3DC1A

Crystal structure of kynurenine aminotransferase ii complex with alpha-ketoglutarate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
414
Chain Sequence
MNYARFITAASAARNPSPGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
total genus 133
structure length 414
sequence length 425
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3dc1A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3dc1A03
2EZ2A 1AMRA 2BIAA 2DGKA 1G7XA 2BYLA 2D66A 3MC6A 3HL2A 4GRXA 4RLGA 1AHFA 2EH6A 2XBNA 1GC3A 3E2FA 4U2HA 1VEFA 5F9SA 1KKJA 3HLMA 3GBXA 4F5FA 3EI8A 3RBLA 2VMXA 1CL2A 4IY7A 1DJUA 2AY3A 2WKAA 5FT8A 4A6RA 2YRIA 3W1IA 3NU7A 2CJDA 4J8LA 5LHAA 2JG2A 3VOMA 2VIAA 4AO9A 1S06A 4JE5A 3FVSA 4RIZA 1RVYA 4MGRA 2R2NA 3KGXA 2BIGA 2X5DA 2VLHA 1B9HA 2ZJGA 3JW9A 4H51A 1M0NA 3KKIA 1OHYA 3ATHA 4BA4A 4J5UA 3PA9A 4AO4A 3EIBA 4MKKA 2JJFA 4K2IA 3UAKA 1ASMA 3R9AA 3A9YA 3WGBA 4OTLA 3NYUA 1W23A 1IUGA 2O1BA 3FFRA 1D7UA 3ISLA 4ATQA 3B8XA 3G7QA 4OC9A 2W8UA 1DJ9A 1TATA 2F8JA 2Z20A 2VGZA 3LVLB 3AENB 2OKJA 3MKJA 4JEYA 3WLXA 2X5FA 3P6KA 2OGAA 4IXZA 4P3MA 4WXFA 3MAUA 2R5CA 3RI6A 2BI9A 3P1TA 1AICA 3B1DA 5M4DA 2EO5A 4ZM4A 1W7NA 1AAMA 3N5MA 3FSLA 1S07A 2AY1A 4JF1A 1MLZA 1IX6A 3I4JA 1AMAA 3CQ4A 5E5IA 2CB1A 5EQCA 1MDZA 3K7YA 3JU7A 4EU1A 1BQDA 1GC2A 1SZUA 1N2TA 3PGYA 4R8DA 2PB0A 1AY8A 3DR4A 2WK7A 2ZUKA 1YIZA 1H1CA 1KL2A 2C44A 5DJ1A 3ACZA 1ASLA 4PFFA 2GQNA 1C4KA 3GR9A 1LC8A 1AHEA 2D7YA 3UE8A 3EI5A 4MKJA 1X2AA 2G6WA 1ASGA 5JAYA 2W7EA 4XJMA 1AJRA 1OHWA 2CTZA 2ZYJA 3FQ8A 1VJOA 1ZOBA 1YAAA 3W1JA 3LY1A 4XQ2A 1DKAA 4Y0DA 4R5ZA 4XJLA 1U08A 1ASAA 2JGTA 2CINA 2Z9VA 3QGUA 4EMYA 2W7IA 4ADCA 1TOJA 3BV0A 3RQ1A 4ZASA 1QZ9A 1M32A 3AOWA 4F5KA 1IJIA 4A0FA 1CQ6A 2YCPA 5G2PA 3PJ0A 2AEUA 3HDOA 3NDNA 2HOZA 5G4IA 1AKAA 2D64A 2VLFA 1GEXA 1Y4IA 1BS0A 3A9ZA 5G4JA 2VMWA 4WYAA 5TF5A 1O4SA 3E6GA 3N0LA 2FM1A 4Q75A 3PDBB 5FT5A 1TPLA 1YJYA 4OYTA 3E9KA 4IX8A 3K28A 4Q6RA 1UKJA 2CH1A 4U1TA 3HQTA 4WYGA 1SF2A 2AY2A 2HORA 3MBBA 1LC5A 3F9TA 4GE7A 2EGYA 3DODA 4RJYA 4GEBA 4MQPA 5IWQA 1AHGA 1CS1A 1O69A 4UHOA 3DXWA 4ISYA 2YCTA 5HHYA 3W1HA 3VK4A 1BQAA 3WCNA 1DFOA 5M46A 2YRRA 4N0WA 3GZDC 2TPLA 2WK8A 2W7MA 4WLHA 3FRKA 2OQXA 2GB3A 3HT4A 1AMSA 1BJNA 3NU8A 1FC4A 1ORDA 1C9CA 4JEXA 3MAFA 4PVFA 4Y0HA 3NYSA 4RAEA 4XJOA 1VP4A 1BW0A 1KKPA 2QLRA 4F4EA 2VMZA 4EB5A 3LG0A 2BWOA 3GWPA 3PIUA 4WXBA 8AATA 1TOKA 1YJZA 2BWPA 2D7ZA 3ELEA 2E54A 3JWAA 1FG3A 4LNMA 1ASDA 4QGRA 4A6TA 1WYVA 2VMVA 2XH1A 2W8WA 3FTBA 3FKDA 4ZSYA 1BJWA 4GE9A 1BJ4A 1X28A 3VK3A 3WKSA 4LNJA 1V2DA 3M5UA 1AY5A 1CZEA 1E5EA 2HOXA 4ITXA 4RM1A 2FYFA 5DJ9A 3NUBA 4GE4A 4WB0B 3WZFA 2BKWA 1AX4A 2ZSMA 2Z1YA 4RKDA 1GEYA 2FNIA 2YKVA 2D65A 1CZCA 2D63A 1SVVA 3I5TA 3II0A 3DRDA 1B9IA 1C7GA 1QIRA 4JEVA 2D61A 5EFSA 4NOGA 1QJ5A 3N75A 1ARTA 2X8UA 1GCKA 1S09A 4XAUA 1OXOA 4DBCA 2DOUA 1J32A 3QN6A 3RCHB 2ZC0A 3QHXA 4KYOA 4CBSA 1Z3ZA 2HUFA 1W3UA 1EQBA 3WKRA 1SZSA 3PDXA 1Z7DA 2O7CA 3RCHA 4F5HA 2X3LA 4LNLA 4ZSWA 3COGA 1W7MA 4HF8A 2R5EA 4WD2A 1MAPA 3EUCA 3HMUA 1WYTA 2VYCA 1B4XA 5FT4A 4F5IA 1GDEA 1M7YA 3AENA 2VI9A 4R5FA 2AY9A 2Q7WA 3QM2A 4A6UA 1QJ3A 3LWSA 4P7YA 2HP2A 3BWOA 3LVMA 1ARSA 1DJEA 3BS8A 2ZY3A 2VMUA 4LW4A 2D5YA 1GEWA 3BN1A 3H14A 4K2BA 2VMSA 2BI3A 2QBTA 3JWBA 4MY5A 3I16A 5DB5A 1S0AA 2VGUA 3ASBA 5E4ZA 2BI1A 1YJSA 1N31A 1ZC9A 2AY5A 2BI5A 3DXVA 4ZDPA 9AATA 2CY8A 2VGSA 2VIBA 3TATA 1UU2A 1C7NA 1GBNA 4OBVA 3EZSA 3FDDA 4LW2A 4PFNA 5E3KA 4A0HA 4DGTA 4Q31A 4WYFA 3PD6B 1QGNA 2VI8A 2AY8A 5M49A 3FZ7A 3EI7A 3ELPA 5BJ4A 3CBFA 2W7JA 3ZZKA 1AIBA 4HVKA 1O61A 2HZPA 2Z9UA 5LH9A 3AELA 4WLJA 1D7SA 2VMPA 1H0CA 4DQ6A 3D6KA 2V1PA 1SFFA 2YOBA 2GSAA 4BQ0A 2DGLA 4RITA 2JJHA 4W5KA 4F5MA 7AATA 1AKBA 4WBTA 1TARA 2QMAA 2W7LA 4W1WA 2OKKA 2E7JA 4RJ0A 1TOIA 3MC6C 3CQ5A 1BKGA 1PMMA 2DGMA 2VGTA 3E77A 4JEZA 1BJOB 1TOEA 2VGVA 3E2ZB 3G8MA 4OCAA 2W7KA 4A0RA 1YIYA 3FQAA 4ZM3A 3BCXA 1I29A 2GMSA 4BHDA 1EJIA 4WYEA 3EI6A 4W8IA 3AEJC 2FN6A 3BWNC 2BI2A 3NRAA 3H7FA 4F5JA 4ZAHA 2AY6A 3ZRPA 1UU0A 5FT6A 4WP0A 3AEPA 2ZY2A 2FNUA 1E5FA 3CQ6A 3A9XA 1M0QA 1B5OA 1PG8A 1CL1A 3B1CA 3LVJA 1T3IA 3LVKA 3PAAA 3CAIA 1MGVA 2HOYA 4IYOB 4R2NA 1WYUB 4W1VA 5DX5A 5EUNA 2JJEA 2DKBA 3VP6A 4IXOA 1ARIA 3ZRRA 5J8QA 1AMQA 2YCNA 4KXKA 3VAXA 4GDYA 2BIEA 3AEJA 1ELQA 3WGCA 1WYUA 4PIWA 3DZZA 4FL0A 3FVXA 1GC0A 3ASAA 1UU1A 1AJSB 1OATA 3MEBA 1I41A 5I92A 3AATA 3GSBA 1B5PA 2C81A 3WX9A 4Q76A 1KMJA 1IBJA 5EIGB 4GSAA 4AH3A 2JISA 3GJUA 3A2BA 4MQRA 3TFTA 4A0GA 1WYVB 1B8GA 1MLYA 2V0YA 1ELUA 1BJOA 2AATA 2FQ6A 4IXSA 5M4BA 4UHNA 4BA5A 3GZDA 5C6UA 2Z61A 3JTXA 2ZSLA 3PPLA 3EI9A 1ASBA 2W7HA 3BCBA 4F5LA 3F6TA 4KAMA 2CANA 2Z9WA 1WYTB 3BB8A 4TV7A 1P3WA 1D7VA 1KMKA 1YNUA 2YHKA 3OKSA 1TOGA 4F5GA 3NTJA 2W7DA 2WK9A 4UHMA 2W7GA 3WY7A 3JZLA 3FCRA 4ADBA 4ADEA 1O62A 3FD0A 3NNKA 4LC3A 4EFFA 4MSOA 3R4TA 1AJSA 2BWNA 1MDOA 4TMRA 1S08A 3DYDA 4OT8A 1OXPA 3GETA 3IHJA 1LW5A 1RV4A 5EAAA 5AX8A 3USFA 1CQ8A 1AY4A 3T32A 4W1XA 1G7WA 2E7IA 3L44A 4WYDA 1G4XA 2EZ1A 1FG7A 4WYCA 1AKCA 3NUIA 4ATPA 4IYOA 3LV2A 4XK1A 2AY4A 3PDBA 4CXRA 2JJGA 2OGEA 1V2EA 2AEVA 4ZLVA 4AOAA 4WB0A 4CBRA 4E3RA 1X29A 4O6ZA 4TN4A 2ZY5A 2W8TA 3AEMA 5EUEA 5HDMA 1MDXA 3BWNA 2HUUA 4UOYA 4ZWMA 3L8AA 3AEMC 3ZZJA 1TASA 3TFUA 1WKHA 1EG5A 1LC7A 2Z9XA 2DR1A 4I8AA 1JF9A 2YKUA 5G0AA 1JS6A 1XEYA 2E7UA 2W8JA 3OP7A 2Z67A 3FZ6A 4ZDLA 3ECDA 3TQXA 4A72A 4B9BA 2YKXA 2CJGA 1D7RA 4A00A 3IF2A 2VMRA 1WSTA 2CFBA 2O0RA 1OHVA 3PD6A 3FFHA 3FDBA 3MAFB 4FFCA 4OBUA 4BMKA 3G0TA 2CH2A 4M2KA 5HXXA 4EB7A 1V2FA 2EPJA 2Z1ZA 3K40A 3QI6A 3B46A 3E2YA 4M2JA 2NMPA 3WCOA 4AZKA 1LS3A 3F0HA 2VMOA 1WKGA 4M2MA 1IX7A 2R0TA 1ZODA 1ASFA 2ZP7A 4MQQA 2QB2A 1AHXA 5D95A 1ASNA 4B98A 3B1EA 3HBXA 1V72A 5G09A 4ADDA 2C0RA 3Q8NA 4RKCA 1ARGA 3MADA 2OATA 1LKCA 1SZKA 3QPGA 2BHXA 4E3QA 3TCMA 1DGDA 1AAWA 2W7FA 1N8PA 1IX8A 4N0BA 2DKJA 3AV7A 5G2QA 3AOVA 1C7OA 4W91A 2QB3A 3RBFA 2RFVA 4ZWVA 3AEOA 4XJPA 2PB2A 3UWCA 3FZ8A 3EZ1A 1QITA 1IAXA 1AIAA 1BT4A 1DTYA 1JG8A 2VGWA 4K2MA 4UQVA 4WXGA 5EIGA 1C0NA 1LW4A 4L0OA 2GMUA 3QBOA 2BYJA 4E1OA 4JE5D 3DU4A 5EAVA 1GC4A 1PMOA 3A8UX 1M0OA 1IVRA 4ZDOA 1QISA 1SPAA 2VMTA 1DGEA 2C7TA 5K8BA 1M0PA 1CJ0A 2R5CB 2W8VA 2AY7A 1XI9A 1MAQA 3HVYA 1W7LA 3FVUA 2ORDA 3NX3A 4XEWA 4ITGA 1AHYA 4OMAA 1M4NA 3DC1A 3FQ7A 1I43A 1G4VA 1YOOA 1LK9A 5EUDA 4JF0A 1I48A 1ECXA 3KE3A 4CXQA 4IW7A 1PFFA 1ARHA 5F8VA 4AZJA 1RV3A 1J04A 1GD9A 1RVUA 3VK2A 4E77A 3E2ZA 3BCAA 2HP1A 2VMQA 2VMNA 5BJ3A 3DR7A 2ZY4A 1KL1A 3GZCA 1IAYA 1ASCA 3KGWA 4CVQA 2CSTA 3RUYA 4Y0IA 2QA3A 4JEWA 3EIAA 5D5SA 2VMYA 1CQ7A 1ASEA 1M6SA 2HUIA 1X0MA 1D2FA 2CJHA 3BC8A 3ZRQA 1JS3A 2YKYA 2PO3A 3NYTA
