJ4B 3PLVA 4HVBA 2CKHB 3V60A 2CHWA 3RCZA 3W1YA 3WA0A 1KM7A 3L0WB 3PREA 2N4FA 2KHWB 3T8MA 3VFKA 4BBNF 5D7GA 3KH0A 2JZZA 2NPTA 4BOSC 1KLVA 5BO4B 1GJZA 3JSVA 3ML8A 4W9IA 2LGXA 2N7DA 3C0RB 2GBJA 2V1YA 2PPHA 3QAQA 4KZCA 3WALA 1OGWA 2L8JA 1V5TA 1VCBA 2KFKB 3PLUA 3QARA 3A1QB 3PT2B 1J0GA 4IWQA 3L10B 4DHZB 2JT4B 2J0MA 2JF5A 2MWSB 1P3QU 3N3KB 4II2B 3M3JA 3EC8A 2K39A 2KFJA 3V61A 1SIFA 2K6DB 2KWCA 4MDKE 1WY8A 2KLGA 4FN2A 1UGMA 4J6IA 3UQAA 1X1MA 3VVWB 4FA6A 3HHMA 2MQJA 4MH0E 3KUZA 3IG3A 3WAOA 1K8RB 2BYEA 4GGQA 3AXCA 2KN5A 3R66C 4N9F4 3SHQA 3UGBB 4PS7A 2NS5A 1RAXA 4I6PA 3K9PB 5E6PA 1Q1OA 3JW0X 3HK0A 4MSMB 4AOFA 1EUVB 2KOXA 1WX7A 4DWFA 2GBNA 1CMXB 5GMVA 3X0WA 5JH5C 1Z2MA 1YX5B 2C60A 2NPTB 1E5WA 1GNUA 2IBIB 2K1FA 2DZKA 2Z59B 2N9EB 3NS8A 3ALBA 4ZDVA 5CHFA 4K7UA 4W9CA 4EUTA 1C1YB 2BYFA 4WWNA 3W1SC 3PGEA 1AARA 2J0KA 1S3SG 2IO3B 1WX9A 3DBHI 4DHZE 1IP9A 2O2VA 1XT9B 2G45B 2EMTA 2KMCA 4NNJB 3IBEA 2ZEQA 2KWVB 3RD2A 3Q3JA 4KDIC 2FCMA 3CF6E 3ZW3A 4F8CB 4MELA 4AJWA 1WE7A 2WX1A 4KV2A 2PE6B 3SD5A 2XEWA 4IUMB 2AL3A 1HE8A 1WR6E 4FJZA 4WWPA 4PYZA 2MBEA 2DX5B 2JZ3B 4FJYA 2MBOA 2MBHA 3VAWA 4HJKA 1ISNA 4M8MA 2ZCCA 4I6NB 4KIKA 2MRPA 2NBVB 3WAMA 1NDDA 3N32A 4EZLA 3PRMB 2FNJB 4XZ4A 4ANUA 4YL8A 1EF5A 3VQIA 5TR5A 3BINA 3QJZA 3NZSA 4EKUA 3TMPB 3MHSD 2ZPYA 4PS8A 2DZMA 3R7RA 1SE9A 3RZWC 3UF8A 1WE6A 2LUEA 3AU5A 4IM0A 3A4RA 2MP2B 4HWIB 2PE9A 5CTRC 1L7YA 4HCPB 4IWOA 2AEHA 1TTNA 2C5LC 2NBUA 4WWOA 2ASQA 2KZRA 2EMSA 2O2VB 4JLCA 2LGDA 3DVGY 3QX1A 2GBMA 1V81A 1KOTA 3D32A 4TQ0A 4F1SA 1GC7A 3Q3FA 2KMAA 1WH3A 4NJ6A 1ZW7A 3B0AA 2A5UA 3GZNI 3ZRCA 1NI2A 3VXWA 3RYTA 3KYDD 4G0NB 2DYOA 3DVNV 4W9JA 4E71A 2D07B 4AJYB 1ZGUB 2KDFB 2MBBB 3ENEA 4FHKA 2MSED 4NJ7A 1IPGA 5CHWA 1WM2A 1YJ1A 2MBQA 3VUYA 2KWUB 2MLBA 2NBWB 1UELA 5AZGA 3QK0A 2EKEC 3ZIMA 1WGHA 5IAAC 2Z0DB 4BFRA 3JYUA 4E74A 3QA8A 4PS3A 2IO2B 4EEWA 1OQYA 1WI0A 3APFA 2KLCA 1FXTB 4FHJA 2GOWA 3EFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4N A;  3B08 A;  2Z0E B;  3W1S A;  1P98 A;  3TL5 A;  3QC8 B;  4LJP B;  1P0R A;  1OEY A;  3A9J A;  4WQO B;  3PTF C;  4DK5 A;  2AL6 A;  4HXD A;  2DEN B;  1YIW A;  4NQK E;  1P1A A;  2YLM A;  1J19 A;  3PRP B;  5L83 A;  2KDI A;  2KDB A;  4B95 A;  3H9D A;  2HE7 A;  3M62 B;  1C3T A;  1V80 A;  2KD0 A;  3ONS A;  1V9J A;  4JGH B;  2M0X A;  2AYO B;  2L0F A;  5DPR A;  4IM2 A;  3UIP B;  3EEC A;  4XC2 A;  1E90 A;  2J0J A;  4B9K A;  3N30 A;  5AEK B;  3H1U A;  3VHT C;  2OJR A;  4GB9 A;  4P7I A;  5JHB A;  2WYQ A;  1GC6 A;  2FCN A;  5D6J B;  5E6O A;  1UBI A;  2JVC A;  4CYE A;  3AU4 A;  4ZRK A;  2KKC A;  1YD8 U;  1LQB A;  5C23 A;  2CR5 A;  1YX6 B;  2ZVN A;  2KK8 A;  2M17 A;  1OTR B;  3WAN A;  2VRR B;  5IA7 A;  4NAW A;  1PQS A;  4ANX A;  3ECI A;  2LWP A;  1D3Z A;  2FIF A;  3L08 A;  4NQL B;  4WJP A;  1YQB A;  4K7S A;  4IM3 A;  2KX0 A;  4M8N A;  1Y8R C;  3WAP A;  4AUQ C;  1H4R A;  2AWT A;  3A9J B;  3APD A;  1F9J A;  1TZ1 A;  3H6N A;  4K1R B;  4K7W A;  1R4M I;  3JSV B;  3DOW A;  5L95 C;  1H8C A;  2LRW A;  1LFD A;  2MX2 A;  3DQV A;  5AZH A;  2DYM A;  4TUU A;  3NOB A;  2GBK A;  2L00 B;  3NZU A;  2UYZ B;  3KVF B;  1WZ3 A;  2XBB C;  1V5O A;  4II3 B;  5E6N A;  2BWE S;  3DVG X;  1J8C A;  3ZO5 B;  2N1W A;  1S1Q B;  2KQ7 A;  2D3G A;  2O6V D;  4TV3 A;  3QHT A;  2LVP A;  4ZRI A;  4GU2 A;  4GSW A;  3V6C B;  3KUC B;  2ZNV C;  2JRI B;  2UWQ A;  4GDL A;  2GMI C;  4EZK A;  4A20 A;  2N1V A;  4W9E A;  4RM9 A;  3PVL A;  4W9L A;  3QWZ B;  2YVC A;  3DCG A;  5FR6 A;  1WR1 A;  2K25 A;  2BGF A;  3A4S C;  2RD0 A;  1ZKH A;  1WIA A;  1UBQ A;  2D10 A;  2J7Q B;  2PEA A;  4NAW B;  5KHQ A;  2JUO A;  4B6W A;  1E7V A;  4RM8 A;  5EDS A;  4LJO B;  2N9X A;  2NCN A;  3L54 A;  1WF9 A;  2CHZ A;  1V86 A;  2V4L A;  4K81 A;  2BF8 B;  3RUI B;  4BBN C;  1WJ4 A;  3L17 A;  1WGG A;  4W9F A;  1V6E A;  5KHO A;  1WX8 A;  4BOZ B;  3K9O B;  3H7P A;  3M63 B;  2BKR B;  1WJU A;  2D11 A;  3LJ3 A;  2ZZP B;  3U30 A;  3ZUN A;  4F7Z A;  3B1L X;  4MGY E;  2BWF A;  3L16 A;  4HLE A;  2LI5 A;  2LZ6 A;  4HDO A;  2KQS A;  2R2Q A;  3WIM A;  2W9N A;  4GOC A;  2HTH A;  4ICU A;  2KDE B;  3RUL A;  3QIJ A;  2KNB A;  2LXC A;  1RLF A;  2MW5 A;  3VTU A;  1SGH A;  3AI5 A;  3SU8 X;  4BKS A;  3HM3 A;  1R4N I;  2ZPN A;  4LDT D;  2IYD B;  3CST A;  2HJ8 A;  1WJ6 A;  1WRD B;  2DZJ A;  1E8W A;  2BKF A;  4GDL B;  3GOE A;  4GIV A;  2C7M B;  3TIX A;  4RMA A;  3ZDM C;  4GDK A;  4FUL A;  4KIK B;  5LLI A;  3VH4 B;  3VTW A;  1BT0 A;  2G4D B;  2IO0 B;  3ZLZ A;  5DPS A;  2A4Z