3DBOB

Crystal structure of a member of the vapbc family of toxin-antitoxin systems, vapbc-5, from mycobacterium tuberculosis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
126
Chain Sequence
PAAGVLDTSVFIAQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Proposed Activity of a Member of the VapBC Family of Toxin-Antitoxin Systems: VapBC-5 FROM MYCOBACTERIUM TUBERCULOSIS.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
molecule keywords Uncharacterized protein
total genus 47
structure length 126
sequence length 131
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3dboB00
1V8PA 1W8IA 1UT5A 2H1CA 1XO1A 2HWYA 2MDTA 1O4WA 3QEBZ 3Q8MA 3Q8KA 3ZVKA 2DOKA 5HMLA 1V8OA 2HWWA 3TNDA 3ZDAA 3QE9Y 4WA8A 3ZDDA 5ECYA 5HMMA 5H4GA 2HWXA 2WP8J 3H8SA 2BSQA 4MJ7A 1TFRA 3ZDEA 5SV2A 1A76A 5ECDA 1YE5A 3H87A 3QEAZ 3ZDBA 5ECWA 1EXNA 2IZOA 3H7IA 3I8OA 3IX7A 5ED0A 5K8JB 5HP4A 2IHNA 1UL1X 3ORYA 1V96A 3ZD8A 1A77A 5L6MB 1Y82A 5L6LB 3ZD9A 3Q8LA 1RXWA 1TAQA 3DBOB 3ZDCA 1TAUA 2QIPA 1BGXT 2H1OA 5H4HA 2LCQA 4CHGA 1MC8A 5HNKA 5FV7A 1UT8A 1B43A 3H8WA 1RXVA 3H8JA 2FE1A 4XGQA 4XGRA
chains in the Genus database with same CATH superfamily
3MQ2A 3PZRA 4XR4A 3TUJC 4F4IA 3H18A 4OJTA 4DANA 5AI4A 4LBZA 1JR3E 4RCVA 2AI1A 1QYIA 1LF5A 4K1XA 5H02A 3AERA 3EHEA 3GUHA 4OGGA 1PQYA 1Z4PX 3G2LA 3VDNB 2D2FA 5HIAA 4GH5A 4ZZ0A 3VHLB 1D4ZA 2H1VA 2QRUA 1QX4A 2FMIA 2GLXA 5IYZF 4NNJA 2Y4NA 4RWZA 1ZM9A 3WHKA 1FIUA 2WWGA 2J41A 2JLBA 3U4IA 4ZVNA 4JT8A 4C7JA 2VFAA 1RHUA 2ZXUA 1JFVA 2C96A 5DI3B 5HJ2A 1P2VA 3D0KA 3TLCA 3PFCA 3E4CA 3NJRA 1J2TA 3PT9A 3PI7A 2E4WA 2BIFA 3ANSA 3P9QA 3F5FA 3G68A 4IDPA 4MPPA 5LQSA 1NATA 3ROMA 1I3CA 1F17A 4GVXA 4QRDA 4MS1B 4G67A 4I1SA 2DLDA 3KXPA 2IY8A 1TFUA 4DNFA 1C3JA 1N5IA 1Y8QB 3ZHSA 4IM7A 2PEYA 1SHUX 3OC6A 4OHKA 1NBEA 2PPVA 4PLYA 3DT8A 1WUHS 5F98A 2RGAA 3QEOA 4MS4B 1DKMA 3BCSA 1MW9X 3PNSA 2C0QA 3KV3O 4D44A 1W49A 3QXGA 4A8JB 3QOYA 4ZVSA 1HKHA 1WW3A 2VRCD 5IZCC 1NMSA 4Y9TA 3T3HA 4BX9A 1ST2A 4WT7A 1SUDA 1EJ6A 4H7FA 2XMGA 2QF7A 2VJNA 1ZGCA 3IEPA 1Y3IA 1Y9JA 1RRPA 1MN6A 4AN1A 1FJHA 5ALDA 3VJLA 1R6VA 2PGOA 3VX4A 3LQQA 3VC3A 1P4AA 1U28A 5DM2A 3BL8A 4H7DA 2HSEA 3BTSA 1U8ZA 4JBNA 2PUGA 2WHQA 2BZ0A 3VO9A 2ZYIA 4B79A 4DLAA 1G2PA 5I9BA 1J09A 4A5OA 1LW6E 4Q03A 2QKYA 4QUAA 3OZWA 4S2EA 5A4AA 2AR0A 4H1TA 1ONBA 4G2NA 5JALA 2ZR9A 2IP2A 4UTVA 1NFRA 1WP4A 2C3PA 4DTCA 3DE5X 3AHGA 3GFFA 3GVPA 2VBGA 1IAVA 2Q2QA 2QTMA 3T1YB 1KEPA 1QFJA 3H1GA 5SZJA 4R8LA 3WLMA 2C8JA 4QOIA 2WABA 3GEDA 4MWGA 3X3HA 3GLIB 2YQZA 3OCJA 1TEHA 4NZ9A 2PX4A 2ZS7A 3AUYA 5FWXA 1Q0SA 2EHJA 2F3RA 4M4SA 3FTQA 1T3LA 3PFNA 5DWQA 2WWVD 2YX1A 821PA 1KZ9A 1YFKA 3V9AA 6GPBA 2IEIA 4EPYA 4ZAYA 1W46A 3KLNA 2JLWA 4XIJA 4RIFA 3VR1A 4BVFA 2KHZA 1Z3CA 4OQFA 1TO1E 2NXWA 3BG5A 1TC2A 2YC2C 1J56A 3CRZA 3DFFA 1X9HA 4WEOA 1JB9A 1UOQA 1KEWA 3OWXA 4QRHA 2QM0A 1LI7A 1NULA 1A9TA 3VNBA 3GDGA 3QLVA 5IAAA 2YL2A 1JLLA 1K3UB 2AQHA 4U2EA 4AB1A 3ZLTA 1W4RA 2X86A 2QTHA 3ETCA 3RLIA 3X1MA 4C0BA 5KTOA 2O8BB 3CRMA 4BKUA 1DIOB 4ZRDA 5F21A 5FPSA 4GZLA 2WG1A 1AQNA 2Y1CA 3LY9A 2DLCX 4M9RA 1CJCA 2OCAA 2XQKA 3BIFA 4Q3AA 2HR1A 3K6SB 1SCQA 4PYNA 5ALZA 3R8XA 3E8MA 5LQMA 1IJFA 4XQ9A 1WHTB 3C98A 4UUMA 1J1UA 3LPMA 2BTEA 3DB2A 4F9EA 1ZM4A 1Y0BA 3FTFA 1H3EA 2O5EA 4FFRA 4ZK6A 1DMRA 3MVEA 5J5AA 1R4NA 5H70A 3REFA 2GN8A 1ADCA 3I01A 1X19A 3K0CC 4MW0A 1RI2A 4ZOBA 5TXGA 3KYIB 1I13A 4PO1A 3K53A 3H99A 1XNQB 1LVHA 1GTRA 2CB9A 4DW8A 5LFAA 1YAJA 1MAHA 3IH5A 4LHWA 1KMHA 1TU3A 5JTTA 5A06A 4K8OA 1IJBA 3IP5A 3K6RA 4FC7A 3SEQA 4MRSA 1JFFB 1I7SB 2C57A 1EP2B 1UDWA 3K6SA 1RVDA 5ALHA 1R2QA 1HG0A 1PS0A 3NWEA 1LDYA 1AURA 1N3IA 1ZJZA 1QHSA 2IVZA 2XCQA 4PZEA 4Q9JA 5CVCA 4OD0A 4MSUA 1PG5A 1NHGA 4G81A 1DC6A 4R51A 4DPKA 3U16A 3ESCA 2LGJA 3Q1KA 2X0DA 1PEYA 1H2BA 3QE4A 2VUHB 1T1IA 3FF1A 3QGMA 4YAGA 4L22A 5C5IA 2GYWA 4MA4A 1CZKA 3G3EA 3MGBA 2UZAA 2I6QA 4K2AA 4M1ZA 2F1OA 1SXJD 2I6FA 2X8LA 2CFIA 3PHBE 3IUMA 3Q6IA 2Y1WA 3HN7A 3W79A 1CJVC 4FFLA 2QZPA 3TMKA 3F97A 3WTCA 4M7PA 1LDBA 3O4FA 5TT0A 2WVHA 2OV2A 1FB5A 4FYMA 4UJ5A 1OBVA 5DCLA 4N5MA 5AQ1A 2YMMA 2ZJ4A 2ZJ8A 3TEFA 1LDEA 1D8TA 2O0JA 4V0NA 2HQOA 2HT6A 2ST1A 2X8AA 1AS3A 4FIDA 2C3OA 1UBHS 5K8IA 4BCCA 4K86A 3W5UA 2Y1OA 5JNUA 5EJ5A 5DP2A 2VI5A 3NC0C 4UVGA 2WU1A 2KBEA 3A27A 1UODA 4C3ZA 2NGRA 4JA2A 5AKIA 2NU8B 3CKMA 3L0SA 2OO3A 5EESA 4FZJA 5PNTA 5HKBA 2Y66A 3TF5A 4TKMA 3AR3A 2GMWA 2HK9A 1SEPA 1D1TA 3QA3E 4BRUA 1XTIA 5FLEX 2Q7DA 3ZHBA 1JEQA 1GPDG 2AK3A 2FWIA 3L0OA 3IUQA 1G21A 2Z1MA 3C6BA 1EBBA 1L5YA 2O52A 2A59A 1EGQA 3IB3A 3HNPA 4E03A 4MQEA 1JH8A 1ZK1A 4NV3A 3TE7A 3QBJA 1GD1O 3CQ9A 3A2MA 3LC2O 4PPYA 3SZMA 4XLTA 2P7IA 3U61B 2F4VB 4HAZA 4CN9A 4F8YA 4F3NA 1L7PA 3B1WA 2L17A 4TKLA 1MKYA 5C7YA 4DR2B 1BC5A 4TTIA 2JKZA 4KHPB 1L6IA 1SIOA 4PQYA 1T5LA 2FRDC 4H7HA 2CLSA 3L7YA 3QEKA 2MMCA 3TQSA 1M8FA 3GGCA 3UT6A 2WG2A 4NDAA 2AV6A 2V6FA 3E03A 3F71A 3MTAA 1KSGA 1E2GA 1XZFA 1Q3HA 3GGPA 3HA7A 1NY5A 1U7HA 1FMFA 3FUWA 1V7PC 2ZIXB 2VYVD 4XJXA 5EHIA 3ZHOA 4JXXA 3O83A 4XEUA 4XIYA 4JX8A 4C0XA 2HSWA 1XAGA 2ZE5A 2QL7A 3TDMA 3KJNA 2H7YA 5ALWA 3TMYA 1VL1A 2BZ1A 5FAKA 4G0WA 1YR1A 