3DC1A

Crystal structure of kynurenine aminotransferase ii complex with alpha-ketoglutarate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
414
Chain Sequence
MNYARFITAASAARNPSPGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
publication title Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 414
sequence length 425
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3dc1A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3dc1A03
3A8UX 1IX7A 1Y4IA 2C44A 2VIBA 3RQ1A 1IJIA 1U08A 4WB0A 1X29A 3DRDA 2D65A 4F5FA 3PAAA 1M0NA 1AIAA 1AJSB 2GMUA 2R5CB 3HVYA 1E5EA 4KYOA 4W8IA 4RKDA 4XJPA 4BA4A 2QA3A 3GSBA 2ZUKA 1CZEA 3FZ7A 4WXGA 4WB0B 3B1EA 4F5KA 1I41A 4ZLVA 1B5PA 3LG0A 1ASLA 2W7LA 4CVQA 1AIBA 3A9XA 3EI7A 4ZWMA 2DR1A 4R2NA 1MAQA 2D66A 2VMNA 1GC0A 5DJ9A 3R9AA 2OKKA 3AV7A 4B98A 1BJ4A 5EUEA 4MSOA 5EQCA 1CL2A 2E7UA 4K2BA 3EI8A 3NNKA 1ZODA 2EPJA 1VJOA 2D7YA 2DKBA 2Z1YA 4P7YA 3ELPA 5E3KA 1MLYA 1TOGA 3I4JA 1CL1A 3VK2A 1GEXA 3B46A 1AHFA 4RAEA 2W7IA 4W5KA 2CJHA 2W7FA 3ZZKA 2VI8A 2RFVA 4XJLA 2GB3A 2V0YA 2O0RA 2ZC0A 4IXOA 3W1HA 1SZKA 3A2BA 2YRRA 1UKJA 3HQTA 1CQ7A 2W7HA 2O7CA 1OXPA 1AHEA 2DOUA 3AEMA 5DB5A 1SFFA 1G4VA 2R2NA 3VOMA 2YRIA 4E3RA 2JJEA 4MQPA 4OBUA 4ZSYA 4UQVA 3W1IA 1QITA 4HVKA 5AX8A 2ZSMA 1SZUA 3ZZJA 1QIRA 1ASGA 1IBJA 4W1VA 4F4EA 4IW7A 4DGTA 1D7SA 1I29A 2ZY4A 1MDZA 3FZ8A 3ASAA 1MDOA 2NMPA 5E4ZA 2D63A 3NX3A 4ZAHA 2BWOA 7AATA 2BI2A 1AKBA 3KGXA 5I92A 2GQNA 4JF1A 1XEYA 3RI6A 4M2JA 3VK3A 4F5JA 1OHWA 4CBRA 1BW0A 3CQ5A 3JW9A 3AEJC 3E9KA 4JEVA 4UOYA 3AEMC 3KKIA 1WYTA 3LV2A 4ADDA 1C7OA 2AEVA 3PDBB 2HZPA 3RBLA 2VMWA 4A6TA 3BWNA 4OYTA 3COGA 3T32A 5HDMA 1ARTA 1C7GA 4EB5A 4LNLA 4MQRA 3M5UA 2CY8A 5F8VA 1B8GA 1UU0A 4A00A 1SVVA 2Z67A 4ZDLA 3WZFA 3BS8A 1CJ0A 2W8JA 1PG8A 3ATHA 4WYFA 3A9ZA 1W23A 3ZRPA 1YNUA 1TOIA 2BWPA 3LVMA 2FYFA 1O61A 2OKJA 2HORA 2YCNA 2ZP7A 4ITXA 2WK8A 2BYJA 3PIUA 4LC3A 1AAWA 3E2ZA 5BJ4A 1AMQA 3ISLA 1GD9A 4PIWA 1TPLA 1KKPA 1ARSA 1ZC9A 2C7TA 1I43A 3PA9A 3EZSA 5BJ3A 1QJ3A 1N2TA 3BWNC 4B9BA 3CQ4A 3FFRA 3NRAA 1OATA 4MKKA 5G09A 2YHKA 1AMSA 1BJOA 3MAFA 2D7ZA 4J8LA 3UWCA 3FRKA 2AY3A 1DFOA 4Q75A 4OT8A 1AY5A 3D6KA 2W7EA 4WLHA 1AMAA 2W7GA 2OATA 3B8XA 5M46A 4XAUA 4ATQA 3R4TA 1V72A 2VGUA 2BIGA 4PVFA 4RITA 3NU7A 3MAFB 2O1BA 1LC5A 1LS3A 1TASA 3FVSA 3LY1A 3FKDA 3WKSA 1GEWA 4RJ0A 2Z61A 2E7IA 3NTJA 2JJGA 4UHNA 1D2FA 2AY1A 5DX5A 3B1DA 1M0OA 1SPAA 4ZWVA 3ZRQA 1P3WA 4IXSA 2FNUA 3K7YA 2VMXA 5TF5A 3KGWA 3EIAA 5IWQA 1WYUA 2HUUA 4A72A 4ZM4A 3PD6B 3DC1A 4JEWA 4M2MA 5F9SA 1C0NA 3G0TA 4W91A 1KL2A 3DXWA 2W8UA 1M6SA 3FZ6A 3DU4A 4ADBA 4EB7A 3AATA 4F5IA 4GEBA 3BCBA 4F5GA 4JEXA 3EI6A 1GBNA 1G7WA 4ZSWA 3QI6A 4OC9A 1ASBA 1GC3A 4Y0DA 3WX9A 5M4BA 1J32A 4WYCA 1EG5A 1S06A 2QLRA 4IYOA 1V2EA 4WLJA 3PDXA 4LNJA 3FCRA 2VGZA 1ASCA 1IAYA 3GR9A 2QB3A 1YJYA 1LW5A 3HDOA 1O69A 2FQ6A 4H51A 3ZRRA 3GZDA 1Z7DA 1N31A 3FQ7A 1E5FA 5EIGA 1LW4A 4CBSA 2OGAA 4IX8A 1ORDA 2ORDA 2Z9UA 5FT5A 1PFFA 2EGYA 2CINA 3W1JA 1BJWA 4MGRA 3LVJA 3EI5A 1OHVA 4JEYA 1S09A 1ASAA 1M7YA 1T3IA 4MKJA 3VP6A 1M4NA 1H1CA 1S07A 1SF2A 4GDYA 3ASBA 4RM1A 2DGMA 4LW4A 2BI9A 3WGCA 3AENA 1I48A 1S08A 1TOKA 1WKGA 2DKJA 3FVXA 3DODA 4CXQA 1S0AA 1ARGA 5FT8A 1C4KA 3GZDC 3EI9A 3GJUA 1AJRA 1BQDA 1IX8A 3MC6A 1D7UA 1M0PA 3UAKA 3NUBA 1ELQA 4IY7A 2VMRA 1QZ9A 2YOBA 3QHXA 2X5FA 4FL0A 3I5TA 3AENB 4ITGA 3P6KA 2VYCA 4WBTA 2BI3A 4ZDOA 4GE4A 3VAXA 2FM1A 4GSAA 3FSLA 4WYEA 1W7MA 3GWPA 3UE8A 2GSAA 1PMMA 3MADA 1XI9A 2YKXA 3F9TA 1AMRA 3QGUA 2Z9XA 3CQ6A 4PFFA 3TFUA 2JGTA 2VMYA 3AELA 2W8WA 1YIYA 5M4DA 3BCXA 2HOXA 2QB2A 3MEBA 2VGWA 4Q6RA 1AHXA 1QISA 1OXOA 4LW2A 3AEOA 1TATA 1WYTB 3NDNA 3MC6C 3DZZA 4WXBA 1FG7A 1J04A 5EUDA 2BHXA 1QGNA 1RV3A 3CAIA 4M2KA 1IX6A 2Z1ZA 3GBXA 1WYVA 1CQ6A 4FFCA 2Z20A 3PGYA 5LHAA 1BT4A 1AY8A 2VMUA 3EUCA 4BA5A 2X5DA 5FT4A 1WSTA 3HLMA 9AATA 2BI5A 3FQAA 4WP0A 2JJFA 1JF9A 1YAAA 2HP2A 2HUFA 2Z9WA 4TN4A 1IUGA 2BKWA 5E5IA 2VGSA 4XK1A 2Q7WA 4UHOA 3II0A 2EO5A 1MGVA 1WKHA 2WKAA 4WXFA 2JJHA 4AO9A 1QJ5A 2W7KA 4WD2A 1MAPA 2VGTA 2X3LA 2ZY3A 2CJGA 4F5HA 1ARHA 2CANA 3E2ZB 3NYUA 2ZSLA 4EFFA 2D61A 3FD0A 2YKVA 2AY5A 2VMPA 1OHYA 1EJIA 1AY4A 1B4XA 4BQ0A 3DR4A 3TFTA 2R5EA 3NYTA 4E3QA 2AY6A 1MDXA 2QBTA 2R0TA 4WYGA 5JAYA 1BJOB 4JE5D 4NOGA 3PPLA 2XBNA 4OCAA 3L8AA 3P1TA 4A6RA 1VP4A 2VLHA 3FVUA 2YKYA 4JE5A 4W1XA 1IVRA 1ASNA 3JTXA 3IF2A 4WYAA 2GMSA 3BC8A 3FFHA 4A6UA 4MY5A 3QPGA 1C9CA 2CJDA 5DJ1A 1DKAA 2F8JA 3K40A 1YJSA 1PMOA 2BYLA 1AAMA 3EZ1A 1VEFA 3TQXA 2FN6A 3PJ0A 1X2AA 1D7RA 2HOYA 4XQ2A 1LC8A 3QM2A 1V2FA 1UU1A 1TOEA 2R5CA 3E2YA 2VMOA 2C81A 2BI1A 4AH3A 1GDEA 1ASDA 3OP7A 3N75A 3A9YA 3MKJA 3JWBA 5K8BA 1RVUA 1V2DA 1WYUB 3Q8NA 5C6UA 1IAXA 1GC2A 3FQ8A 3DXVA 2YCPA 2AY9A 2VMVA 2CSTA 1YJZA 1KL1A 1EQBA 1M0QA 2PB2A 3BCAA 3HMUA 3MAUA 3G8MA 3JWAA 4OTLA 5HXXA 1ZOBA 1AHGA 2EZ1A 1D7VA 2HUIA 2VGVA 2W8VA 3GETA 3H14A 4OBVA 3AOVA 4A0GA 4ISYA 3H7FA 1LKCA 2HP1A 1RVYA 2Z9VA 4GE7A 4AOAA 3LVKA 4AO4A 1M32A 4IYOB 4TV7A 1DJEA 2BIEA 3NUIA 4RLGA 2JISA 4U2HA 2BIAA 2AY2A 1B9HA 2E7JA 2ZYJA 5G4JA 1G4XA 8AATA 1ELUA 2W7JA 3FTBA 2AY4A 1B5OA 4ZDPA 1X0MA 1G7XA 1DGEA 2OGEA 2D5YA 1AHYA 3JZLA 2QMAA 4KAMA 5EIGB 5EFSA 3HBXA 2V1PA 1CZCA 3G7QA 2W7DA 2AEUA 1W7LA 2CH2A 4IXZA 2DGKA 5EAVA 3USFA 3HT4A 1GC4A 1BQAA 3MBBA 1SZSA 3N0LA 4BHDA 3DYDA 3WGBA 4P3MA 4TMRA 4F5MA 2FNIA 1BS0A 2PO3A 4W1WA 2ZY2A 3RCHA 4EU1A 2W7MA 2AY7A 2XH1A 2VMQA 1W7NA 4LNMA 3FDDA 3LWSA 4PFNA 3BWOA 2HOZA 3K28A 1DJUA 5G2QA 1TOJA 3AEJA 1DJ9A 2YKUA 3ACZA 2WK9A 2EZ2A 3E6GA 5G2PA 4ADCA 3E2FA 1O4SA 4EMYA 1RV4A 3HL2A 4Y0HA 2YCTA 3JU7A 3QBOA 4JEZA 5J8QA 3RBFA 3RCHB 2X8UA 2CFBA 3WY7A 5LH9A 2C0RA 4CXRA 2JG2A 4XJOA 5D95A 4OMAA 