A;  3QQ8 B;  2WX0 A;  3RZF A;  3ZTD A;  4EFO A;  3OAW A;  3ZTC A;  1WGD A;  3PRZ A;  2GBR A;  4DDG D;  3PZD A;  3SDL C;  1G6J A;  3ZRF A;  2LXA A;  1P9D U;  1XD3 B;  2WWZ A;  2WDT B;  2NVU I;  4MEM A;  1GUA B;  2DAF A;  4ASW C;  5DPT A;  1WXM A;  2CS4 A;  2KX3 A;  2V3S A;  3DBR I;  3KW5 B;  3PPA A;  4DHJ D;  1L2N A;  3H7P B;  3VDZ A;  1WFY A;  4IC7 B;  2KJR A;  2ZVO A;  2L7R A;  1EF1 A;  4JQW C;  3A9K A;  3KYC D;  3PSE B;  4IW0 A;  3TBL D;  2DZI A;  2OOB B;  4DHJ B;  3KUD B;  4G11 A;  2LD9 A;  4KVG B;  4BKS D;  2M1M A;  3VUX A;  4BKT A;  2DAJ A;  3PV1 A;  4EZJ A;  4URK A;  1WGR A;  2M8S A;  3ZVV A;  3NY5 A;  3RT3 B;  4MJS A;  4GDK B;  1Z5S B;  3VH3 B;  1WXA A;  1WZ0 A;  1TGZ B;  2LRU A;  4GXB A;  3ZNG C;  4KDL B;  2O6V A;  2FCS A;  2JRH A;  3OJ3 A;  1WXV A;  3HM6 X;  1T0Y A;  5CHV C;  1E7U A;  2L05 A;  2C7H A;  3JVZ X;  5D94 A;  4DXA B;  2JWZ A;  2XK5 A;  3MJW A;  5AZF A;  1A5R A;  1U4A A;  4MGK E;  2KAN A;  2C9W B;  4ICV A;  1LM8 B;  3UIO B;  2L3Z A;  3QCA A;  5J2R A;  4E3C A;  5JHA A;  2ZCB A;  2FUH B;  3DDC B;  3PS6 A;  4WJQ A;  1LXD A;  4HCN B;  4HPM B;  4W9G A;  2RSU A;  4A3P A;  2L0T A;  4MGI E;  3M95 A;  2QHO A;  4NY0 A;  3U8Z A;  3A9K B;  3PHW B;  1E8X A;  2JPH A;  2R2O A;  3DVN U;  3ZNH B;  4FLH A;  4W9K A;  3T9L A;  4WJO A;  4HDQ A;  4JIO U;  1NBF C;  1WM3 A;  3X23 A;  4PYU A;  2HD5 B;  2ZNV B;  4G3X B;  4WAA A;  2C7N B;  2K8C A;  2JY6 A;  4GMV A;  2Y5B B;  3TJP A;  4AWJ A;  1RFA A;  3IHP C;  1WMH A;  1XQQ A;  4XX5 A;  2KO3 A;  1E8Y A;  2LGY A;  2BYV E;  4I6L B;  1Q5W B;  3MTN B;  4MJS B;  3IVF A;  4HK2 A;  1JRU A;  1EO6 A;  3DPD A;  3OLM D;  5C1Z A;  3LDZ E;  5LXH A;  2KC2 A;  4IG7 B;  2O6V B;  3ZDT A;  2KTF A;  3I3T B;  2MP2 A;  3CMM B;  4DBG A;  3APC A;  2PJH A;  2KXJ A;  2B3A A;  3UIN B;  4A3O A;  2DHZ A;  1RRB A;  2KC1 A;  4CO7 A;  4KSL C;  3CSF A;  4NPN A;  2FCQ A;  2XK5 B;  5DPW A;  4JL9 A;  2REX A;  3VTV A;  3NHE B;  4MSQ B;  4G50 A;  1MG8 A;  1VD2 A;  2CHX A;  2K6Q A;  4MGZ E;  4FBJ B;  2KTR A;  1QZE A;  3R3M A;  4ANV A;  5HKH A;  4ZYN A;  1UD7 A;  1V49 A;  3R7Q A;  4HPL B;  3TCA A;  4FAD A;  4AP4 C;  5JZE B;  1UZX B;  2NR2 A;  4FJV B;  4TQ1 A;  2CU1 A;  4X57 B;  2G4S A;  3V62 A;  3HIZ A;  3DBL I;  4M0W B;  3VUW A;  2IY0 B;  2LJ5 A;  2I1J A;  1WMH B;  1GG3 A;  1TBE A;  3H7S A;  2RGF A;  4ANW A;  4KZ0 A;  2LAS A;  3PHX B;  3AUL A;  2IZV B;  1I42 A;  1M94 A;  1OEY J;  2I1K A;  1WXS A;  3O65 B;  4W9H A;  2N9P C;  3ML9 A;  3V6E B;  2JXX A;  1V2Y A;  2K8B A;  2IO1 B;  2KVR A;  4LDT B;  2FID A;  2KJ6 A;  4CHK A;  1WJN A;  4EOY A;  1UH6 A;  1I35 A;  4MM3 A;  1Q0W B;  3P2B A;  2BPS A;  3DBS A;  4WJN A;  2N7E A;  2KFK A;  2KJH B;  2D2Q A;  2ZJD A;  4OVV A;  3A1Q A;  3ZNI D;  2LVO A;  4OVU A;  3EHV A;  5J18 A;  3BY4 B;  1KJT A;  2G3Q B;  3UQB A;  1IYF A;  5CX3 A;  2K8H A;  2KTR B;  3ZNZ B;  5LXI B;  4KSK C;  4BKG A;  2RR9 A;  2IY1 B;  2FAZ A;  2L76 A;  2DYB A;  2RPQ A;  1WGY A;  4TKN A;  4BVU C;  3IFW B;  3U7D A;  5DCN A;  4W9D A;  1E8Z A;  3A33 B;  4GN1 A;  3ZKJ C;  3L13 A;  3S2A A;  1WYW B;  4DDI D;  5J17 A;  4ZRJ A;  5G55 A;  5D2M B;  5G2N A;  2MA9 B;  4LCD E;  2MCN B;  2LVQ A;  4IWP A;  3OJ4 B;  3PLV A;  4HVB A;  2CKH B;  3V60 A;  2CHW A;  3RCZ A;  3W1Y A;  3WA0 A;  1KM7 A;  3L0W B;  3PRE A;  2N4F A;  2KHW B;  3T8M A;  3VFK A;  4BBN F;  5D7G A;  3KH0 A;  2JZZ A;  2NPT A;  4BOS C;  1KLV A;  5BO4 B;  1GJZ A;  3JSV A;  3ML8 A;  4W9I A;  2LGX A;  2N7D A;  3C0R B;  2GBJ A;  2V1Y A;  2PPH A;  3QAQ A;  4KZC A;  3WAL A;  1OGW A;  2L8J A;  1V5T A;  1VCB A;  2KFK B;  3PLU A;  3QAR A;  3A1Q B;  3PT2 B;  1J0G A;  4IWQ A;  3L10 B;  4DHZ B;  2JT4 B;  2J0M A;  2JF5 A;  2MWS B;  1P3Q U;  3N3K B;  4II2 B;  3M3J A;  3EC8 A;  2K39 A;  2KFJ A;  3V61 A;  1SIF A;  2K6D B;  2KWC A;  4MDK E;  1WY8 A;  2KLG A;  4FN2 A;  1UGM A;  4J6I A;  3UQA A;  1X1M A;  3VVW B;  4FA6 A;  3HHM A;  2MQJ A;  4MH0 E;  3KUZ A;  3IG3 A;  3WAO A;  1K8R B;  2BYE A;  4GGQ A;  3AXC A;  2KN5 A;  3R66 C;  4N9F 4;  3SHQ A;  3UGB B;  4PS7 A;  2NS5 A;  1RAX A;  4I6P A;  3K9P B;  5E6P A;  1Q1O A;  3JW0 X;  3HK0 A;  4MSM B;  4AOF A;  1EUV B;  2KOX A;  1WX7 A;  4DWF A;  2GBN A;  1CMX B;  5GMV A;  3X0W A;  5JH5 C;  1Z2M A;  1YX5 B;  2C60 A;  2NPT B;  1E5W A;  1GNU A;  2IBI B;  2K1F A;  2DZK A;  2Z59 B;  2N9E B;  3NS8 A;  3ALB A;  4ZDV A;  5CHF A;  4K7U A;  4W9C A;  4EUT A;  1C1Y B;  2BYF A;  4WWN A;  3W1S C;  3PGE A;  1AAR A;  2J0K A;  1S3S