chains in the Genus database with same CATH superfamily
2EZ2A 1AMRA 2BIAA 2DGKA 1G7XA 2BYLA 2D66A 3MC6A 3HL2A 4GRXA 4RLGA 1AHFA 2EH6A 2XBNA 1GC3A 3E2FA 4U2HA 1VEFA 5F9SA 1KKJA 3HLMA 3GBXA 4F5FA 3EI8A 3RBLA 2VMXA 1CL2A 4IY7A 1DJUA 2AY3A 2WKAA 5FT8A 4A6RA 2YRIA 3W1IA 3NU7A 2CJDA 4J8LA 5LHAA 2JG2A 3VOMA 2VIAA 4AO9A 1S06A 4JE5A 3FVSA 4RIZA 1RVYA 4MGRA 2R2NA 3KGXA 2BIGA 2X5DA 2VLHA 1B9HA 2ZJGA 3JW9A 4H51A 1M0NA 3KKIA 1OHYA 3ATHA 4BA4A 4J5UA 3PA9A 4AO4A 3EIBA 4MKKA 2JJFA 4K2IA 3UAKA 1ASMA 3R9AA 3A9YA 3WGBA 4OTLA 3NYUA 1W23A 1IUGA 2O1BA 3FFRA 1D7UA 3ISLA 4ATQA 3B8XA 3G7QA 4OC9A 2W8UA 1DJ9A 1TATA 2F8JA 2Z20A 2VGZA 3LVLB 3AENB 2OKJA 3MKJA 4JEYA 3WLXA 2X5FA 3P6KA 2OGAA 4IXZA 4P3MA 4WXFA 3MAUA 2R5CA 3RI6A 2BI9A 3P1TA 1AICA 3B1DA 5M4DA 2EO5A 4ZM4A 1W7NA 1AAMA 3N5MA 3FSLA 1S07A 2AY1A 4JF1A 1MLZA 1IX6A 3I4JA 1AMAA 3CQ4A 5E5IA 2CB1A 5EQCA 1MDZA 3K7YA 3JU7A 4EU1A 1BQDA 1GC2A 1SZUA 1N2TA 3PGYA 4R8DA 2PB0A 3N7NA 1AY8A 3DR4A 2WK7A 2ZUKA 1YIZA 1H1CA 1KL2A 2C44A 5DJ1A 3ACZA 1ASLA 4PFFA 2GQNA 1C4KA 3GR9A 1LC8A 1AHEA 2D7YA 3UE8A 3EI5A 4MKJA 1X2AA 2G6WA 1ASGA 5JAYA 2W7EA 4XJMA 1AJRA 1OHWA 2CTZA 2ZYJA 3FQ8A 1VJOA 1ZOBA 1YAAA 3W1JA 3LY1A 4XQ2A 1DKAA 4Y0DA 4R5ZA 4XJLA 1U08A 1ASAA 2JGTA 2CINA 2Z9VA 3QGUA 4EMYA 2W7IA 4ADCA 1TOJA 3BV0A 3RQ1A 4ZASA 1QZ9A 1M32A 3AOWA 4F5KA 1IJIA 4A0FA 1CQ6A 2YCPA 5G2PA 3PJ0A 2AEUA 3HDOA 3NDNA 2HOZA 5G4IA 1AKAA 2D64A 2VLFA 1GEXA 1Y4IA 1BS0A 3A9ZA 5G4JA 2VMWA 4WYAA 5TF5A 1O4SA 3E6GA 3N0LA 2FM1A 4Q75A 3PDBB 5FT5A 1TPLA 1YJYA 4OYTA 3E9KA 4IX8A 3K28A 4Q6RA 1UKJA 2CH1A 4U1TA 3HQTA 4WYGA 1SF2A 2AY2A 2HORA 3MBBA 1LC5A 3F9TA 4GE7A 2EGYA 3DODA 4RJYA 4GEBA 4MQPA 5IWQA 1AHGA 1CS1A 1O69A 4UHOA 3DXWA 4ISYA 2YCTA 5HHYA 3W1HA 3N4XA 3VK4A 1BQAA 3WCNA 1DFOA 5M46A 2YRRA 4N0WA 3GZDC 2TPLA 2WK8A 2W7MA 4WLHA 3FRKA 2OQXA 2GB3A 3HT4A 1AMSA 1BJNA 3NU8A 1FC4A 1ORDA 1C9CA 4JEXA 3MAFA 4PVFA 4Y0HA 3NYSA 4RAEA 4XJOA 1VP4A 1BW0A 1KKPA 2QLRA 4F4EA 2VMZA 4EB5A 2FKIA 3LG0A 2BWOA 3GWPA 3PIUA 4WXBA 8AATA 1TOKA 1YJZA 2BWPA 2D7ZA 3ELEA 2E54A 3JWAA 1FG3A 4LNMA 1ASDA 4QGRA 4A6TA 1WYVA 2VMVA 2XH1A 2W8WA 3FTBA 3FKDA 4ZSYA 1BJWA 4GE9A 1BJ4A 1X28A 3VK3A 3WKSA 4LNJA 1V2DA 3M5UA 1AY5A 1CZEA 1E5EA 2HOXA 4ITXA 4RM1A 2FYFA 5DJ9A 3NUBA 4GE4A 4WB0B 3WZFA 2BKWA 1AX4A 2ZSMA 2Z1YA 4RKDA 1GEYA 2FNIA 2YKVA 2D65A 1CZCA 2D63A 1SVVA 3I5TA 3II0A 3DRDA 1B9IA 1C7GA 1QIRA 4JEVA 2D61A 5EFSA 4NOGA 1QJ5A 3N75A 1ARTA 2X8UA 1GCKA 1S09A 4XAUA 1OXOA 4DBCA 2DOUA 1J32A 3QN6A 3RCHB 5KTBA 2ZC0A 3QHXA 4KYOA 4CBSA 1Z3ZA 2HUFA 1W3UA 1EQBA 3WKRA 1SZSA 3PDXA 1Z7DA 2O7CA 3RCHA 4F5HA 2X3LA 4LNLA 4ZSWA 3COGA 1W7MA 4HF8A 2R5EA 4WD2A 1MAPA 3EUCA 3HMUA 1WYTA 2VYCA 1B4XA 5FT4A 4F5IA 1GDEA 1M7YA 3AENA 2VI9A 4R5FA 2AY9A 2Q7WA 3QM2A 4A6UA 1QJ3A 3LWSA 4P7YA 2HP2A 3BWOA 3LVMA 1ARSA 1DJEA 3BS8A 2ZY3A 4K05A 2VMUA 4LW4A 2D5YA 1GEWA 3BN1A 3H14A 4K2BA 2VMSA 2BI3A 2QBTA 3JWBA 4MY5A 3I16A 5DB5A 1S0AA 2VGUA 3ASBA 5E4ZA 2BI1A 1YJSA 1N31A 1ZC9A 2AY5A 2BI5A 3DXVA 4ZDPA 9AATA 2CY8A 2VGSA 2VIBA 3TATA 1UU2A 1C7NA 1GBNA 4OBVA 3EZSA 3FDDA 4LW2A 4PFNA 5E3KA 4A0HA 4DGTA 4Q31A 4WYFA 3PD6B 1QGNA 2VI8A 2AY8A 5M49A 3FZ7A 3EI7A 3ELPA 5BJ4A 3CBFA 2W7JA 3ZZKA 1AIBA 4HVKA 1O61A 2HZPA 2Z9UA 5LH9A 3AELA 4WLJA 1D7SA 2VMPA 1H0CA 4DQ6A 3D6KA 2V1PA 1SFFA 2YOBA 2GSAA 2EYQA 4BQ0A 2DGLA 4RITA 2JJHA 4W5KA 4F5MA 7AATA 1AKBA 4WBTA 1TARA 2QMAA 2W7LA 4W1WA 2OKKA 2E7JA 4RJ0A 1TOIA 3MC6C 3CQ5A 1BKGA 1PMMA 2DGMA 2VGTA 3E77A 4JEZA 1BJOB 1TOEA 2VGVA 3E2ZB 3G8MA 4OCAA 2W7KA 4A0RA 1YIYA 3FQAA 4ZM3A 3BCXA 1I29A 2GMSA 4BHDA 1EJIA 4WYEA 3EI6A 4W8IA 3AEJC 2FN6A 3BWNC 2BI2A 3H9XA 3NRAA 3H7FA 4F5JA 4ZAHA 2AY6A 3ZRPA 1UU0A 5FT6A 4WP0A 3AEPA 2ZY2A 2FNUA 1E5FA 3CQ6A 3A9XA 1M0QA 1B5OA 1PG8A 1CL1A 3B1CA 3LVJA 1T3IA 3LVKA 3PAAA 3CAIA 1MGVA 2HOYA 4IYOB 4R2NA 1WYUB 4W1VA 5DX5A 5EUNA 2JJEA 2DKBA 3VP6A 4IXOA 1ARIA 3ZRRA 5J8QA 1AMQA 2YCNA 4KXKA 3VAXA 4GDYA 2BIEA 3AEJA 1ELQA 3WGCA 1WYUA 4PIWA 3DZZA 4FL0A 3FVXA 1GC0A 3ASAA 1UU1A 1AJSB 1OATA 3MEBA 2G7JA 1I41A 5I92A 3AATA 3GSBA 1B5PA 2C81A 3WX9A 4Q76A 1KMJA 1IBJA 5EIGB 4GSAA 4AH3A 2QSRA 2JISA 3GJUA 3A2BA 4MQRA 3TFTA 4A0GA 1WYVB 1B8GA 1MLYA 2V0YA 1ELUA 1BJOA 2AATA 2FQ6A 4IXSA 5M4BA 4UHNA 4BA5A 3GZDA 5C6UA 2Z61A 3JTXA 2ZSLA 3PPLA 3EI9A 1ASBA 2W7HA 3BCBA 4F5LA 3F6TA 4KAMA 2CANA 2Z9WA 1WYTB 3BB8A 4TV7A 1P3WA 3N4SA 1D7VA 1KMKA 1YNUA 2YHKA 3OKSA 1TOGA 4F5GA 3NTJA 2W7DA 2WK9A 4UHMA 2W7GA 3WY7A 3JZLA 3FCRA 4ADBA 4ADEA 1O62A 3FD0A 3NNKA 4LC3A 4EFFA 4MSOA 3R4TA 1AJSA 2BWNA 1MDOA 4TMRA 1S08A 3DYDA 4OT8A 1OXPA 3GETA 3IHJA 1LW5A 1RV4A 5EAAA 5AX8A 3USFA 1CQ8A 1AY4A 3T32A 4W1XA 1G7WA 2E7IA 3L44A 4WYDA 1G4XA 2EZ1A 1FG7A 4WYCA 1AKCA 3NUIA 4ATPA 4IYOA 3LV2A 4XK1A 2AY4A 3PDBA 4CXRA 2JJGA 2OGEA 1V2EA 2AEVA 4ZLVA 4AOAA 4WB0A 4CBRA 4E3RA 1X29A 4O6ZA 4TN4A 2ZY5A 2W8TA 3AEMA 5EUEA 5HDMA 1MDXA 3BWNA 2HUUA 4UOYA 4ZWMA 3L8AA 3AEMC 3ZZJA 1TASA 3TFUA 1WKHA 1EG5A 1LC7A 2Z9XA 2DR1A 4I8AA 1JF9A 2YKUA 5G0AA 1JS6A 1KAFA 1XEYA 2E7UA 2W8JA 3OP7A 2KFPA 2Z67A 3FZ6A 4ZDLA 4H63Q 3ECDA 3TQXA 4A72A 4B9BA 2YKXA 2CJGA 1D7RA 4A00A 3IF2A 2VMRA 1WSTA 2CFBA 2O0RA 1OHVA 3PD6A 3FFHA 3FDBA 3MAFB 4FFCA 4OBUA 4BMKA 3G0TA 2CH2A 4M2KA 5HXXA 4EB7A 1V2FA 2EPJA 2Z1ZA 3K40A 3QI6A 3B46A 3E2YA 4M2JA 2NMPA 3WCOA 4AZKA 1LS3A 