3HXMA 2PV7A 3ED1A 3PR1A 1UWVA 4P32A 2JJ1D 4B83A 4BGIA 3RT9A 1S3GA 4Q7EA 3UFXA 3HXQA 4LSZA 3NV9A 4UUAA 5HR5A 2WJPA 4RAQA 4BB0A 1BX1A 2FMKA 4FYWA 1MO4A 1OLUB 1SXJE 4YRLA 2HU8A 2IYYA 4CMBA 1JHQA 1MGPA 2A0UA 4EHKA 1W35A 1JALA 2AIRA 1C1XB 2Z4TA 5K0NA 1U31A 2HO5A 5JSFA 3LMKA 2F9MA 2OHJA 2VPWA 4CCYA 1KY4A 4G56A 4C3UA 3OJWA 3SKXA 4DA9A 1L5FA 1GITA 2C9CA 4YUXA 3X1DA 4BQOA 3DHYA 1QIFA 3L41A 4IUBS 3BH6A 1NXVA 1GHTA 3ICCA 2DSTA 1S1MA 5DIZA 1D2EA 2QD5A 2W0SA 2X40A 2DUMA 3GUVA 3KQVA 4FXOA 5DSXA 4ZCQA 5I4CA 3MAAC 3WK5A 5IS2A 1P5RA 3DEFA 1JHOA 3QX8A 5JPIA 1F3LA 10MHA 2O2EA 4E94A 1YZNA 2FI1A 4JP1A 4DUGA 3KFXA 1E3JA 5GV8A 5JAOA 4Y2GA 2UZ4A 1FFGA 2NSDA 2EZ4A 4S1PA 1EJBA 4PN7A 4TLBA 4FFBA 3O4GA 1P2TA 3TRIA 1QVRA 5LDHA 7GPBA 2C2GA 3PEYA 2FWNA 2WUWE 4Q3CA 3HXPA 3W0LB 2DETA 3FCXA 1LDGA 3UMGA 1DC3A 4EYSA 1X1DA 3FPLA 2FG7C 3GMSA 1FW6A 4NWIA 2H11A 2J4FA 1XAJA 3FD8A 3QVUA 3NI2A 2YRXA 1LVUA 4Q3BA 5HA5A 4GPAA 3RBVA 5JCXA 2WY2D 1SH7A 2CUZA 4HB4A 5BP7A 5AKYA 4GGOA 1V0JA 4F5YA 4ER3A 3QI7A 2LVBA 3WYNA 3NHJA 4JB8A 1KA9H 1DHRA 3RYHA 2OBBA 1AV6A 2I65A 4QO7A 4IIEA 2BMFA 1DO0A 1T3SA 2GWRA 1H8EA 3OE5A 4IG4A 1PGQA 3C3DA 2NZ2A 3GT0A 1O1YA 4URYR 3ZVKA 3OZUA 3G5MA 4KQMA 4NBWA 2WNIA 2A9VA 2X77A 3BPSA 4LC9A 4QICA 2UUOA 2CMFA 1OXXK 3HJHA 3WIEA 2IYAA 5IXYA 4G65A 2OO5A 4YAWA 4H6VA 3MMSA 2RGNC 3OKCA 3QXJA 1H6AA 3RO7A 4IDHA 1IJEA 1ZL0A 4XYGA 2PH5A 4RV9A 2AZDA 4AJ9A 2W6IA 2D0OB 2HRZA 1SOUA 1ZH2A 4XFKA 3W5IA 3HH8A 1HNNA 3GFSA 1HQCA 3CYFA 4O5AA 1VCNA 1YE8A 3A7DA 3TN7A 4IO0A 1N0VC 3UJPA 4BV3A 4YMHA 3FUUA 4OP1A 4R6XA 1QF7A 1I5RA 1JG1A 1I1HA 3NDRA 1M8KA 3M6MD 4IIUA 1U63A 4I5IA 1SUEA 1WUYA 1EQAA 2ORWA 2IPLA 2OT3B 3CWZA 2XW6A 1LDNA 2B8WA 2OL4A 4V0LA 4FGWA 5ALMA 2PM8A 2ENWA 3GEMA 3IHLA 4OP2A 4QULA 4CM9A 4NFHA 1IJKA 1C30A 1N2SA 1Y89A 2PANA 4N3CA 1R0XA 2LW7A 4B2PA 1C9KA 1LUAA 1EAYA 1QZ3A 5EHXA 3KJFA 3KKQA 5AW7A 1M67A 1W1UA 2MSCB 4M1TA 3CZRA 4WBNB 4QJ3A 4F7DA 3WZ2A 1PNRA 1HKUA 4RHCA 3TXXA 5BSWA 2VEOA 3P2YA 1P3DA 1PNTA 1ENZA 3PQ8A 1GTJ1 1P7VA 2OXEA 5F1YA 3ZXIA 1USIA 4MLDA 4GC9A 3VPBA 1PZXA 4ZI7B 4CEIB 1CRQA 1JG3A 1Y3FE 2W6ZA 4G41A 2ZUTA 3X2SA 1Z18A 2KMLA 3DPUA 1HPLA 3MWKA 1R8XA 5CPBA 1TZJA 4HO1X 3DE0X 4M53A 4RD4A 4B48A 1O96B 4Q3DA 5EHQA 3KB8A 4H59A 3LIIA 5FO1A 2GF2A 3HG7A 1CY1A 3HB5X 1XTUA 4OLFA 3O8QB 5G1NA 3RVRA 1Q11A 1R5NA 1ZLXA 3A6EA 1DRWA 1CZUA 3LY7A 4IHJA 4Q12A 3TD9A 4IUYA 1ACLA 4OBXA 3VR4H 1JMYA 1FP7A 3OJLA 2GVZC 3UGKA 3SXUB 1U2RA 3DCYA 3COYA 2VAXA 3ULKA 4KYIB 4R01A 4A91A 4EKDA 1QAOA 5BN1A 4WCFC 4TTTS 3K0EA 3RUFA 4DQ0A 5H9VA 3C70A 4DKXA 2E55A 4DNPA 5IUJC 2CYBA 3EZ7A 1CZNA 1AA9A 2XMCA 4I4IA 1AS0A 1WXWA 4EKNB 3JAWA 3OM1A 2SBTA 4V2UA 1T9BA 1DL5A 1XMPA 3H5OA 5MFPA 4ROTA 1T8TA 2D7CA 3AY7A 3N0TA 3NFYA 3QG5A 5CTAA 3WHIA 4CKEB 2ZT5A 3LC1O 4BLPA 1QQ7A 3VBEA 2NPIA 1DUVG 4CMEA 3G2NA 4LISA 4JOBA 1IEVA 5J23A 1EWTA 2QN8A 1G3IA 4K3UA 5LP6C 3LUJA 4BGEA 3R5KA 1IBRA 1Y7IA 4ESOA 2ACEA 5C9ZA 1LSOA 2AJCA 2C9MA 3ENKA 1PDWA 1LS6A 2HX1A 1J2UA 3NKVA 1BN7A 5KSPA 5HP4A 3IEMA 1YVPA 1SIBE 1VFNA 2IYVA 5ALKA 4R9NA 5C8YF 1SKMA 1FVXA 2LCQA 3RVOA 4D02A 2H18A 1U8FO 4IOJA 4MI9A 1MJFA 4RK7A 1NF2A 1VLLA 3LVRE 5CXUA 1YC2A 2OCLA 5ITZB 1PV2A 1Z07A 2AJTA 4HUTA 3TJRA 1W4ZA 3W6OA 4DCGA 4YXFA 3EZYA 3RIYA 4MR8B 1L0BA 1M6EX 4R1UA 4RH3A 5BY2A 4JP3A 4JYPA 5KYGA 2OBYA 1E1QA 3C3MA 4IVQA 3CR7A 2BELA 4B44A 1A9ZA 4G5GA 2NLOA 1L5VA 2Z83A 3UB4A 3UVEA 1KYZA 2GFHA 3M49A 2V5AA 4ND1A 2B36A 5J4LA 3CVXA 3TLMA 4MNTA 3UWMA 5A9RA 2AZXA 1TAUA 3T99A 4HEA1 1QCYA 3W2GA 1KRHA 2Z4SA 3JWPA 2Q3MA 3L4SO 1F8GA 4KSYA 1J0BA 4TSRA 1QGUB 1WF6A 4RHUA 4BXOA 3KQKA 4A8HA 4U2GA 1KQ3A 4XCQA 1C4WA 1AQ6A 1O95A 3VVBA 2XCTB 1W19A 1I0ZA 4FMDF 4P0QB 4Q82A 3F73A 4INOA 3NUGA 3ILHA 1COZA 1TKRA 4YHBA 4NU8X 4ZKDA 4M8NE 2XE6A 2JLQA 3QX9A 3UOWA 3LHKA 1W5SA 4MHOA 1BYIA 2I6UA 2Y8EA 1QYWA 4LTMA 1OLUA 1Y4AE 4JLKA 4KWEA 1E2MA 4JBHA 1RAGA 1BEUB 3NYWA 2R66A 1GNLA 1YRBA 2X4LA 1T9GR 3BD8A 3CZ4A 4ML3A 5C4IA 5K8JB 4RTLA 4KXUA 3G0HA 1ZSYA 1ZGJA 3BQNB 2F55A 1DQRA 2RAPA 2QQEA 3T1VA 1S8NA 3JQ8A 4QELA 5ELMA 2Q5FA 4IH9A 1DCTA 1QIKA 3T4EA 4BQQA 2JBAB 3A11A 2RJ3A 1HQDA 1CQPA 1GNPA 1RQ7A 1VXRA 2CLEB 3AO0B 3FZEA 3MJTA 4YLGA 2YFHA 3BGSA 1P19A 4WLUA 4XB2A 2R85A 1PJ3A 3B52X 1FS4A 4JLVA 2XXAB 1M6YA 3IAXA 2EKQA 2VHCA 3SYLA 4S3MA 5K0ZA 2DJIA 4R83A 5AJZA 4PQFA 1AKNA 4JI4B 2IOQA 1MB4A 4LSMA 3EFBA 3ZWAA 1QGZA 5AP9A 5DKFA 4CODB 4CZ2A 2XHZA 3EMVA 1HM5A 9MHTA 3RG8A 4UHHA 3LZ6A 3GPDG 1JZQA 1XXLA 5TIIA 4RKWA 2QV0A 2EHDA 2XF2A 5CP8A 3L49A 3G0CA 3VVLA 5EQTA 1C7FA 4HAVA 3R44A 2FN4A 4JEUA 4RFSB 5P21A 1RCFA 3V1UA 4HV4A 1XOIA 3U1BA 3NHMA 3IRUA 4LN1A 3H9GA 3EVBA 3IBGA 3PZBA 3GH3A 4MARA 3RREA 1UJ2A 1JXOA 2XVZA 3DXYA 3UBMA 6AT1A 5CT6A 4CN8A 4JJ8A 1SBCA 2LV8A 4D6PA 2HBQA 1OROA 4RKEA 3EC1A 1E59A 4XYMA 3DAOA 3Q2IA 4AJJA 2W71A 1EDBA 1E5VA 4FJ2A 2G6BA 1MAVA 3RHFA 5TARA 1XV5A 2FSFA 4PPGA 2RCYA 3V80A 4RVNA 2P1ZA 2G0NA 4PVDA 4ITRC 1NNI1 1WQ3A 2WF6A 1HZZC 2FWRA 4Q18A 4YJKA 4AMYA 2G63A 4GLLA 1NFFA 1R4MA 2MSDB 5FTNA 2EFYA 1GQYA 2V74B 4G5XA 3R9XB 3FNRA 3G88A 1G7TA 4R2MA 3S55A 4C2BA 1NG1A 6NULA 4A15A 1FFYA 1ZN9A 5IHPA 4JGGA 4N6NA 3L8DA 3L92A 