G;  2IO3 B;  1WX9 A;  3DBH I;  4DHZ E;  1IP9 A;  2O2V A;  1XT9 B;  2G45 B;  2EMT A;  2KMC A;  4NNJ B;  3IBE A;  2ZEQ A;  2KWV B;  3RD2 A;  3Q3J A;  4KDI C;  2FCM A;  3CF6 E;  3ZW3 A;  4F8C B;  4MEL A;  4AJW A;  1WE7 A;  2WX1 A;  4KV2 A;  2PE6 B;  3SD5 A;  2XEW A;  4IUM B;  2AL3 A;  1HE8 A;  1WR6 E;  4FJZ A;  4WWP A;  4PYZ A;  2MBE A;  2DX5 B;  2JZ3 B;  4FJY A;  2MBO A;  2MBH A;  3VAW A;  4HJK A;  1ISN A;  4M8M A;  2ZCC A;  4I6N B;  4KIK A;  2MRP A;  2NBV B;  3WAM A;  1NDD A;  3N32 A;  4EZL A;  3PRM B;  2FNJ B;  4XZ4 A;  4ANU A;  4YL8 A;  1EF5 A;  3VQI A;  5TR5 A;  3BIN A;  3QJZ A;  3NZS A;  4EKU A;  3TMP B;  3MHS D;  2ZPY A;  4PS8 A;  2DZM A;  3R7R A;  1SE9 A;  3RZW C;  3UF8 A;  1WE6 A;  2LUE A;  3AU5 A;  4IM0 A;  3A4R A;  2MP2 B;  4HWI B;  2PE9 A;  5CTR C;  1L7Y A;  4HCP B;  4IWO A;  2AEH A;  1TTN A;  2C5L C;  2NBU A;  4WWO A;  2ASQ A;  2KZR A;  2EMS A;  2O2V B;  4JLC A;  2LGD A;  3DVG Y;  3QX1 A;  2GBM A;  1V81 A;  1KOT A;  3D32 A;  4TQ0 A;  4F1S A;  1GC7 A;  3Q3F A;  2KMA A;  1WH3 A;  4NJ6 A;  1ZW7 A;  3B0A A;  2A5U A;  3GZN I;  3ZRC A;  1NI2 A;  3VXW A;  3RYT A;  3KYD D;  4G0N B;  2DYO A;  3DVN V;  4W9J A;  4E71 A;  2D07 B;  4AJY B;  1ZGU B;  2KDF B;  2MBB B;  3ENE A;  4FHK A;  2MSE D;  4NJ7 A;  1IPG A;  5CHW A;  1WM2 A;  1YJ1 A;  2MBQ A;  3VUY A;  2KWU B;  2MLB A;  2NBW B;  1UEL A;  5AZG A;  3QK0 A;  2EKE C;  3ZIM A;  1WGH A;  5IAA C;  2Z0D B;  4BFR A;  3JYU A;  4E74 A;  3QA8 A;  4PS3 A;  2IO2 B;  4EEW A;  1OQY A;  1WI0 A;  3APF A;  2KLC A;  1FXT B;  4FHJ A;  2GOW A;  3EFU A; 
#chains in the Genus database with same CATH topology
 2CU3 A;  3N1Y C;  4LJP B;  1P0R A;  4DK5 A;  3PTF C;  4TMA B;  2WU2 B;  2KDB A;  2HE7 A;  1V80 A;  2L0F A;  5DPR A;  2AX5 A;  2X38 A;  3VR9 B;  4B9K A;  3H1U A;  3RN9 C;  5BYS A;  2WQY B;  2WYQ A;  1GC6 A;  5D6J B;  4C7Y A;  1IUE A;  5E6O A;  3AMZ A;  1VJK A;  1GB1 A;  2KKC A;  4JX1 C;  3FAH A;  1LQB A;  1C4A A;  3WAN A;  5IA7 A;  1PQS A;  2JQR B;  1D3Z A;  2FIF A;  2N0S B;  1YQB A;  4K7S A;  2KX0 A;  4AUQ C;  1TKE A;  3WAP A;  2AWT A;  5IKC M;  1AWD A;  5L95 C;  1L0Y B;  1H8C A;  2LRW A;  4RF0 A;  3NJT A;  5AZH A;  3H8H A;  4C80 A;  1WZ3 A;  1V5O A;  4II3 B;  1J8C A;  3DVG X;  4M0W A;  2JWU A;  2JYT A;  2EKI A;  2N1W A;  1FCC C;  2KQ7 A;  2D3G A;  1FIQ A;  1L4Z B;  4ZRI A;  4GU2 A;  2BS4 B;  3U4E G;  2UWQ A;  3Q8B A;  3PVL A;  2OHF A;  3QWZ B;  3DCG A;  2QIL A;  2J7Q B;  3PZ7 A;  4ZHP A;  5KHQ A;  5EDS A;  1XLO A;  2CHZ A;  2FBW B;  3RUI B;  2BF8 B;  1V6E A;  3EA6 A;  1OQR A;  4BOZ B;  2INP E;  3ZUN A;  1EWY C;  1ZXI A;  2BWF A;  3ZQ4 A;  1BML C;  2LZ6 A;  1EM7 A;  2R2Q A;  1KTK A;  2W9N A;  3GE8 C;  3RUL A;  3QIJ A;  2KNB A;  3VTU A;  1RLF A;  1SGH A;  3SU8 X;  3DWG C;  1R4N I;  1V97 A;  3VRB B;  1WRD B;  2BKF A;  2WXK A;  1YOV B;  2C7M B;  4RMA A;  4GDK A;  3ZLZ A;  5MPO A;  3QQ8 B;  4EFO A;  1XXG A;  4LK0 M;  1C76 A;  3OAW A;  1GAQ B;  2Q5W D;  4BAX A;  1JAL A;  4ASW C;  5DPT A;  2CS4 A;  2V3S A;  1HEZ E;  2K9X A;  1F77 A;  2KJR A;  2ZVO A;  2R61 A;  4JQW C;  1ZDV A;  3PSE B;  4IW0 A;  4ZRP A;  2DAJ A;  4EZJ A;  2BS2 B;  1L6V A;  3NY5 A;  4GDK B;  1PGB A;  3ZNG C;  2O6V A;  3OJ3 A;  1T0Y A;  3HRD D;  2VZK D;  1MJD A;  3P63 A;  3JVZ X;  1A5R A;  2KAN A;  1HTO A;  3B2F A;  1LO5 D;  5JHA A;  4WJQ A;  2WLB A;  2Z8L A;  4S17 A;  3M95 A;  3PHW B;  1YMH E;  3DVN U;  1WRI A;  3T9L A;  1WM3 A;  2SEB D;  3X23 A;  2QCZ A;  3GZN B;  1BXT A;  4G3X B;  4GMV A;  3IHP C;  3B2G A;  2KO3 A;  1C77 A;  2LGY A;  3Q8F A;  3AE5 B;  1L5P A;  4HK2 A;  2PVG C;  1FFV A;  2KDM A;  1EO6 A;  3DPD A;  4TSS A;  2NTS A;  2O6V B;  2KTF A;  2MP2 A;  3HVZ A;  1ZUD 2;  2GB1 A;  3APC A;  2PJH A;  2B3A A;  5IN7 A;  4A3O A;  1DOX A;  4KGS A;  1TS5 A;  2DNF A;  3NHE B;  4MSQ B;  1MG8 A;  2K6Q A;  1V1P A;  4MGZ E;  1XCT L;  2KTR A;  2L52 A;  2FUG 1;  4ANV A;  5HKH A;  1UD7 A;  2WGS A;  4FAD A;  4AP4 C;  3HUI A;  1CJE A;  3NVV A;  3VUW A;  1ET9 A;  4KZ0 A;  2LAS A;  3PHX B;  3KQ4 A;  2I1K A;  1DYQ A;  1WXS A;  4W9H A;  1I4X A;  1SF0 A;  2JXX A;  2K8B A;  5HG2 A;  4LDT B;  1WJN A;  1UH6 A;  2I2Y A;  3P4P B;  1V1P B;  2LVO A;  2KTR B;  5LXI B;  1YJJ A;  4KSK C;  4TKN A;  1KRH A;  4BVU C;  5DCN A;  2FE8 A;  1TY2 A;  4GN1 A;  1WYW B;  4DDI D;  5J17 A;  3BII D;  5D2M B;  1PUT A;  2MA9 B;  2ZW0 A;  2BTE A;  3W1Y A;  2KHW B;  4BBN F;  4BOS C;  1GJZ A;  3NVW A;  2N7D A;  2KAJ A;  2MJ3 A;  1V5T A;  1SSN A;  2I38 