3F0HA 2WB6A 2VMOA 1WKGA 4M2MA 1IX7A 2R0TA 1ZODA 1ASFA 2ZP7A 4MQQA 2QB2A 1AHXA 5D95A 1ASNA 4B98A 3B1EA 3HBXA 1V72A 5G09A 4ADDA 2C0RA 3Q8NA 4RKCA 1ARGA 3MADA 2OATA 1LKCA 2A1VA 1SZKA 3QPGA 2BHXA 4E3QA 3TCMA 1DGDA 1AAWA 2W7FA 1N8PA 1IX8A 4N0BA 2DKJA 3AV7A 5G2QA 3AOVA 1C7OA 4W91A 2QB3A 3RBFA 2RFVA 4ZWVA 3AEOA 4XJPA 2PB2A 3UWCA 3FZ8A 3EZ1A 1QITA 1IAXA 1AIAA 1BT4A 1DTYA 1JG8A 2VGWA 4K2MA 4UQVA 4WXGA 5EIGA 1C0NA 1LW4A 4L0OA 2GMUA 3QBOA 2BYJA 4E1OA 4JE5D 3DU4A 5EAVA 1GC4A 1PMOA 3A8UX 1M0OA 1IVRA 4ZDOA 1QISA 1SPAA 2VMTA 1DGEA 2C7TA 5K8BA 1M0PA 1CJ0A 2R5CB 2W8VA 2AY7A 1XI9A 1MAQA 3HVYA 1W7LA 3FVUA 2ORDA 3NX3A 4XEWA 4ITGA 1AHYA 4OMAA 1M4NA 3DC1A 3FQ7A 1I43A 1G4VA 1YOOA 1LK9A 5EUDA 4JF0A 1I48A 1ECXA 3KE3A 3N4RA 4CXQA 4IW7A 1PFFA 1ARHA 5F8VA 4AZJA 1RV3A 1J04A 1GD9A 1RVUA 3VK2A 4E77A 3E2ZA 3BCAA 2HP1A 2VMQA 2VMNA 5BJ3A 3DR7A 2ZY4A 1KL1A 3GZCA 1IAYA 1ASCA 3KGWA 4CVQA 2CSTA 3RUYA 4Y0IA 2QA3A 4JEWA 3EIAA 5D5SA 2VMYA 1CQ7A 1ASEA 1M6SA 2HUIA 1X0MA 1D2FA 2CJHA 3BC8A 3ZRQA 1JS3A 2YKYA 2PO3A 3NYTA
chains in the Genus database with same CATH topology
2EZ2A 1AMRA 2BIAA 2DGKA 1G7XA 2BYLA 2D66A 3MC6A 3HL2A 4GRXA 4RLGA 1AHFA 2EH6A 2XBNA 1GC3A 3E2FA 4U2HA 1VEFA 5F9SA 1KKJA 3HLMA 3GBXA 4F5FA 3EI8A 3RBLA 2VMXA 1CL2A 4IY7A 1DJUA 2AY3A 2WKAA 5FT8A 4A6RA 2YRIA 3W1IA 3NU7A 2CJDA 4J8LA 5LHAA 2JG2A 3VOMA 2VIAA 4AO9A 1S06A 4JE5A 3FVSA 4RIZA 1RVYA 4MGRA 2R2NA 3KGXA 2BIGA 2X5DA 2VLHA 1B9HA 2ZJGA 3JW9A 4H51A 1M0NA 3KKIA 1OHYA 3ATHA 4BA4A 4J5UA 3PA9A 4AO4A 3EIBA 4MKKA 2JJFA 4K2IA 3UAKA 1ASMA 3R9AA 3A9YA 3WGBA 4OTLA 3NYUA 1W23A 1IUGA 2O1BA 3FFRA 1D7UA 3ISLA 4ATQA 3B8XA 3G7QA 4OC9A 2W8UA 1DJ9A 1TATA 2F8JA 2Z20A 2VGZA 3LVLB 3AENB 2OKJA 3MKJA 4JEYA 3WLXA 2X5FA 3P6KA 2OGAA 4IXZA 4P3MA 4WXFA 3MAUA 2R5CA 3RI6A 2BI9A 3P1TA 1AICA 3B1DA 5M4DA 2EO5A 4ZM4A 1W7NA 1AAMA 3N5MA 3FSLA 1S07A 2AY1A 4JF1A 1MLZA 1IX6A 3I4JA 1AMAA 3CQ4A 5E5IA 2CB1A 5EQCA 1MDZA 3K7YA 3JU7A 4EU1A 1BQDA 1GC2A 1SZUA 1N2TA 3PGYA 4R8DA 2PB0A 3N7NA 1AY8A 3DR4A 2WK7A 2ZUKA 1YIZA 1H1CA 1KL2A 2C44A 5DJ1A 3ACZA 1ASLA 4PFFA 2GQNA 1C4KA 3GR9A 1LC8A 1AHEA 2D7YA 3UE8A 3EI5A 4MKJA 1X2AA 2G6WA 1ASGA 5JAYA 2W7EA 4XJMA 1AJRA 1OHWA 2CTZA 2ZYJA 3FQ8A 1VJOA 1ZOBA 1YAAA 3W1JA 3LY1A 4XQ2A 1DKAA 4Y0DA 4R5ZA 4XJLA 1U08A 1ASAA 2JGTA 2CINA 2Z9VA 3QGUA 4EMYA 2W7IA 4ADCA 1TOJA 3BV0A 3RQ1A 4ZASA 1QZ9A 1M32A 3AOWA 4F5KA 1IJIA 4A0FA 1CQ6A 2YCPA 5G2PA 3PJ0A 2AEUA 3HDOA 3NDNA 2HOZA 5G4IA 1AKAA 2D64A 2VLFA 1GEXA 1Y4IA 1BS0A 3A9ZA 5G4JA 2VMWA 4WYAA 5TF5A 1O4SA 3E6GA 3N0LA 2FM1A 4Q75A 3PDBB 5FT5A 1TPLA 1YJYA 4OYTA 3E9KA 4IX8A 3K28A 4Q6RA 1UKJA 2CH1A 4U1TA 3HQTA 4WYGA 1SF2A 2AY2A 2HORA 3MBBA 1LC5A 3F9TA 4GE7A 2EGYA 3DODA 4RJYA 4GEBA 4MQPA 5IWQA 1AHGA 1CS1A 1O69A 4UHOA 3DXWA 4ISYA 2YCTA 5HHYA 3W1HA 3N4XA 3VK4A 1BQAA 3WCNA 1DFOA 5M46A 2YRRA 4N0WA 3GZDC 2TPLA 2WK8A 2W7MA 4WLHA 3FRKA 2OQXA 2GB3A 3HT4A 1AMSA 1BJNA 3NU8A 1FC4A 1ORDA 1C9CA 4JEXA 3MAFA 4PVFA 4Y0HA 3NYSA 4RAEA 4XJOA 1VP4A 1BW0A 1KKPA 2QLRA 4F4EA 2VMZA 4EB5A 2FKIA 3LG0A 2BWOA 3GWPA 3PIUA 4WXBA 8AATA 1TOKA 1YJZA 2BWPA 2D7ZA 3ELEA 2E54A 3JWAA 1FG3A 4LNMA 1ASDA 4QGRA 4A6TA 1WYVA 2VMVA 2XH1A 2W8WA 3FTBA 3FKDA 4ZSYA 1BJWA 4GE9A 1BJ4A 1X28A 3VK3A 3WKSA 4LNJA 1V2DA 3M5UA 1AY5A 1CZEA 1E5EA 2HOXA 4ITXA 4RM1A 2FYFA 5DJ9A 3NUBA 4GE4A 4WB0B 3WZFA 2BKWA 1AX4A 2ZSMA 2Z1YA 4RKDA 1GEYA 2FNIA 2YKVA 2D65A 1CZCA 2D63A 1SVVA 3I5TA 3II0A 3DRDA 1B9IA 1C7GA 1QIRA 4JEVA 2D61A 5EFSA 4NOGA 1QJ5A 3N75A 1ARTA 2X8UA 1GCKA 1S09A 4XAUA 1OXOA 4DBCA 2DOUA 1J32A 3QN6A 3RCHB 5KTBA 2ZC0A 3QHXA 4KYOA 4CBSA 1Z3ZA 2HUFA 1W3UA 1EQBA 3WKRA 1SZSA 3PDXA 1Z7DA 2O7CA 3RCHA 4F5HA 2X3LA 4LNLA 4ZSWA 3COGA 1W7MA 4HF8A 2R5EA 4WD2A 1MAPA 3EUCA 3HMUA 1WYTA 2VYCA 1B4XA 5FT4A 4F5IA 1GDEA 1M7YA 3AENA 2VI9A 4R5FA 2AY9A 2Q7WA 3QM2A 4A6UA 1QJ3A 3LWSA 4P7YA 2HP2A 3BWOA 3LVMA 1ARSA 1DJEA 3BS8A 2ZY3A 4K05A 2VMUA 4LW4A 2D5YA 1GEWA 3BN1A 3H14A 4K2BA 2VMSA 2BI3A 2QBTA 3JWBA 4MY5A 3I16A 5DB5A 1S0AA 2VGUA 3ASBA 5E4ZA 2BI1A 1YJSA 1N31A 1ZC9A 2AY5A 2BI5A 3DXVA 4ZDPA 9AATA 2CY8A 2VGSA 2VIBA 3TATA 1UU2A 1C7NA 1GBNA 4OBVA 3EZSA 3FDDA 4LW2A 4PFNA 5E3KA 4A0HA 4DGTA 4Q31A 4WYFA 3PD6B 1QGNA 2VI8A 2AY8A 5M49A 3FZ7A 3EI7A 3ELPA 5BJ4A 3CBFA 2W7JA 3ZZKA 1AIBA 4HVKA 1O61A 2HZPA 2Z9UA 5LH9A 3AELA 4WLJA 1D7SA 2VMPA 1H0CA 4DQ6A 3D6KA 2V1PA 1SFFA 2YOBA 2GSAA 2EYQA 4BQ0A 2DGLA 4RITA 2JJHA 4W5KA 4F5MA 7AATA 1AKBA 4WBTA 1TARA 2QMAA 2W7LA 4W1WA 2OKKA 2E7JA 4RJ0A 1TOIA 3MC6C 3CQ5A 1BKGA 1PMMA 2DGMA 2VGTA 3E77A 4JEZA 1BJOB 1TOEA 2VGVA 3E2ZB 3G8MA 4OCAA 2W7KA 4A0RA 1YIYA 3FQAA 4ZM3A 3BCXA 1I29A 2GMSA 4BHDA 1EJIA 4WYEA 3EI6A 4W8IA 3AEJC 2FN6A 3BWNC 2BI2A 3H9XA 3NRAA 3H7FA 4F5JA 4ZAHA 2AY6A 3ZRPA 1UU0A 5FT6A 4WP0A 3AEPA 2ZY2A 2FNUA 1E5FA 3CQ6A 3A9XA 1M0QA 1B5OA 1PG8A 1CL1A 3B1CA 3LVJA 1T3IA 3LVKA 3PAAA 3CAIA 1MGVA 2HOYA 4IYOB 4R2NA 1WYUB 4W1VA 5DX5A 5EUNA 2JJEA 2DKBA 3VP6A 4IXOA 1ARIA 3ZRRA 5J8QA 1AMQA 2YCNA 4KXKA 3VAXA 4GDYA 2BIEA 3AEJA 1ELQA 3WGCA 1WYUA 4PIWA 3DZZA 4FL0A 3FVXA 1GC0A 3ASAA 1UU1A 1AJSB 1OATA 3MEBA 2G7JA 1I41A 5I92A 3AATA 3GSBA 1B5PA 2C81A 3WX9A 4Q76A 1KMJA 1IBJA 5EIGB 4GSAA 4AH3A 2QSRA 2JISA 3GJUA 3A2BA 4MQRA 3TFTA 4A0GA 1WYVB 1B8GA 1MLYA 2V0YA 1ELUA 1BJOA 2AATA 2FQ6A 4IXSA 5M4BA 4UHNA 4BA5A 3GZDA 5C6UA 2Z61A 3JTXA 2ZSLA 3PPLA 3EI9A 1ASBA 2W7HA 3BCBA 4F5LA 3F6TA 4KAMA 2CANA 2Z9WA 1WYTB 3BB8A 4TV7A 1P3WA 3N4SA 1D7VA 1KMKA 1YNUA 2YHKA 3OKSA 1TOGA 4F5GA 3NTJA 2W7DA 2WK9A 4UHMA 2W7GA 3WY7A 3JZLA 3FCRA 4ADBA 4ADEA 1O62A 3FD0A 3NNKA 4LC3A 4EFFA 4MSOA 3R4TA 1AJSA 2BWNA 1MDOA 4TMRA 1S08A 3DYDA 4OT8A 1OXPA 3GETA 3IHJA 1LW5A 1RV4A 5EAAA 5AX8A 3USFA 1CQ8A 1AY4A 3T32A 4W1XA 1G7WA 2E7IA 3L44A 4WYDA 1G4XA 2EZ1A 1FG7A 4WYCA 1AKCA 3NUIA 4ATPA 4IYOA 3LV2A 4XK1A 2AY4A 3PDBA 4CXRA 2JJGA 2OGEA 1V2EA 2AEVA 4ZLVA 4AOAA 4WB0A 4CBRA 4E3RA 1X29A 4O6ZA 4TN4A 2ZY5A 2W8TA 3AEMA 5EUEA 5HDMA 1MDXA 3BWNA 2HUUA 4UOYA 4ZWMA 3L8AA 3AEMC 3ZZJA 