4A26A 4RF2A 5HJ7A 1HGXA 1XFDA 1ECJA 4PX9A 5H3CA 2VK4A 1WMAA 3ZDDA 2JH8A 3U3DA 4TQGA 1EKXA 3IVCA 4UMVA 1EEXB 3ND7A 4GKBA 4O25A 4R9UC 1ZVKA 1C9JA 2CZQA 1FSSA 3R40A 4V03A 2ZRHA 3H0CA 5B2ZA 2Z3WA 3AHCA 3EWNA 1F60A 3JW8A 5FNVB 3ZJ5A 3UMFA 3ZQJA 1GSIA 3CKLA 4H1WA 1X8KA 5AW4A 4UTXA 4ZIRA 4LNUA 3W2FA 4CDNA 4L27A 1TYCA 4GPD1 3QLEA 5AVYA 5LU8A 3KQHA 2G1AA 2ODAA 3I92A 3BMOB 3E3LA 4XYBA 3OJXA 4N0EA 3EH1A 1EVJA 4K9QA 4WE3A 2BFDA 3S5JA 5IN5A 3BXZA 4P5DA 1A71A 5FOTA 2A0KA 3ORHA 3STYA 2V3VA 2AG1A 3D5QA 4NOMA 1ICIA 1MVNA 3GDHA 4RHXA 3WP1B 4ALJA 4EF4A 4QFMA 4AXXA 4R5MA 1FU8A 1PQUA 5B57C 1AS2A 5IKEA 2WWFA 1M1NA 2OWEA 1XMQB 3IL2A 2WE7A 1RE1A 2D1QA 2J0VA 3INNA 1KYQA 1IBSA 3HWSA 2X9GA 1CIPA 3JD3A 1W4BA 3PNPA 4X91A 5IMBA 3B1JA 4EI2A 1S2NA 3O2NA 4EUHA 2NXCA 5JD6A 4JASB 1X7ZA 3PRJA 2A0FA 4UM7A 3F0TA 1MPXA 5HJ5A 1VHJA 4YV0A 3RFFA 2VHEA 3D6AA 4KUHA 4MVJM 4HGPA 2LIPA 4LCJA 2FPRA 3CEAA 4UPVA 3O1LA 3RUDA 2FEXA 2WHEA 2J48A 1Q7BA 3UHPA 3EXFB 4ECAA 4MVJF 3X1ZA 2DECA 1XQ6A 2E4XA 5BWLA 1VHTA 3HL4A 4FBGA 5LD2C 1Z6GA 3BXFA 1RXCA 2X7HA 4OXNA 1ZK4A 4OMCA 4U7HA 5ULLA 2R7KA 3OMXA 5C7IO 1PK7A 1TIBA 3H3FA 1NUPA 2ODQA 3L1VA 3HDJA 1J8DA 3CPEA 3FA2A 3QWFA 4OAPA 4OHZA 1JG7A 3LXUX 4XPIB 1ZL2A 1TVKA 1XVAA 4NQZA 4P3PA 5DYTA 3EUEA 3OE4A 3ANNA 1JQLB 1U2EA 3E0XA 2WAXA 3OLZA 4UBOA 3RODA 4F1WA 2OUKA 2C7PA 1O94D 3VDXA 3SFZA 1HYEA 2WWRA 4ND8B 2QAGA 4CQJA 2GCOA 3IGFA 3AR8A 4EJ0A 1YJCA 3LCRA 1SEVA 3U44A 1AKWA 5FOXA 1Z22A 4V0KA 2AF4C 4NI5A 3BICA 2FCAA 4RVOA 4CM8B 1L1QA 4L4XA 1EFPB 3L0IB 4OAQA 3K1YA 4YJGA 1U6IA 5EGSA 2NWQA 4O29A 1IZ0A 4UXIA 4AJLA 5JROA 1GPJA 4ESEA 4YB8A 2A94A 1G4AE 2BFCB 2IPMA 2BSAA 3N8NA 4CXMA 2C0CA 1Q3TA 3BSWA 2POQX 1Y1LA 2Z0MA 1I6MA 2IOYA 2JJ2A 3WWCA 4MKFA 3I5MA 5TRTA 2QLFA 4ZJUA 1DCMA 3GLSA 2L42A 2P67A 2YVAA 2RBEA 3KCQA 4L51A 4EHBA 2XZLA 1G55A 1PJLA 4AF7A 5LYJA 1RZVA 3ICVA 4ZCTA 2I62A 3OOSA 4N12A 5T6BA 3WGYA 2VATA 4DEXA 2AOWA 2ZEJA 1OQAA 2XRFA 4LHXA 4DLSA 4E0BA 1I10A 1V3VA 3LKBA 4GOKA 4TL8A 2QQ5A 3HO6A 1N8NA 4JA0A 2NO0A 4FS3A 1N6KA 3AL3A 5HF5A 3Q2OA 3W90A 5L3ZA 4CU5A 2D59A 3E4DA 3N0WA 4GIBA 3TSCA 1LRKA 5KKNB 1CUVA 1RJ9A 2XTMA 5BUSA 5BV0A 3UMYA 1IXKA 1A7AA 3FZGA 2ZS9A 1BU8A 1YK0A 4LRSB 4UW9A 2ENUA 3WYDA 3NX4A 1PFVA 3GK3A 4O8ZA 4KACA 4CMGA 3PC3A 1F6WA 3GD5A 3GCZA 3L07A 4OO3A 4JMLA 2HADA 4PC6A 3IKJA 3EZXA 5TJ9A 3T9AA 5LMZA 2GZ1A 4HNQA 4EENA 5I3CA 4M7WA 2Q41A 2BDTA 3OHSX 1BIFA 5BN5A 5JD4A 1HE3A 4JHXA 1JNYA 1TM4E 2HV9A 5DDIP 2BSQA 1OX4B 3PL5A 4DIOA 4FQ5A 2RSLA 2X6TA 4RNCA 4R2HA 4G4JA 3DR5A 3MLBA 3A3PA 2MJLA 4IW3B 2HSZA 3AFNA 2ZIAA 3UH1A 2Y1KA 1WA5A 3CLHA 1QH0A 1U0TA 4GWGA 3X44A 4C89A 4HYYA 2QG9A 4BU0A 4D9MA 4EAQA 3ERCA 4DV0B 3CSSA 3IP8A 2VTBA 4HFNA 5H4HA 5GP1A 3PHCA 5ALFA 3UJAA 3GO4A 2GHRA 1ZONA 5AWFC 2ZYUX 2E2WA 4QPZA 8ATCA 2B83A 1Z5PA 3KV1A 4BEWA 5J4VA 4Z4FA 1MZPA 3AY6A 1P8AA 4DSNA 4JIMA 3TGLA 1RABA 2QX9A 2K5UA 1P5HA 1V37A 3GT3A 4CDRA 4ZZ1A 4CQNA 5B37A 2P0YA 2HLNA 2YV5A 3C41J 4QUDA 4C0QC 1TYBE 1KR5A 3QKIA 4NDNE 2P69A 3N3BC 1SXJC 3RS8A 3EZNA 4UTRA 5DNAA 3FLAA 4JI5B 4H0NA 2CD7A 1GWNA 1TVCA 2WU4A 4C05A 4D4MA 1G7SA 2I76A 3GJQA 4RA6A 3I8OA 3SQOA 1ZJJA 4CEJB 2ZRPA 4NL4H 1Y6RA 3SE7A 1TZ2A 5BT8A 3MFYA 1MIHA 3VR0A 3VXKA 5FEUA 1Z0UA 3JQFA 3RS5A 4MB2A 4CMIA 1N5DA 1ECBA 4QDTA 5CJPA 3VHRA 1NIPA 3ZEAA 4JYAB 3V00A 1XMSA 4UAUA 1Z0JA 4RVDA 1DV2A 1RJEA 2F62A 4NE9A 1H2HA 1K4YA 4UCQA 3W2HA 2QNBA 1PCXA 2B3TA 4M87A 4WEQA 2WKWA 1Z39A 1Z5NA 3MMXA 3AOEC 1CY2A 3ZCSA 5IX8A 5G4KB 3SOZA 2QDKA 5AUOB 4TGLA 1ZMXA 2DPYA 3CW8X 3QLUA 4M9QA 4YFVA 1DVRA 2QPOA 4OKNA 3WLSA 1XAIA 1TF5A 5JSKA 5K8VA 3THYB 2PJZA 3LY8A 1O58A 2UZ1B 3ZDFA 3H0KA 3H9BA 3SM9A 4FYJA 2ECKA 5F9FA 5CURA 4NSNA 1NP3A 1JL3A 1RBMA 1SXGA 4J49A 3AILA 5JS6A 3SVTA 2RFLA 4POOA 1VYVA 1T3ZA 1IPHA 1W88A 3IBCA 4Q21A 3LCMA 3BK1A 3RK1A 3WKCA 4WFKA 1HC7A 3FLMA 1AB5A 1E62A 1MAAA 2PS3A 1EA7A 1V3TA 2WMOB 2WE8A 2AEFA 5I5EA 1NI4A 3B9BA 1SWVA 3P5SA 3UMMA 4HX9A 1AGXA 2RGWA 4TVKA 4RD3A 2PCJA 1AVTA 1CU1A 4OH7A 4UM5A 3IT2A 1EFRD 4C1NA 1QP4A 2NMVA 2A7QA 1A8PA 1RIIA 1K6XA 4FFVA 3O26A 2P0AA 4WX2B 3DEHA 1SELA 1EFTA 4HC4A 4X1IB 1RR6A 3KL2A 5UKDA 1P6QA 3T3MB 4DABA 3DZBA 1NTOA 3KUDA 3VMFA 2CD9A 1EE2A 4NBLA 4ZQFA 2AEJA 3BFVA 3JYPA 2WC1A 1M1YE 1M9NA 3MBIA 4DQDA 2QEQA 3KVNA 1SURA 5IMSA 1F7VA 4FFPA 5BNWA 3EGCA 2GVNA 4KEAA 2DJ5A 3FWNA 1Z73A 5KNBH 4I9FA 3WQQA 4KXYA 1MW8X 1OH5A 1YJXA 1AT1A 3PYXA 1T5BA 4ZVTA 2CFCA 4FI3F 2OORA 1DKUA 3CZMA 4MCIA 4D43A 1GU7A 1COWA 1W88B 4LBYA 3DE6X 1ZESA 2JEZA 3NH9A 4Z0TA 2HJGA 5FWAA 4R0MA 3PGVA 1TPZA 4G1UC 4RU1A 1FLAA 3ZTTA 3OCCA 2ZJ1A 2WTUA 1M0WA 2BMWA 3ME5A 3QW4B 2JFGA 3HUDA 2PT5A 4M7RA 3WL4A 1PI3A 3WTBA 1RAEA 3ZIDA 1SG6A 4HP8A 5FKJA 3GAMA 4N39A 3IUNA 5HIJA 2ZVDA 4DUZB 5ERYA 4KE7A 2GN4A 4GYJA 2CLKB 1YT5A 4YMTA 4ZIRB 3I2HA 1KOGA 4R1SA 2D2VA 3G8BA 3L9WA 4I5EA 4QEKA 4RCYA 1IHUA 5AMXA 5DM70 4MQFB 1NV8A 2WMNB 1Z29A 2RE8A 2BJVA 5KI6A 4PC7A 1RSZA 4OQDA 4D6YA 3E48A 3EAFA 1M8GA 4KODA 3EZ2A 3QKRA 5GJVC 4OX9Y 1GFSA 1E2UA 1BNCA 4I9GA 4A92A 1HDYA 1R0YA 1ZVJA 3A9UA 2H48A 4ME6A 1Z7GA 1X1CA 3B60A 4XX0B 4LHYA 3GLGB 2XWSA 1ZGGA 5HSGA 1PJ4A 2H4JA 3GL9A 3PKJA 1HDIA 2ZRKA 3VNRA 