1GCKA 1BKGA 5M49A 1JS6A 2CB1A 2VMSA 2W8TA 5G0AA 3WLXA 4A0FA 2VMTA 3PDBA 2DGLA 4U1TA 1MLZA 5G4IA 2VLFA 1AKAA 3E77A 2WK7A 1N8PA 4AZJA 3GZCA 3IHJA 4A0RA 4WYDA 3ELEA 2VMZA 4F5LA 3OKSA 2E54A 4ZM3A 3BN1A 1B9IA 1AX4A 5D5SA 2VI9A 3TATA 1KKJA 4KXKA 4R8DA 2PB0A 2ZJGA 3DR7A 1BJNA 3I16A 3L44A 4E77A 3NU8A 2CH1A 2G6WA 3WKRA 4R5FA 3AOWA 1X28A 4XEWA 4A0HA 1UU2A 4I8AA 1CQ8A 1YOOA 4N0WA 4BMKA 2OQXA 4DBCA 1C7NA 3ECDA 4R5ZA 4RKCA 3BV0A 5HHYA 4Y0IA 1H0CA 1JS3A 3QN6A 4HF8A 1WYVB 4JF0A 4UHMA 4AZKA 3AEPA 4MQQA 2TPLA 3KE3A 3RUYA 1TARA 4ZASA 1AICA 1ASMA 3WCOA 4J5UA 3EIBA 1W3UA 3F0HA 4Q31A 1DGDA 1JG8A 4Q76A 1KMKA 3LVLB 1GEYA 2AATA 1ASFA 1KMJA 1FG3A 2D64A 1ASEA 5EUNA 3N5MA 1LC7A 4QGRA 5EAAA 2VIAA 4L0OA 3VK4A 4GE9A 2ZY5A 5FT6A 4E1OA 4ADEA 1FC4A 4XJMA 4N0BA 1ARIA 1AKCA 1Z3ZA 3BB8A 3F6TA 1LK9A 3B1CA 3TCMA 3WCNA 3NYSA 4RJYA 4ATPA 2BWNA 3FDBA 4GRXA 4K2MA 1AJSA 1YIZA 4O6ZA 2EH6A 1CS1A 4K2IA 1O62A 4DQ6A 3PD6A 4RIZA 2CTZA 3CBFA 1ECXA 1DTYA 2AY8A
chains in the Genus database with same CATH superfamily
3A8UX 1IX7A 1Y4IA 2C44A 2VIBA 3RQ1A 1IJIA 5KTBA 1U08A 4WB0A 1X29A 3DRDA 2D65A 4F5FA 3PAAA 1M0NA 1AIAA 1AJSB 2GMUA 2R5CB 3HVYA 1E5EA 4KYOA 4W8IA 4RKDA 4XJPA 4BA4A 2QA3A 3GSBA 2ZUKA 1CZEA 3FZ7A 4WXGA 4WB0B 3B1EA 4F5KA 1I41A 4ZLVA 1B5PA 3LG0A 1ASLA 2W7LA 4CVQA 1AIBA 3A9XA 3EI7A 4ZWMA 2DR1A 4R2NA 1MAQA 2D66A 2VMNA 1GC0A 5DJ9A 3R9AA 2OKKA 3AV7A 4B98A 1BJ4A 5EUEA 4MSOA 5EQCA 1CL2A 2E7UA 4K2BA 3EI8A 3NNKA 1ZODA 2EPJA 1VJOA 2D7YA 2DKBA 2Z1YA 4P7YA 3ELPA 5E3KA 1MLYA 1TOGA 3I4JA 1CL1A 3VK2A 1GEXA 3B46A 1AHFA 4RAEA 2W7IA 4W5KA 2CJHA 2W7FA 3ZZKA 2VI8A 2RFVA 4XJLA 2GB3A 2V0YA 2O0RA 2ZC0A 4IXOA 3W1HA 1SZKA 3A2BA 2YRRA 1UKJA 3HQTA 1CQ7A 2W7HA 2O7CA 1OXPA 1AHEA 2DOUA 3AEMA 5DB5A 1SFFA 1G4VA 2R2NA 3VOMA 2YRIA 4E3RA 2JJEA 4MQPA 4OBUA 4ZSYA 4UQVA 3W1IA 1QITA 4HVKA 5AX8A 2ZSMA 1SZUA 3ZZJA 1QIRA 1ASGA 1IBJA 4W1VA 4F4EA 4IW7A 4DGTA 1D7SA 1I29A 2ZY4A 1MDZA 3FZ8A 3ASAA 1MDOA 2NMPA 5E4ZA 2D63A 3NX3A 4ZAHA 2BWOA 7AATA 2A1VA 2BI2A 1AKBA 3KGXA 5I92A 2GQNA 4JF1A 1XEYA 3RI6A 4M2JA 3VK3A 4F5JA 1OHWA 4CBRA 1BW0A 3CQ5A 3JW9A 3AEJC 3E9KA 4JEVA 4UOYA 3AEMC 3KKIA 1WYTA 3LV2A 4ADDA 1C7OA 2AEVA 3PDBB 2HZPA 3RBLA 2VMWA 4A6TA 3BWNA 4OYTA 3COGA 3T32A 5HDMA 1ARTA 1C7GA 4EB5A 4LNLA 4MQRA 3M5UA 2CY8A 5F8VA 1B8GA 1UU0A 4A00A 1SVVA 2Z67A 4ZDLA 3WZFA 3BS8A 1CJ0A 2W8JA 1PG8A 3ATHA 4WYFA 3A9ZA 1W23A 3ZRPA 1YNUA 1TOIA 2BWPA 3LVMA 2FYFA 1O61A 2OKJA 2HORA 2YCNA 2ZP7A 4ITXA 2WK8A 2BYJA 3PIUA 4LC3A 1KAFA 1AAWA 3E2ZA 5BJ4A 1AMQA 3ISLA 1GD9A 4PIWA 1TPLA 1KKPA 1ARSA 1ZC9A 2C7TA 1I43A 3PA9A 3EZSA 5BJ3A 1QJ3A 1N2TA 3BWNC 4B9BA 3CQ4A 3FFRA 3NRAA 1OATA 4MKKA 5G09A 2YHKA 1AMSA 1BJOA 3MAFA 2D7ZA 4J8LA 3UWCA 3FRKA 3N4SA 2AY3A 1DFOA 4Q75A 4OT8A 4K05A 1AY5A 3D6KA 2W7EA 4WLHA 1AMAA 2W7GA 2OATA 3B8XA 5M46A 4XAUA 4ATQA 2KFPA 3R4TA 1V72A 2VGUA 2BIGA 4PVFA 4RITA 3NU7A 3MAFB 2O1BA 1LC5A 1LS3A 1TASA 3FVSA 3LY1A 3FKDA 3WKSA 1GEWA 4RJ0A 2Z61A 2E7IA 3NTJA 2JJGA 4UHNA 1D2FA 2AY1A 5DX5A 3B1DA 2WB6A 1M0OA 1SPAA 4ZWVA 3ZRQA 1P3WA 4IXSA 2FNUA 3K7YA 2VMXA 5TF5A 3KGWA 3EIAA 5IWQA 1WYUA 2HUUA 4A72A 4ZM4A 3PD6B 3DC1A 4JEWA 4M2MA 5F9SA 1C0NA 3G0TA 4W91A 1KL2A 3DXWA 2W8UA 1M6SA 3FZ6A 3DU4A 4ADBA 4EB7A 3AATA 4F5IA 4GEBA 3BCBA 4F5GA 4JEXA 3EI6A 1GBNA 1G7WA 4ZSWA 3QI6A 4OC9A 1ASBA 1GC3A 4Y0DA 3WX9A 5M4BA 1J32A 4WYCA 1EG5A 1S06A 2QLRA 4IYOA 1V2EA 4WLJA 3PDXA 4LNJA 3FCRA 2VGZA 1ASCA 1IAYA 3GR9A 2QB3A 1YJYA 1LW5A 3HDOA 1O69A 2FQ6A 4H51A 3ZRRA 3GZDA 1Z7DA 1N31A 3FQ7A 1E5FA 5EIGA 1LW4A 4CBSA 2OGAA 4IX8A 1ORDA 2ORDA 2Z9UA 5FT5A 1PFFA 2EGYA 2CINA 3W1JA 1BJWA 4MGRA 3LVJA 3EI5A 1OHVA 4JEYA 1S09A 1ASAA 1M7YA 1T3IA 4MKJA 2EYQA 3VP6A 1M4NA 1H1CA 1S07A 1SF2A 4GDYA 3ASBA 4RM1A 2DGMA 4LW4A 2BI9A 3WGCA 3AENA 1I48A 1S08A 1TOKA 1WKGA 2DKJA 3FVXA 3DODA 4CXQA 1S0AA 1ARGA 5FT8A 1C4KA 3GZDC 3EI9A 3GJUA 1AJRA 1BQDA 1IX8A 3MC6A 1D7UA 1M0PA 3UAKA 3NUBA 1ELQA 4IY7A 2VMRA 1QZ9A 2YOBA 3QHXA 2X5FA 4FL0A 3I5TA 3AENB 4ITGA 3P6KA 2VYCA 4WBTA 2BI3A 4ZDOA 4GE4A 3VAXA 2FM1A 4GSAA 3FSLA 4WYEA 1W7MA 3GWPA 3UE8A 2GSAA 1PMMA 3MADA 1XI9A 2YKXA 3F9TA 1AMRA 3QGUA 2FKIA 2Z9XA 3CQ6A 4PFFA 3TFUA 2JGTA 2VMYA 3AELA 2W8WA 1YIYA 5M4DA 3BCXA 2HOXA 2QB2A 3MEBA 2VGWA 4Q6RA 1AHXA 1QISA 1OXOA 4LW2A 3AEOA 1TATA 1WYTB 3NDNA 3MC6C 3DZZA 4WXBA 1FG7A 1J04A 5EUDA 2BHXA 1QGNA 1RV3A 3CAIA 4M2KA 1IX6A 2Z1ZA 3GBXA 1WYVA 1CQ6A 4FFCA 2Z20A 3PGYA 5LHAA 1BT4A 1AY8A 2VMUA 3EUCA 4BA5A 2X5DA 5FT4A 1WSTA 3HLMA 9AATA 2BI5A 3FQAA 4WP0A 2JJFA 1JF9A 1YAAA 2HP2A 2HUFA 2Z9WA 4TN4A 1IUGA 2BKWA 5E5IA 2VGSA 4XK1A 2Q7WA 4UHOA 3II0A 2EO5A 1MGVA 1WKHA 2WKAA 4WXFA 2JJHA 4AO9A 1QJ5A 2W7KA 4WD2A 1MAPA 2VGTA 2X3LA 2ZY3A 2CJGA 4F5HA 1ARHA 2CANA 3E2ZB 3NYUA 2ZSLA 4EFFA 2D61A 3FD0A 2YKVA 2AY5A 2VMPA 1OHYA 1EJIA 1AY4A 1B4XA 2QSRA 4BQ0A 3DR4A 3TFTA 2R5EA 3NYTA 4E3QA 2AY6A 1MDXA 2QBTA 2R0TA 4WYGA 5JAYA 1BJOB 4JE5D 4NOGA 3PPLA 2XBNA 4OCAA 3L8AA 3P1TA 4A6RA 1VP4A 2VLHA 3FVUA 2YKYA 4JE5A 4W1XA 1IVRA 1ASNA 3JTXA 3IF2A 4WYAA 2GMSA 3BC8A 3FFHA 4A6UA 4MY5A 3QPGA 1C9CA 2CJDA 5DJ1A 1DKAA 2F8JA 3K40A 1YJSA 1PMOA 2BYLA 1AAMA 3EZ1A 1VEFA 3TQXA 2FN6A 3PJ0A 1X2AA 1D7RA 2HOYA 4XQ2A 1LC8A 3QM2A 1V2FA 2G7JA 1UU1A 1TOEA 2R5CA 3E2YA 2VMOA 2C81A 2BI1A 4AH3A 1GDEA 1ASDA 3OP7A 3N75A 3A9YA 3MKJA 3JWBA 5K8BA 1RVUA 1V2DA 1WYUB 3Q8NA 5C6UA 1IAXA 1GC2A 3FQ8A 3DXVA 2YCPA 2AY9A 2VMVA 2CSTA 1YJZA 1KL1A 1EQBA 1M0QA 2PB2A 3BCAA 3HMUA 3MAUA 3G8MA 3JWAA 4OTLA 5HXXA 1ZOBA 1AHGA 2EZ1A 1D7VA 2HUIA 2VGVA 2W8VA 3GETA 3H14A 4OBVA 3AOVA 4A0GA 4ISYA 3H7FA 1LKCA 2HP1A 1RVYA 2Z9VA 4GE7A 4AOAA 3LVKA 4AO4A 1M32A 4IYOB 4TV7A 1DJEA 2BIEA 3NUIA 4RLGA 2JISA 4U2HA 2BIAA 2AY2A 1B9HA 