A;  2J0M A;  2MWS B;  4USA A;  1HZ5 A;  3EC8 A;  3V61 A;  1SIF A;  2KT7 A;  3E9S A;  2PIA A;  1UGM A;  2M56 B;  1NYR A;  1QIL A;  2BYE A;  1SEB D;  3R66 C;  4PS7 A;  2NS5 A;  1ZOY B;  1RAX A;  3K9P B;  3JW0 X;  4AOF A;  2KOX A;  4DWF A;  1F2R C;  3AE7 B;  3LB8 C;  2IBI B;  1N5X A;  3N1Z C;  1JWB D;  4K7U A;  2BQQ A;  1C1Y B;  1OQQ A;  2J0K A;  1ACC A;  3RMK C;  1SB3 C;  4HKQ A;  1C4P A;  2V9H A;  5D3D A;  4ITK A;  3Q3J A;  3CF6 E;  2EEL A;  4Q2J A;  4KV2 A;  2PE6 B;  2DLB A;  3R2T A;  5JXV A;  4WWP A;  4PYZ A;  2MBO A;  4HJK A;  1A70 A;  2N9K A;  4I6N B;  4WH4 A;  5TR5 A;  4EKU A;  3MHS D;  2ZPY A;  3R7R A;  1QOA A;  3AU5 A;  3A4R A;  2M0A A;  3L4P A;  2C5L C;  3EGR A;  2EMS A;  2LGD A;  4OZB A;  5C2T B;  1KOT A;  5H8Y E;  1XO3 A;  4TQ0 A;  2XN9 C;  4ZRQ A;  1GC7 A;  1WH3 A;  1ZW7 A;  3B0A A;  2A5U A;  5E6J A;  3VXW A;  3RYT A;  3KYD D;  3DVN V;  4W9J A;  3ZGZ A;  4YTN B;  4FHK A;  3TUO A;  2K22 A;  5CHW A;  1N63 A;  4S0R A;  2NBW B;  3MC8 A;  3ZIM A;  3AEF B;  1WGH A;  5IAA C;  1T0S C;  1I4H A;  1I4P A;  4EEW A;  3APF A;  2KLC A;  5EE9 A;  2VH1 A;  3BYY B;  4FHJ A;  2NTT A;  3TL5 A;  1L6U A;  1OEY A;  1EU3 A;  1HXY D;  2B76 B;  2VH2 A;  4LNI A;  4C56 C;  1ENF A;  5BMI A;  1F52 A;  4NQK E;  1P1A A;  2QJL A;  2KVZ A;  2YLM A;  5L83 A;  4ZOH C;  4GLS C;  3I5J C;  1PDX A;  1V9J A;  5HFY A;  4M00 A;  2AYO B;  3UIP B;  3EEC A;  4L2Y A;  1E90 A;  3N30 A;  1I7H A;  5AEK B;  4GB9 A;  5JHB A;  4P6V F;  1QKZ A;  2INC C;  3CIR B;  2CR5 A;  2ZVN A;  2QIE B;  3ECI A;  2LWP A;  2KWD A;  1TKY A;  1TZ1 A;  3BK2 A;  1C79 A;  3JSV B;  3N20 C;  2JX5 A;  3RPF C;  2MX2 A;  4HEA 1;  2GBK A;  1IGC A;  3NZU A;  4KX6 B;  3RNF C;  3RNA C;  3ZO5 B;  2LGS A;  2N7J A;  2O6V D;  2MJE A;  2LVP A;  3AE4 B;  3V6C B;  4GDL A;  4EZK A;  4A20 A;  2N1V A;  2INN E;  1WR1 A;  3A4S C;  2N9X A;  1SJE D;  2NCN A;  1WF9 A;  3W9C B;  4K81 A;  4BBN C;  1SBB B;  3R8B A;  1WX8 A;  1RWS A;  4XE0 A;  2W55 A;  2BKR B;  3U30 A;  1QOF A;  2WP9 B;  1PYW D;  3Q69 A;  1IBX A;  1KFY B;  4HLE A;  2LI5 A;  1NEN B;  3IXS A;  2IDY A;  1VRA B;  3AI5 A;  4BKS A;  2BW2 A;  2ZPN A;  3I57 A;  4LDT D;  3Q8C A;  4GDL B;  4OVZ A;  3GOE A;  4GIV A;  3E56 A;  3TIX A;  4JWS C;  3VH4 B;  3VTW A;  1BT0 A;  1YN4 A;  1T0R C;  2A4Z A;  3RZF A;  2WX0 A;  1ESF A;  3BVZ A;  3SDL C;  3ZRF A;  2LHE A;  2LXA A;  3B9J A;  3BVG A;  4N59 A;  2WWZ A;  2WDT B;  4KKJ A;  3AEC B;  3P42 A;  2KX3 A;  2WXI A;  4DHJ D;  3VDZ A;  1TY0 A;  3AEE B;  4WWM A;  1IBX B;  2LMC A;  3RFZ B;  1PGA A;  2LD9 A;  4KVG B;  2J4X A;  1I4G A;  4XDC A;  3VUX A;  4BKT A;  2L32 A;  1UWM A;  1FXI A;  3W5U B;  5AUK A;  1SJH D;  1Z5S B;  3VH3 B;  1TGZ B;  2BS3 B;  3HM6 X;  4RGM A;  2LHD A;  3KWV A;  3RNC C;  4DXA B;  2XK5 A;  5AZF A;  1U4A A;  2C9W B;  3AB5 A;  3UIO B;  4WQM A;  5J2R A;  4E3C A;  3DDC B;  3PS6 A;  3AEA B;  4HCN B;  2RSU A;  4L1B A;  2QHO A;  1E8X A;  4US8 A;  4WJO A;  1SE3 A;  4HDQ A;  4JIO U;  3BWU D;  2HD5 B;  4AWJ A;  1RFA A;  4I6L B;  3IVF A;  1MHH E;  3OLM D;  3URY A;  1I4Q A;  3I3T B;  4IKG A;  4RGN A;  4H2A A;  2KXJ A;  4HRS A;  2DHZ A;  2KC1 A;  4KSL C;  3CSF A;  2XK5 B;  1L0V B;  4JL9 A;  3ZXV A;  1B1Z A;  2CHX A;  1FXA A;  4FBJ B;  2ON8 A;  3DBR B;  4BZA A;  2ICI A;  3R3M A;  3T3N A;  1HZ6 A;  4QAY A;  1RM6 C;  5JZE B;  3MFG A;  1UZX B;  3MP9 A;  4RCO A;  3ZJV A;  2NR2 A;  5AUI A;  1WGK A;  1MPE A;  3V62 A;  4M0W B;  2E6X A;  2LJ5 A;  1GG3 A;  2RGF A;  4ANW A;  3U2S C;  2WXM A;  3AN1 A;  3O65 B;  2N9P C;  3ML9 A;  1VZ8 A;  3V6E B;  3C8Y A;  1TS4 A;  1V2Y A;  1C78 A;  2KVR A;  3NRZ A;  2KJ6 A;  4CHK A;  3ZJU A;  1I35 A;  2J53 A;  1Q0W B;  2Y5C A;  2N7E A;  2ZJD A;  4OVV A;  3A1Q A;  2WS3 B;  4OVU A;  4A55 A;  3UQB A;  3BY4 B;  2V4I B;  4YTP B;  3ZNZ B;  4WUR A;  3PZ8 A;  2IY1 B;  2FAZ A;  3P4Q B;  1P7E A;  1NEK B;  2JU6 X;  1YN5 A;  2XNA C;  3MHZ A;  3SR6 A;  1FRD A;  3ZKJ C;  1K53 A;  5G55 A;  1N5W A;  2V3N A;  3OJ4 B;  3PLV A;  4HVB A;  2CHW A;  3RCZ A;  3FIL A;  1KLG D;  3T8M A;  3VFK A;  4LLG M;  2LGX A;  3C0R B;  3WAL A;  3T3O A;  3A1Q B;  3PT2 B;  1B9R A;  2JT4 B;  1P3Q U;  3N3K B;  4II2 B;  3M3J A;  1JML A;  2K6D B;  4MDK E;  4FN2 A;  2W54 A;  4UDU C;  1PFD A;  4J6I A;  3UQA A;  1N61 A;  1ZE3 D;  3LXF A;  3WAO A;  2MQJ A;  4MH0 E;  3IG3 A;  4GGQ A;  3AXC A;  4WAF A;  3SHQ A;  4N9F 4;  3UGB B;  4KKI A;  1Q1O A;  4MSM B;  1EUV B;  1WX7 A;  3FIL B;  3PO0 A;  2GBN A;  5GMV A;  