3W3AA 5ICMA 2GPBA 1YZVA 3COJA 2YHAA 3IUBA 4G1MB 2F3TA 1L4KA 3C0KA 4IV8A 4I4LA 4POAA 3OF3A 4Q1VA 3QBEA 1B23P 4JJEA 4YUZA 4PAWA 2FSVA 4IQGA 3ZLJA 3H16A 3WKAA 4G24A 5KVVA 1EWRA 1MEEA 3CEHA 1JUDA 2LP4Y 5EPUA 4WZAE 4RK0A 1LI4A 1PLJA 2Z08A 2CXOA 1KYWA 3U3MA 2CHQA 3IOYA 3K35A 5EP1A 3ZWOA 1Q7GA 3E9CA 3AESB 5AO9A 4JCOA 1Y7LA 3DC2A 3H1BA 2ZJ2A 4S1OA 5IYZB 4EB6A 2FP4B 4CQLB 4ZRNA 1GN8A 1KI4A 1JN0A 3L4JA 2XLCA 3A70A 1GZHB 5JRJA 2OAQ1 4P2GA 2B8EA 4MKZA 5ARDA 2AD5A 5KAMA 1VSUA 3VI3B 1NNSA 2JFQA 2V6BA 3F3SA 4K46A 4B4OA 1CJUC 4CDMA 3G2MA 3RTEA 2BHNA 2QTZA 5LZ2A 3OZCA 2C0PA 2ZVQX 3TR6A 3CO5A 1P4SA 4B3RB 3Q3IA 1GO2A 2GTHA 5SYAA 1X7XA 1V3UA 3KQLA 4YAOA 4KPUA 5JI2E 1PWEA 1F38A 4DILA 2WU0A 3WIDA 3HA2A 3N2LA 3ANYB 3I39X 1Y6QA 2P9QA 4GM1A 4JL6A 4AO6A 4KQHA 4BO7A 3U4AA 3FTEA 1M1XB 3V1LA 1NVDA 1YRQA 3FSGD 3JVDA 4GP7A 4MK4A 2AR7A 1EFLA 2QORA 1Z38A 4LYDA 4PHTA 3MRSA 4URFA 1PTKA 1NOIA 2VCEA 4Q4AB 1UT6A 3IDQA 2D0PB 1DJLA 2QSYA 4N1AA 2QN7A 3THOA 3BTUA 3ZXYA 1G3MA 1NQUA 4IV0A 5LUAA 4BZXA 2XNKA 4ZYTA 1DJOA 1E2NA 1TLLA 2C5BA 1X0VA 1U7UA 4I5FA 5J1TB 2PBLA 2PN1A 4FOTA 4H4EA 5GVRA 3V42A 1H2XA 5ITSA 4YPFA 3GA5A 2PUBA 4JOCA 5FL7A 4RSRA 1I1NA 4X90A 3D7LA 4OQNA 5HE8A 3AEQB 3SIRA 3E35A 1J8FA 1ESZA 2AK2A 3MWDB 4AS3A 5JDIA 1FLDA 3EDMA 1W0KD 3TR0A 3A31A 3AEZA 3EAQA 3JQ6A 1J20A 1UIRA 4WKGA 1ZXBA 3UOGA 2CJPA 2HJ9A 2HDOA 2QP4A 4Q4DA 5AJUA 5BVGB 3T3NA 2W6NA 3HCOA 2JLSA 4NZNA 1DBVO 3T7CA 2VQFB 1P29A 1OSNA 1JDBC 4I0WB 4WI1A 1B2RA 1C0LA 3KR9A 5LZ8A 3AVTA 4UHEA 2O8EB 1YASA 3HWRA 4JU9A 5EFZA 4D4IA 3EXHB 2JIOA 1CB7A 2B0JA 1ISFA 1L7DA 2LCIA 3B9RA 3C5VA 4MUNA 2YWEA 1ZR4A 4I8XA 3HJAA 2C9BA 5E95A 3R3ZA 5H0IA 2J7PA 3IQFA 4WECA 5ER6A 5JYBA 2XMQA 2Y1DA 1I3LA 4MS3A 4EARA 2Q5CA 1RYHA 3RV3A 2C2MA 2G7MC 3R5SA 2QW1A 2FK7A 1Y42X 4II7A 1AQLA 4WN9A 8MHTA 2EIXA 1ULUA 2GD2A 3HDHA 3AL2A 2WVGA 1BROA 3K96A 3NIGB 3O9ZA 3Q9UA 2DUJA 2B8NA 2X5OA 3ONFA 4NYJQ 4V0ME 3TFOA 1JJIA 4DYDA 4MRMB 4GG1A 3IPLA 4Q9IA 3T3DA 3DBOB 3PNQA 2OD7A 4BNUA 5BVHB 3CX6A 3JWIA 4US1R 5KZMB 2IXAA 1TTTA 1Z35A 4RPIA 2UZ0A 2C78A 2VWHA 1RXVA 1E3TA 2EBHX 2WTXA 3GXOA 3L05A 4TLDA 1Y8ZA 2FUG6 4ARCA 2H16A 4KK3A 4NBTA 4X92A 3ZGNA 5J59A 2GN6A 1FDOA 2ASVA 4AG6A 2WJ4A 4RKFA 4V0MA 4HAIA 1JSRA 3K05A 1GJRA 1I2BA 1TA0A 1FP2A 3RAJA 2P40A 1UH5A 4IWXA 2CYAA 1RT9A 4KZPA 3JAKB 4LZJA 3TVDA 4I1IA 3MN1A 3JWGA 1Q1BA 4F4CA 5JJKA 5A3RA 4TTPA 5M04A 4CEJA 2JGDB 3KPUA 1D0IA 2QUJA 3K09A 3Q10A 5GOZA 5BN4B 4E7OA 4BNDA 2NNLD 5F7OA 3ZD6A 1USWA 1XZKA 4KBGA 3R6WA 3DTVB 3W2EA 3AIMA 3OEYA 4W1PA 3WBJA 2ZXEA 1WO8A 4CKEA 2EJVA 4KHZA 4WGFA 1SCIA 3AP1A 1WM1A 5LYYA 3GUCA 5EE0A 4Y6GB 3ZWYA 1LNQA 1JHUA 3WNDA 2OOKA 3U44B 5HZHA 2C8LA 2Y27A 4UUNA 3HN2A 3TIFA 4I8DA 1HE8B 2EV9A 4BNZA 5IJ9B 2Y6VA 1AMOA 1S9DA 1YCFA 1R0BA 4R05A 1H2AS 5FA8A 2HMSA 3H8SA 4XB1A 1PT9A 5C80A 5DP1A 3NC1C 4H9GA 3SIPA 1C3OA 2VOJA 4LXTA 4M83A 3T94A 4B3HA 1JT9A 5CDHA 1JG2A 4X5OA 3Q2KA 2FYTA 4PSCA 3PWKA 3R24A 2Z98A 4I1OA 2NUAB 1FFSA 1NR1A 1OCEA 4ND3A 3OE7D 1N7HA 4PGMA 5DH9A 4D98A 3QUQA 5CNJA 2G0AA 1HLPA 3L6DA 1RS0A 2AUNA 1V5WA 2ZETA 3KR2A 2P2LA 4RESA 3TPZA 4C76A 3AX6A 5GPBA 3GRZA 4QUGA 5JOQA 1V8BA 3MZ0A 2DVMA 1JPUA 2AUMA 1X9GA 1TTQB 3BTOA 3DFUA 5KWJA 2ZM6B 4HLUC 4DV7B 1JEYA 3IMGA 5SZIA 4ZI7A 4CEIA 3KOMA 2D1SA 2XI4A 4G5SA 2P4SA 3OAAD 3QFCA 5DBFA 1G66A 2PGDA 5JYCA 1VIMA 2OV8A 5CT5A 3T9FA 3IDFA 2EP5A 1VL8A 2B1IA 1GFWA 1YTLA 2PJDA 1JJVA 2JD1A 3GAFA 3HXTA 4M0KA 3EH2A 4QEDA 1Q6YA 1RM0A 1SHLA 4MCAA 1VJ5A 2J7PD 2KLBA 4BWYA 2QHXA 5K45A 3C3BA 2D13A 2FGKA 1F9AA 3VAZA 3ZCQA 1QZXA 3D8BA 1XRRA 3V4LA 3WOVA 4F2HA 5H81A 1FUKA 4IYRA 1VFPA 3WVNA 2JCXA 2Y0EA 5AW9A 1E3DA 1PW7A 1PKEA 3QY0A 1XL0A 4HAYA 5AJXA 4IDDA 2ZSUA 1U81A 5DM60 2BZGA 3SHVA 5CHYA 4ASUA 1L8OA 5KX5A 2WIJA 1ESNA 2YH2A 4GI7A 1ZBDA 4PF1A 4FLFA 3D6MA 1V8ZA 2ZUFA 1ISMA 3GEPA 4C7BA 4MW7A 1G19A 3EE6A 1IIBA 4G01B 4MEAA 2WIKA 5JH7B 4NCHA 5BQXA 4WACA 1XPJA 2BRUC 4Z2YA 1N2XA 2OXFA 3UBTA 1ZICA 4KAAA 5K8CA 4Z4GA 3JR3A 2GN2A 1KHHA 1JEDA 5LOVA 3O2QB 3ORSA 1O57A 5ABPA 3ISJA 4B8YA 5CLFA 3RJMA 3G2JA 4U7FA 1CUXA 4QYSA 3BDIA 1EWQA 1XJ5A 2OQIA 1TUIA 1NYLA 1ODLA 1G3QA 5TGTA 1Z4KA 1JILA 4PTLA 4KR6A 3O4VA 4MPRA 3CRW1 3JTEA 4QQNA 2WRZA 1KJZA 4GAEA 3WL5A 4J0GA 3IA7A 3KZNA 5EHNA 2OXTA 1JPVA 3QE0A 4IGEA 4C7VA 3TI9A 4JVMA 3ESXA 3LCVB 3AUJB 4YV2A 4F9FA 5AKXA 1NF8A 3N1UA 3DZJA 6ADHA 3W8RA 2GPTA 7YASA 3AM1A 2VHXA 2CL6X 5JHHB 4WZBA 5FWDA 1Z15A 1J8MF 1YSCA 4OU5A 4F91B 3HMQA 9ABPA 2FDXA 2F43A 4JLOA 4LMPA 3ELYA 3NBAA 1I94B 2WM8A 2C2KA 4FFBB 3PFIA 1P0CA 1V71A 3ZD7A 2BFAA 4X64B 3QVSA 4Q0MA 1CR2A 1PQ4A 4QXQA 1MXHA 4AKSA 2N9UA 4C6RA 3T5BA 4U9IS 5FWYA 1FYXA 4Z86A 1B0AA 1M1YA 3ABQB 5LBTA 4RL6A 1WZEA 2BD0A 4A10A 4BU1A 4EW3A 1GSAA 4Y7DA 1E1QD 5CFOA 1BVYF 2YHIB 2BHSA 4ZPJA 1LC3A 3QTTA 4DY4A 1PT6A 1FX0B 4GMGA 4B7UA 4YUYA 4ZCMA 5LIRA 4IVPA 2GJ4A 4HHEA 1D6MA 2WLTA 1QIJA 4Z9YA 2ZJ0A 3U4QB 4I50F 1Y80A 2TMKA 4NOLA 5KKAA 1QV7A 2JAXA 3WLLA 4IRUB 2EKLA 2P2ZA 5C5CA 1W5AA 1NPTO 4GXNA 1YFLA 1YS9A 3HBJA 1CUZA 1AY0A 1VKZA 2QJTA 1USUA 4LNUB 3PGJA 4NY1A 4BNJA 4C07A 3FVTA 1V3QE 1LSJA 2GNOA 5KO2A 1EGMB 4HPWA 2W2KA 4OJMX 1NVVR 1ODCA 3ZE8A 