2E7JA 2ZYJA 5G4JA 1G4XA 8AATA 1ELUA 2W7JA 3FTBA 2AY4A 1B5OA 4ZDPA 1X0MA 1G7XA 1DGEA 2OGEA 2D5YA 1AHYA 3JZLA 2QMAA 4KAMA 5EIGB 5EFSA 3HBXA 2V1PA 1CZCA 3G7QA 2W7DA 2AEUA 1W7LA 2CH2A 4IXZA 2DGKA 5EAVA 3USFA 3HT4A 1GC4A 1BQAA 3MBBA 1SZSA 3N0LA 4BHDA 3DYDA 3WGBA 4P3MA 4TMRA 4F5MA 2FNIA 1BS0A 2PO3A 4W1WA 2ZY2A 3RCHA 4EU1A 2W7MA 2AY7A 2XH1A 2VMQA 1W7NA 4LNMA 3FDDA 3LWSA 4PFNA 3BWOA 2HOZA 3K28A 3N4XA 1DJUA 5G2QA 1TOJA 3AEJA 1DJ9A 2YKUA 3ACZA 2WK9A 2EZ2A 3E6GA 5G2PA 4ADCA 3E2FA 1O4SA 4EMYA 1RV4A 3HL2A 4Y0HA 2YCTA 3JU7A 3QBOA 4JEZA 5J8QA 3RBFA 3RCHB 2X8UA 2CFBA 3WY7A 3N7NA 5LH9A 2C0RA 4CXRA 2JG2A 4XJOA 5D95A 4OMAA 1GCKA 1BKGA 5M49A 1JS6A 2CB1A 2VMSA 2W8TA 5G0AA 3WLXA 4A0FA 2VMTA 3PDBA 2DGLA 4U1TA 1MLZA 5G4IA 2VLFA 1AKAA 3E77A 2WK7A 1N8PA 4AZJA 3GZCA 3IHJA 4A0RA 4WYDA 3ELEA 2VMZA 4F5LA 3OKSA 2E54A 4ZM3A 3BN1A 1B9IA 1AX4A 5D5SA 2VI9A 3TATA 1KKJA 4KXKA 4R8DA 2PB0A 2ZJGA 3DR7A 1BJNA 3I16A 3L44A 3N4RA 4E77A 3NU8A 2CH1A 2G6WA 3WKRA 4R5FA 3AOWA 1X28A 4XEWA 4A0HA 1UU2A 4I8AA 1CQ8A 1YOOA 4N0WA 4BMKA 2OQXA 4DBCA 1C7NA 3ECDA 4R5ZA 4RKCA 3BV0A 5HHYA 4Y0IA 1H0CA 1JS3A 3QN6A 4HF8A 1WYVB 4JF0A 4UHMA 4AZKA 3AEPA 4MQQA 2TPLA 3KE3A 3RUYA 1TARA 4ZASA 1AICA 1ASMA 3WCOA 4J5UA 3EIBA 1W3UA 3F0HA 4Q31A 1DGDA 1JG8A 4Q76A 1KMKA 3LVLB 1GEYA 2AATA 1ASFA 1KMJA 1FG3A 2D64A 1ASEA 5EUNA 3N5MA 1LC7A 4QGRA 5EAAA 2VIAA 3H9XA 4L0OA 3VK4A 4GE9A 2ZY5A 5FT6A 4E1OA 4ADEA 1FC4A 4XJMA 4N0BA 1ARIA 4H63Q 1AKCA 1Z3ZA 3BB8A 3F6TA 1LK9A 3B1CA 3TCMA 3WCNA 3NYSA 4RJYA 4ATPA 2BWNA 3FDBA 4GRXA 4K2MA 1AJSA 1YIZA 4O6ZA 2EH6A 1CS1A 4K2IA 1O62A 4DQ6A 3PD6A 4RIZA 2CTZA 3CBFA 1ECXA 1DTYA 2AY8A
chains in the Genus database with same CATH topology
3A8UX 1IX7A 1Y4IA 2C44A 2VIBA 3RQ1A 1IJIA 5KTBA 1U08A 4WB0A 1X29A 3DRDA 2D65A 4F5FA 3PAAA 1M0NA 1AIAA 1AJSB 2GMUA 2R5CB 3HVYA 1E5EA 4KYOA 4W8IA 4RKDA 4XJPA 4BA4A 2QA3A 3GSBA 2ZUKA 1CZEA 3FZ7A 4WXGA 4WB0B 3B1EA 4F5KA 1I41A 4ZLVA 1B5PA 3LG0A 1ASLA 2W7LA 4CVQA 1AIBA 3A9XA 3EI7A 4ZWMA 2DR1A 4R2NA 1MAQA 2D66A 2VMNA 1GC0A 5DJ9A 3R9AA 2OKKA 3AV7A 4B98A 1BJ4A 5EUEA 4MSOA 5EQCA 1CL2A 2E7UA 4K2BA 3EI8A 3NNKA 1ZODA 2EPJA 1VJOA 2D7YA 2DKBA 2Z1YA 4P7YA 3ELPA 5E3KA 1MLYA 1TOGA 3I4JA 1CL1A 3VK2A 1GEXA 3B46A 1AHFA 4RAEA 2W7IA 4W5KA 2CJHA 2W7FA 3ZZKA 2VI8A 2RFVA 4XJLA 2GB3A 2V0YA 2O0RA 2ZC0A 4IXOA 3W1HA 1SZKA 3A2BA 2YRRA 1UKJA 3HQTA 1CQ7A 2W7HA 2O7CA 1OXPA 1AHEA 2DOUA 3AEMA 5DB5A 1SFFA 1G4VA 2R2NA 3VOMA 2YRIA 4E3RA 2JJEA 4MQPA 4OBUA 4ZSYA 4UQVA 3W1IA 1QITA 4HVKA 5AX8A 2ZSMA 1SZUA 3ZZJA 1QIRA 1ASGA 1IBJA 4W1VA 4F4EA 4IW7A 4DGTA 1D7SA 1I29A 2ZY4A 1MDZA 3FZ8A 3ASAA 1MDOA 2NMPA 5E4ZA 2D63A 3NX3A 4ZAHA 2BWOA 7AATA 2A1VA 2BI2A 1AKBA 3KGXA 5I92A 2GQNA 4JF1A 1XEYA 3RI6A 4M2JA 3VK3A 4F5JA 1OHWA 4CBRA 1BW0A 3CQ5A 3JW9A 3AEJC 3E9KA 4JEVA 4UOYA 3AEMC 3KKIA 1WYTA 3LV2A 4ADDA 1C7OA 2AEVA 3PDBB 2HZPA 3RBLA 2VMWA 4A6TA 3BWNA 4OYTA 3COGA 3T32A 5HDMA 1ARTA 1C7GA 4EB5A 4LNLA 4MQRA 3M5UA 2CY8A 5F8VA 1B8GA 1UU0A 4A00A 1SVVA 2Z67A 4ZDLA 3WZFA 3BS8A 1CJ0A 2W8JA 1PG8A 3ATHA 4WYFA 3A9ZA 1W23A 3ZRPA 1YNUA 1TOIA 2BWPA 3LVMA 2FYFA 1O61A 2OKJA 2HORA 2YCNA 2ZP7A 4ITXA 2WK8A 2BYJA 3PIUA 4LC3A 1AAWA 3E2ZA 5BJ4A 1AMQA 3ISLA 1GD9A 4PIWA 1TPLA 1KKPA 1ARSA 1ZC9A 2C7TA 1I43A 3PA9A 3EZSA 5BJ3A 1QJ3A 1N2TA 3BWNC 4B9BA 3CQ4A 3FFRA 3NRAA 1OATA 4MKKA 5G09A 2YHKA 1AMSA 1BJOA 3MAFA 2D7ZA 4J8LA 3UWCA 3FRKA 3N4SA 2AY3A 1DFOA 4Q75A 4OT8A 4K05A 1AY5A 3D6KA 2W7EA 4WLHA 1AMAA 2W7GA 2OATA 3B8XA 5M46A 4XAUA 4ATQA 2KFPA 3R4TA 1V72A 2VGUA 2BIGA 4PVFA 4RITA 3NU7A 3MAFB 2O1BA 1LC5A 1LS3A 1TASA 3FVSA 3LY1A 3FKDA 3WKSA 1GEWA 4RJ0A 2Z61A 2E7IA 3NTJA 2JJGA 4UHNA 1D2FA 2AY1A 5DX5A 3B1DA 2WB6A 1M0OA 1SPAA 4ZWVA 3ZRQA 1P3WA 4IXSA 2FNUA 3K7YA 2VMXA 5TF5A 3KGWA 3EIAA 5IWQA 1WYUA 2HUUA 4A72A 4ZM4A 3PD6B 3DC1A 4JEWA 4M2MA 5F9SA 1C0NA 3G0TA 4W91A 1KL2A 3DXWA 2W8UA 1M6SA 3FZ6A 3DU4A 4ADBA 4EB7A 3AATA 4F5IA 4GEBA 3BCBA 4F5GA 4JEXA 3EI6A 1GBNA 1G7WA 4ZSWA 3QI6A 4OC9A 1ASBA 1GC3A 4Y0DA 3WX9A 5M4BA 1J32A 4WYCA 1EG5A 1S06A 2QLRA 4IYOA 1V2EA 4WLJA 3PDXA 4LNJA 3FCRA 2VGZA 1ASCA 1IAYA 3GR9A 2QB3A 1YJYA 1LW5A 3HDOA 1O69A 2FQ6A 4H51A 3ZRRA 3GZDA 1Z7DA 1N31A 3FQ7A 1E5FA 5EIGA 1LW4A 4CBSA 2OGAA 4IX8A 1ORDA 2ORDA 2Z9UA 5FT5A 1PFFA 2EGYA 2CINA 3W1JA 1BJWA 4MGRA 3LVJA 3EI5A 1OHVA 4JEYA 1S09A 1ASAA 1M7YA 1T3IA 4MKJA 2EYQA 3VP6A 1M4NA 1H1CA 1S07A 1SF2A 4GDYA 3ASBA 4RM1A 2DGMA 4LW4A 2BI9A 3WGCA 3AENA 1I48A 1S08A 1TOKA 1WKGA 2DKJA 3FVXA 3DODA 4CXQA 1S0AA 1ARGA 5FT8A 1C4KA 3GZDC 3EI9A 3GJUA 1AJRA 1BQDA 1IX8A 3MC6A 1D7UA 1M0PA 3UAKA 3NUBA 1ELQA 4IY7A 2VMRA 1QZ9A 2YOBA 3QHXA 2X5FA 4FL0A 3I5TA 3AENB 4ITGA 3P6KA 2VYCA 4WBTA 2BI3A 4ZDOA 4GE4A 3VAXA 2FM1A 4GSAA 3FSLA 4WYEA 1W7MA 3GWPA 3UE8A 2GSAA 1PMMA 3MADA 1XI9A 2YKXA 3F9TA 1AMRA 3QGUA 2FKIA 2Z9XA 3CQ6A 4PFFA 3TFUA 2JGTA 2VMYA 3AELA 2W8WA 1YIYA 5M4DA 3BCXA 2HOXA 2QB2A 3MEBA 2VGWA 4Q6RA 1AHXA 1QISA 1OXOA 4LW2A 3AEOA 1TATA 1WYTB 3NDNA 3MC6C 3DZZA 4WXBA 1FG7A 1J04A 5EUDA 2BHXA 1QGNA 1RV3A 3CAIA 4M2KA 1IX6A 2Z1ZA 3GBXA 1WYVA 1CQ6A 4FFCA 2Z20A 3PGYA 5LHAA 1BT4A 1AY8A 2VMUA 3EUCA 4BA5A 2X5DA 5FT4A 1WSTA 3HLMA 9AATA 2BI5A 3FQAA 4WP0A 2JJFA 1JF9A 1YAAA 2HP2A 2HUFA 2Z9WA 4TN4A 1IUGA 2BKWA 5E5IA 2VGSA 4XK1A 2Q7WA 4UHOA 3II0A 2EO5A 1MGVA 1WKHA 2WKAA 4WXFA 2JJHA 4AO9A 1QJ5A 2W7KA 4WD2A 1MAPA 2VGTA 2X3LA 2ZY3A 2CJGA 4F5HA 1ARHA 2CANA 3E2ZB 3NYUA 2ZSLA 4EFFA 2D61A 3FD0A 2YKVA 2AY5A 2VMPA 1OHYA 1EJIA 1AY4A 1B4XA 2QSRA 4BQ0A 3DR4A 3TFTA 2R5EA 3NYTA 4E3QA 2AY6A 1MDXA 2QBTA 2R0TA 4WYGA 5JAYA 1BJOB 4JE5D 4NOGA 3PPLA 2XBNA 4OCAA 3L8AA 3P1TA 4A6RA 1VP4A 2VLHA 3FVUA 2YKYA 4JE5A 4W1XA 1IVRA 1ASNA 3JTXA 3IF2A 4WYAA 2GMSA 