1TASA 3TFUA 1WKHA 1EG5A 1LC7A 2Z9XA 2DR1A 4I8AA 1JF9A 2YKUA 5G0AA 1JS6A 1XEYA 2E7UA 2W8JA 3OP7A 2KFPA 2Z67A 3FZ6A 4ZDLA 4H63Q 3ECDA 3TQXA 4A72A 4B9BA 2YKXA 2CJGA 1D7RA 4A00A 3IF2A 2VMRA 1WSTA 2CFBA 2O0RA 1OHVA 3PD6A 3FFHA 3FDBA 3MAFB 4FFCA 4OBUA 4BMKA 3G0TA 2CH2A 4M2KA 5HXXA 4EB7A 1V2FA 2EPJA 2Z1ZA 3K40A 3QI6A 3B46A 3E2YA 4M2JA 2NMPA 3WCOA 4AZKA 1LS3A 3F0HA 2WB6A 2VMOA 1WKGA 4M2MA 1IX7A 2R0TA 1ZODA 1ASFA 2ZP7A 4MQQA 2QB2A 1AHXA 5D95A 1ASNA 4B98A 3B1EA 3HBXA 1V72A 5G09A 4ADDA 2C0RA 3Q8NA 4RKCA 1ARGA 3MADA 2OATA 1LKCA 2A1VA 1SZKA 3QPGA 2BHXA 4E3QA 3TCMA 1DGDA 1AAWA 2W7FA 1N8PA 1IX8A 4N0BA 2DKJA 3AV7A 5G2QA 3AOVA 1C7OA 4W91A 2QB3A 3RBFA 2RFVA 4ZWVA 3AEOA 4XJPA 2PB2A 3UWCA 3FZ8A 3EZ1A 1QITA 1IAXA 1AIAA 1BT4A 1DTYA 1JG8A 2VGWA 4K2MA 4UQVA 4WXGA 5EIGA 1C0NA 1LW4A 4L0OA 2GMUA 3QBOA 2BYJA 4E1OA 4JE5D 3DU4A 5EAVA 1GC4A 1PMOA 3A8UX 1M0OA 1IVRA 4ZDOA 1QISA 1SPAA 2VMTA 1DGEA 2C7TA 5K8BA 1M0PA 1CJ0A 2R5CB 2W8VA 2AY7A 1XI9A 1MAQA 3HVYA 1W7LA 3FVUA 2ORDA 3NX3A 4XEWA 4ITGA 1AHYA 4OMAA 1M4NA 3DC1A 3FQ7A 1I43A 1G4VA 1YOOA 1LK9A 5EUDA 4JF0A 1I48A 1ECXA 3KE3A 3N4RA 4CXQA 4IW7A 1PFFA 1ARHA 5F8VA 4AZJA 1RV3A 1J04A 1GD9A 1RVUA 3VK2A 4E77A 3E2ZA 3BCAA 2HP1A 2VMQA 2VMNA 5BJ3A 3DR7A 2ZY4A 1KL1A 3GZCA 1IAYA 1ASCA 3KGWA 4CVQA 2CSTA 3RUYA 4Y0IA 2QA3A 4JEWA 3EIAA 5D5SA 2VMYA 1CQ7A 1ASEA 1M6SA 2HUIA 1X0MA 1D2FA 2CJHA 3BC8A 3ZRQA 1JS3A 2YKYA 2PO3A 3NYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZ2 A;  1AMR A;  2BIA A;  2DGK A;  1G7X A;  2BYL A;  2D66 A;  3MC6 A;  3HL2 A;  4GRX A;  4RLG A;  1AHF A;  2EH6 A;  2XBN A;  1GC3 A;  3E2F A;  4U2H A;  1VEF A;  5F9S A;  1KKJ A;  3HLM A;  3GBX A;  4F5F A;  3EI8 A;  3RBL A;  2VMX A;  1CL2 A;  4IY7 A;  1DJU A;  2AY3 A;  2WKA A;  5FT8 A;  4A6R A;  2YRI A;  3W1I A;  3NU7 A;  2CJD A;  4J8L A;  5LHA A;  2JG2 A;  3VOM A;  2VIA A;  4AO9 A;  1S06 A;  4JE5 A;  3FVS A;  4RIZ A;  1RVY A;  4MGR A;  2R2N A;  3KGX A;  2BIG A;  2X5D A;  2VLH A;  1B9H A;  2ZJG A;  3JW9 A;  4H51 A;  1M0N A;  3KKI A;  1OHY A;  3ATH A;  4BA4 A;  4J5U A;  3PA9 A;  4AO4 A;  3EIB A;  4MKK A;  2JJF A;  4K2I A;  3UAK A;  1ASM A;  3R9A A;  3A9Y A;  3WGB A;  4OTL A;  3NYU A;  1W23 A;  1IUG A;  2O1B A;  3FFR A;  1D7U A;  3ISL A;  4ATQ A;  3B8X A;  3G7Q A;  4OC9 A;  2W8U A;  1DJ9 A;  1TAT A;  2F8J A;  2Z20 A;  2VGZ A;  3LVL B;  3AEN B;  2OKJ A;  3MKJ A;  4JEY A;  3WLX A;  2X5F A;  3P6K A;  2OGA A;  4IXZ A;  4P3M A;  4WXF A;  3MAU A;  2R5C A;  3RI6 A;  2BI9 A;  3P1T A;  1AIC A;  3B1D A;  5M4D A;  2EO5 A;  4ZM4 A;  1W7N A;  1AAM A;  3N5M A;  3FSL A;  1S07 A;  2AY1 A;  4JF1 A;  1MLZ A;  1IX6 A;  3I4J A;  1AMA A;  3CQ4 A;  5E5I A;  2CB1 A;  5EQC A;  1MDZ A;  3K7Y A;  3JU7 A;  4EU1 A;  1BQD A;  1GC2 A;  1SZU A;  1N2T A;  3PGY A;  4R8D A;  2PB0 A;  1AY8 A;  3DR4 A;  2WK7 A;  2ZUK A;  1YIZ A;  1H1C A;  1KL2 A;  2C44 A;  5DJ1 A;  3ACZ A;  1ASL A;  4PFF A;  2GQN A;  1C4K A;  3GR9 A;  1LC8 A;  1AHE A;  2D7Y A;  3UE8 A;  3EI5 A;  4MKJ A;  1X2A A;  2G6W A;  1ASG A;  5JAY A;  2W7E A;  4XJM A;  1AJR A;  1OHW A;  2CTZ A;  2ZYJ A;  3FQ8 A;  1VJO A;  1ZOB A;  1YAA A;  3W1J A;  3LY1 A;  4XQ2 A;  1DKA A;  4Y0D A;  4R5Z A;  4XJL A;  1U08 A;  1ASA A;  2JGT A;  2CIN A;  2Z9V A;  3QGU A;  4EMY A;  2W7I A;  4ADC A;  1TOJ A;  3BV0 A;  3RQ1 A;  4ZAS A;  1QZ9 A;  1M32 A;  3AOW A;  4F5K A;  1IJI A;  4A0F A;  1CQ6 A;  2YCP A;  5G2P A;  3PJ0 A;  2AEU A;  3HDO A;  3NDN A;  2HOZ A;  5G4I A;  1AKA A;  2D64 A;  2VLF A;  1GEX A;  1Y4I A;  1BS0 A;  3A9Z A;  5G4J A;  2VMW A;  4WYA A;  5TF5 A;  1O4S A;  3E6G A;  3N0L A;  2FM1 A;  4Q75 A;  3PDB B;  5FT5 A;  1TPL A;  1YJY A;  4OYT A;  3E9K A;  4IX8 A;  3K28 A;  4Q6R A;  1UKJ A;  2CH1 A;  4U1T A;  3HQT A;  4WYG A;  1SF2 A;  2AY2 A;  2HOR A;  3MBB A;  1LC5 A;  3F9T A;  4GE7 A;  2EGY A;  3DOD A;  4RJY A;  4GEB A;  4MQP A;  5IWQ A;  1AHG A;  1CS1 A;  1O69 A;  4UHO A;  3DXW A;  4ISY A;  2YCT A;  5HHY A;  3W1H A;  3VK4 A;  1BQA A;  3WCN A;  1DFO A;  5M46 A;  2YRR A;  4N0W A;  3GZD C;  2TPL A;  2WK8 A;  2W7M A;  4WLH A;  3FRK A;  2OQX A;  2GB3 A;  3HT4 A;  1AMS A;  1BJN A;  3NU8 A;  1FC4 A;  1ORD A;  1C9C A;  4JEX A;  3MAF A;  4PVF A;  4Y0H A;  3NYS A;  4RAE A;  4XJO A;  1VP4 A;  1BW0 A;  1KKP A;  2QLR A;  4F4E A;  2VMZ A;  4EB5 A;  3LG0 A;  2BWO A;  3GWP A;  3PIU A;  4WXB A;  8AAT A;  1TOK A;  1YJZ A;  2BWP A;  2D7Z A;  3ELE A;  2E54 A;  3JWA A;  1FG3 A;  4LNM A;  1ASD A;  4QGR A;  4A6T A;  1WYV A;  2VMV A;  2XH1 A;  2W8W A;  3FTB A;  3FKD A;  4ZSY A;  1BJW A;  4GE9 A;  1BJ4 A;  1X28 A;  3VK3 A;  3WKS A;  4LNJ A;  1V2D A;  3M5U A;  1AY5 A;  1CZE A;  1E5E A;  2HOX A;  4ITX A;  4RM1 A;  2FYF A;  5DJ9 A;  3NUB A;  4GE4 A;  4WB0 B;  3WZF A;  2BKW A;  1AX4 A;  2ZSM A;  2Z1Y A;  4RKD A;  1GEY A;  2FNI A;  2YKV A;  2D65 A;  1CZC A;  2D63 A;  1SVV A;  3I5T A;  3II0 A;  3DRD A;  1B9I A;  1C7G A;  1QIR A;  4JEV A;  2D61 A;  5EFS A;  4NOG A;  1QJ5 A;  3N75 A;  1ART A;  2X8U A;  1GCK A;  1S09 A;  4XAU A;  1OXO A;  4DBC A;  2DOU A;  1J32 A;  3QN6 A;  3RCH B;  2ZC0 A;  3QHX A;  4KYO A;  4CBS A;  1Z3Z A;  2HUF A;  1W3U A;  1EQB A;  3WKR A;  1SZS A;  3PDX A;  1Z7D A;  2O7C A;  3RCH A;  4F5H A;  2X3L A;  4LNL A;  4ZSW A;  3COG A;  1W7M A;  4HF8 A;  2R5E A;  4WD2 A;  1MAP A;  3EUC A;  3HMU A;  1WYT A;  2VYC A;  1B4X A;  5FT4 A;  4F5I A;  1GDE A;  1M7Y A;  3AEN A;  2VI9 A;  4R5F A;  2AY9 A;  2Q7W A;  3QM2 A;  4A6U A;  1QJ3 A;  3LWS A;  4P7Y A;  2HP2 A;  3BWO A;  3LVM A;  1ARS A;  1DJE A;  3BS8 A;  2ZY3 A;  2VMU A;  4LW4 A;  2D5Y A;  1GEW A;  3BN1 A;  3H14 A;  4K2B A;  2VMS A;  2BI3 A;  2QBT A;  3JWB A;  4MY5 A;  3I16 A;  5DB5 A;  1S0A A;  2VGU A;  3ASB A;  5E4Z A;  2BI1 A;  1YJS A;  1N31 A;  1ZC9 A;  2AY5 A;  2BI5 A;  3DXV A;  4ZDP A;  9AAT A;  2CY8 A;  2VGS A;  2VIB A;  3TAT A;  1UU2 A;  1C7N A;  1GBN A;  4OBV A;  