2IYNA 1ESEA 2IOHA 4Y30A 4WY8A 4FKMA 1CLUA 4IJMA 2G4CA 2AQIA 1ZSVA 1SZDA 4GE0A 3T15A 4W5TA 4TQUS 1Q0PA 4F21A 4GI5A 4YXWD 4IFIA 1RQGA 5EZYF 4DVJA 1D4OA 1MFZA 1AXRA 4BV2A 2BI7A 3P9XA 1HR0B 3GU3A 4JJZA 3JD4A 3KHUA 4QU8A 3SP1A 2GKGA 3NVKI 4PYLA 1QHHB 1NU8A 1P1HA 3V1TC 4EAAA 1K2VN 2VN8A 1HFWA 3HCPA 4Y67A 3WGVA 1KZ4A 1YNOA 1PJRA 4HNTA 1S2IA 1SVLA 3TGWA 1B15A 3QEMB 4MMXB 1BD3A 4YIHA 1K08A 3UCXA 4LMRA 3SYKA 4EYGA 3AKCA 1QP0A 4MGHA 3MILA 3V1KA 4CU2A 5M34A 2PY6A 2R8RA 3IQZA 2VOEA 5L7YA 1W7AA 3LHSA 5F9HA 1GPBA 3AF3A 1GSHA 1G5PA 2QIPA 4ESHA 2GHQA 1FFEA 4QG7A 2WHPA 3LX4A 2BPOA 3A1SA 3RT7A 4LK2A 4PSAA 3DVSX 2IYTA 2O8CA 2XV1A 2A9RA 2AF3C 3O3CA 1KJJA 3BRWA 3TI7A 4RZHA 1CY0A 3LGAA 2VNAA 3OMWA 3CY6A 3R9KA 1IXZA 1UPFA 2FPSA 4ZFNA 3PR3A 3QHPA 1A27A 1YB2A 2JL1A 2W93A 5D5QA 3VC2A 3F2IA 1X9IA 1GZ4A 2RKOA 3WISA 4BRWA 4HVLA 3SKVA 2O19A 5BRNA 3FVWA 1OXMA 2OHIA 1U6JA 4CWAA 3H7IA 4CKCB 1JSLA 1OX5A 1WV1A 2PFKA 4PHHA 2ZTMA 4P4SB 3K30A 5KMGA 2VP2A 1VA5A 5GZ3A 3TJMA 4JZYA 2IH2A 3K1JA 4ZQIA 1YACA 1Z47A 5GJWC 2PRJA 3DBLA 3J7TA 3MSCA 4DV4B 2HCJB 3I0MA 4DCNA 2DFDA 5LUBA 3VISA 2BGGA 3QJ5A 2BEUB 3ILXA 4L0CA 1U7WA 3M5CA 2WJAA 3NEJA 3DHEA 4K8RB 4EFMA 5L8VA 1UMKA 2HGSA 4LPSA 2PT6A 4Q3KA 4QUEA 1P18A 5G0UA 5B1DA 1Y8AA 4R1LA 4Q1CA 1E66A 3KAPA 1EZZA 1O95C 3G2QA 3AJRA 3OFSA 2MSLA 2HIAA 3MB8A 3SZRA 4YJ2A 4QE3A 4WBNA 2YDYA 1ZZGA 4CM4A 1QGOA 3OEWA 4TV8F 4EECA 4BNHA 3E3AA 5KUTA 3OHMA 2GYUA 2FW8A 2BMEA 1T5OA 3OLWA 4MWOA 4AROA 3FOBA 2ZI4A 2ORED 3OOYA 1BA3A 3DV2A 3QWHA 2J45A 4L4ZA 3T7KA 5MN6A 4XWOA 1XEAA 5LR6A 3MJEA 5IBCA 2JG3A 2Y0BA 1T3GA 1ECGA 5AVUA 3PUVA 2GBLA 3TLKA 4PV7A 2AI3A 1YKSA 2DTEA 3OLYA 5DGTA 2Z57A 5FO0A 3ZY6A 2AFHB 3FLBA 3VR2D 2NXJA 1KI9A 2UYQA 1CIJA 4EHIA 2E5WA 2APJA 1JWBB 4H60A 4OTZA 3TK1A 4ZEOA 3T4UA 1XD9A 4IWYA 3GLFB 2JVKA 4BMVA 4YRFA 3QF7A 3C3XA 3PYMA 4FYYA 3D3EA 4O8CA 5G3YA 3PEFA 3WC4A 4A23A 3L6UA 1MD9A 3L77A 3LPAA 4D9FA 4ICIA 4XWYA 1DIHA 2QUZA 3AJDA 1R9JA 1VE3A 2XB9A 4AJKA 3N70A 1M2WA 3OTGA 4QUHA 4M3NA 2O8BA 4QQRA 3CEPB 3F47A 3W6UA 4ZARA 1TJ4A 2ZJAA 1EBUA 2FPGA 3ELWA 5I7SA 5IBRA 3RRXA 4CMEC 4I55A 3D43A 3EYAA 1HL3A 1TUBA 2X41A 3AVPA 1PJCA 1OH7A 1D2GA 3ONWA 2QAIA 3EZFA 2ON6A 4I50B 5EPOA 2JI9A 4E4RA 3EGXB 4DIBA 1ILEA 3OUUA 2D1YA 1DAPA 1K5GA 3F7MA 2PWZA 3GJ4A 4XB6B 1T8SA 3IAM1 4CUKA 1QRSA 3KSMA 1MB2A 3CR8A 3AL0C 4DIMA 1RWXA 2IYFA 2OG2A 3BE8A 2ADOA 4G84A 4KKVA 2QYHA 5J2UA 1MJGA 3DOCA 3IERA 2RI1A 2XDWA 1U2GA 2OC4A 5LZ5A 1ZG3A 4UASA 2XZTA 1CUBA 3FFAA 3D0OA 4YPOA 1WZIA 2UYHA 4O4IB 4X24A 3NC4A 4R7ZA 4F86A 5JZBA 1Q95A 3MUOA 3T7RA 4TS1A 2PRIA 3RYCA 1X1EA 3CMMA 2NO7A 3KXIA 1G2IA 4XR9A 3L7KA 3TQCA 5DMXA 2ANCA 5C4MA 3JD0A 1COWD 3P32A 4XUCA 5JC8A 1DQPA 2YJNA 2ZT7A 2XXJA 3JALA 4RY8A 4N0MA 2EP7A 2GBCA 5DXJA 3BIOA 3NJ4A 4C4XA 2IEAA 3RWBA 5IM4F 4IX1A 3PBKA 3SR0A 4AKIA 1WS6A 1OZAA 4FCVA 4NG5A 3ZGYA 5C52B 2C2BA 4KOAA 1JQEA 2COUA 1MO5A 4EJSB 2PUJA 1T5HX 4GQAA 1B8VA 3CW2A 3GWZA 1N2JA 4B5LA 4TYQA 4B4DA 3ZWBA 1FVOA 5JSQA 4J8PA 2R60A 2CC2A 2WM9B 1QWSA 2JFXA 3E7DA 3U48A 2EQ5A 5BWBA 3KVOA 4MW4A 4NBUA 4BB9A 4NFSA 1E2JA 3AUTA 1Z62A 4L5BA 4GHWA 2GM4A 4BEVA 3ZWQA 3QNUA 3RSZA 4AY4A 3W5CA 1JQ3A 2JGRA 1V6AA 2HHLA 4CLXA 1UBKS 2QRLA 3F49S 5K8TA 2EKZA 5DTEA 2WP8J 3PD0A 4DCCA 1G4HA 1H85A 5CFLA 4XOIA 2R8XA 1Q0QA 4E6PA 4RY2A 3S2UA 1A72A 3BHJA 5H1YA 5LQRA 2BM8A 2FSVC 2GXSA 2J1LA 2QRQA 4PRLA 5K05A 4BNVA 5J4YA 1VDZA 1KI2A 4W8HA 3AYZB 3T38A 4NNPA 4RLQA 3GV0A 4KREA 5AXDA 2WF5A 2RH5A 5IC5A 3R8CA 4DEYA 1LWNA 1C5KA 1J8QA 1PR4A 2EFCB 4HWPA 2F3UA 4US2R 1WBJB 4BAZA 4WESB 4OFWA 3TTTA 3AMVA 2IYXA 1UFVA 1U7TA 2B98A 2P9BA 4OQ4A 1XEWY 4OL0A 2MYPA 4LDNA 3UF0A 5MGBA 1AUVA 4BO3A 5FPKA 4Q16A 1QU2A 5D01A 5B53A 4CM9D 2Y68A 2XTZA 3HU1A 4TTQA 1QQTA 5AI9A 4B31A 3ZGLA 3OD1A 4QGHA 4RHFA 4KE9A 4KG7A 3WGLA 1WSAA 3PG5A 1ZY2A 2VR1A 4PG6A 2WAAA 4I1RA 3OZRA 3TPCA 4IS3A 5EWLA 5L40A 1XUOA 4BVAA 2Q4BA 4YT2A 2EW2A 2R47A 3EUWA 3GG9A 4UU0A 4MW9A 1AD2A 1QANA 1R8JA 5FLXA 3QENA 4L0MA 4L4RA 2GZDA 1H3FA 5E8JA 1P2BA 5I7AA 4Y1RB 1ZPDA 3ZGXA 5HKOA 3E23A 1RLUA 1AUQA 3FYHA 3TUIC 4DYHA 1XG5A 3BD6A 3M1YA 4YT5A 4ZPXA 1D6JA 4ZZ2A 3FAZA 3H8VA 4XQGA 3AOEA 2XUAA 3V1NA 3WFZA 4CM6A 4F2PA 5CD1A 1BG6A 4V2IA 1KSJA 4XWKA 2PUDA 2NT4A 5TX7A 4Y6OA 1LB1B 4Y0VA 2VDMB 3AHHA 4LXIA 1RE0A 2AFIA 2ZW9A 4WUVA 5DLPA 3TAHA 4RIIA 1MA0A 3BDVA 2DUUA 4LY6A 5IDYA 1U8CB 2HMTA 4HY3A 2CB0A 1TTPB 2GT1A 1F8UA 2ZYHA 3H4TA 1MV8A 2Z2JA 4HL6A 3SZUA 1DBQA 3JV7A 2YWRA 1J00A 2KB0A 3NGXA 3QNWA 1KH2A 1OHHA 1T34A 3ZBUA 4CKWA 3FOCA 1C29B 3DFMA 5SV2A 3II6X 5KYWB 2YIDA 1MUUA 3LHFA 1Y6FA 3W5HA 1BKYA 4DG5A 4EGFA 1TCAA 2C77A 3FVVA 4Z0HO 4ZREA 5AVOA 3V34A 1OLOA 2VS1A 3B7WA 3HB4X 3Q12A 3IQDB 4QDZA 1K8QA 3LUPA 1TM7E 3ESQA 3B8EA 4PLPA 4E21A 3B2NA 4EKEA 4JOQA 4KWIA 3I34X 4RXTA 2M9MA 5TSDA 1F14A 1F4PA 2ZWIA 1FSGA 3G5UA 4D9GA 5ADVA 2ZBVA 5LQAA 3FCEA 4P7JA 4CL2A 1NYTA 1XXHE 1VPTA 3GVHA 3TYXA 3O73A 1K68A 5HRUA 2V7VA 3U9LA 3BFXA 1VZ2A 4IILA 1KOFA 3F6YA 3CVWA 4KDRA 3VJKA 1OD6A 3MB5A 2AGVA 3PGKA 4Q3OA 3OX3A 3LLSA 1JR3D 2HSDA 1PZHA 4PWYA 2K7FA 4WKNA 2CNLA 1Z17A 2QWXA 4IIGA 3T0IA 2E0IA 1ODTC 1SKQA 1U94A 1IOWA 1KSHA 1QFZA 1VMEA 