2C60 A;  1E5W A;  2QC8 A;  2K1F A;  3Q14 C;  2N9E B;  3P4S B;  4ZDV A;  4W9C A;  4HRO A;  4DXF A;  4A9A A;  4WWN A;  3W1S C;  1AAR A;  1S3S G;  1WX9 A;  2G45 B;  3GS2 A;  2IGD A;  1JWU D;  2WXL A;  3IBE A;  2ZEQ A;  4RH6 A;  4F8C B;  4MEL A;  4AJW A;  2WX1 A;  1FMA D;  3SD5 A;  2H89 B;  4IUM B;  4ARI A;  1ISN A;  4M8M A;  4OZC A;  2J52 A;  4KIK A;  3AE9 B;  3AEB B;  1T3Q A;  1HQR D;  3VQI A;  1F2R I;  2Y3A A;  4OHJ A;  2RMM A;  1J7A A;  1UGJ A;  4PS8 A;  2DZM A;  3UF8 A;  2MP2 B;  3I63 C;  4HWI B;  2PE9 A;  1FCL A;  3AV8 A;  4HCP B;  2AEH A;  4HPP A;  3DVG Y;  3QX1 A;  2D3B A;  5FR3 A;  1V81 A;  5IO9 A;  4RF1 A;  2KMA A;  4G0N B;  3KLS X;  2D07 B;  2MBB B;  2IJ0 A;  1L0X B;  1SXT A;  3VUY A;  3QK0 A;  2EKE C;  2Z0D B;  2YEP F;  3JYU A;  3QA8 A;  4R3D A;  5EE1 A;  1OQY A;  5EE0 A;  1FXT B;  2GOW A;  3EFU A;  3B08 A;  2Z0E B;  3W1S A;  3QC8 B;  4WQO B;  1VR9 A;  1E6E B;  3DBH B;  2KYW A;  2DEN B;  1YIW A;  5BMH A;  1HTQ A;  1UUP A;  2BYT A;  4XYC A;  4O1N A;  3M62 B;  3DHI C;  4K3C A;  2KD0 A;  3ONS A;  4IM2 A;  4XC2 A;  1SE2 A;  3BZD B;  3SEB A;  3VHT C;  2BBC A;  4NJC A;  1UBI A;  4JE3 B;  2KN4 A;  4CYE A;  3AU4 A;  4ZRK A;  1YD8 U;  4D2K A;  1YX6 B;  3TEZ A;  2M17 A;  1OTR B;  4AS1 A;  3NS1 A;  3RI7 C;  1FRR A;  2K0P A;  2WXH A;  2K5P A;  4IM3 A;  2MH7 A;  4M8N A;  2QSD A;  1E9M A;  1H4R A;  3MJ5 A;  3APD A;  4K7W A;  2M19 A;  1J7C A;  1R4M I;  3IT4 B;  5G5H A;  1WYG A;  2W3S A;  3DOW A;  3DHH C;  2MHJ A;  2DYM A;  4TUU A;  3NOB A;  2HDE A;  1XEE A;  2L00 B;  2UYZ B;  2XBB C;  2RPV A;  1AW7 A;  2BWE S;  4C7Z A;  1QOG A;  1NI3 A;  1FM0 D;  3QHT A;  1MFW A;  1KLU D;  3KUC B;  2ZNV C;  3IAM 1;  2JRI B;  4DXG A;  4W9E A;  4RM9 A;  2BVC A;  2YVC A;  5FR6 A;  2UU7 A;  1WIA A;  1UBQ A;  2D10 A;  2IGG A;  2PEA A;  2JUO A;  1E7V A;  4C4V A;  4LJO B;  1MVK A;  2N9L A;  2V4L A;  4NAM A;  4LTU A;  3IT6 B;  1WGG A;  5KHO A;  5IOI A;  3H7P A;  1WJU A;  1J7B A;  2ZZP B;  4F7Z A;  1VZ6 A;  3C19 A;  2QMT A;  4MGY E;  3L16 A;  1RFK A;  4HDO A;  3WIM A;  1ZP0 B;  4M02 A;  2KDE B;  3NUH B;  2LXC A;  2WXO A;  2DBY A;  2WXR A;  2PLP A;  2IYD B;  2G1E A;  1WJ6 A;  1UWX A;  2DZJ A;  1E8W A;  1QOB A;  3ZDM C;  1TKG A;  5LLI A;  1XLQ A;  2IO0 B;  1V8C A;  3ZXR A;  4DDG D;  3PZD A;  1T5X D;  1VDV A;  1XD3 B;  1TJE A;  1AN8 A;  4RGT A;  5HHD G;  3I9V 1;  3Q3N C;  3EUB 2;  4MEM A;  3KW5 B;  3DBR I;  1L2N A;  3PPA A;  3H7P B;  1WFY A;  4IC7 B;  2L7R A;  1EF1 A;  4KGR A;  3KYC D;  4US9 A;  3TBL D;  3KUD B;  4G11 A;  4DQO C;  3RNE C;  2ZW1 A;  1JQ4 A;  1F1H A;  4P1C C;  2BB6 A;  3PV1 A;  3RNB C;  4URK A;  1WGR A;  4B0E A;  2AQ1 B;  4MJS A;  3CWI A;  1WXA A;  5IP4 D;  1WZ0 A;  2KQ4 X;  4HJG E;  3OWE B;  2FCS A;  1AYF A;  1EWC A;  1N60 A;  2L05 A;  2C7H A;  5D94 A;  4MGK E;  4ICV A;  5BYQ A;  2L3Z A;  3QCA A;  2ZCB A;  2FUH B;  2PMV A;  4A3P A;  2TSS A;  2L0T A;  4MGI E;  2JPH A;  2R2O A;  3KWL A;  1NBF C;  1VZ7 A;  1STE A;  3AH7 A;  1F0Z A;  2ZNV B;  4WAA A;  2K8C A;  2Y5B B;  3TJP A;  2GI9 A;  2LGI A;  4XX5 A;  4MT5 A;  2JYE A;  2NMQ A;  2BYV E;  3AE6 B;  4MJS B;  4EE2 A;  1JRU A;  3LDZ E;  3ZDT A;  4IG7 B;  1D4B A;  3CMM B;  4DBG A;  3UIN B;  1DOI A;  1RYJ A;  1RRB A;  4CO7 A;  4NPN A;  2FCQ A;  5DPW A;  1T6B X;  1K52 A;  2CJO A;  4G50 A;  5C3J B;  1SIJ A;  2WDQ B;  3AE1 B;  3GP7 A;  4N6E B;  4ZYN A;  3OG5 A;  1V49 A;  4FJV B;  2CU1 A;  3DBL I;  5FKA C;  2JSV X;  3AUL A;  2IZV B;  1I42 A;  1M94 A;  1OEY J;  3EFC A;  3LYY A;  1QF6 A;  1E0Z A;  5TSS A;  2IPK D;  4MM3 A;  3P2B A;  3Q8A A;  3TSS A;  1FEH A;  2D2Q A;  4L23 A;  5J18 A;  1KJT A;  2G3Q B;  2MEK A;  4LNN A;  5CX3 A;  4A6Q A;  3AE2 B;  1XCQ L;  1QLB B;  1R4M B;  4XGA B;  4BKG A;  1WGY A;  1CQV A;  1ZXH A;  4REZ A;  4ZRJ A;  1T0Q C;  5G2N A;  4LCD E;  2LVQ A;  3Q3M C;  4IWP A;  2QEJ C;  2WXF A;  2GLS A;  2KAC A;  3WA0 A;  2N4F A;  5D7G A;  3KH0 A;  2JZZ A;  2NPT A;  5HI1 A;  3ML8 A;  4MM3 B;  4W9I A;  2WHI A;  2V1Y A;  3QAQ A;  4KZC A;  2L8J A;  4IWQ A;  3V3X A;  4DHZ B;  2WXG A;  2K39 A;  2Y5P A;  2KLG A;  3ZJT A;  1X1M A;  4OW0 A;  2WXQ A;  3HHM A;  3KUZ A;  1K50 A;  4A90 A;  1BUI C;  1YJI A;  4I6P A;  5E6P A;  3HK0 A;  2V3P A;  2YEP B;  3X0W A;  1Z2M A;  4C00 A;  2NPT B;  1QQR A;  3NVY A;  4J3O D;  2DZK A;  1MI0 A;  3NS8 A;  2GRI A;  2AQ3 B;  5CHF A;  4EUT A;  3PGE A;  3DBH I;  4JPS A;  1IP9 A;  1D5M C;  1XT9 B;  2EMT A;  1ZPS A;  4NNJ B;  2L83 A;  1FO4 A;  4ZHO A;  