3EZS A;  3FDD A;  4LW2 A;  4PFN A;  5E3K A;  4A0H A;  4DGT A;  4Q31 A;  4WYF A;  3PD6 B;  1QGN A;  2VI8 A;  2AY8 A;  5M49 A;  3FZ7 A;  3EI7 A;  3ELP A;  5BJ4 A;  3CBF A;  2W7J A;  3ZZK A;  1AIB A;  4HVK A;  1O61 A;  2HZP A;  2Z9U A;  5LH9 A;  3AEL A;  4WLJ A;  1D7S A;  2VMP A;  1H0C A;  4DQ6 A;  3D6K A;  2V1P A;  1SFF A;  2YOB A;  2GSA A;  4BQ0 A;  2DGL A;  4RIT A;  2JJH A;  4W5K A;  4F5M A;  7AAT A;  1AKB A;  4WBT A;  1TAR A;  2QMA A;  2W7L A;  4W1W A;  2OKK A;  2E7J A;  4RJ0 A;  1TOI A;  3MC6 C;  3CQ5 A;  1BKG A;  1PMM A;  2DGM A;  2VGT A;  3E77 A;  4JEZ A;  1BJO B;  1TOE A;  2VGV A;  3E2Z B;  3G8M A;  4OCA A;  2W7K A;  4A0R A;  1YIY A;  3FQA A;  4ZM3 A;  3BCX A;  1I29 A;  2GMS A;  4BHD A;  1EJI A;  4WYE A;  3EI6 A;  4W8I A;  3AEJ C;  2FN6 A;  3BWN C;  2BI2 A;  3NRA A;  3H7F A;  4F5J A;  4ZAH A;  2AY6 A;  3ZRP A;  1UU0 A;  5FT6 A;  4WP0 A;  3AEP A;  2ZY2 A;  2FNU A;  1E5F A;  3CQ6 A;  3A9X A;  1M0Q A;  1B5O A;  1PG8 A;  1CL1 A;  3B1C A;  3LVJ A;  1T3I A;  3LVK A;  3PAA A;  3CAI A;  1MGV A;  2HOY A;  4IYO B;  4R2N A;  1WYU B;  4W1V A;  5DX5 A;  5EUN A;  2JJE A;  2DKB A;  3VP6 A;  4IXO A;  1ARI A;  3ZRR A;  5J8Q A;  1AMQ A;  2YCN A;  4KXK A;  3VAX A;  4GDY A;  2BIE A;  3AEJ A;  1ELQ A;  3WGC A;  1WYU A;  4PIW A;  3DZZ A;  4FL0 A;  3FVX A;  1GC0 A;  3ASA A;  1UU1 A;  1AJS B;  1OAT A;  3MEB A;  1I41 A;  5I92 A;  3AAT A;  3GSB A;  1B5P A;  2C81 A;  3WX9 A;  4Q76 A;  1KMJ A;  1IBJ A;  5EIG B;  4GSA A;  4AH3 A;  2JIS A;  3GJU A;  3A2B A;  4MQR A;  3TFT A;  4A0G A;  1WYV B;  1B8G A;  1MLY A;  2V0Y A;  1ELU A;  1BJO A;  2AAT A;  2FQ6 A;  4IXS A;  5M4B A;  4UHN A;  4BA5 A;  3GZD A;  5C6U A;  2Z61 A;  3JTX A;  2ZSL A;  3PPL A;  3EI9 A;  1ASB A;  2W7H A;  3BCB A;  4F5L A;  3F6T A;  4KAM A;  2CAN A;  2Z9W A;  1WYT B;  3BB8 A;  4TV7 A;  1P3W A;  1D7V A;  1KMK A;  1YNU A;  2YHK A;  3OKS A;  1TOG A;  4F5G A;  3NTJ A;  2W7D A;  2WK9 A;  4UHM A;  2W7G A;  3WY7 A;  3JZL A;  3FCR A;  4ADB A;  4ADE A;  1O62 A;  3FD0 A;  3NNK A;  4LC3 A;  4EFF A;  4MSO A;  3R4T A;  1AJS A;  2BWN A;  1MDO A;  4TMR A;  1S08 A;  3DYD A;  4OT8 A;  1OXP A;  3GET A;  3IHJ A;  1LW5 A;  1RV4 A;  5EAA A;  5AX8 A;  3USF A;  1CQ8 A;  1AY4 A;  3T32 A;  4W1X A;  1G7W A;  2E7I A;  3L44 A;  4WYD A;  1G4X A;  2EZ1 A;  1FG7 A;  4WYC A;  1AKC A;  3NUI A;  4ATP A;  4IYO A;  3LV2 A;  4XK1 A;  2AY4 A;  3PDB A;  4CXR A;  2JJG A;  2OGE A;  1V2E A;  2AEV A;  4ZLV A;  4AOA A;  4WB0 A;  4CBR A;  4E3R A;  1X29 A;  4O6Z A;  4TN4 A;  2ZY5 A;  2W8T A;  3AEM A;  5EUE A;  5HDM A;  1MDX A;  3BWN A;  2HUU A;  4UOY A;  4ZWM A;  3L8A A;  3AEM C;  3ZZJ A;  1TAS A;  3TFU A;  1WKH A;  1EG5 A;  1LC7 A;  2Z9X A;  2DR1 A;  4I8A A;  1JF9 A;  2YKU A;  5G0A A;  1JS6 A;  1XEY A;  2E7U A;  2W8J A;  3OP7 A;  2Z67 A;  3FZ6 A;  4ZDL A;  3ECD A;  3TQX A;  4A72 A;  4B9B A;  2YKX A;  2CJG A;  1D7R A;  4A00 A;  3IF2 A;  2VMR A;  1WST A;  2CFB A;  2O0R A;  1OHV A;  3PD6 A;  3FFH A;  3FDB A;  3MAF B;  4FFC A;  4OBU A;  4BMK A;  3G0T A;  2CH2 A;  4M2K A;  5HXX A;  4EB7 A;  1V2F A;  2EPJ A;  2Z1Z A;  3K40 A;  3QI6 A;  3B46 A;  3E2Y A;  4M2J A;  2NMP A;  3WCO A;  4AZK A;  1LS3 A;  3F0H A;  2VMO A;  1WKG A;  4M2M A;  1IX7 A;  2R0T A;  1ZOD A;  1ASF A;  2ZP7 A;  4MQQ A;  2QB2 A;  1AHX A;  5D95 A;  1ASN A;  4B98 A;  3B1E A;  3HBX A;  1V72 A;  5G09 A;  4ADD A;  2C0R A;  3Q8N A;  4RKC A;  1ARG A;  3MAD A;  2OAT A;  1LKC A;  1SZK A;  3QPG A;  2BHX A;  4E3Q A;  3TCM A;  1DGD A;  1AAW A;  2W7F A;  1N8P A;  1IX8 A;  4N0B A;  2DKJ A;  3AV7 A;  5G2Q A;  3AOV A;  1C7O A;  4W91 A;  2QB3 A;  3RBF A;  2RFV A;  4ZWV A;  3AEO A;  4XJP A;  2PB2 A;  3UWC A;  3FZ8 A;  3EZ1 A;  1QIT A;  1IAX A;  1AIA A;  1BT4 A;  1DTY A;  1JG8 A;  2VGW A;  4K2M A;  4UQV A;  4WXG A;  5EIG A;  1C0N A;  1LW4 A;  4L0O A;  2GMU A;  3QBO A;  2BYJ A;  4E1O A;  4JE5 D;  3DU4 A;  5EAV A;  1GC4 A;  1PMO A;  3A8U X;  1M0O A;  1IVR A;  4ZDO A;  1QIS A;  1SPA A;  2VMT A;  1DGE A;  2C7T A;  5K8B A;  1M0P A;  1CJ0 A;  2R5C B;  2W8V A;  2AY7 A;  1XI9 A;  1MAQ A;  3HVY A;  1W7L A;  3FVU A;  2ORD A;  3NX3 A;  4XEW A;  4ITG A;  1AHY A;  4OMA A;  1M4N A;  3DC1 A;  3FQ7 A;  1I43 A;  1G4V A;  1YOO A;  1LK9 A;  5EUD A;  4JF0 A;  1I48 A;  1ECX A;  3KE3 A;  4CXQ A;  4IW7 A;  1PFF A;  1ARH A;  5F8V A;  4AZJ A;  1RV3 A;  1J04 A;  1GD9 A;  1RVU A;  3VK2 A;  4E77 A;  3E2Z A;  3BCA A;  2HP1 A;  2VMQ A;  2VMN A;  5BJ3 A;  3DR7 A;  2ZY4 A;  1KL1 A;  3GZC A;  1IAY A;  1ASC A;  3KGW A;  4CVQ A;  2CST A;  3RUY A;  4Y0I A;  2QA3 A;  4JEW A;  3EIA A;  5D5S A;  2VMY A;  1CQ7 A;  1ASE A;  1M6S A;  2HUI A;  1X0M A;  1D2F A;  2CJH A;  3BC8 A;  3ZRQ A;  1JS3 A;  2YKY A;  2PO3 A;  3NYT A; 
#chains in the Genus database with same CATH topology
 2EZ2 A;  1AMR A;  2BIA A;  2DGK A;  1G7X A;  2BYL A;  2D66 A;  3MC6 A;  3HL2 A;  4GRX A;  4RLG A;  1AHF A;  2EH6 A;  2XBN A;  1GC3 A;  3E2F A;  4U2H A;  1VEF A;  5F9S A;  1KKJ A;  3HLM A;  3GBX A;  4F5F A;  3EI8 A;  3RBL A;  2VMX A;  1CL2 A;  4IY7 A;  1DJU A;  2AY3 A;  2WKA A;  5FT8 A;  4A6R A;  2YRI A;  3W1I A;  3NU7 A;  2CJD A;  4J8L A;  5LHA A;  2JG2 A;  3VOM A;  2VIA A;  4AO9 A;  1S06 A;  4JE5 A;  3FVS A;  4RIZ A;  1RVY A;  4MGR A;  2R2N A;  3KGX A;  2BIG A;  2X5D A;  2VLH A;  1B9H A;  2ZJG A;  3JW9 A;  4H51 A;  1M0N A;  3KKI A;  1OHY A;  3ATH A;  4BA4 A;  4J5U A;  3PA9 A;  4AO4 A;  3EIB A;  4MKK A;  2JJF A;  4K2I A;  3UAK A;  1ASM A;  3R9A A;  3A9Y A;  3WGB A;  4OTL A;  3NYU A;  1W23 A;  1IUG A;  2O1B A;  3FFR A;  1D7U A;  3ISL A;  4ATQ A;  3B8X A;  3G7Q A;  4OC9 A;  2W8U A;  1DJ9 A;  1TAT A;  2F8J A;  2Z20 A;  2VGZ A;  3LVL B;  3AEN B;  2OKJ A;  3MKJ A;  4JEY A;  3WLX A;  2X5F A;  3P6K A;  2OGA A;  4IXZ A;  4P3M A;  4WXF A;  3MAU A;  2R5C A;  3RI6 A;  2BI9 A;  3P1T A;  1AIC A;  3B1D A;  5M4D A;  2EO5 