1VSVA 3QPDA 3OFNA 4BP8A 4XARA 4TXMA 1LQ2A 3EHDA 1G5TA 4X20A 3RRNA 4ENPA 3FKJA 1JXQA 4P4LA 5I8PA 4QVKA 4AJ4A 4YMGA 1QE3A 2BHLA 2LXNA 3ZWVA 3NT5A 3LOUA 2BI4A 2OSBA 2XLBA 2DFPA 1AZSC 4G0ZA 2QN9A 1JFLA 2GWHA 3GJRA 1BOOA 1N25A 3ITDA 1R0CA 2DT8A 2GXUA 2XWBF 3MJHA 5JWRA 1PR3A 1GRQA 5IPFA 3FMVA 4NAUA 1PG2A 4TL9A 3T6KA 3ZGZA 5FIUA 1J49A 5KNCD 2CL0X 2ZT6A 2O7RA 3ANMA 7REQA 1EXMA 3PKZA 3P2IA 1ZNZA 3H13A 3STTA 4EYEA 3OFJA 3AW8A 4FT4A 5T4FA 3TTYA 2X2OA 4QPDA 3IQGX 2B8TA 1QGED 2PLWA 4JWTA 3SMVA 5F35A 5ES4B 3UHAA 4EY3A 2IEDA 3ESRA 1OW3B 1A98A 1YBVA 2I2DA 5MGNA 5ESDA 4QQ8A 4LKOA 2I34A 1S0UA 4AN4A 1U2SA 5L4SA 1M1UA 3GFRA 4JP2A 3MOSA 4FHFA 2ZE8A 5FBHA 1UMCA 1NXXA 2E3JA 4YWHA 5BT9A 2GQ0A 4TTAA 3AC0A 3P4XA 4M89A 3JZMA 1S7CA 3K2EA 1GQQA 3MWYW 4JENA 2ZSIA 2R4TA 3QXCA 3CLSD 4JT9A 3VR5H 4X6UA 5FBWB 3Q3GE 5AD1A 3A2KA 3I05A 2FX2A 1GNRA 4LS3A 4BZPA 1ULSA 1DU4A 2O3QA 2PU7A 4UZSA 3GFGA 1RWPA 2HLDA 2YASA 2REQA 2ZR7A 3MG9A 3OE7A 1A3CA 2V7PA 1Z8NA 2ZE6A 4YUAA 2VJCA 3PC2A 3I04A 5HTKA 1H1LB 2V4ZA 1KBZA 1EWYA 1SZJG 3JATA 2VXYA 1J0DA 1FUIA 1A76A 3BCRA 4GMDA 3ZY5A 2I03A 1F12A 2ZSDA 3EUFA 1LX6A 4HDQB 2PZMA 2D3WA 4F04A 1X7HA 2JARA 4R7TA 2DUWA 3HABA 4DYVA 1JI0A 1SVOA 2C4TA 2GLTA 2XA9A 4BNMA 4U7TB 1JJBA 3PQ3A 3AEKB 1BXGB 5IDVA 4QTTB 2VHYA 4NZOA 2QE7A 1DJQA 2IS4A 2IUYA 2QQGA 4MP3A 4RA6B 2WV7A 3G17A 1VL5A 4FSHA 1Z25A 1OJ7A 1VBNA 3LFUA 2OR3A 5IAEA 5KREA 1L2TA 1DZ3A 2JGAA 3I09A 5D1NA 5G0VA 4XQEA 3GF4A 1ZOSA 1XA4A 4QWWA 4U39A 4XD7D 3ZUGA 1YRYE 2MSEB 2B8JA 4MMZB 2XHEA 3MNFA 4XSHA 3D7NA 1T5IA 2VYFA 1XTSA 2CCJA 2R6CA 4ZYVA 3NGLA 5H80A 1GVHA 1EHYA 4C7OB 1BHSA 2TYSB 4I4TB 1HNWB 2FN8A 1CQJB 1PKXA 4FOLA 1U0OC 4F5EA 2F8TA 1CYDA 1KGSA 3KYBA 2IUUA 3H5LA 1U0BB 3N2EA 1ZC3A 4UNPA 1Z9BA 4K26A 4ZGWA 3TNDA 3NHBA 4BQNA 3SF8A 3OIWA 3A1VA 2R96A 3RD5A 3CF0A 2RHOA 4ZJZA 4EY8A 4FE4A 3ZGOA 3ZR4B 3TEJA 1U2DA 3H6GA 1XZ8A 1Y4DE 3KX2A 1E6LA 2DH6A 3GARA 4LQ4A 3TSOA 1IK6A 3KUUA 2IBTA 2PZLA 1O87A 4TM7A 2ZI6A 1RWNA 4YPVA 1NOKA 3NHKA 1TRKA 3NVMB 4PXAA 4CL8A 1ZP6A 1OI4A 3DWEX 3OOJA 3DYVA 1KJNA 4FMBB 4JXZA 5FNZA 4HLQB 5CA0F 2X2EA 2OGZA 5A6SA 5HIKA 4DCUA 4WZBB 1EQ2A 3QBTA 1N5RA 4EX6A 2O3RA 2FLVA 1OLXA 4L15A 3ONDA 4LOJA 5B3LA 2AW5A 2Y99A 3LC7O 3VYRB 4AKEA 4FXPA 4R1NA 2W2NA 3T5CA 1JMVA 3RI3A 4B9AA 4YYZA 4N65A 1CQXA 3R20A 1Z06A 1DGQA 1YE3A 4D92A 3BMNA 2YOHA 5LLTA 1D2RA 4YJFB 3UAWA 4U7GA 4W5WA 2YC4C 2ZIGA 4RS4A 4QC2A 1NC1A 2PZJA 2NVBA 3H1AA 3KHTA 1KDTA 3L43A 4H1UA 2FG6C 1FC0A 5D7BA 5ALOA 2A35A 2GX6A 3G49A 5E38A 5JCOA 1IUKA 3V4RA 4E13A 1D6SA 1Z2OX 3L1KA 4IXNA 2WWTA 3RWOA 2O3JA 3TIGA 3OIFA 1WOYA 4C7MA 2QUIA 3NQ41 3ZW8A 2XGOA 1HQYE 3FZQA 3H2YA 1TNDA 2GZAA 3EB9A 4ZAZA 5BWMA 5AW0A 5F3RA 5TVGA 1N6PA 4P5EA 2P27A 3GGDA 3TL3A 5CFZA 3IVRA 4GE3A 2FMUA 4PYIA 3GLHB 1K9SA 3ZE1B 2AFHE 4ANFA 1U3DA 5JMPA 1A8IA 1KJQA 1TM1E 2Q3LA 5HIIA 3V4FA 5IZCA 2X1LA 4LVNA 1U11A 1JJFA 1OT5A 3PGA1 2GETA 3O8NA 1N9ZA 4PR3A 4RK4A 2CNOA 1P72A 1VXOA 3AHEA 3WWEA 1Y4SA 3ZQ6A 2QYOA 1TMOA 1L9KA 1U5BA 1AXEA 4PAGA 1D2HA 4FM9A 3BRSA 1E58A 3Q3JB 4TYPA 4PBSA 1GGJA 4HTAA 4XPIA 2O5RA 3ZQ4A 2WUDA 3QVGA 2PZFA 3CLRC 1VPWA 1RQXA 1Y33E 2I7DA 4TRJA 1BKSB 3NBXX 4ZTBA 4ZOQI 1KOLA 3O3OB 2VPXA 3BJMA 1ZI6A 4ZVUA 4FR0A 4ENQA 2OM6A 2AHRA 2E49A 4AT1A 5CDFA 2WZDA 4IVRA 2H8KA 2P3OA 3OPYB 2D62A 1EUCA 5LZ7A 1SKBA 3AYXB 3VYUB 4EJ2A 3RNLA 3EVTA 2BRUA 4HS9A 1GSOA 4J0IA 2IYEA 3NNDA 4ZI2A 4I99A 1W47A 1ADGA 1E20A 1SZPA 4K9DA 3JQDA 5GOTA 3QFRA 5HCIA 4B3XA 3GP8A 5D6OA 3AIKA 1M6VA 1WXEA 3L79A 2CSXA 1L4LA 3KB2A 4U8GA 1WV0A 1IULA 4MYCA 2EC5A 3C6YA 3VZQA 4CETA 4OB8A 4B43A 5KPDA 4QM7A 1BX3A 1JEAA 2FA9A 1H9BA 4YH1A 1O7JA 2Q0XA 3L7CA 3PV0A 3W3AD 3IEUA 1WBBA 3M3DA 1VYTA 1W1IA 2GVDC 3SXPA 3EFOB 5F5NA 4D0GA 4XI9A 1GA6A 1DTWB 1UZLA 1MEOA 1JHVA 4XVHA 1G16A 3JU3A 1L4YA 3LX6A 1L4MA 1I4DD 1RAAA 2X3UA 3TKYA 4D4GA 5LMUB 1MHTA 4CEHB 2BH2A 2NUAA 3FX2A 4OXKA 5DGDA 5FPHA 1OFTA 4C6HA 1V9CA 1U8EA 3VOSA 5H3HA 4KAFA 1JZSA 5EXDA 2WFAA 5BURA 1UK8A 4I2NA 4LEIA 2VSXA 2Q2WA 3CVJA 4GPEA 1PT8A 2C9DA 1MVLA 1FP4B 2PZKA 2A1UA 4UBKA 3WAJA 1RHJA 1BXGA 3BN3A 3M8KA 4QG3A 1ZU5A 1QOQB 3F7TA 1VE1A 3RVLA 1P7ZA 1DKLA 2F48A 2XNHA 3OM8A 2Y05A 2YNMA 1HYQA 1YI8A 2FMFA 1PVDA 2ZIFA 2NO9A 4MUFA 1I9GA 3Q98A 5LB4A 4JBIA 1EVKA 1R3DA 1UP6A 1W75A 2BEKA 3O1IC 4KIWA 1BFDA 3TQTA 4EHLA 3RTAA 2Q2OA 4IH4A 3ZV6A 2QM7A 4DIFA 4X8HA 3TLZA 4OHXA 1W0JD 1H2EA 1IHPA 4GUAA 2G67A 1P7CA 3RCBA 2PDAA 1KJIA 1Y8CA 3N9IA 2WWHA 4QRIA 1EX7A 1ZJ5A 2LTAA 2VNJA 3JAKA 2NTNA 1VHQA 4JVSB 3H8WA 4D8TA 3HA3A 3HN6A 3RSLA 2HA3A 3QTBA 1SQSA 3MINA 4ZA2A 2GKOA 3M4XA 3TRDA 1QBGA 4Q1DA 3T4XA 4YR9A 5A9TA 1U2PA 1PEDA 2JNWA 4OI0A 2O0KA 1LCIA 2VZ0A 2HA0A 5CIWA 4X8OA 3MW8A 4AJPA 1LC0A 1RJDA 2HLDD 2Z4RA 3D4PA 4ZYXA 1KEEA 2IH4A 1ODSA 4HDRA 4EO7A 3JAWB 4G0MA 1U8TA 3RRJA 3FOFC 4KV9A 1DP4A 2AOUA 2GEUA 4O1MA 3CF4G 4IIXA 3WSWA 1PNVA 4FCWA 1V6CA 5F7ZA 3I61A 2A67A 3MCWA 1O0CA 1EFVB 3G9QA 1B73A 5E2AA 3NLLA 1LLUA 1UC9A 3K0HA 4YAUA 3N5CA 2ADMA 1NWHA 2MDTA 1A2KC 3EXHA 4WMLA 5EXEA 3UUFA 4B82A 4GSYA 5JCJD 3HTXA 2IHBA 4Q6BA 1YC5A 3OQHA 4WVLA 3V7UA 3JX9A 4P84A 4TX1A 2GEDA 2ZRAA 4QYIB 1O77A 3QKUA 5FWNA 2H5IA 