3BC8A 3FFHA 4A6UA 4MY5A 3QPGA 1C9CA 2CJDA 5DJ1A 1DKAA 2F8JA 3K40A 1YJSA 1PMOA 2BYLA 1AAMA 3EZ1A 1VEFA 3TQXA 2FN6A 3PJ0A 1X2AA 1D7RA 2HOYA 4XQ2A 1LC8A 3QM2A 1V2FA 2G7JA 1UU1A 1TOEA 2R5CA 3E2YA 2VMOA 2C81A 2BI1A 4AH3A 1GDEA 1ASDA 3OP7A 3N75A 3A9YA 3MKJA 3JWBA 5K8BA 1RVUA 1V2DA 1WYUB 3Q8NA 5C6UA 1IAXA 1GC2A 3FQ8A 3DXVA 2YCPA 2AY9A 2VMVA 2CSTA 1YJZA 1KL1A 1EQBA 1M0QA 2PB2A 3BCAA 3HMUA 3MAUA 3G8MA 3JWAA 4OTLA 5HXXA 1ZOBA 1AHGA 2EZ1A 1D7VA 2HUIA 2VGVA 2W8VA 3GETA 3H14A 4OBVA 3AOVA 4A0GA 4ISYA 3H7FA 1LKCA 2HP1A 1RVYA 2Z9VA 4GE7A 4AOAA 3LVKA 4AO4A 1M32A 4IYOB 4TV7A 1DJEA 2BIEA 3NUIA 4RLGA 2JISA 4U2HA 2BIAA 2AY2A 1B9HA 2E7JA 2ZYJA 5G4JA 1G4XA 8AATA 1ELUA 2W7JA 3FTBA 2AY4A 1B5OA 4ZDPA 1X0MA 1G7XA 1DGEA 2OGEA 2D5YA 1AHYA 3JZLA 2QMAA 4KAMA 5EIGB 5EFSA 3HBXA 2V1PA 1CZCA 3G7QA 2W7DA 2AEUA 1W7LA 2CH2A 4IXZA 2DGKA 5EAVA 3USFA 3HT4A 1GC4A 1BQAA 3MBBA 1SZSA 3N0LA 4BHDA 3DYDA 3WGBA 4P3MA 4TMRA 4F5MA 2FNIA 1BS0A 2PO3A 4W1WA 2ZY2A 3RCHA 4EU1A 2W7MA 2AY7A 2XH1A 2VMQA 1W7NA 4LNMA 3FDDA 3LWSA 4PFNA 3BWOA 2HOZA 3K28A 3N4XA 1DJUA 5G2QA 1TOJA 3AEJA 1DJ9A 2YKUA 3ACZA 2WK9A 2EZ2A 3E6GA 5G2PA 4ADCA 3E2FA 1O4SA 4EMYA 1RV4A 3HL2A 4Y0HA 2YCTA 3JU7A 3QBOA 4JEZA 5J8QA 3RBFA 3RCHB 2X8UA 2CFBA 3WY7A 3N7NA 5LH9A 2C0RA 4CXRA 2JG2A 4XJOA 5D95A 4OMAA 1GCKA 1BKGA 5M49A 1JS6A 2CB1A 2VMSA 2W8TA 5G0AA 3WLXA 4A0FA 2VMTA 3PDBA 2DGLA 4U1TA 1MLZA 5G4IA 2VLFA 1AKAA 3E77A 2WK7A 1N8PA 4AZJA 3GZCA 3IHJA 4A0RA 4WYDA 3ELEA 2VMZA 4F5LA 3OKSA 2E54A 4ZM3A 3BN1A 1B9IA 1AX4A 5D5SA 2VI9A 3TATA 1KKJA 4KXKA 4R8DA 2PB0A 2ZJGA 3DR7A 1BJNA 3I16A 3L44A 3N4RA 4E77A 3NU8A 2CH1A 2G6WA 3WKRA 4R5FA 3AOWA 1X28A 4XEWA 4A0HA 1UU2A 4I8AA 1CQ8A 1YOOA 4N0WA 4BMKA 2OQXA 4DBCA 1C7NA 3ECDA 4R5ZA 4RKCA 3BV0A 5HHYA 4Y0IA 1H0CA 1JS3A 3QN6A 4HF8A 1WYVB 4JF0A 4UHMA 4AZKA 3AEPA 4MQQA 2TPLA 3KE3A 3RUYA 1TARA 4ZASA 1AICA 1ASMA 3WCOA 4J5UA 3EIBA 1W3UA 3F0HA 4Q31A 1DGDA 1JG8A 4Q76A 1KMKA 3LVLB 1GEYA 2AATA 1ASFA 1KMJA 1FG3A 2D64A 1ASEA 5EUNA 3N5MA 1LC7A 4QGRA 5EAAA 2VIAA 3H9XA 4L0OA 3VK4A 4GE9A 2ZY5A 5FT6A 4E1OA 4ADEA 1FC4A 4XJMA 4N0BA 1ARIA 4H63Q 1AKCA 1Z3ZA 3BB8A 3F6TA 1LK9A 3B1CA 3TCMA 3WCNA 3NYSA 4RJYA 4ATPA 2BWNA 3FDBA 4GRXA 4K2MA 1AJSA 1YIZA 4O6ZA 2EH6A 1CS1A 4K2IA 1O62A 4DQ6A 3PD6A 4RIZA 2CTZA 3CBFA 1ECXA 1DTYA 2AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8U X;  1IX7 A;  1Y4I A;  2C44 A;  2VIB A;  3RQ1 A;  1IJI A;  1U08 A;  4WB0 A;  1X29 A;  3DRD A;  2D65 A;  4F5F A;  3PAA A;  1M0N A;  1AIA A;  1AJS B;  2GMU A;  2R5C B;  3HVY A;  1E5E A;  4KYO A;  4W8I A;  4RKD A;  4XJP A;  4BA4 A;  2QA3 A;  3GSB A;  2ZUK A;  1CZE A;  3FZ7 A;  4WXG A;  4WB0 B;  3B1E A;  4F5K A;  1I41 A;  4ZLV A;  1B5P A;  3LG0 A;  1ASL A;  2W7L A;  4CVQ A;  1AIB A;  3A9X A;  3EI7 A;  4ZWM A;  2DR1 A;  4R2N A;  1MAQ A;  2D66 A;  2VMN A;  1GC0 A;  5DJ9 A;  3R9A A;  2OKK A;  3AV7 A;  4B98 A;  1BJ4 A;  5EUE A;  4MSO A;  5EQC A;  1CL2 A;  2E7U A;  4K2B A;  3EI8 A;  3NNK A;  1ZOD A;  2EPJ A;  1VJO A;  2D7Y A;  2DKB A;  2Z1Y A;  4P7Y A;  3ELP A;  5E3K A;  1MLY A;  1TOG A;  3I4J A;  1CL1 A;  3VK2 A;  1GEX A;  3B46 A;  1AHF A;  4RAE A;  2W7I A;  4W5K A;  2CJH A;  2W7F A;  3ZZK A;  2VI8 A;  2RFV A;  4XJL A;  2GB3 A;  2V0Y A;  2O0R A;  2ZC0 A;  4IXO A;  3W1H A;  1SZK A;  3A2B A;  2YRR A;  1UKJ A;  3HQT A;  1CQ7 A;  2W7H A;  2O7C A;  1OXP A;  1AHE A;  2DOU A;  3AEM A;  5DB5 A;  1SFF A;  1G4V A;  2R2N A;  3VOM A;  2YRI A;  4E3R A;  2JJE A;  4MQP A;  4OBU A;  4ZSY A;  4UQV A;  3W1I A;  1QIT A;  4HVK A;  5AX8 A;  2ZSM A;  1SZU A;  3ZZJ A;  1QIR A;  1ASG A;  1IBJ A;  4W1V A;  4F4E A;  4IW7 A;  4DGT A;  1D7S A;  1I29 A;  2ZY4 A;  1MDZ A;  3FZ8 A;  3ASA A;  1MDO A;  2NMP A;  5E4Z A;  2D63 A;  3NX3 A;  4ZAH A;  2BWO A;  7AAT A;  2BI2 A;  1AKB A;  3KGX A;  5I92 A;  2GQN A;  4JF1 A;  1XEY A;  3RI6 A;  4M2J A;  3VK3 A;  4F5J A;  1OHW A;  4CBR A;  1BW0 A;  3CQ5 A;  3JW9 A;  3AEJ C;  3E9K A;  4JEV A;  4UOY A;  3AEM C;  3KKI A;  1WYT A;  3LV2 A;  4ADD A;  1C7O A;  2AEV A;  3PDB B;  2HZP A;  3RBL A;  2VMW A;  4A6T A;  3BWN A;  4OYT A;  3COG A;  3T32 A;  5HDM A;  1ART A;  1C7G A;  4EB5 A;  4LNL A;  4MQR A;  3M5U A;  2CY8 A;  5F8V A;  1B8G A;  1UU0 A;  4A00 A;  1SVV A;  2Z67 A;  4ZDL A;  3WZF A;  3BS8 A;  1CJ0 A;  2W8J A;  1PG8 A;  3ATH A;  4WYF A;  3A9Z A;  1W23 A;  3ZRP A;  1YNU A;  1TOI A;  2BWP A;  3LVM A;  2FYF A;  1O61 A;  2OKJ A;  2HOR A;  2YCN A;  2ZP7 A;  4ITX A;  2WK8 A;  2BYJ A;  3PIU A;  4LC3 A;  1AAW A;  3E2Z A;  5BJ4 A;  1AMQ A;  3ISL A;  1GD9 A;  4PIW A;  1TPL A;  1KKP A;  1ARS A;  1ZC9 A;  2C7T A;  1I43 A;  3PA9 A;  3EZS A;  5BJ3 A;  1QJ3 A;  1N2T A;  3BWN C;  4B9B A;  3CQ4 A;  3FFR A;  3NRA A;  1OAT A;  4MKK A;  5G09 A;  2YHK A;  1AMS A;  1BJO A;  3MAF A;  2D7Z A;  4J8L A;  3UWC A;  3FRK A;  2AY3 A;  1DFO A;  4Q75 A;  4OT8 A;  1AY5 A;  3D6K A;  2W7E A;  4WLH A;  1AMA A;  2W7G A;  2OAT A;  3B8X A;  5M46 A;  4XAU A;  4ATQ A;  3R4T A;  1V72 A;  2VGU A;  2BIG A;  4PVF A;  4RIT A;  3NU7 A;  3MAF B;  2O1B A;  1LC5 A;  1LS3 A;  1TAS A;  3FVS A;  3LY1 A;  3FKD A;  3WKS A;  1GEW A;  4RJ0 A;  2Z61 A;  2E7I A;  3NTJ A;  2JJG A;  4UHN A;  1D2F A;  2AY1 A;  5DX5 A;  3B1D A;  1M0O A;  1SPA A;  4ZWV A;  3ZRQ A;  1P3W A;  4IXS A;  2FNU A;  3K7Y A;  2VMX A;  5TF5 A;  3KGW A;  3EIA A;  5IWQ A;  1WYU A;  2HUU A;  4A72 A;  4ZM4 A;  3PD6 B;  3DC1 A;  4JEW A;  4M2M A;  5F9S A;  1C0N A;  3G0T A;  4W91 A;  1KL2 A;  3DXW A;  2W8U A;  1M6S A;  3FZ6 A;  3DU4 A;  4ADB A;  4EB7 A;  3AAT A;  4F5I A;  4GEB A;  3BCB A;  4F5G A;  4JEX A;  3EI6 A;  1GBN A;  1G7W A;  4ZSW