A;  4ZM4 A;  1W7N A;  1AAM A;  3N5M A;  3FSL A;  1S07 A;  2AY1 A;  4JF1 A;  1MLZ A;  1IX6 A;  3I4J A;  1AMA A;  3CQ4 A;  5E5I A;  2CB1 A;  5EQC A;  1MDZ A;  3K7Y A;  3JU7 A;  4EU1 A;  1BQD A;  1GC2 A;  1SZU A;  1N2T A;  3PGY A;  4R8D A;  2PB0 A;  3N7N A;  1AY8 A;  3DR4 A;  2WK7 A;  2ZUK A;  1YIZ A;  1H1C A;  1KL2 A;  2C44 A;  5DJ1 A;  3ACZ A;  1ASL A;  4PFF A;  2GQN A;  1C4K A;  3GR9 A;  1LC8 A;  1AHE A;  2D7Y A;  3UE8 A;  3EI5 A;  4MKJ A;  1X2A A;  2G6W A;  1ASG A;  5JAY A;  2W7E A;  4XJM A;  1AJR A;  1OHW A;  2CTZ A;  2ZYJ A;  3FQ8 A;  1VJO A;  1ZOB A;  1YAA A;  3W1J A;  3LY1 A;  4XQ2 A;  1DKA A;  4Y0D A;  4R5Z A;  4XJL A;  1U08 A;  1ASA A;  2JGT A;  2CIN A;  2Z9V A;  3QGU A;  4EMY A;  2W7I A;  4ADC A;  1TOJ A;  3BV0 A;  3RQ1 A;  4ZAS A;  1QZ9 A;  1M32 A;  3AOW A;  4F5K A;  1IJI A;  4A0F A;  1CQ6 A;  2YCP A;  5G2P A;  3PJ0 A;  2AEU A;  3HDO A;  3NDN A;  2HOZ A;  5G4I A;  1AKA A;  2D64 A;  2VLF A;  1GEX A;  1Y4I A;  1BS0 A;  3A9Z A;  5G4J A;  2VMW A;  4WYA A;  5TF5 A;  1O4S A;  3E6G A;  3N0L A;  2FM1 A;  4Q75 A;  3PDB B;  5FT5 A;  1TPL A;  1YJY A;  4OYT A;  3E9K A;  4IX8 A;  3K28 A;  4Q6R A;  1UKJ A;  2CH1 A;  4U1T A;  3HQT A;  4WYG A;  1SF2 A;  2AY2 A;  2HOR A;  3MBB A;  1LC5 A;  3F9T A;  4GE7 A;  2EGY A;  3DOD A;  4RJY A;  4GEB A;  4MQP A;  5IWQ A;  1AHG A;  1CS1 A;  1O69 A;  4UHO A;  3DXW A;  4ISY A;  2YCT A;  5HHY A;  3W1H A;  3N4X A;  3VK4 A;  1BQA A;  3WCN A;  1DFO A;  5M46 A;  2YRR A;  4N0W A;  3GZD C;  2TPL A;  2WK8 A;  2W7M A;  4WLH A;  3FRK A;  2OQX A;  2GB3 A;  3HT4 A;  1AMS A;  1BJN A;  3NU8 A;  1FC4 A;  1ORD A;  1C9C A;  4JEX A;  3MAF A;  4PVF A;  4Y0H A;  3NYS A;  4RAE A;  4XJO A;  1VP4 A;  1BW0 A;  1KKP A;  2QLR A;  4F4E A;  2VMZ A;  4EB5 A;  2FKI A;  3LG0 A;  2BWO A;  3GWP A;  3PIU A;  4WXB A;  8AAT A;  1TOK A;  1YJZ A;  2BWP A;  2D7Z A;  3ELE A;  2E54 A;  3JWA A;  1FG3 A;  4LNM A;  1ASD A;  4QGR A;  4A6T A;  1WYV A;  2VMV A;  2XH1 A;  2W8W A;  3FTB A;  3FKD A;  4ZSY A;  1BJW A;  4GE9 A;  1BJ4 A;  1X28 A;  3VK3 A;  3WKS A;  4LNJ A;  1V2D A;  3M5U A;  1AY5 A;  1CZE A;  1E5E A;  2HOX A;  4ITX A;  4RM1 A;  2FYF A;  5DJ9 A;  3NUB A;  4GE4 A;  4WB0 B;  3WZF A;  2BKW A;  1AX4 A;  2ZSM A;  2Z1Y A;  4RKD A;  1GEY A;  2FNI A;  2YKV A;  2D65 A;  1CZC A;  2D63 A;  1SVV A;  3I5T A;  3II0 A;  3DRD A;  1B9I A;  1C7G A;  1QIR A;  4JEV A;  2D61 A;  5EFS A;  4NOG A;  1QJ5 A;  3N75 A;  1ART A;  2X8U A;  1GCK A;  1S09 A;  4XAU A;  1OXO A;  4DBC A;  2DOU A;  1J32 A;  3QN6 A;  3RCH B;  5KTB A;  2ZC0 A;  3QHX A;  4KYO A;  4CBS A;  1Z3Z A;  2HUF A;  1W3U A;  1EQB A;  3WKR A;  1SZS A;  3PDX A;  1Z7D A;  2O7C A;  3RCH A;  4F5H A;  2X3L A;  4LNL A;  4ZSW A;  3COG A;  1W7M A;  4HF8 A;  2R5E A;  4WD2 A;  1MAP A;  3EUC A;  3HMU A;  1WYT A;  2VYC A;  1B4X A;  5FT4 A;  4F5I A;  1GDE A;  1M7Y A;  3AEN A;  2VI9 A;  4R5F A;  2AY9 A;  2Q7W A;  3QM2 A;  4A6U A;  1QJ3 A;  3LWS A;  4P7Y A;  2HP2 A;  3BWO A;  3LVM A;  1ARS A;  1DJE A;  3BS8 A;  2ZY3 A;  4K05 A;  2VMU A;  4LW4 A;  2D5Y A;  1GEW A;  3BN1 A;  3H14 A;  4K2B A;  2VMS A;  2BI3 A;  2QBT A;  3JWB A;  4MY5 A;  3I16 A;  5DB5 A;  1S0A A;  2VGU A;  3ASB A;  5E4Z A;  2BI1 A;  1YJS A;  1N31 A;  1ZC9 A;  2AY5 A;  2BI5 A;  3DXV A;  4ZDP A;  9AAT A;  2CY8 A;  2VGS A;  2VIB A;  3TAT A;  1UU2 A;  1C7N A;  1GBN A;  4OBV A;  3EZS A;  3FDD A;  4LW2 A;  4PFN A;  5E3K A;  4A0H A;  4DGT A;  4Q31 A;  4WYF A;  3PD6 B;  1QGN A;  2VI8 A;  2AY8 A;  5M49 A;  3FZ7 A;  3EI7 A;  3ELP A;  5BJ4 A;  3CBF A;  2W7J A;  3ZZK A;  1AIB A;  4HVK A;  1O61 A;  2HZP A;  2Z9U A;  5LH9 A;  3AEL A;  4WLJ A;  1D7S A;  2VMP A;  1H0C A;  4DQ6 A;  3D6K A;  2V1P A;  1SFF A;  2YOB A;  2GSA A;  2EYQ A;  4BQ0 A;  2DGL A;  4RIT A;  2JJH A;  4W5K A;  4F5M A;  7AAT A;  1AKB A;  4WBT A;  1TAR A;  2QMA A;  2W7L A;  4W1W A;  2OKK A;  2E7J A;  4RJ0 A;  1TOI A;  3MC6 C;  3CQ5 A;  1BKG A;  1PMM A;  2DGM A;  2VGT A;  3E77 A;  4JEZ A;  1BJO B;  1TOE A;  2VGV A;  3E2Z B;  3G8M A;  4OCA A;  2W7K A;  4A0R A;  1YIY A;  3FQA A;  4ZM3 A;  3BCX A;  1I29 A;  2GMS A;  4BHD A;  1EJI A;  4WYE A;  3EI6 A;  4W8I A;  3AEJ C;  2FN6 A;  3BWN C;  2BI2 A;  3H9X A;  3NRA A;  3H7F A;  4F5J A;  4ZAH A;  2AY6 A;  3ZRP A;  1UU0 A;  5FT6 A;  4WP0 A;  3AEP A;  2ZY2 A;  2FNU A;  1E5F A;  3CQ6 A;  3A9X A;  1M0Q A;  1B5O A;  1PG8 A;  1CL1 A;  3B1C A;  3LVJ A;  1T3I A;  3LVK A;  3PAA A;  3CAI A;  1MGV A;  2HOY A;  4IYO B;  4R2N A;  1WYU B;  4W1V A;  5DX5 A;  5EUN A;  2JJE A;  2DKB A;  3VP6 A;  4IXO A;  1ARI A;  3ZRR A;  5J8Q A;  1AMQ A;  2YCN A;  4KXK A;  3VAX A;  4GDY A;  2BIE A;  3AEJ A;  1ELQ A;  3WGC A;  1WYU A;  4PIW A;  3DZZ A;  4FL0 A;  3FVX A;  1GC0 A;  3ASA A;  1UU1 A;  1AJS B;  1OAT A;  3MEB A;  2G7J A;  1I41 A;  5I92 A;  3AAT A;  3GSB A;  1B5P A;  2C81 A;  3WX9 A;  4Q76 A;  1KMJ A;  1IBJ A;  5EIG B;  4GSA A;  4AH3 A;  2QSR A;  2JIS A;  3GJU A;  3A2B A;  4MQR A;  3TFT A;  4A0G A;  1WYV B;  1B8G A;  1MLY A;  2V0Y A;  1ELU A;  1BJO A;  2AAT A;  2FQ6 A;  4IXS A;  5M4B A;  4UHN A;  4BA5 A;  3GZD A;  5C6U A;  2Z61 A;  3JTX A;  2ZSL A;  3PPL A;  3EI9 A;  1ASB A;  2W7H A;  3BCB A;  4F5L A;  3F6T A;  4KAM A;  2CAN A;  2Z9W A;  1WYT B;  3BB8 A;  4TV7 A;  1P3W A;  3N4S A;  1D7V A;  1KMK A;  1YNU A;  2YHK A;  3OKS A;  1TOG A;  4F5G A;  3NTJ A;  2W7D A;  2WK9 A;  4UHM A;  2W7G A;  3WY7 A;  3JZL A;  3FCR A;  4ADB A;  4ADE A;  1O62 A;  3FD0 A;  3NNK A;  4LC3 A;  4EFF A;  4MSO A;  3R4T A;  1AJS A;  2BWN A;  1MDO A;  4TMR A;  1S08 A;  3DYD A;  4OT8 A;  1OXP A;  3GET A;  3IHJ A;  1LW5 A;  1RV4 A;  5EAA A;  5AX8 A;  3USF A;  1CQ8 A;  1AY4 A;  3T32 A;  4W1X A;  1G7W A;  2E7I A;  3L44 A;  4WYD A;  1G4X A;  2EZ1 A;  1FG7 A;  4WYC A;  1AKC A;  3NUI A;  4ATP A;  4IYO A;  3LV2 A;  4XK1 A;  2AY4 A;  3PDB A;  4CXR A;  2JJG A;  2OGE A;  