5BVGA 1BQEA 4Y0AA 2JRLA 3DL7A 4X1YB 5LN1A 2C4KA 4K0RA 1BDIA 3HVKA 5DYNA 3QYAA 3D2AA 3D2CA 4F3TA 4V3CA 4B3SB 1Y48E 4JQCA 1A77A 4PBRA 3VVCA 3FVRA 1IHXA 3GZNA 1BXKA 1LPAB 1NJFA 4KPUB 3RE1A 4D26A 1I6WA 4KI0A 4GEGA 4D41A 2VA8A 5KQRA 4YP0A 1MRZA 4ZYLA 3RB8A 4PX2A 3N05A 3R0QA 4HQLA 3NHPA 1GTMA 2FUEA 1O6GA 1G9SA 3CLTD 1U5AA 1M7GA 5TDHA 2R6JA 2QY6A 3NHZA 3H6HA 3SYTA 3W1EA 3CWCA 1T91A 2EGGA 4RKRA 5F7XA 2PWYA 3EK2A 4N0PA 1AKYA 1O3YA 3NBFA 4CR8A 5HUHA 3P27A 2RK6A 4WKPA 1L8XA 3T3EA 5EWJA 4Z5XA 3K72B 3TLYA 4AG3A 2QGNA 2O2YA 3DDSA 4CMHA 5A04A 5ENZA 2WD9A 3URMA 1JQDA 3EPRA 2QT1A 2YY7A 3OU7A 3VJMA 3P0JA 1QMGA 2Q9BA 4OM8A 4LZZA 5I48A 4ZEXA 4JKIA 3RAPR 2RK4A 1OBCA 2QV7A 4IDNA 4YDHB 1OASA 2ZJFA 4ABYA 4MDEA 5KJEA 2P68A 1NTRA 1H8ED 2PWPA 3MCZA 5IUKC 2OGWA 4H18A 3K09C 3QFHA 4MAMA 4NABA 2IPXA 4OGWA 5SY9A 4AULA 1KJWA 3DOIA 2DPHA 2R44A 1ZUNA 2PX8A 4RGQA 2PLAA 2K87A 3AHIA 3EA4A 1H6CA 3KJHA 4OP3A 4UD6A 2A88A 4P4TA 1YD7A 1SKAA 1NW4A 2CMDA 2P4HX 3NTUA 3ZYZA 1SVKA 2CXHA 3BJIC 3KT6A 1CUHA 1MO6A 1AX9A 2JCSA 2Q46A 4NCIA 4PYRA 1OREA 4KQ6A 1H5NA 2E7ZA 3QG1A 4MW6A 4Q3LA 3EVNA 3ST7A 3L6CA 4HLNA 2ODWA 2OGTA 5E4YA 4DA8A 2F3QA 5LXTB 4RTKA 3ACDA 2AXNA 1P31A 1XEXB 4PIMA 3OIYA 3ER9A 2CV0A 1J7KA 2JDIA 2DHEA 4RTRA 5JS1A 1CIVA 1F0PA 1LJLA 5KVSA 4ZT4A 4D9IA 1IN8A 1DZIA 4YRBA 4KAJA 1OAKA 2P65A 3M1AA 3HNRA 4Q4LA 2HMUA 2AJDA 3I6MA 3ZLBA 3AEKA 1DX9A 2X3FA 1JAIA 2YHSA 4RPJA 4EUKA 5A2QA 4EPVA 4NU5A 4F6RA 4AL4A 1KARA 1MNQA 1R9NA 3SIWA 4NATA 3EWSA 3S2FA 2ERYA 2VT7A 3U0VA 1L7BA 3TLJA 2X4IA 3W5JA 3WLRA 5GVSA 4YDQA 4S0XA 3IA2A 1RWWA 5M7EA 1AO0A 3C8UA 3X1WA 4MRMA 2YXDA 1TJ3A 1GYRA 4F11A 3QY9A 3O7MA 2XA1A 3RVPA 1PR5A 1ZN7A 4MGEA 2ERXA 4DHWA 3HCFA 4BX2A 1QH8A 1S8OA 2CK3D 4G37A 5JI3E 2D5IA 1LBIA 1G8MA 3QFFA 2JLXA 3ADDA 3AP2A 5LP6F 5F7JA 1GCIA 1FXWF 2ZRJA 4DWWA 1T4CA 5JASA 4FDVA 1RJGA 3GVCA 4CLOB 3D6UA 1A4XA 3FF4A 2P4QA 1VMKA 3UOAB 2O8EA 4OYLA 2Q7OE 3VSEA 1RP1A 2ZREA 2Q1YA 1GG2A 4M37A 5AYVA 2FW6A 5A5VA 4NNOA 3LFTA 3CLUC 3FBTA 1BN6A 1CX9B 5HKKD 1JKJB 1XA0A 2DWCA 3E3OA 3KDPA 3K1AB 2AH5A 1D2MA 2V5VA 4N48A 4FLEA 1KVRA 4GT1A 4QREA 3QW2A 2PEZA 4JITA 2I33A 4LGMA 3FMOB 3A1EA 2C2OA 4WKCA 4ZI7F 1S2GA 2PR7A 3Q7SA 4FONA 4AECA 1BFKA 2Z2KA 4ZOLA 4UTNA 4GKJB 2BISA 5JH7F 3MJSA 4KXVA 4JX9A 3OQMA 2IYPA 2TMYA 4AJEA 2WV9A 3I53A 4NRDA 4P33A 2UZ1A 2VT6A 4B80A 4WNIA 4P4GA 2MYTA 3TL2A 4BLRA 3DAFA 1GNSA 1FFXA 2ONKA 4MHSA 4K9MA 3BHMA 3KOUA 2X2PA 5A5GA 3N8KA 4B8WA 4BX0A 1B4DA 3IDZA 3PHJA 1W59A 5T41A 1EVZA 3HJFA 3CONA 1PL6A 1QOZA 2JI8A 4S1WA 3LDHA 4BMPB 4YDRA 4GF5A 2DQKA 2WJYA 4UBLA 4J16A 2PYZA 4FJ1A 4QUJA 2GBIA 1NPDA 1E77A 4IXMA 1MU0A 3GCDA 2F1JA 5B6IA 4OQXA 3B6IA 4F2GA 4E2YA 4C03A 2H1FA 1U3TA 5ARCA 3KOYA 1H2WA 3WK7A 4S05A 2PE5A 4K9OA 5L3QB 2YYYA 3PQ7A 3WMRA 1RXSA 1X1TA 4R40A 4C5AA 4K88A 5HKLA 2JGJA 5HUQA 1C9DB 3UWKA 3BWMA 2BFEB 3DHWC 3N2KB 1UZAA 4HGQA 4MWZA 4Y9RA 1Q91A 1WB6A 2C58A 3F74A 3ADBA 1BS2A 2AFIB 4AIIA 1TW2A 3G0BA 4BGDA 4XPZA 2Z30A 3C5WP 5JRZA 2D74A 1OUMA 1UDXA 3ZKWA 4KO3S 4CPDA 3TB4A 1IATA 3HKBA 2O9JA 3FPJA 1HYGA 3NWOA 4BVJA 4U6QA 1QHIA 3GROA 1YR2A 4NS4A 2E6KA 3AJ8A 3EMKA 2QZSA 4D7AA 4Z49A 5L3QA 3Q7PA 1E9SA 4OSEA 1KWKA 2AN4A 4ROSA 4XA8A 1KO5A 4Z53A 1XKQA 3CN7A 4JJKA 5JE8A 5DK4A 2Z2YA 1YS7A 3I45A 2A1TR 2PS9A 4GX0A 3ROQA 2KLHA 1W2GA 2FEMA 1QIHA 1Q14A 3VAYA 2JJ8A 3HWWA 4QIHA 1UDAA 4YALA 5AKKA 2PMWB 2YY5A 1PX0A 2WF7A 1TEVA 2CNNA 2OORC 5JDCC 2PLFA 3EGDA 4QFCA 1RMTA 5JDIC 2QSZA 2KSQA 1ISIA 5IH7A 1GQRA 3E1KA 3O47A 1J0AA 2FR1A 2WTMA 3O8OA 1S3SA 5BSVA 1G9TA 1R1DA 3V33A 4BN0A 3NGMA 1PX2A 2JASA 3E8XA 4UTZA 3WDSA 3N0XA 4KPYA 2QTBA 1NR5A 3EPHA 1XNGA 3DZGA 5K6TA 1RVV1 3L4EA 3EYWA 5BSMA 7AT1A 5IT5A 2B1JA 3AJAA 4YRRA 4ETNA 1PGNA 2BUCA 5DASA 1ZSNA 1OGYA 3GZNB 5TQ0B 2V7UA 3WICA 4A2PA 2OP1A 4E12A 1TC1A 3ZJUA 2PQ0A 2QLMA 2Q3CA 3HVJA 3R7WA 5TPWA 1CJSA 3TBHA 1UFOA 1G3RA 1WMDA 1VE9A 1Y63A 1B6SA 2ET6A 2XJ4A 3DZ8A 4WNYA 4AY3A 3ZS9A 1UT5A 1QFSA 4RW0A 2IBMA 2MYUA 4ZANA 1W5BA 2WTBA 1Z34A 2E48A 3DJFA 4U2DA 3TCKA 1UC4B 4C0JA 4DCTA 1QGDA 3KZMA 2OGUA 2XYHA 1QHXA 2BZSA 4RJKA 4ZVPA 5BNIA 4NOJA 4CLHA 3L04A 5IKMA 1GM5A 1D1SA 4OEHA 1KNXA 1GAQA 2RI0A 3RRFA 2BJWA 4EVIA 5LSAA 1QRDA 1D7OA 1HQKA 2VUSA 4AJOA 5F3DA 5JAPA 1EFPA 1U4SA 3HDVA 4J0FA 4PO8A 4M76B 1CERA 3L7LA 3IMEA 5FUYA 4MV4A 3V4VB 3OESA 3QPVA 3IT3A 2DRIA 1NJ8A 1QIDA 3WXMA 1FY2A 4AKGA 2WJZB 3DEAA 1D5CA 1Q0HA 1WLSA 2GCOB 3FRHA 3FXAA 1ORIA 1OMOA 3KNZA 2ZYVX 4OYYA 3IBTA 1QG0A 3ORFA 3EQ2A 4DDVA 1LBEA 4HI0E 3DAGA 1KYTA 3KSBC 1CHNA 1XZJA 4UTOA 2YVLA 3FGPA 3I9FA 1DNPA 1U0SY 4BMZA 2WD7A 2QG4A 3EZ9A 3QELB 4OI4A 4UMEA 3UPDA 4C7KA 2YCLA 1JHRA 4PR0A 2WFMA 1X7WB 1DX6A 1PEAA 2Q9CA 1TX4B 2YXPX 3K5IA 4HAOA 4IDOA 1N2IA 3DDNA 3LQ1A 1N5LA 5YASA 1YE5A 4CM8A 3VR6A 5CXQA 4N9QA 4KLAA 1IYZA 1E1YA 1R6DA 2AXEA 3I9JA 4M8KA 5BV2P 3OOWA 3RYTC 3ZHTA 4Q9DA 3LDGA 2W2XA 2QAGB 4QTYA 1IUNA 2FRXA 2R1UA 1JG4A 3ACCA 4FQ8A 4X7RA 3ZH9B 1QK4A 4BO2A 5JZ9A 5LMNB 4MP8A 5AI8A 3NBYC 4BN5A 2NYAA 3QEBZ 3RK4A 2ZQZA 2VHTA 1XDSA 3OEHA 4FC6A 3G8DA 1TQ4A 3DVLA 4JBLA 5BWOA 1SXJA 2AKEA 1KQGA 2XUPA 1GGMA 2HFJA 2N1MA 1MQSA 2C4NA 3Q8XB 3IKLA 4GRIA 1T24A 