A;  3QI6 A;  4OC9 A;  1ASB A;  1GC3 A;  4Y0D A;  3WX9 A;  5M4B A;  1J32 A;  4WYC A;  1EG5 A;  1S06 A;  2QLR A;  4IYO A;  1V2E A;  4WLJ A;  3PDX A;  4LNJ A;  3FCR A;  2VGZ A;  1ASC A;  1IAY A;  3GR9 A;  2QB3 A;  1YJY A;  1LW5 A;  3HDO A;  1O69 A;  2FQ6 A;  4H51 A;  3ZRR A;  3GZD A;  1Z7D A;  1N31 A;  3FQ7 A;  1E5F A;  5EIG A;  1LW4 A;  4CBS A;  2OGA A;  4IX8 A;  1ORD A;  2ORD A;  2Z9U A;  5FT5 A;  1PFF A;  2EGY A;  2CIN A;  3W1J A;  1BJW A;  4MGR A;  3LVJ A;  3EI5 A;  1OHV A;  4JEY A;  1S09 A;  1ASA A;  1M7Y A;  1T3I A;  4MKJ A;  3VP6 A;  1M4N A;  1H1C A;  1S07 A;  1SF2 A;  4GDY A;  3ASB A;  4RM1 A;  2DGM A;  4LW4 A;  2BI9 A;  3WGC A;  3AEN A;  1I48 A;  1S08 A;  1TOK A;  1WKG A;  2DKJ A;  3FVX A;  3DOD A;  4CXQ A;  1S0A A;  1ARG A;  5FT8 A;  1C4K A;  3GZD C;  3EI9 A;  3GJU A;  1AJR A;  1BQD A;  1IX8 A;  3MC6 A;  1D7U A;  1M0P A;  3UAK A;  3NUB A;  1ELQ A;  4IY7 A;  2VMR A;  1QZ9 A;  2YOB A;  3QHX A;  2X5F A;  4FL0 A;  3I5T A;  3AEN B;  4ITG A;  3P6K A;  2VYC A;  4WBT A;  2BI3 A;  4ZDO A;  4GE4 A;  3VAX A;  2FM1 A;  4GSA A;  3FSL A;  4WYE A;  1W7M A;  3GWP A;  3UE8 A;  2GSA A;  1PMM A;  3MAD A;  1XI9 A;  2YKX A;  3F9T A;  1AMR A;  3QGU A;  2Z9X A;  3CQ6 A;  4PFF A;  3TFU A;  2JGT A;  2VMY A;  3AEL A;  2W8W A;  1YIY A;  5M4D A;  3BCX A;  2HOX A;  2QB2 A;  3MEB A;  2VGW A;  4Q6R A;  1AHX A;  1QIS A;  1OXO A;  4LW2 A;  3AEO A;  1TAT A;  1WYT B;  3NDN A;  3MC6 C;  3DZZ A;  4WXB A;  1FG7 A;  1J04 A;  5EUD A;  2BHX A;  1QGN A;  1RV3 A;  3CAI A;  4M2K A;  1IX6 A;  2Z1Z A;  3GBX A;  1WYV A;  1CQ6 A;  4FFC A;  2Z20 A;  3PGY A;  5LHA A;  1BT4 A;  1AY8 A;  2VMU A;  3EUC A;  4BA5 A;  2X5D A;  5FT4 A;  1WST A;  3HLM A;  9AAT A;  2BI5 A;  3FQA A;  4WP0 A;  2JJF A;  1JF9 A;  1YAA A;  2HP2 A;  2HUF A;  2Z9W A;  4TN4 A;  1IUG A;  2BKW A;  5E5I A;  2VGS A;  4XK1 A;  2Q7W A;  4UHO A;  3II0 A;  2EO5 A;  1MGV A;  1WKH A;  2WKA A;  4WXF A;  2JJH A;  4AO9 A;  1QJ5 A;  2W7K A;  4WD2 A;  1MAP A;  2VGT A;  2X3L A;  2ZY3 A;  2CJG A;  4F5H A;  1ARH A;  2CAN A;  3E2Z B;  3NYU A;  2ZSL A;  4EFF A;  2D61 A;  3FD0 A;  2YKV A;  2AY5 A;  2VMP A;  1OHY A;  1EJI A;  1AY4 A;  1B4X A;  4BQ0 A;  3DR4 A;  3TFT A;  2R5E A;  3NYT A;  4E3Q A;  2AY6 A;  1MDX A;  2QBT A;  2R0T A;  4WYG A;  5JAY A;  1BJO B;  4JE5 D;  4NOG A;  3PPL A;  2XBN A;  4OCA A;  3L8A A;  3P1T A;  4A6R A;  1VP4 A;  2VLH A;  3FVU A;  2YKY A;  4JE5 A;  4W1X A;  1IVR A;  1ASN A;  3JTX A;  3IF2 A;  4WYA A;  2GMS A;  3BC8 A;  3FFH A;  4A6U A;  4MY5 A;  3QPG A;  1C9C A;  2CJD A;  5DJ1 A;  1DKA A;  2F8J A;  3K40 A;  1YJS A;  1PMO A;  2BYL A;  1AAM A;  3EZ1 A;  1VEF A;  3TQX A;  2FN6 A;  3PJ0 A;  1X2A A;  1D7R A;  2HOY A;  4XQ2 A;  1LC8 A;  3QM2 A;  1V2F A;  1UU1 A;  1TOE A;  2R5C A;  3E2Y A;  2VMO A;  2C81 A;  2BI1 A;  4AH3 A;  1GDE A;  1ASD A;  3OP7 A;  3N75 A;  3A9Y A;  3MKJ A;  3JWB A;  5K8B A;  1RVU A;  1V2D A;  1WYU B;  3Q8N A;  5C6U A;  1IAX A;  1GC2 A;  3FQ8 A;  3DXV A;  2YCP A;  2AY9 A;  2VMV A;  2CST A;  1YJZ A;  1KL1 A;  1EQB A;  1M0Q A;  2PB2 A;  3BCA A;  3HMU A;  3MAU A;  3G8M A;  3JWA A;  4OTL A;  5HXX A;  1ZOB A;  1AHG A;  2EZ1 A;  1D7V A;  2HUI A;  2VGV A;  2W8V A;  3GET A;  3H14 A;  4OBV A;  3AOV A;  4A0G A;  4ISY A;  3H7F A;  1LKC A;  2HP1 A;  1RVY A;  2Z9V A;  4GE7 A;  4AOA A;  3LVK A;  4AO4 A;  1M32 A;  4IYO B;  4TV7 A;  1DJE A;  2BIE A;  3NUI A;  4RLG A;  2JIS A;  4U2H A;  2BIA A;  2AY2 A;  1B9H A;  2E7J A;  2ZYJ A;  5G4J A;  1G4X A;  8AAT A;  1ELU A;  2W7J A;  3FTB A;  2AY4 A;  1B5O A;  4ZDP A;  1X0M A;  1G7X A;  1DGE A;  2OGE A;  2D5Y A;  1AHY A;  3JZL A;  2QMA A;  4KAM A;  5EIG B;  5EFS A;  3HBX A;  2V1P A;  1CZC A;  3G7Q A;  2W7D A;  2AEU A;  1W7L A;  2CH2 A;  4IXZ A;  2DGK A;  5EAV A;  3USF A;  3HT4 A;  1GC4 A;  1BQA A;  3MBB A;  1SZS A;  3N0L A;  4BHD A;  3DYD A;  3WGB A;  4P3M A;  4TMR A;  4F5M A;  2FNI A;  1BS0 A;  2PO3 A;  4W1W A;  2ZY2 A;  3RCH A;  4EU1 A;  2W7M A;  2AY7 A;  2XH1 A;  2VMQ A;  1W7N A;  4LNM A;  3FDD A;  3LWS A;  4PFN A;  3BWO A;  2HOZ A;  3K28 A;  1DJU A;  5G2Q A;  1TOJ A;  3AEJ A;  1DJ9 A;  2YKU A;  3ACZ A;  2WK9 A;  2EZ2 A;  3E6G A;  5G2P A;  4ADC A;  3E2F A;  1O4S A;  4EMY A;  1RV4 A;  3HL2 A;  4Y0H A;  2YCT A;  3JU7 A;  3QBO A;  4JEZ A;  5J8Q A;  3RBF A;  3RCH B;  2X8U A;  2CFB A;  3WY7 A;  5LH9 A;  2C0R A;  4CXR A;  2JG2 A;  4XJO A;  5D95 A;  4OMA A;  1GCK A;  1BKG A;  5M49 A;  1JS6 A;  2CB1 A;  2VMS A;  2W8T A;  5G0A A;  3WLX A;  4A0F A;  2VMT A;  3PDB A;  2DGL A;  4U1T A;  1MLZ A;  5G4I A;  2VLF A;  1AKA A;  3E77 A;  2WK7 A;  1N8P A;  4AZJ A;  3GZC A;  3IHJ A;  4A0R A;  4WYD A;  3ELE A;  2VMZ A;  4F5L A;  3OKS A;  2E54 A;  4ZM3 A;  3BN1 A;  1B9I A;  1AX4 A;  5D5S A;  2VI9 A;  3TAT A;  1KKJ A;  4KXK A;  4R8D A;  2PB0 A;  2ZJG A;  3DR7 A;  1BJN A;  3I16 A;  3L44 A;  4E77 A;  3NU8 A;  2CH1 A;  2G6W A;  3WKR A;  4R5F A;  3AOW A;  1X28 A;  4XEW A;  4A0H A;  1UU2 A;  4I8A A;  1CQ8 A;  1YOO A;  4N0W A;  4BMK A;  2OQX A;  4DBC A;  1C7N A;  3ECD A;  4R5Z A;  4RKC A;  3BV0 A;  5HHY A;  4Y0I A;  1H0C A;  1JS3 A;  3QN6 A;  4HF8 A;  1WYV B;  4JF0 A;  4UHM A;  4AZK A;  3AEP A;  4MQQ A;  2TPL A;  3KE3 A;  3RUY A;  1TAR A;  4ZAS A;  1AIC A;  1ASM A;  3WCO A;  4J5U A;  3EIB A;  1W3U A;  3F0H A;  4Q31 A;  1DGD A;  1JG8 A;  4Q76 A;  1KMK A;  3LVL B;  1GEY A;  2AAT A;  1ASF A;  1KMJ A;  1FG3 A;  2D64 A;  1ASE A;  5EUN A;  3N5M A;  1LC7 A;  4QGR A;  5EAA A;  2VIA A;  4L0O A;  3VK4 A;  4GE9 A;  2ZY5 A;  5FT6 A;  4E1O A;  4ADE A;  1FC4 A;  4XJM A;  4N0B A;  1ARI A;  1AKC A;  1Z3Z A;  3BB8 A;  3F6T A;  1LK9 A;  3B1C A;  3TCM A;  3WCN A;  3NYS A;  4RJY A;  4ATP A;  2BWN A;  3FDB A;  4GRX A;  4K2M A;  1AJS A;  1YIZ A;  4O6Z A;  2EH6 A;  1CS1 A;  4K2I A;  1O62 A;  4DQ6 A;  3PD6 A;  4RIZ A;  2CTZ A;  3CBF A;  1ECX A;  1DTY A;  2AY8 A; 