2KWV B;  2RDB C;  1WE7 A;  2XEW A;  2AL3 A;  1WR6 E;  4FJZ A;  2JZ3 B;  4FJY A;  2MBH A;  3VAW A;  1KF6 B;  3ETR A;  1HA5 A;  2ZCC A;  2MRP A;  1NDD A;  2FNJ B;  4ANU A;  4YL8 A;  1EF5 A;  4PK1 A;  3BIN A;  3QJZ A;  2WDR B;  3TMP B;  1EU4 A;  2LEK A;  1M4V A;  1WE6 A;  2LUE A;  4IM0 A;  4HKZ E;  4P1B C;  2RDH A;  5CTR C;  3AED B;  2ASQ A;  4JLC A;  3D32 A;  4F1S A;  4RNA A;  3Q3F A;  1NI2 A;  4P16 A;  1JWA D;  3N9Y C;  4E71 A;  5BYR A;  4AJY B;  1ZGU B;  5GXG B;  1WM2 A;  1SE4 A;  1YJ1 A;  2MBQ A;  2KWU B;  1MHX A;  2WDV B;  1UEL A;  5AZG A;  4BFR A;  3FC4 A;  4E74 A;  4PS3 A;  3AM9 A;  2IO2 B;  1WI0 A;  3HVD A;  1JCK B;  1V1O A;  2M4N A;  3SFE B;  1P98 A;  1YQ4 B;  3R2I A;  3AE3 B;  3A9J A;  2AL6 A;  2E3T A;  4HXD A;  1WXQ A;  3TEW A;  4YSZ B;  3U7Z A;  4ZYS A;  1J19 A;  3IAS 1;  3PRP B;  2JXT A;  2KDI A;  4B95 A;  1C3T A;  3H9D A;  4JGH B;  2M0X A;  3N1X C;  2J0J A;  3MC9 A;  2OJR A;  4P7I A;  2FCN A;  2JVC A;  3DBL B;  2W82 A;  5C23 A;  2CJN A;  2KK8 A;  3NG0 A;  2VRR B;  4NAW A;  4ANX A;  1K51 A;  3L08 A;  2D3C A;  4NQL B;  2PKO A;  4WJP A;  4MH8 A;  1Y8R C;  3A9J B;  4K1R B;  1F9J A;  3H6N A;  5G5G A;  4LNF A;  1LFD A;  3DQV A;  3KVF B;  2D5G A;  5E6N A;  1S1Q B;  4TV3 A;  3AEG B;  4GSW A;  2GMI C;  4IOI E;  4W9L A;  2K25 A;  3TEX A;  2BGF A;  2LJI A;  1ZKH A;  2RD0 A;  3P1M A;  4WIP A;  4NAW B;  4B6W A;  4RM8 A;  2D3A A;  5BMG A;  3L54 A;  2IGH A;  1V86 A;  1WJ4 A;  3L17 A;  3AE8 B;  4W9F A;  3RNG C;  4YTM B;  3K9O B;  3M63 B;  3LJ3 A;  2D11 A;  5D3I B;  3B1L X;  2KQS A;  4GOC A;  2HTH A;  4ICU A;  2V0G A;  2HTM E;  2MW5 A;  4IDI A;  3HM3 A;  3CST A;  2ACZ B;  2HJ8 A;  2W3R A;  4FUL A;  4KIK B;  1DOY A;  2G4D B;  1YNT E;  5DPS A;  3ZTD A;  2WU5 B;  2LFI A;  3ZTC A;  1XLN A;  1WGD A;  3PRZ A;  2GBR A;  1G6J A;  2JZP A;  1P9D U;  5I4D A;  1GPX A;  1TIF A;  2NVU I;  1OFF A;  1GUA B;  2DAF A;  3BYT B;  2BB5 A;  1WXM A;  3Q6B A;  3U52 E;  4DHJ B;  3A9K A;  2DZI A;  1GOZ A;  2OOB B;  2X8X X;  2WXN A;  4CQN A;  2L1A A;  4BKS D;  1WWT A;  2PVO D;  2M1M A;  1TYG B;  1NVI D;  1N62 A;  2K3U A;  2J42 A;  1NYQ A;  5FK9 C;  2M8S A;  3ZVV A;  1D5X C;  3RT3 B;  1FNU A;  2PTL A;  2LRU A;  4GXB A;  4KDL B;  2JRH A;  1WXV A;  1E10 A;  3BVM A;  2PW9 A;  5CHV C;  1E7U A;  4ARC A;  2WNM A;  3J9C A;  2JWZ A;  3MJW A;  4YXD B;  1JW9 D;  4RFB A;  1LM8 B;  1LXD A;  4HPM B;  4W9G A;  4NY0 A;  4LNK A;  3U8Z A;  3A9K B;  4NZL B;  3ZNH B;  4FLH A;  4W9K A;  4ACF A;  1P7F A;  4PYU A;  1Q10 A;  2C7N B;  2JY6 A;  4JWU C;  1R4N B;  1WMH A;  1XQQ A;  1E8Y A;  3O13 A;  1TT5 B;  1JRP A;  1Q5W B;  1XF5 L;  3MTN B;  2WXJ A;  4XDD A;  4YT0 B;  5C1Z A;  4PT5 A;  1ET6 A;  5LXH A;  2AQ2 B;  2KC2 A;  1E7P B;  3BK1 A;  4XWW A;  4YWG G;  4M01 A;  2REX A;  2KMM A;  2WXP A;  3VTV A;  1YN3 A;  1VD2 A;  1Y56 A;  1QZE A;  1C4C A;  2H88 B;  5H92 C;  3R7Q A;  3ZYY X;  4HPL B;  3TCA A;  3GE3 C;  4AQ7 A;  1FD6 A;  4TQ1 A;  3V05 A;  4X57 B;  2G4S A;  1I4R A;  3HIZ A;  2IY0 B;  2I1J A;  1N6Z A;  1WMH B;  1TBE A;  3H7S A;  3MC0 B;  4A8X C;  1JWM D;  1ROE A;  1VLB A;  5LNK 1;  4N58 A;  2IO1 B;  3W5V B;  2FID A;  4B0M A;  4EOY A;  1WSP A;  2BPS A;  3DBS A;  4WJN A;  2IND C;  2KFK A;  2KJH B;  4C4V B;  3ZNI D;  2RDG A;  3EHV A;  1IYF A;  4XWT A;  2K8H A;  1FFU A;  2G9H D;  1DGJ A;  2RR9 A;  2L76 A;  2DYB A;  2RPQ A;  3IFW B;  3U7D A;  1JWS D;  4W9D A;  1E8Z A;  3A33 B;  3L13 A;  3S2A A;  4FXC A;  1ZDX A;  2MCN B;  1QT9 A;  2LUM A;  3VR8 B;  2CKH B;  3V60 A;  4YSX B;  5T8I A;  1KM7 A;  3L0W B;  3PRE A;  1JRO A;  2MJD A;  1TS3 A;  1UF0 A;  5BO4 B;  1KLV A;  3JSV A;  2GBJ A;  2PPH A;  1OGW A;  3QAR A;  1VCB A;  2KFK B;  3PLU A;  3Q2A C;  1J0G A;  1PGX A;  3Q8E A;  1D6E C;  3L10 B;  3FKY A;  2JF5 A;  2VZK B;  2SAK A;  2ONQ A;  2KFJ A;  2KWC A;  1WY8 A;  1GB4 A;  4MAC A;  3NVZ A;  3DHG C;  3VRA B;  1KH0 A;  3VVW B;  4FA6 A;  1K8R B;  3NZ3 A;  4OZA A;  2KN5 A;  1XLP A;  3Q3O C;  1FPY A;  3P4R B;  1R7S A;  1CMX B;  1YQ3 B;  5JH5 C;  1D5Z C;  1YX5 B;  1GNU A;  1UNS A;  2Z59 B;  1TS2 A;  3ALB A;  1IGD A;  2BYF A;  4DHZ E;  2IO3 B;  2O2V A;  4KGT A;  2OJW A;  2KMC A;  3RD2 A;  3TEY A;  4KDI C;  2FCM A;  3ZW3 A;  1MG4 A;  3UI3 A;  1HE8 A;  2MBE A;  2DX5 B;  4LNO A;  2NBV B;  3WAM A;  3N32 A;  1LGR A;  1TZO A;  3PRM B;  3WCQ A;  4XZ4 A;  4EZL A;  1FNV A;  3NZS A;  4YSY B;  1CK1 A;  1C9F A;  1SE9 A;  3RZW C;  2OED A;  5EE3 A;  4K3B A;  1L7Y A;  2QDF A;  4IWO A;  1TTN A;  2NBU A;  4WWO A;  2KZR A;  2BT6 A;  2O2V B;  3GB1 A;  2GBM A;  3ABV B;  3DWM A;  3SFD B;  4NJ6 A;  4RGO S;  3GZN I;  3ZRC A;  2DYO A;  2KDF B;  2HJ1 A;  3ENE A;  4NJ7 A;  2MSE D;  1FNW A;  1L4D B;  1IPG A;  1CZP A;  3W2D A;  2MLB A;  2DWQ A; 