1R12A 2PX5A 1FRNA 2N47A 3PQFA 5LJLA 4ZMBA 2Z8XA 3GEBA 2ADFA 4R9RA 3CNOA 1XF9A 2ZRIA 3OT4A 4HZGA 5JNTA 1PBNA 3QPAA 5B58C 1B3BA 2O8FA 2B7BA 3LXMA 5FYQA 4BDTA 4L6CA 3OQBA 4DR6B 3ML1A 2A9PA 4OLHA 1BMFA 1YB7A 2FK8A 4YP6A 2C5FA 1HEUA 2RC5A 4W7SA 1U1DA 3LJKA 5BMOA 4CJXA 4P92A 1U80A 4KXWA 5E6SA 1C3VA 3S27A 3HU2A 1CUCA 2QJOA 1NLZA 2QS9A 3EA5A 3H86A 2ISSD 5KS2A 4HX5A 2DFVA 5B64A 3ZC3A 3LQKA 4OQYA 4INAA 1GZDA 1T29A 2RGCA 3UMRA 4MV0A 4BNXA 2IDZA 1NE7A 2Z5VA 4EPXA 4C43A 3D02A 4ZQHA 4AQ7A 3ZI0A 2XCUA 4IHQA 1K92A 2O8VA 3WFJA 4ACAA 1EXVA 4JBWA 2CMKA 3GGGA 1WR8A 3OZGA 3PQEA 3UJHA 3Q40A 4O2LA 2QRNA 3AGQA 3O5AA 4J4HA 4BLSA 1B14A 1MRNA 4ISCA 4A6PA 4Q1EA 1L5NA 2OVBA 3DONA 3KELA 3EIEA 1UWKA 3DKRA 4M60A 2IZ5A 1NKSA 4R8MA 4XGRA 1SUIA 1YQEA 3IVXA 2JC3A 4MLCA 4EFNA 4EHNA 1Q3KA 1HO3A 3EDCA 3FB4A 1IHOA 1URPA 4CDGA 5L51A 1RHRA 2WB4A 3S1AA 2HZBA 2H9YA 3DV0B 1V8OA 2VAPA 1NKVA 4FYKA 2J3LA 5JYEA 1F4VA 4Y6LA 4FCCA 5DNWA 1UKYA 2HD4A 2XCLA 2JFVA 5IM4A 1BU5A 2PMCA 5AM1A 1DFHA 1D1PA 3W77A 5FI5A 2OG1A 2FZEA 1SHZA 2K6GA 1OZFA 5AKLA 4P54A 2AW3A 3B1ZA 1VL6A 4B3BA 5FOQA 1A8UA 3PEEA 2GERA 2O54A 3MAGA 2NUTB 1UZUA 2GASA 3EXHC 5ICFA 5IW8A 3TINA 4EDFA 2D5LA 3MMZA 2HI0A 3QU7A 3LHIA 3EEOA 1Z7BA 3E7FA 1C8BA 4DA0A 4UU8A 2B5VA 4FEYA 2J6IA 2ORYA 3I72A 4COKA 2P91A 5B55A 2FSPA 3M5PA 3WK4A 2RJNA 1HBJA 4U7WA 4KK4A 4RK6A 2I4MA 2GZSA 4B8ZA 4FPXA 1ZHOA 2EJWA 4BX8A 5HTOA 1GCOA 4N3NA 1C41A 3HADA 3A4IA 3FGNA 3Q88A 4EW2A 4AAYA 1WVMA 1T6NA 1VG0B 1E3LA 3FMGA 4GP9A 1E9DA 1FZQA 3DB1A 2VKTA 5KNDA 1SPXA 3CNBA 1O2DA 2B4RO 2J9FB 2O2XA 1EVIA 4K05A 1VIVA 2YBEA 3HYTA 3R4CA 1UQUA 4K9KA 2KM1A 4ZXFA 1A88A 3PWSA 3Q1LA 3DULA 2EW8A 2R0QC 4YJGB 3V8NA 4I7EA 2IQ5A 5CM2Z 4W5JA 5IBQA 1IWOA 3B5EA 4X7BA 2P4EA 1BJRE 2YWHA 3R5FA 5K0FA 4D4HA 1V39A 1XHEA 1TEZA 2A92A 3JYNA 4RIEA 3JYLA 3AOGA 4Q4HA 2WIFA 1YL7A 4W1SA 1HE1C 3WL3A 3H19A 1Y6GA 3WNVA 4C21A 3E81A 5CH3A 4H35A 3SM3A 5L3SB 3IIJA 3KYJB 4HGZA 4AMGA 1W94A 5J2TA 2EOAA 3I58A 5EQJB 5CBPA 3HEMA 4NPHA 2E4YA 1T2FA 3VTFA 5IDWA 3E5RA 3G7UA 2G72A 5DW3A 4I6JA 3F96A 3OT1A 4IIVA 4NLLA 5MF6A 2X15A 4HVTA 1PT5A 3L7DA 4HS4A 1Z2PX 2CL5A 2Q28A 2R6HA 4RE5A 3M6VA 1YMUA 3X43A 4AZ0A 3L82B 3KOZA 2Y71A 421PA 3ZQUA 3P7MA 3V7FA 1U9IA 4DR7B 1S4MA 5B7NA 3F9IA 3KWMA 2ZRLA 1YVEI 4YX9A 1ENPA 4OQLA 3E8SA 3GC6A 4RWEA 4U4AA 5G1OA 1JYFA 1KRXA 1DXHA 5I9IA 5KOJB 1RQPA 3ESBA 3U1TA 3KTAA 1DAMA 4Q9KA 4BXOB 2IK8A 4GKKB 4KLZA 3LBYA 5D8DA 5DLDA 1VBMA 2RHRA 4RD1A 5JAIA 1ZD5A 1L7EA 4AWBA 3U5TA 1Z74A 3RASA 1YVRA 4RHYA 4KTTE 5AW6A 2FZGA 3JQAD 4J90A 4GNKA 1BKDR 3HJCA 4KVZA 3E6AA 4ON9A 1ZR2A 4RD6A 3DTYA 4DQLA 1AUXA 2CWWA 3SHOA 4B2LA 2AVNA 2VZ8A 2BKEA 4QZVA 4JROA 3H8JA 4PBTA 5A05A 1BX0A 2ZB7A 1GZVA 1NXOA 1VRCA 3CE9A 3CURA 4O4HB 3IXMA 1Q20A 4L5CA 5ITZA 5EJMA 2V7WA 4PONA 1V41E 3RGWS 3RRMA 5A5DA 2PFSA 4RF4A 4E5KA 2EX4A 5FAXA 5F5LA 4YJHA 3USES 1QYDA 3CVVA 4AZTA 3BMQA 3WXBA 1WUTA 3SBEA 1H2YA 1RRMA 4FT2A 4F60A 4S04A 2JLVA 5EJIA 2HK8A 3MIZA 2HEIA 2FOIA 3U37A 2F4NA 1QRAA 4PSKA 1M72A 1GCAA 3YASA 2Z04A 3TOXA 2HA7A 1N75A 3MEQA 1P9OA 1Z7WA 1E0DA 1LTHR 4KUEA 5DSTA 2R751 3DE4X 3FTNA 1XN4A 3ZIAA 2DGDA 2QR2A 3SJZA 4ETIA 2QE7D 4FI3C 3WJ1A 3BT7A 4M46A 4MZXA 2WQ7A 3P2OA 5KEIA 4QBTA 3WNZA 3MERA 3V2GA 3VRHA 2HXGA 4RPCA 3W9YA 3DPSA 4PAQA 5CG1A 2G5PA 4M2LA 4Q19A 2C8VA 3MYYA 4H6XA 4A27A 1QM5A 2IYRA 3DDWA 2RGGA 1WL8A 2W00A 5K6AA 3VU9A 1L7XA 1YCGA 4Z9FA 3RIHA 5LZ4A 3J81k 5CRIA 2MINB 5ER9A 1W30A 2GUGA 2TRSB 3I76A 3KEQA 4K6HA 3WGTA 4CGZA 4CFYA 1DG3A 2JK0A 1UMCB 1NRWA 1ZBQA 2Q0HA 2NSLA 2YR0A 4L73A 1A5ZA 3UAZA 1PFKA 2PJUA 4DOMA 2GS9A 3F4LA 3GJ0A 1MXFA 4BMYA 2QJRA 1CUWA 1B8NA 1JAYA 3T52A 3MTBA 3LI2A 4UUOA 3RUPA 2BDEA 2HPZA 1IAQA 3DO8A 1TMYA 3WGNA 5CM9C 3DMPA 5JCOC 2PUFA 1THMA 5AXAA 4M9SA 4TMFA 3W9BA 4CMCA 2GGSA 3PFBA 2DTXA 4M54A 4A0HA 1K5HA 2QMZA 1CW2B 3NBZC 5ESXA 1XWFA 3MCTA 5E3JA 3MWLA 1LZLA 1WE2A 1XLVA 3DFKA 4G9GA 5FA6A 2XNSA 4BRZA 1UK6A 4A73A 2XRZA 5JEDA 4GYYA 3QQ5A 3C3PA 1AKEA 3I1JA 4RPGA 1X38A 1FRVA 2C8KA 4RVHA 3W4IA 1E5XA 1XTBA 4F0JA 1XTZA 4MGKR 4MIKA 3O03A 1VRVA 3LS2A 3WX0A 3B6MA 2A5GA 2UYGA 5B1SA 3QPWA 1V45E 4QDXA 1U02A 3JWJA 3QVOA 4D2IA 2PXHA 2R6FA 2R1ZA 3QWIA 4YEDA 3TRJA 5SZKB 2H4HA 1GY8A 4LECA 5DWDA 5EIFA 3WGZA 4GGMX 3ZDQA 1AUPA 1KMCA 2V9ZA 2CK3A 2P9EA 3LUHA 1IPFA 3QVXA 2GF9A 5HZMA 1D1QA 3LPCA 4FGUA 2CY0A 4ERXA 3FFWA 1IG3A 1A9YA 1P39A 1X7XB 1YBHA 3DEKA 1X7YA 3HKDB 4R84A 4YQYA 1GR0A 4C0KA 4GYWA 1LU9A 4DLUA 4JKYA 3PUXA 3RDPA 1ACJA 4Q01A 3K20A 3RYIA 4KLNA 2GD0A 3C15C 5AVQA 2D2EA 3LT0A 3EIWA 3I12A 4LBWA 3KG2A 3ZHUA 5P8WA 3DF7A 2QAJA 3R3VA 1WBDA 3D4BA 2AE1A 3D3WB 3LRTA 3BAFA 3ZDRA 2R00A 2YV2A 1ZH8A 3TXYA 2Q3JA 4A0SA 4EUSA 3GXBA 3ZDAA 2IKSA 1X0XA 3BEOA 3PEUA 4U9UA 4F84A 2OQRA 1TCCA 3HM2A 3KBOA 5DNEA 3ZNOA 2XMDA 4LDRA 1GXSB 1BCRB 1Z7YA 4HADA 5AI6A 2P9TA 2G04A 4O2BA 4BNDB 2G36A 4Y1GA 2O59A 4C4YA 3R3HA 1AN0A 2G9ZA 3FDXA 3TZEA 2PSDA 3PPWA 5AM4A 4D4KA 3OKAA 2PRKA 1DUIA 1N2HA 2W6OA 1CCWA 1GQFA 2DX7A 3L7AA 3UJ8A 4HSEA 4D97A 4D1YA 2I2CA 3D3QA 1B76A 1R6BX 1RWMA 3JR7A 3QKRB 4O0LA 3KZKA 1DAGA 2WIAA 4GQBA 4EMUA 1AKUA 1ZIOA 4M1QA 2RGRA 1GGFA 3M4ZA 3HCAA 1MX3A 3U40A