#chains in the Genus database with same CATH topology
 3A8U X;  1IX7 A;  1Y4I A;  2C44 A;  2VIB A;  3RQ1 A;  1IJI A;  5KTB A;  1U08 A;  4WB0 A;  1X29 A;  3DRD A;  2D65 A;  4F5F A;  3PAA A;  1M0N A;  1AIA A;  1AJS B;  2GMU A;  2R5C B;  3HVY A;  1E5E A;  4KYO A;  4W8I A;  4RKD A;  4XJP A;  4BA4 A;  2QA3 A;  3GSB A;  2ZUK A;  1CZE A;  3FZ7 A;  4WXG A;  4WB0 B;  3B1E A;  4F5K A;  1I41 A;  4ZLV A;  1B5P A;  3LG0 A;  1ASL A;  2W7L A;  4CVQ A;  1AIB A;  3A9X A;  3EI7 A;  4ZWM A;  2DR1 A;  4R2N A;  1MAQ A;  2D66 A;  2VMN A;  1GC0 A;  5DJ9 A;  3R9A A;  2OKK A;  3AV7 A;  4B98 A;  1BJ4 A;  5EUE A;  4MSO A;  5EQC A;  1CL2 A;  2E7U A;  4K2B A;  3EI8 A;  3NNK A;  1ZOD A;  2EPJ A;  1VJO A;  2D7Y A;  2DKB A;  2Z1Y A;  4P7Y A;  3ELP A;  5E3K A;  1MLY A;  1TOG A;  3I4J A;  1CL1 A;  3VK2 A;  1GEX A;  3B46 A;  1AHF A;  4RAE A;  2W7I A;  4W5K A;  2CJH A;  2W7F A;  3ZZK A;  2VI8 A;  2RFV A;  4XJL A;  2GB3 A;  2V0Y A;  2O0R A;  2ZC0 A;  4IXO A;  3W1H A;  1SZK A;  3A2B A;  2YRR A;  1UKJ A;  3HQT A;  1CQ7 A;  2W7H A;  2O7C A;  1OXP A;  1AHE A;  2DOU A;  3AEM A;  5DB5 A;  1SFF A;  1G4V A;  2R2N A;  3VOM A;  2YRI A;  4E3R A;  2JJE A;  4MQP A;  4OBU A;  4ZSY A;  4UQV A;  3W1I A;  1QIT A;  4HVK A;  5AX8 A;  2ZSM A;  1SZU A;  3ZZJ A;  1QIR A;  1ASG A;  1IBJ A;  4W1V A;  4F4E A;  4IW7 A;  4DGT A;  1D7S A;  1I29 A;  2ZY4 A;  1MDZ A;  3FZ8 A;  3ASA A;  1MDO A;  2NMP A;  5E4Z A;  2D63 A;  3NX3 A;  4ZAH A;  2BWO A;  7AAT A;  2A1V A;  2BI2 A;  1AKB A;  3KGX A;  5I92 A;  2GQN A;  4JF1 A;  1XEY A;  3RI6 A;  4M2J A;  3VK3 A;  4F5J A;  1OHW A;  4CBR A;  1BW0 A;  3CQ5 A;  3JW9 A;  3AEJ C;  3E9K A;  4JEV A;  4UOY A;  3AEM C;  3KKI A;  1WYT A;  3LV2 A;  4ADD A;  1C7O A;  2AEV A;  3PDB B;  2HZP A;  3RBL A;  2VMW A;  4A6T A;  3BWN A;  4OYT A;  3COG A;  3T32 A;  5HDM A;  1ART A;  1C7G A;  4EB5 A;  4LNL A;  4MQR A;  3M5U A;  2CY8 A;  5F8V A;  1B8G A;  1UU0 A;  4A00 A;  1SVV A;  2Z67 A;  4ZDL A;  3WZF A;  3BS8 A;  1CJ0 A;  2W8J A;  1PG8 A;  3ATH A;  4WYF A;  3A9Z A;  1W23 A;  3ZRP A;  1YNU A;  1TOI A;  2BWP A;  3LVM A;  2FYF A;  1O61 A;  2OKJ A;  2HOR A;  2YCN A;  2ZP7 A;  4ITX A;  2WK8 A;  2BYJ A;  3PIU A;  4LC3 A;  1KAF A;  1AAW A;  3E2Z A;  5BJ4 A;  1AMQ A;  3ISL A;  1GD9 A;  4PIW A;  1TPL A;  1KKP A;  1ARS A;  1ZC9 A;  2C7T A;  1I43 A;  3PA9 A;  3EZS A;  5BJ3 A;  1QJ3 A;  1N2T A;  3BWN C;  4B9B A;  3CQ4 A;  3FFR A;  3NRA A;  1OAT A;  4MKK A;  5G09 A;  2YHK A;  1AMS A;  1BJO A;  3MAF A;  2D7Z A;  4J8L A;  3UWC A;  3FRK A;  3N4S A;  2AY3 A;  1DFO A;  4Q75 A;  4OT8 A;  4K05 A;  1AY5 A;  3D6K A;  2W7E A;  4WLH A;  1AMA A;  2W7G A;  2OAT A;  3B8X A;  5M46 A;  4XAU A;  4ATQ A;  2KFP A;  3R4T A;  1V72 A;  2VGU A;  2BIG A;  4PVF A;  4RIT A;  3NU7 A;  3MAF B;  2O1B A;  1LC5 A;  1LS3 A;  1TAS A;  3FVS A;  3LY1 A;  3FKD A;  3WKS A;  1GEW A;  4RJ0 A;  2Z61 A;  2E7I A;  3NTJ A;  2JJG A;  4UHN A;  1D2F A;  2AY1 A;  5DX5 A;  3B1D A;  2WB6 A;  1M0O A;  1SPA A;  4ZWV A;  3ZRQ A;  1P3W A;  4IXS A;  2FNU A;  3K7Y A;  2VMX A;  5TF5 A;  3KGW A;  3EIA A;  5IWQ A;  1WYU A;  2HUU A;  4A72 A;  4ZM4 A;  3PD6 B;  3DC1 A;  4JEW A;  4M2M A;  5F9S A;  1C0N A;  3G0T A;  4W91 A;  1KL2 A;  3DXW A;  2W8U A;  1M6S A;  3FZ6 A;  3DU4 A;  4ADB A;  4EB7 A;  3AAT A;  4F5I A;  4GEB A;  3BCB A;  4F5G A;  4JEX A;  3EI6 A;  1GBN A;  1G7W A;  4ZSW A;  3QI6 A;  4OC9 A;  1ASB A;  1GC3 A;  4Y0D A;  3WX9 A;  5M4B A;  1J32 A;  4WYC A;  1EG5 A;  1S06 A;  2QLR A;  4IYO A;  1V2E A;  4WLJ A;  3PDX A;  4LNJ A;  3FCR A;  2VGZ A;  1ASC A;  1IAY A;  3GR9 A;  2QB3 A;  1YJY A;  1LW5 A;  3HDO A;  1O69 A;  2FQ6 A;  4H51 A;  3ZRR A;  3GZD A;  1Z7D A;  1N31 A;  3FQ7 A;  1E5F A;  5EIG A;  1LW4 A;  4CBS A;  2OGA A;  4IX8 A;  1ORD A;  2ORD A;  2Z9U A;  5FT5 A;  1PFF A;  2EGY A;  2CIN A;  3W1J A;  1BJW A;  4MGR A;  3LVJ A;  3EI5 A;  1OHV A;  4JEY A;  1S09 A;  1ASA A;  1M7Y A;  1T3I A;  4MKJ A;  2EYQ A;  3VP6 A;  1M4N A;  1H1C A;  1S07 A;  1SF2 A;  4GDY A;  3ASB A;  4RM1 A;  2DGM A;  4LW4 A;  2BI9 A;  3WGC A;  3AEN A;  1I48 A;  1S08 A;  1TOK A;  1WKG A;  2DKJ A;  3FVX A;  3DOD A;  4CXQ A;  1S0A A;  1ARG A;  5FT8 A;  1C4K A;  3GZD C;  3EI9 A;  3GJU A;  1AJR A;  1BQD A;  1IX8 A;  3MC6 A;  1D7U A;  1M0P A;  3UAK A;  3NUB A;  1ELQ A;  4IY7 A;  2VMR A;  1QZ9 A;  2YOB A;  3QHX A;  2X5F A;  4FL0 A;  3I5T A;  3AEN B;  4ITG A;  3P6K A;  2VYC A;  4WBT A;  2BI3 A;  4ZDO A;  4GE4 A;  3VAX A;  2FM1 A;  4GSA A;  3FSL A;  4WYE A;  1W7M A;  3GWP A;  3UE8 A;  2GSA A;  1PMM A;  3MAD A;  1XI9 A;  2YKX A;  3F9T A;  1AMR A;  3QGU A;  2FKI A;  2Z9X A;  3CQ6 A;  4PFF A;  3TFU A;  2JGT A;  2VMY A;  3AEL A;  2W8W A;  1YIY A;  5M4D A;  3BCX A;  2HOX A;  2QB2 A;  3MEB A;  2VGW A;  4Q6R A;  1AHX A;  1QIS A;  1OXO A;  4LW2 A;  3AEO A;  1TAT A;  1WYT B;  3NDN A;  3MC6 C;  3DZZ A;  4WXB A;  1FG7 A;  1J04 A;  5EUD A;  2BHX A;  1QGN A;  1RV3 A;  3CAI A;  4M2K A;  1IX6 A;  2Z1Z A;  3GBX A;  1WYV A;  1CQ6 A;  4FFC A;  2Z20 A;  3PGY A;  5LHA A;  1BT4 A;  1AY8 A;  2VMU A;  3EUC A;  4BA5 A;  2X5D A;  5FT4 A;  1WST A;  3HLM A;  9AAT A;  2BI5 A;  3FQA A;  4WP0 A;  2JJF A;  1JF9 A;  1YAA A;  2HP2 A;  2HUF A;  2Z9W A;  4TN4 A;  1IUG A;  2BKW A;  5E5I A;  2VGS A;  4XK1 A;  2Q7W A;  4UHO A;  3II0 A;  2EO5 