1V2E A;  2AEV A;  4ZLV A;  4AOA A;  4WB0 A;  4CBR A;  4E3R A;  1X29 A;  4O6Z A;  4TN4 A;  2ZY5 A;  2W8T A;  3AEM A;  5EUE A;  5HDM A;  1MDX A;  3BWN A;  2HUU A;  4UOY A;  4ZWM A;  3L8A A;  3AEM C;  3ZZJ A;  1TAS A;  3TFU A;  1WKH A;  1EG5 A;  1LC7 A;  2Z9X A;  2DR1 A;  4I8A A;  1JF9 A;  2YKU A;  5G0A A;  1JS6 A;  1KAF A;  1XEY A;  2E7U A;  2W8J A;  3OP7 A;  2KFP A;  2Z67 A;  3FZ6 A;  4ZDL A;  4H63 Q;  3ECD A;  3TQX A;  4A72 A;  4B9B A;  2YKX A;  2CJG A;  1D7R A;  4A00 A;  3IF2 A;  2VMR A;  1WST A;  2CFB A;  2O0R A;  1OHV A;  3PD6 A;  3FFH A;  3FDB A;  3MAF B;  4FFC A;  4OBU A;  4BMK A;  3G0T A;  2CH2 A;  4M2K A;  5HXX A;  4EB7 A;  1V2F A;  2EPJ A;  2Z1Z A;  3K40 A;  3QI6 A;  3B46 A;  3E2Y A;  4M2J A;  2NMP A;  3WCO A;  4AZK A;  1LS3 A;  3F0H A;  2WB6 A;  2VMO A;  1WKG A;  4M2M A;  1IX7 A;  2R0T A;  1ZOD A;  1ASF A;  2ZP7 A;  4MQQ A;  2QB2 A;  1AHX A;  5D95 A;  1ASN A;  4B98 A;  3B1E A;  3HBX A;  1V72 A;  5G09 A;  4ADD A;  2C0R A;  3Q8N A;  4RKC A;  1ARG A;  3MAD A;  2OAT A;  1LKC A;  2A1V A;  1SZK A;  3QPG A;  2BHX A;  4E3Q A;  3TCM A;  1DGD A;  1AAW A;  2W7F A;  1N8P A;  1IX8 A;  4N0B A;  2DKJ A;  3AV7 A;  5G2Q A;  3AOV A;  1C7O A;  4W91 A;  2QB3 A;  3RBF A;  2RFV A;  4ZWV A;  3AEO A;  4XJP A;  2PB2 A;  3UWC A;  3FZ8 A;  3EZ1 A;  1QIT A;  1IAX A;  1AIA A;  1BT4 A;  1DTY A;  1JG8 A;  2VGW A;  4K2M A;  4UQV A;  4WXG A;  5EIG A;  1C0N A;  1LW4 A;  4L0O A;  2GMU A;  3QBO A;  2BYJ A;  4E1O A;  4JE5 D;  3DU4 A;  5EAV A;  1GC4 A;  1PMO A;  3A8U X;  1M0O A;  1IVR A;  4ZDO A;  1QIS A;  1SPA A;  2VMT A;  1DGE A;  2C7T A;  5K8B A;  1M0P A;  1CJ0 A;  2R5C B;  2W8V A;  2AY7 A;  1XI9 A;  1MAQ A;  3HVY A;  1W7L A;  3FVU A;  2ORD A;  3NX3 A;  4XEW A;  4ITG A;  1AHY A;  4OMA A;  1M4N A;  3DC1 A;  3FQ7 A;  1I43 A;  1G4V A;  1YOO A;  1LK9 A;  5EUD A;  4JF0 A;  1I48 A;  1ECX A;  3KE3 A;  3N4R A;  4CXQ A;  4IW7 A;  1PFF A;  1ARH A;  5F8V A;  4AZJ A;  1RV3 A;  1J04 A;  1GD9 A;  1RVU A;  3VK2 A;  4E77 A;  3E2Z A;  3BCA A;  2HP1 A;  2VMQ A;  2VMN A;  5BJ3 A;  3DR7 A;  2ZY4 A;  1KL1 A;  3GZC A;  1IAY A;  1ASC A;  3KGW A;  4CVQ A;  2CST A;  3RUY A;  4Y0I A;  2QA3 A;  4JEW A;  3EIA A;  5D5S A;  2VMY A;  1CQ7 A;  1ASE A;  1M6S A;  2HUI A;  1X0M A;  1D2F A;  2CJH A;  3BC8 A;  3ZRQ A;  1JS3 A;  2YKY A;  2PO3 A;  3NYT A; 
#chains in the Genus database with same CATH homology
 2EZ2 A;  1AMR A;  2BIA A;  2DGK A;  1G7X A;  2BYL A;  2D66 A;  3MC6 A;  3HL2 A;  4GRX A;  4RLG A;  1AHF A;  2EH6 A;  2XBN A;  1GC3 A;  3E2F A;  4U2H A;  1VEF A;  5F9S A;  1KKJ A;  3HLM A;  3GBX A;  4F5F A;  3EI8 A;  3RBL A;  2VMX A;  1CL2 A;  4IY7 A;  1DJU A;  2AY3 A;  2WKA A;  5FT8 A;  4A6R A;  2YRI A;  3W1I A;  3NU7 A;  2CJD A;  4J8L A;  5LHA A;  2JG2 A;  3VOM A;  2VIA A;  4AO9 A;  1S06 A;  4JE5 A;  3FVS A;  4RIZ A;  1RVY A;  4MGR A;  2R2N A;  3KGX A;  2BIG A;  2X5D A;  2VLH A;  1B9H A;  2ZJG A;  3JW9 A;  4H51 A;  1M0N A;  3KKI A;  1OHY A;  3ATH A;  4BA4 A;  4J5U A;  3PA9 A;  4AO4 A;  3EIB A;  4MKK A;  2JJF A;  4K2I A;  3UAK A;  1ASM A;  3R9A A;  3A9Y A;  3WGB A;  4OTL A;  3NYU A;  1W23 A;  1IUG A;  2O1B A;  3FFR A;  1D7U A;  3ISL A;  4ATQ A;  3B8X A;  3G7Q A;  4OC9 A;  2W8U A;  1DJ9 A;  1TAT A;  2F8J A;  2Z20 A;  2VGZ A;  3LVL B;  3AEN B;  2OKJ A;  3MKJ A;  4JEY A;  3WLX A;  2X5F A;  3P6K A;  2OGA A;  4IXZ A;  4P3M A;  4WXF A;  3MAU A;  2R5C A;  3RI6 A;  2BI9 A;  3P1T A;  1AIC A;  3B1D A;  5M4D A;  2EO5 A;  4ZM4 A;  1W7N A;  1AAM A;  3N5M A;  3FSL A;  1S07 A;  2AY1 A;  4JF1 A;  1MLZ A;  1IX6 A;  3I4J A;  1AMA A;  3CQ4 A;  5E5I A;  2CB1 A;  5EQC A;  1MDZ A;  3K7Y A;  3JU7 A;  4EU1 A;  1BQD A;  1GC2 A;  1SZU A;  1N2T A;  3PGY A;  4R8D A;  2PB0 A;  3N7N A;  1AY8 A;  3DR4 A;  2WK7 A;  2ZUK A;  1YIZ A;  1H1C A;  1KL2 A;  2C44 A;  5DJ1 A;  3ACZ A;  1ASL A;  4PFF A;  2GQN A;  1C4K A;  3GR9 A;  1LC8 A;  1AHE A;  2D7Y A;  3UE8 A;  3EI5 A;  4MKJ A;  1X2A A;  2G6W A;  1ASG A;  5JAY A;  2W7E A;  4XJM A;  1AJR A;  1OHW A;  2CTZ A;  2ZYJ A;  3FQ8 A;  1VJO A;  1ZOB A;  1YAA A;  3W1J A;  3LY1 A;  4XQ2 A;  1DKA A;  4Y0D A;  4R5Z A;  4XJL A;  1U08 A;  1ASA A;  2JGT A;  2CIN A;  2Z9V A;  3QGU A;  4EMY A;  2W7I A;  4ADC A;  1TOJ A;  3BV0 A;  3RQ1 A;  4ZAS A;  1QZ9 A;  1M32 A;  3AOW A;  4F5K A;  1IJI A;  4A0F A;  1CQ6 A;  2YCP A;  5G2P A;  3PJ0 A;  2AEU A;  3HDO A;  3NDN A;  2HOZ A;  5G4I A;  1AKA A;  2D64 A;  2VLF A;  1GEX A;  1Y4I A;  1BS0 A;  3A9Z A;  5G4J A;  2VMW A;  4WYA A;  5TF5 A;  1O4S A;  3E6G A;  3N0L A;  2FM1 A;  4Q75 A;  3PDB B;  5FT5 A;  1TPL A;  1YJY A;  4OYT A;  3E9K A;  4IX8 A;  3K28 A;  4Q6R A;  1UKJ A;  2CH1 A;  4U1T A;  3HQT A;  4WYG A;  1SF2 A;  2AY2 A;  2HOR A;  3MBB A;  1LC5 A;  3F9T A;  4GE7 A;  2EGY A;  3DOD A;  4RJY A;  4GEB A;  4MQP A;  5IWQ A;  1AHG A;  1CS1 A;  1O69 A;  4UHO A;  3DXW A;  4ISY A;  2YCT A;  5HHY A;  3W1H A;  3N4X A;  3VK4 A;  1BQA A;  3WCN A;  1DFO A;  5M46 A;  2YRR A;  4N0W A;  3GZD C;  2TPL A;  2WK8 A;  2W7M A;  4WLH A;  3FRK A;  2OQX A;  2GB3 A;  3HT4 A;  1AMS A;  1BJN A;  3NU8 A;  1FC4 A;  1ORD A;  1C9C A;  4JEX A;  3MAF A;  4PVF A;  4Y0H A;  3NYS A;  4RAE A;  4XJO A;  1VP4 A;  1BW0 A;  1KKP A;  2QLR A;  4F4E A;  2VMZ A;  4EB5 A;  2FKI A;  3LG0 A;  2BWO A;  3GWP A;  3PIU A;  4WXB A;  8AAT A;  1TOK A;  1YJZ A;  2BWP A;  2D7Z A;  3ELE A;  2E54 A;  3JWA A;  1FG3 A;  4LNM A;  1ASD A;  4QGR A;  4A6T A;  1WYV A;  2VMV A;  2XH1 A;  2W8W A;  3FTB A;  3FKD A;  4ZSY A;  1BJW A;  4GE9 A;  1BJ4 A;  1X28 A;  3VK3 A;  3WKS A;  4LNJ A;  1V2D A;  3M5U A;  1AY5 A;  1CZE A;  1E5E A;  2HOX A;  4ITX A;  4RM1 A;  2FYF A;  5DJ9 A;  3NUB A;  4GE4 A;  4WB0 B;  3WZF A;  2BKW A;  1AX4 A;  2ZSM A;  2Z1Y A;  4RKD A;  1GEY A;  2FNI A;  2YKV A;  2D65 A;  1CZC A;  2D63 A;  1SVV A;  3I5T A;  3II0 A;  3DRD A;  1B9I A;  1C7G A;  1QIR A;  