#chains in the Genus database with same CATH homology
 2M4N A;  3B08 A;  2Z0E B;  3W1S A;  1P98 A;  3TL5 A;  3QC8 B;  4LJP B;  1P0R A;  1OEY A;  3A9J A;  4WQO B;  3PTF C;  4DK5 A;  2AL6 A;  4HXD A;  2DEN B;  1YIW A;  4NQK E;  1P1A A;  2YLM A;  1J19 A;  3PRP B;  5L83 A;  2KDI A;  2KDB A;  4B95 A;  3H9D A;  2HE7 A;  3M62 B;  1C3T A;  1V80 A;  2KD0 A;  3ONS A;  1V9J A;  4JGH B;  2M0X A;  2AYO B;  2L0F A;  5DPR A;  4IM2 A;  3UIP B;  3EEC A;  4XC2 A;  1E90 A;  2J0J A;  4B9K A;  3N30 A;  5AEK B;  3H1U A;  3VHT C;  2OJR A;  4GB9 A;  4P7I A;  5JHB A;  2WYQ A;  1GC6 A;  2FCN A;  5D6J B;  5E6O A;  1UBI A;  2JVC A;  4CYE A;  3AU4 A;  4ZRK A;  2KKC A;  1YD8 U;  1LQB A;  5C23 A;  2CR5 A;  1YX6 B;  2ZVN A;  2KK8 A;  2M17 A;  1OTR B;  3WAN A;  2VRR B;  5IA7 A;  4NAW A;  1PQS A;  4ANX A;  3ECI A;  2LWP A;  1D3Z A;  2FIF A;  3L08 A;  4NQL B;  4WJP A;  1YQB A;  4K7S A;  4IM3 A;  2KX0 A;  4M8N A;  1Y8R C;  3WAP A;  4AUQ C;  1H4R A;  2AWT A;  3A9J B;  3APD A;  1F9J A;  1TZ1 A;  3H6N A;  4K1R B;  4K7W A;  1R4M I;  3JSV B;  3DOW A;  5L95 C;  1H8C A;  2LRW A;  1LFD A;  2MX2 A;  3DQV A;  5AZH A;  2DYM A;  4TUU A;  3NOB A;  2GBK A;  2L00 B;  3NZU A;  2UYZ B;  3KVF B;  1WZ3 A;  2XBB C;  1V5O A;  4II3 B;  5E6N A;  2BWE S;  3DVG X;  1J8C A;  3ZO5 B;  2N1W A;  1S1Q B;  2KQ7 A;  2D3G A;  2O6V D;  4TV3 A;  3QHT A;  2LVP A;  4ZRI A;  4GU2 A;  4GSW A;  3V6C B;  3KUC B;  2ZNV C;  2JRI B;  2UWQ A;  4GDL A;  2GMI C;  4EZK A;  4A20 A;  2N1V A;  4W9E A;  4RM9 A;  3PVL A;  4W9L A;  3QWZ B;  2YVC A;  3DCG A;  5FR6 A;  1WR1 A;  2K25 A;  2BGF A;  3A4S C;  2RD0 A;  1ZKH A;  1WIA A;  1UBQ A;  2D10 A;  2J7Q B;  2PEA A;  4NAW B;  5KHQ A;  2JUO A;  4B6W A;  1E7V A;  4RM8 A;  5EDS A;  4LJO B;  2N9X A;  2NCN A;  3L54 A;  1WF9 A;  2CHZ A;  1V86 A;  2V4L A;  4K81 A;  2BF8 B;  3RUI B;  4BBN C;  1WJ4 A;  3L17 A;  1WGG A;  4W9F A;  1V6E A;  5KHO A;  1WX8 A;  4BOZ B;  3K9O B;  3H7P A;  3M63 B;  2BKR B;  1WJU A;  2D11 A;  3LJ3 A;  2ZZP B;  3U30 A;  3ZUN A;  4F7Z A;  3B1L X;  4MGY E;  2BWF A;  3L16 A;  4HLE A;  2LI5 A;  2LZ6 A;  4HDO A;  2KQS A;  2R2Q A;  3WIM A;  2W9N A;  4GOC A;  2HTH A;  4ICU A;  2KDE B;  3RUL A;  3QIJ A;  2KNB A;  2LXC A;  1RLF A;  2MW5 A;  3VTU A;  1SGH A;  3AI5 A;  3SU8 X;  4BKS A;  3HM3 A;  1R4N I;  2ZPN A;  4LDT D;  2IYD B;  3CST A;  2HJ8 A;  1WJ6 A;  1WRD B;  2DZJ A;  1E8W A;  2BKF A;  4GDL B;  3GOE A;  4GIV A;  2C7M B;  3TIX A;  4RMA A;  3ZDM C;  4GDK A;  4FUL A;  4KIK B;  5LLI A;  3VH4 B;  3VTW A;  1BT0 A;  2G4D B;  2IO0 B;  3ZLZ A;  5DPS A;  2A4Z A;  3QQ8 B;  2WX0 A;  3RZF A;  3ZTD A;  4EFO A;  3OAW A;  3ZTC A;  1WGD A;  3PRZ A;  2GBR A;  4DDG D;  3PZD A;  3SDL C;  1G6J A;  3ZRF A;  2LXA A;  1P9D U;  1XD3 B;  2WWZ A;  2WDT B;  2NVU I;  4MEM A;  1GUA B;  2DAF A;  4ASW C;  5DPT A;  1WXM A;  2CS4 A;  2KX3 A;  2V3S A;  3DBR I;  3KW5 B;  3PPA A;  4DHJ D;  1L2N A;  3H7P B;  3VDZ A;  1WFY A;  4IC7 B;  2KJR A;  2ZVO A;  2L7R A;  1EF1 A;  4JQW C;  3A9K A;  3KYC D;  3PSE B;  4IW0 A;  3TBL D;  2DZI A;  2OOB B;  4DHJ B;  3KUD B;  4G11 A;  2LD9 A;  4KVG B;  4BKS D;  2M1M A;  3VUX A;  4BKT A;  2DAJ A;  3PV1 A;  4EZJ A;  4URK A;  1WGR A;  2M8S A;  3ZVV A;  3NY5 A;  3RT3 B;  4MJS A;  4GDK B;  1Z5S B;  3VH3 B;  1WXA A;  1WZ0 A;  1TGZ B;  2LRU A;  4GXB A;  3ZNG C;  4KDL B;  2O6V A;  2FCS A;  2JRH A;  3OJ3 A;  1WXV A;  3HM6 X;  1T0Y A;  5CHV C;  1E7U A;  2L05 A;  2C7H A;  3JVZ X;  5D94 A;  4DXA B;  2JWZ A;  2XK5 A;  3MJW A;  5AZF A;  1A5R A;  1U4A A;  4MGK E;  2KAN A;  2C9W B;  4ICV A;  1LM8 B;  3UIO B;  2L3Z A;  3QCA A;  5J2R A;  4E3C A;  5JHA A;  2ZCB A;  2FUH B;  3DDC B;  3PS6 A;  4WJQ A;  1LXD A;  4HCN B;  4HPM B;  4W9G A;  2RSU A;  4A3P A;  2L0T A;  4MGI E;  3M95 A;  2QHO A;  4NY0 A;  3U8Z A;  3A9K B;  3PHW B;  1E8X A;  2JPH A;  2R2O A;  3DVN U;  3ZNH B;  4FLH A;  4W9K A;  3T9L A;  4WJO A;  4HDQ A;  4JIO U;  1NBF C;  1WM3 A;  3X23 A;  4PYU A;  2HD5 B;  2ZNV B;  4G3X B;  4WAA A;  2C7N B;  2K8C A;  2JY6 A;  4GMV A;  2Y5B B;  3TJP A;  4AWJ A;  1RFA A;  3IHP C;  1WMH A;  1XQQ A;  4XX5 A;  2KO3 A;  1E8Y A;  2LGY A;  2BYV E;  4I6L B;  1Q5W B;  3MTN B;  4MJS B;  3IVF A;  4HK2 A;  1JRU A;  1EO6 