A;  1MGV A;  1WKH A;  2WKA A;  4WXF A;  2JJH A;  4AO9 A;  1QJ5 A;  2W7K A;  4WD2 A;  1MAP A;  2VGT A;  2X3L A;  2ZY3 A;  2CJG A;  4F5H A;  1ARH A;  2CAN A;  3E2Z B;  3NYU A;  2ZSL A;  4EFF A;  2D61 A;  3FD0 A;  2YKV A;  2AY5 A;  2VMP A;  1OHY A;  1EJI A;  1AY4 A;  1B4X A;  2QSR A;  4BQ0 A;  3DR4 A;  3TFT A;  2R5E A;  3NYT A;  4E3Q A;  2AY6 A;  1MDX A;  2QBT A;  2R0T A;  4WYG A;  5JAY A;  1BJO B;  4JE5 D;  4NOG A;  3PPL A;  2XBN A;  4OCA A;  3L8A A;  3P1T A;  4A6R A;  1VP4 A;  2VLH A;  3FVU A;  2YKY A;  4JE5 A;  4W1X A;  1IVR A;  1ASN A;  3JTX A;  3IF2 A;  4WYA A;  2GMS A;  3BC8 A;  3FFH A;  4A6U A;  4MY5 A;  3QPG A;  1C9C A;  2CJD A;  5DJ1 A;  1DKA A;  2F8J A;  3K40 A;  1YJS A;  1PMO A;  2BYL A;  1AAM A;  3EZ1 A;  1VEF A;  3TQX A;  2FN6 A;  3PJ0 A;  1X2A A;  1D7R A;  2HOY A;  4XQ2 A;  1LC8 A;  3QM2 A;  1V2F A;  2G7J A;  1UU1 A;  1TOE A;  2R5C A;  3E2Y A;  2VMO A;  2C81 A;  2BI1 A;  4AH3 A;  1GDE A;  1ASD A;  3OP7 A;  3N75 A;  3A9Y A;  3MKJ A;  3JWB A;  5K8B A;  1RVU A;  1V2D A;  1WYU B;  3Q8N A;  5C6U A;  1IAX A;  1GC2 A;  3FQ8 A;  3DXV A;  2YCP A;  2AY9 A;  2VMV A;  2CST A;  1YJZ A;  1KL1 A;  1EQB A;  1M0Q A;  2PB2 A;  3BCA A;  3HMU A;  3MAU A;  3G8M A;  3JWA A;  4OTL A;  5HXX A;  1ZOB A;  1AHG A;  2EZ1 A;  1D7V A;  2HUI A;  2VGV A;  2W8V A;  3GET A;  3H14 A;  4OBV A;  3AOV A;  4A0G A;  4ISY A;  3H7F A;  1LKC A;  2HP1 A;  1RVY A;  2Z9V A;  4GE7 A;  4AOA A;  3LVK A;  4AO4 A;  1M32 A;  4IYO B;  4TV7 A;  1DJE A;  2BIE A;  3NUI A;  4RLG A;  2JIS A;  4U2H A;  2BIA A;  2AY2 A;  1B9H A;  2E7J A;  2ZYJ A;  5G4J A;  1G4X A;  8AAT A;  1ELU A;  2W7J A;  3FTB A;  2AY4 A;  1B5O A;  4ZDP A;  1X0M A;  1G7X A;  1DGE A;  2OGE A;  2D5Y A;  1AHY A;  3JZL A;  2QMA A;  4KAM A;  5EIG B;  5EFS A;  3HBX A;  2V1P A;  1CZC A;  3G7Q A;  2W7D A;  2AEU A;  1W7L A;  2CH2 A;  4IXZ A;  2DGK A;  5EAV A;  3USF A;  3HT4 A;  1GC4 A;  1BQA A;  3MBB A;  1SZS A;  3N0L A;  4BHD A;  3DYD A;  3WGB A;  4P3M A;  4TMR A;  4F5M A;  2FNI A;  1BS0 A;  2PO3 A;  4W1W A;  2ZY2 A;  3RCH A;  4EU1 A;  2W7M A;  2AY7 A;  2XH1 A;  2VMQ A;  1W7N A;  4LNM A;  3FDD A;  3LWS A;  4PFN A;  3BWO A;  2HOZ A;  3K28 A;  3N4X A;  1DJU A;  5G2Q A;  1TOJ A;  3AEJ A;  1DJ9 A;  2YKU A;  3ACZ A;  2WK9 A;  2EZ2 A;  3E6G A;  5G2P A;  4ADC A;  3E2F A;  1O4S A;  4EMY A;  1RV4 A;  3HL2 A;  4Y0H A;  2YCT A;  3JU7 A;  3QBO A;  4JEZ A;  5J8Q A;  3RBF A;  3RCH B;  2X8U A;  2CFB A;  3WY7 A;  3N7N A;  5LH9 A;  2C0R A;  4CXR A;  2JG2 A;  4XJO A;  5D95 A;  4OMA A;  1GCK A;  1BKG A;  5M49 A;  1JS6 A;  2CB1 A;  2VMS A;  2W8T A;  5G0A A;  3WLX A;  4A0F A;  2VMT A;  3PDB A;  2DGL A;  4U1T A;  1MLZ A;  5G4I A;  2VLF A;  1AKA A;  3E77 A;  2WK7 A;  1N8P A;  4AZJ A;  3GZC A;  3IHJ A;  4A0R A;  4WYD A;  3ELE A;  2VMZ A;  4F5L A;  3OKS A;  2E54 A;  4ZM3 A;  3BN1 A;  1B9I A;  1AX4 A;  5D5S A;  2VI9 A;  3TAT A;  1KKJ A;  4KXK A;  4R8D A;  2PB0 A;  2ZJG A;  3DR7 A;  1BJN A;  3I16 A;  3L44 A;  3N4R A;  4E77 A;  3NU8 A;  2CH1 A;  2G6W A;  3WKR A;  4R5F A;  3AOW A;  1X28 A;  4XEW A;  4A0H A;  1UU2 A;  4I8A A;  1CQ8 A;  1YOO A;  4N0W A;  4BMK A;  2OQX A;  4DBC A;  1C7N A;  3ECD A;  4R5Z A;  4RKC A;  3BV0 A;  5HHY A;  4Y0I A;  1H0C A;  1JS3 A;  3QN6 A;  4HF8 A;  1WYV B;  4JF0 A;  4UHM A;  4AZK A;  3AEP A;  4MQQ A;  2TPL A;  3KE3 A;  3RUY A;  1TAR A;  4ZAS A;  1AIC A;  1ASM A;  3WCO A;  4J5U A;  3EIB A;  1W3U A;  3F0H A;  4Q31 A;  1DGD A;  1JG8 A;  4Q76 A;  1KMK A;  3LVL B;  1GEY A;  2AAT A;  1ASF A;  1KMJ A;  1FG3 A;  2D64 A;  1ASE A;  5EUN A;  3N5M A;  1LC7 A;  4QGR A;  5EAA A;  2VIA A;  3H9X A;  4L0O A;  3VK4 A;  4GE9 A;  2ZY5 A;  5FT6 A;  4E1O A;  4ADE A;  1FC4 A;  4XJM A;  4N0B A;  1ARI A;  4H63 Q;  1AKC A;  1Z3Z A;  3BB8 A;  3F6T A;  1LK9 A;  3B1C A;  3TCM A;  3WCN A;  3NYS A;  4RJY A;  4ATP A;  2BWN A;  3FDB A;  4GRX A;  4K2M A;  1AJS A;  1YIZ A;  4O6Z A;  2EH6 A;  1CS1 A;  4K2I A;  1O62 A;  4DQ6 A;  3PD6 A;  4RIZ A;  2CTZ A;  3CBF A;  1ECX A;  1DTY A;  2AY8 A; 
#chains in the Genus database with same CATH homology
 3A8U X;  1IX7 A;  1Y4I A;  2C44 A;  2VIB A;  3RQ1 A;  1IJI A;  5KTB A;  1U08 A;  4WB0 A;  1X29 A;  3DRD A;  2D65 A;  4F5F A;  3PAA A;  1M0N A;  1AIA A;  1AJS B;  2GMU A;  2R5C B;  3HVY A;  1E5E A;  4KYO A;  4W8I A;  4RKD A;  4XJP A;  4BA4 A;  2QA3 A;  3GSB A;  2ZUK A;  1CZE A;  3FZ7 A;  4WXG A;  4WB0 B;  3B1E A;  4F5K A;  1I41 A;  4ZLV A;  1B5P A;  3LG0 A;  1ASL A;  2W7L A;  4CVQ A;  1AIB A;  3A9X A;  3EI7 A;  4ZWM A;  2DR1 A;  4R2N A;  1MAQ A;  2D66 A;  2VMN A;  1GC0 A;  5DJ9 A;  3R9A A;  2OKK A;  3AV7 A;  4B98 A;  1BJ4 A;  5EUE A;  4MSO A;  5EQC A;  1CL2 A;  2E7U A;  4K2B A;  3EI8 A;  3NNK A;  1ZOD A;  2EPJ A;  1VJO A;  2D7Y A;  2DKB A;  2Z1Y A;  4P7Y A;  3ELP A;  5E3K A;  1MLY A;  1TOG A;  3I4J A;  1CL1 A;  3VK2 A;  1GEX A;  3B46 A;  1AHF A;  4RAE A;  2W7I A;  4W5K A;  2CJH A;  2W7F A;  3ZZK A;  2VI8 A;  2RFV A;  4XJL A;  2GB3 A;  2V0Y A;  2O0R A;  2ZC0 A;  4IXO A;  3W1H A;  1SZK A;  3A2B A;  2YRR A;  1UKJ A;  3HQT A;  1CQ7 A;  2W7H A;  2O7C A;  1OXP A;  1AHE A;  2DOU A;  3AEM A;  5DB5 A;  1SFF A;  1G4V A;  2R2N A;  3VOM A;  2YRI A;  4E3R A;  2JJE A;  4MQP A;  4OBU A;  4ZSY A;  4UQV A;  3W1I A;  1QIT A;  4HVK A;  5AX8 A;  2ZSM A;  1SZU A;  3ZZJ A;  1QIR A;  1ASG A;  1IBJ A;  4W1V A;  4F4E A;  4IW7 A;  4DGT A;  1D7S A;  1I29 A;  2ZY4 A;  1MDZ A;  3FZ8 A;  3ASA A;  1MDO A;  2NMP A;  5E4Z A;  2D63 A;  3NX3 A;  4ZAH A;  2BWO A;  7AAT A;  2A1V A;  2BI2 A;  1AKB A;  3KGX A;  5I92 A;  2GQN A;  4JF1 A;  