4JEV A;  2D61 A;  5EFS A;  4NOG A;  1QJ5 A;  3N75 A;  1ART A;  2X8U A;  1GCK A;  1S09 A;  4XAU A;  1OXO A;  4DBC A;  2DOU A;  1J32 A;  3QN6 A;  3RCH B;  5KTB A;  2ZC0 A;  3QHX A;  4KYO A;  4CBS A;  1Z3Z A;  2HUF A;  1W3U A;  1EQB A;  3WKR A;  1SZS A;  3PDX A;  1Z7D A;  2O7C A;  3RCH A;  4F5H A;  2X3L A;  4LNL A;  4ZSW A;  3COG A;  1W7M A;  4HF8 A;  2R5E A;  4WD2 A;  1MAP A;  3EUC A;  3HMU A;  1WYT A;  2VYC A;  1B4X A;  5FT4 A;  4F5I A;  1GDE A;  1M7Y A;  3AEN A;  2VI9 A;  4R5F A;  2AY9 A;  2Q7W A;  3QM2 A;  4A6U A;  1QJ3 A;  3LWS A;  4P7Y A;  2HP2 A;  3BWO A;  3LVM A;  1ARS A;  1DJE A;  3BS8 A;  2ZY3 A;  4K05 A;  2VMU A;  4LW4 A;  2D5Y A;  1GEW A;  3BN1 A;  3H14 A;  4K2B A;  2VMS A;  2BI3 A;  2QBT A;  3JWB A;  4MY5 A;  3I16 A;  5DB5 A;  1S0A A;  2VGU A;  3ASB A;  5E4Z A;  2BI1 A;  1YJS A;  1N31 A;  1ZC9 A;  2AY5 A;  2BI5 A;  3DXV A;  4ZDP A;  9AAT A;  2CY8 A;  2VGS A;  2VIB A;  3TAT A;  1UU2 A;  1C7N A;  1GBN A;  4OBV A;  3EZS A;  3FDD A;  4LW2 A;  4PFN A;  5E3K A;  4A0H A;  4DGT A;  4Q31 A;  4WYF A;  3PD6 B;  1QGN A;  2VI8 A;  2AY8 A;  5M49 A;  3FZ7 A;  3EI7 A;  3ELP A;  5BJ4 A;  3CBF A;  2W7J A;  3ZZK A;  1AIB A;  4HVK A;  1O61 A;  2HZP A;  2Z9U A;  5LH9 A;  3AEL A;  4WLJ A;  1D7S A;  2VMP A;  1H0C A;  4DQ6 A;  3D6K A;  2V1P A;  1SFF A;  2YOB A;  2GSA A;  2EYQ A;  4BQ0 A;  2DGL A;  4RIT A;  2JJH A;  4W5K A;  4F5M A;  7AAT A;  1AKB A;  4WBT A;  1TAR A;  2QMA A;  2W7L A;  4W1W A;  2OKK A;  2E7J A;  4RJ0 A;  1TOI A;  3MC6 C;  3CQ5 A;  1BKG A;  1PMM A;  2DGM A;  2VGT A;  3E77 A;  4JEZ A;  1BJO B;  1TOE A;  2VGV A;  3E2Z B;  3G8M A;  4OCA A;  2W7K A;  4A0R A;  1YIY A;  3FQA A;  4ZM3 A;  3BCX A;  1I29 A;  2GMS A;  4BHD A;  1EJI A;  4WYE A;  3EI6 A;  4W8I A;  3AEJ C;  2FN6 A;  3BWN C;  2BI2 A;  3H9X A;  3NRA A;  3H7F A;  4F5J A;  4ZAH A;  2AY6 A;  3ZRP A;  1UU0 A;  5FT6 A;  4WP0 A;  3AEP A;  2ZY2 A;  2FNU A;  1E5F A;  3CQ6 A;  3A9X A;  1M0Q A;  1B5O A;  1PG8 A;  1CL1 A;  3B1C A;  3LVJ A;  1T3I A;  3LVK A;  3PAA A;  3CAI A;  1MGV A;  2HOY A;  4IYO B;  4R2N A;  1WYU B;  4W1V A;  5DX5 A;  5EUN A;  2JJE A;  2DKB A;  3VP6 A;  4IXO A;  1ARI A;  3ZRR A;  5J8Q A;  1AMQ A;  2YCN A;  4KXK A;  3VAX A;  4GDY A;  2BIE A;  3AEJ A;  1ELQ A;  3WGC A;  1WYU A;  4PIW A;  3DZZ A;  4FL0 A;  3FVX A;  1GC0 A;  3ASA A;  1UU1 A;  1AJS B;  1OAT A;  3MEB A;  2G7J A;  1I41 A;  5I92 A;  3AAT A;  3GSB A;  1B5P A;  2C81 A;  3WX9 A;  4Q76 A;  1KMJ A;  1IBJ A;  5EIG B;  4GSA A;  4AH3 A;  2QSR A;  2JIS A;  3GJU A;  3A2B A;  4MQR A;  3TFT A;  4A0G A;  1WYV B;  1B8G A;  1MLY A;  2V0Y A;  1ELU A;  1BJO A;  2AAT A;  2FQ6 A;  4IXS A;  5M4B A;  4UHN A;  4BA5 A;  3GZD A;  5C6U A;  2Z61 A;  3JTX A;  2ZSL A;  3PPL A;  3EI9 A;  1ASB A;  2W7H A;  3BCB A;  4F5L A;  3F6T A;  4KAM A;  2CAN A;  2Z9W A;  1WYT B;  3BB8 A;  4TV7 A;  1P3W A;  3N4S A;  1D7V A;  1KMK A;  1YNU A;  2YHK A;  3OKS A;  1TOG A;  4F5G A;  3NTJ A;  2W7D A;  2WK9 A;  4UHM A;  2W7G A;  3WY7 A;  3JZL A;  3FCR A;  4ADB A;  4ADE A;  1O62 A;  3FD0 A;  3NNK A;  4LC3 A;  4EFF A;  4MSO A;  3R4T A;  1AJS A;  2BWN A;  1MDO A;  4TMR A;  1S08 A;  3DYD A;  4OT8 A;  1OXP A;  3GET A;  3IHJ A;  1LW5 A;  1RV4 A;  5EAA A;  5AX8 A;  3USF A;  1CQ8 A;  1AY4 A;  3T32 A;  4W1X A;  1G7W A;  2E7I A;  3L44 A;  4WYD A;  1G4X A;  2EZ1 A;  1FG7 A;  4WYC A;  1AKC A;  3NUI A;  4ATP A;  4IYO A;  3LV2 A;  4XK1 A;  2AY4 A;  3PDB A;  4CXR A;  2JJG A;  2OGE A;  1V2E A;  2AEV A;  4ZLV A;  4AOA A;  4WB0 A;  4CBR A;  4E3R A;  1X29 A;  4O6Z A;  4TN4 A;  2ZY5 A;  2W8T A;  3AEM A;  5EUE A;  5HDM A;  1MDX A;  3BWN A;  2HUU A;  4UOY A;  4ZWM A;  3L8A A;  3AEM C;  3ZZJ A;  1TAS A;  3TFU A;  1WKH A;  1EG5 A;  1LC7 A;  2Z9X A;  2DR1 A;  4I8A A;  1JF9 A;  2YKU A;  5G0A A;  1JS6 A;  1XEY A;  2E7U A;  2W8J A;  3OP7 A;  2KFP A;  2Z67 A;  3FZ6 A;  4ZDL A;  4H63 Q;  3ECD A;  3TQX A;  4A72 A;  4B9B A;  2YKX A;  2CJG A;  1D7R A;  4A00 A;  3IF2 A;  2VMR A;  1WST A;  2CFB A;  2O0R A;  1OHV A;  3PD6 A;  3FFH A;  3FDB A;  3MAF B;  4FFC A;  4OBU A;  4BMK A;  3G0T A;  2CH2 A;  4M2K A;  5HXX A;  4EB7 A;  1V2F A;  2EPJ A;  2Z1Z A;  3K40 A;  3QI6 A;  3B46 A;  3E2Y A;  4M2J A;  2NMP A;  3WCO A;  4AZK A;  1LS3 A;  3F0H A;  2WB6 A;  2VMO A;  1WKG A;  4M2M A;  1IX7 A;  2R0T A;  1ZOD A;  1ASF A;  2ZP7 A;  4MQQ A;  2QB2 A;  1AHX A;  5D95 A;  1ASN A;  4B98 A;  3B1E A;  3HBX A;  1V72 A;  5G09 A;  4ADD A;  2C0R A;  3Q8N A;  4RKC A;  1ARG A;  3MAD A;  2OAT A;  1LKC A;  2A1V A;  1SZK A;  3QPG A;  2BHX A;  4E3Q A;  3TCM A;  1DGD A;  1AAW A;  2W7F A;  1N8P A;  1IX8 A;  4N0B A;  2DKJ A;  3AV7 A;  5G2Q A;  3AOV A;  1C7O A;  4W91 A;  2QB3 A;  3RBF A;  2RFV A;  4ZWV A;  3AEO A;  4XJP A;  2PB2 A;  3UWC A;  3FZ8 A;  3EZ1 A;  1QIT A;  1IAX A;  1AIA A;  1BT4 A;  1DTY A;  1JG8 A;  2VGW A;  4K2M A;  4UQV A;  4WXG A;  5EIG A;  1C0N A;  1LW4 A;  4L0O A;  2GMU A;  3QBO A;  2BYJ A;  4E1O A;  4JE5 D;  3DU4 A;  5EAV A;  1GC4 A;  1PMO A;  3A8U X;  1M0O A;  1IVR A;  4ZDO A;  1QIS A;  1SPA A;  2VMT A;  1DGE A;  2C7T A;  5K8B A;  1M0P A;  1CJ0 A;  2R5C B;  2W8V A;  2AY7 A;  1XI9 A;  1MAQ A;  3HVY A;  1W7L A;  3FVU A;  2ORD A;  3NX3 A;  4XEW A;  4ITG A;  1AHY A;  4OMA A;  1M4N A;  3DC1 A;  3FQ7 A;  1I43 A;  1G4V A;  1YOO A;  1LK9 A;  5EUD A;  4JF0 A;  1I48 A;  1ECX A;  3KE3 A;  3N4R A;  4CXQ A;  4IW7 A;  1PFF A;  1ARH A;  5F8V A;  4AZJ A;  1RV3 A;  1J04 A;  1GD9 A;  1RVU A;  3VK2 A;  4E77 A;  3E2Z A;  3BCA A;  2HP1 A;  2VMQ A;  2VMN A;  5BJ3 A;  3DR7 A;  2ZY4 A;  1KL1 A;  3GZC A;  1IAY A;  1ASC A;  3KGW A;  4CVQ A;  2CST A;  3RUY A;  4Y0I A;  2QA3 A;  4JEW A;  3EIA A;  5D5S A;  2VMY A;  1CQ7 A;  1ASE A;  1M6S A;  2HUI A;  1X0M A;  1D2F A;  2CJH A;  3BC8 A;  3ZRQ A;  1JS3 A;  2YKY A;  2PO3 A;  3NYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...