A;  3DPD A;  3OLM D;  5C1Z A;  3LDZ E;  5LXH A;  2KC2 A;  4IG7 B;  2O6V B;  3ZDT A;  2KTF A;  3I3T B;  2MP2 A;  3CMM B;  4DBG A;  3APC A;  2PJH A;  2KXJ A;  2B3A A;  3UIN B;  4A3O A;  2DHZ A;  1RRB A;  2KC1 A;  4CO7 A;  4KSL C;  3CSF A;  4NPN A;  2FCQ A;  2XK5 B;  5DPW A;  4JL9 A;  2REX A;  3VTV A;  3NHE B;  4MSQ B;  4G50 A;  1MG8 A;  1VD2 A;  2CHX A;  2K6Q A;  4MGZ E;  4FBJ B;  2KTR A;  1QZE A;  3R3M A;  4ANV A;  5HKH A;  4ZYN A;  1UD7 A;  1V49 A;  3R7Q A;  4HPL B;  3TCA A;  4FAD A;  4AP4 C;  5JZE B;  1UZX B;  2NR2 A;  4FJV B;  4TQ1 A;  2CU1 A;  4X57 B;  2G4S A;  3V62 A;  3HIZ A;  3DBL I;  4M0W B;  3VUW A;  2IY0 B;  2LJ5 A;  2I1J A;  1WMH B;  1GG3 A;  1TBE A;  3H7S A;  2RGF A;  4ANW A;  4KZ0 A;  2LAS A;  3PHX B;  3AUL A;  2IZV B;  1I42 A;  1M94 A;  1OEY J;  2I1K A;  1WXS A;  3O65 B;  4W9H A;  2N9P C;  3ML9 A;  3V6E B;  2JXX A;  1V2Y A;  2K8B A;  2IO1 B;  2KVR A;  4LDT B;  2FID A;  2KJ6 A;  4CHK A;  1WJN A;  4EOY A;  1UH6 A;  1I35 A;  4MM3 A;  1Q0W B;  3P2B A;  2BPS A;  3DBS A;  4WJN A;  2N7E A;  2KFK A;  2KJH B;  2D2Q A;  2ZJD A;  4OVV A;  3A1Q A;  3ZNI D;  2LVO A;  4OVU A;  3EHV A;  5J18 A;  3BY4 B;  1KJT A;  2G3Q B;  3UQB A;  1IYF A;  5CX3 A;  2K8H A;  2KTR B;  3ZNZ B;  5LXI B;  4KSK C;  4BKG A;  2RR9 A;  2IY1 B;  2FAZ A;  2L76 A;  2DYB A;  2RPQ A;  1WGY A;  4TKN A;  4BVU C;  3IFW B;  3U7D A;  5DCN A;  4W9D A;  1E8Z A;  3A33 B;  4GN1 A;  3ZKJ C;  3L13 A;  3S2A A;  1WYW B;  4DDI D;  5J17 A;  4ZRJ A;  5G55 A;  5D2M B;  5G2N A;  2MA9 B;  4LCD E;  2MCN B;  2LVQ A;  4IWP A;  3OJ4 B;  3PLV A;  4HVB A;  2CKH B;  3V60 A;  2CHW A;  3RCZ A;  3W1Y A;  3WA0 A;  1KM7 A;  3L0W B;  3PRE A;  2N4F A;  2KHW B;  3T8M A;  3VFK A;  4BBN F;  5D7G A;  3KH0 A;  2JZZ A;  2NPT A;  4BOS C;  1KLV A;  5BO4 B;  1GJZ A;  3JSV A;  3ML8 A;  4W9I A;  2LGX A;  2N7D A;  3C0R B;  2GBJ A;  2V1Y A;  2PPH A;  3QAQ A;  4KZC A;  3WAL A;  1OGW A;  2L8J A;  1V5T A;  1VCB A;  2KFK B;  3PLU A;  3QAR A;  3A1Q B;  3PT2 B;  1J0G A;  4IWQ A;  3L10 B;  4DHZ B;  2JT4 B;  2J0M A;  2JF5 A;  2MWS B;  1P3Q U;  3N3K B;  4II2 B;  3M3J A;  3EC8 A;  2K39 A;  2KFJ A;  3V61 A;  1SIF A;  2K6D B;  2KWC A;  4MDK E;  1WY8 A;  2KLG A;  4FN2 A;  1UGM A;  4J6I A;  3UQA A;  1X1M A;  3VVW B;  4FA6 A;  3HHM A;  2MQJ A;  4MH0 E;  3KUZ A;  3IG3 A;  3WAO A;  1K8R B;  2BYE A;  4GGQ A;  3AXC A;  2KN5 A;  3R66 C;  4N9F 4;  3SHQ A;  3UGB B;  4PS7 A;  2NS5 A;  1RAX A;  4I6P A;  3K9P B;  5E6P A;  1Q1O A;  3JW0 X;  3HK0 A;  4MSM B;  4AOF A;  1EUV B;  2KOX A;  1WX7 A;  4DWF A;  2GBN A;  1CMX B;  5GMV A;  3X0W A;  5JH5 C;  1Z2M A;  1YX5 B;  2C60 A;  2NPT B;  1E5W A;  1GNU A;  2IBI B;  2K1F A;  2DZK A;  2Z59 B;  2N9E B;  3NS8 A;  3ALB A;  4ZDV A;  5CHF A;  4K7U A;  4W9C A;  4EUT A;  1C1Y B;  2BYF A;  4WWN A;  3W1S C;  3PGE A;  1AAR A;  2J0K A;  1S3S G;  2IO3 B;  1WX9 A;  3DBH I;  4DHZ E;  1IP9 A;  2O2V A;  1XT9 B;  2G45 B;  2EMT A;  2KMC A;  4NNJ B;  3IBE A;  2ZEQ A;  2KWV B;  3RD2 A;  3Q3J A;  4KDI C;  2FCM A;  3CF6 E;  3ZW3 A;  4F8C B;  4MEL A;  4AJW A;  1WE7 A;  2WX1 A;  4KV2 A;  2PE6 B;  3SD5 A;  2XEW A;  4IUM B;  2AL3 A;  1HE8 A;  1WR6 E;  4FJZ A;  4WWP A;  4PYZ A;  2MBE A;  2DX5 B;  2JZ3 B;  4FJY A;  2MBO A;  2MBH A;  3VAW A;  4HJK A;  1ISN A;  4M8M A;  2ZCC A;  4I6N B;  4KIK A;  2MRP A;  2NBV B;  3WAM A;  1NDD A;  3N32 A;  4EZL A;  3PRM B;  2FNJ B;  4XZ4 A;  4ANU A;  4YL8 A;  1EF5 A;  3VQI A;  5TR5 A;  3BIN A;  3QJZ A;  3NZS A;  4EKU A;  3TMP B;  3MHS D;  2ZPY A;  4PS8 A;  2DZM A;  3R7R A;  1SE9 A;  3RZW C;  3UF8 A;  1WE6 A;  2LUE A;  3AU5 A;  4IM0 A;  3A4R A;  2MP2 B;  4HWI B;  2PE9 A;  5CTR C;  1L7Y A;  4HCP B;  4IWO A;  2AEH A;  1TTN A;  2C5L C;  2NBU A;  4WWO A;  2ASQ A;  2KZR A;  2EMS A;  2O2V B;  4JLC A;  2LGD A;  3DVG Y;  3QX1 A;  2GBM A;  1V81 A;  1KOT A;  3D32 A;  4TQ0 A;  4F1S A;  1GC7 A;  3Q3F A;  2KMA A;  1WH3 A;  4NJ6 A;  1ZW7 A;  3B0A A;  2A5U A;  3GZN I;  3ZRC A;  1NI2 A;  3VXW A;  3RYT A;  3KYD D;  4G0N B;  2DYO A;  3DVN V;  4W9J A;  4E71 A;  2D07 B;  4AJY B;  1ZGU B;  2KDF B;  2MBB B;  3ENE A;  4FHK A;  2MSE D;  4NJ7 A;  1IPG A;  5CHW A;  1WM2 A;  1YJ1 A;  2MBQ A;  3VUY A;  2KWU B;  2MLB A;  2NBW B;  1UEL A;  5AZG A;  3QK0 A;  2EKE C;  3ZIM A;  1WGH A;  5IAA C;  2Z0D B;  4BFR A;  3JYU A;  4E74 A;  3QA8 A;  4PS3 A;  2IO2 B;  4EEW A;  1OQY A;  1WI0 A;  3APF A;  2KLC A;  1FXT B;  4FHJ A;  2GOW A;  3EFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...