1XEY A;  3RI6 A;  4M2J A;  3VK3 A;  4F5J A;  1OHW A;  4CBR A;  1BW0 A;  3CQ5 A;  3JW9 A;  3AEJ C;  3E9K A;  4JEV A;  4UOY A;  3AEM C;  3KKI A;  1WYT A;  3LV2 A;  4ADD A;  1C7O A;  2AEV A;  3PDB B;  2HZP A;  3RBL A;  2VMW A;  4A6T A;  3BWN A;  4OYT A;  3COG A;  3T32 A;  5HDM A;  1ART A;  1C7G A;  4EB5 A;  4LNL A;  4MQR A;  3M5U A;  2CY8 A;  5F8V A;  1B8G A;  1UU0 A;  4A00 A;  1SVV A;  2Z67 A;  4ZDL A;  3WZF A;  3BS8 A;  1CJ0 A;  2W8J A;  1PG8 A;  3ATH A;  4WYF A;  3A9Z A;  1W23 A;  3ZRP A;  1YNU A;  1TOI A;  2BWP A;  3LVM A;  2FYF A;  1O61 A;  2OKJ A;  2HOR A;  2YCN A;  2ZP7 A;  4ITX A;  2WK8 A;  2BYJ A;  3PIU A;  4LC3 A;  1AAW A;  3E2Z A;  5BJ4 A;  1AMQ A;  3ISL A;  1GD9 A;  4PIW A;  1TPL A;  1KKP A;  1ARS A;  1ZC9 A;  2C7T A;  1I43 A;  3PA9 A;  3EZS A;  5BJ3 A;  1QJ3 A;  1N2T A;  3BWN C;  4B9B A;  3CQ4 A;  3FFR A;  3NRA A;  1OAT A;  4MKK A;  5G09 A;  2YHK A;  1AMS A;  1BJO A;  3MAF A;  2D7Z A;  4J8L A;  3UWC A;  3FRK A;  3N4S A;  2AY3 A;  1DFO A;  4Q75 A;  4OT8 A;  4K05 A;  1AY5 A;  3D6K A;  2W7E A;  4WLH A;  1AMA A;  2W7G A;  2OAT A;  3B8X A;  5M46 A;  4XAU A;  4ATQ A;  2KFP A;  3R4T A;  1V72 A;  2VGU A;  2BIG A;  4PVF A;  4RIT A;  3NU7 A;  3MAF B;  2O1B A;  1LC5 A;  1LS3 A;  1TAS A;  3FVS A;  3LY1 A;  3FKD A;  3WKS A;  1GEW A;  4RJ0 A;  2Z61 A;  2E7I A;  3NTJ A;  2JJG A;  4UHN A;  1D2F A;  2AY1 A;  5DX5 A;  3B1D A;  2WB6 A;  1M0O A;  1SPA A;  4ZWV A;  3ZRQ A;  1P3W A;  4IXS A;  2FNU A;  3K7Y A;  2VMX A;  5TF5 A;  3KGW A;  3EIA A;  5IWQ A;  1WYU A;  2HUU A;  4A72 A;  4ZM4 A;  3PD6 B;  3DC1 A;  4JEW A;  4M2M A;  5F9S A;  1C0N A;  3G0T A;  4W91 A;  1KL2 A;  3DXW A;  2W8U A;  1M6S A;  3FZ6 A;  3DU4 A;  4ADB A;  4EB7 A;  3AAT A;  4F5I A;  4GEB A;  3BCB A;  4F5G A;  4JEX A;  3EI6 A;  1GBN A;  1G7W A;  4ZSW A;  3QI6 A;  4OC9 A;  1ASB A;  1GC3 A;  4Y0D A;  3WX9 A;  5M4B A;  1J32 A;  4WYC A;  1EG5 A;  1S06 A;  2QLR A;  4IYO A;  1V2E A;  4WLJ A;  3PDX A;  4LNJ A;  3FCR A;  2VGZ A;  1ASC A;  1IAY A;  3GR9 A;  2QB3 A;  1YJY A;  1LW5 A;  3HDO A;  1O69 A;  2FQ6 A;  4H51 A;  3ZRR A;  3GZD A;  1Z7D A;  1N31 A;  3FQ7 A;  1E5F A;  5EIG A;  1LW4 A;  4CBS A;  2OGA A;  4IX8 A;  1ORD A;  2ORD A;  2Z9U A;  5FT5 A;  1PFF A;  2EGY A;  2CIN A;  3W1J A;  1BJW A;  4MGR A;  3LVJ A;  3EI5 A;  1OHV A;  4JEY A;  1S09 A;  1ASA A;  1M7Y A;  1T3I A;  4MKJ A;  2EYQ A;  3VP6 A;  1M4N A;  1H1C A;  1S07 A;  1SF2 A;  4GDY A;  3ASB A;  4RM1 A;  2DGM A;  4LW4 A;  2BI9 A;  3WGC A;  3AEN A;  1I48 A;  1S08 A;  1TOK A;  1WKG A;  2DKJ A;  3FVX A;  3DOD A;  4CXQ A;  1S0A A;  1ARG A;  5FT8 A;  1C4K A;  3GZD C;  3EI9 A;  3GJU A;  1AJR A;  1BQD A;  1IX8 A;  3MC6 A;  1D7U A;  1M0P A;  3UAK A;  3NUB A;  1ELQ A;  4IY7 A;  2VMR A;  1QZ9 A;  2YOB A;  3QHX A;  2X5F A;  4FL0 A;  3I5T A;  3AEN B;  4ITG A;  3P6K A;  2VYC A;  4WBT A;  2BI3 A;  4ZDO A;  4GE4 A;  3VAX A;  2FM1 A;  4GSA A;  3FSL A;  4WYE A;  1W7M A;  3GWP A;  3UE8 A;  2GSA A;  1PMM A;  3MAD A;  1XI9 A;  2YKX A;  3F9T A;  1AMR A;  3QGU A;  2FKI A;  2Z9X A;  3CQ6 A;  4PFF A;  3TFU A;  2JGT A;  2VMY A;  3AEL A;  2W8W A;  1YIY A;  5M4D A;  3BCX A;  2HOX A;  2QB2 A;  3MEB A;  2VGW A;  4Q6R A;  1AHX A;  1QIS A;  1OXO A;  4LW2 A;  3AEO A;  1TAT A;  1WYT B;  3NDN A;  3MC6 C;  3DZZ A;  4WXB A;  1FG7 A;  1J04 A;  5EUD A;  2BHX A;  1QGN A;  1RV3 A;  3CAI A;  4M2K A;  1IX6 A;  2Z1Z A;  3GBX A;  1WYV A;  1CQ6 A;  4FFC A;  2Z20 A;  3PGY A;  5LHA A;  1BT4 A;  1AY8 A;  2VMU A;  3EUC A;  4BA5 A;  2X5D A;  5FT4 A;  1WST A;  3HLM A;  9AAT A;  2BI5 A;  3FQA A;  4WP0 A;  2JJF A;  1JF9 A;  1YAA A;  2HP2 A;  2HUF A;  2Z9W A;  4TN4 A;  1IUG A;  2BKW A;  5E5I A;  2VGS A;  4XK1 A;  2Q7W A;  4UHO A;  3II0 A;  2EO5 A;  1MGV A;  1WKH A;  2WKA A;  4WXF A;  2JJH A;  4AO9 A;  1QJ5 A;  2W7K A;  4WD2 A;  1MAP A;  2VGT A;  2X3L A;  2ZY3 A;  2CJG A;  4F5H A;  1ARH A;  2CAN A;  3E2Z B;  3NYU A;  2ZSL A;  4EFF A;  2D61 A;  3FD0 A;  2YKV A;  2AY5 A;  2VMP A;  1OHY A;  1EJI A;  1AY4 A;  1B4X A;  2QSR A;  4BQ0 A;  3DR4 A;  3TFT A;  2R5E A;  3NYT A;  4E3Q A;  2AY6 A;  1MDX A;  2QBT A;  2R0T A;  4WYG A;  5JAY A;  1BJO B;  4JE5 D;  4NOG A;  3PPL A;  2XBN A;  4OCA A;  3L8A A;  3P1T A;  4A6R A;  1VP4 A;  2VLH A;  3FVU A;  2YKY A;  4JE5 A;  4W1X A;  1IVR A;  1ASN A;  3JTX A;  3IF2 A;  4WYA A;  2GMS A;  3BC8 A;  3FFH A;  4A6U A;  4MY5 A;  3QPG A;  1C9C A;  2CJD A;  5DJ1 A;  1DKA A;  2F8J A;  3K40 A;  1YJS A;  1PMO A;  2BYL A;  1AAM A;  3EZ1 A;  1VEF A;  3TQX A;  2FN6 A;  3PJ0 A;  1X2A A;  1D7R A;  2HOY A;  4XQ2 A;  1LC8 A;  3QM2 A;  1V2F A;  2G7J A;  1UU1 A;  1TOE A;  2R5C A;  3E2Y A;  2VMO A;  2C81 A;  2BI1 A;  4AH3 A;  1GDE A;  1ASD A;  3OP7 A;  3N75 A;  3A9Y A;  3MKJ A;  3JWB A;  5K8B A;  1RVU A;  1V2D A;  1WYU B;  3Q8N A;  5C6U A;  1IAX A;  1GC2 A;  3FQ8 A;  3DXV A;  2YCP A;  2AY9 A;  2VMV A;  2CST A;  1YJZ A;  1KL1 A;  1EQB A;  1M0Q A;  2PB2 A;  3BCA A;  3HMU A;  3MAU A;  3G8M A;  3JWA A;  4OTL A;  5HXX A;  1ZOB A;  1AHG A;  2EZ1 A;  1D7V A;  2HUI A;  2VGV A;  2W8V A;  3GET A;  3H14 A;  4OBV A;  3AOV A;  4A0G A;  4ISY A;  3H7F A;  1LKC A;  2HP1 A;  1RVY A;  2Z9V A;  4GE7 A;  4AOA A;  3LVK A;  4AO4 A;  1M32 A;  4IYO B;  4TV7 A;  1DJE A;  2BIE A;  3NUI A;  4RLG A;  2JIS A;  4U2H A;  2BIA A;  2AY2 A;  1B9H A;  2E7J A;  2ZYJ A;  5G4J A;  1G4X A;  8AAT A;  1ELU A;  2W7J A;  3FTB A;  2AY4 A;  1B5O A;  4ZDP A;  1X0M A;  1G7X A;  1DGE A;  2OGE A;  2D5Y A;  1AHY A;  3JZL A;  2QMA A;  4KAM A;  5EIG B;  5EFS A;  3HBX A;  2V1P A;  1CZC A;  3G7Q A;  2W7D A;  2AEU A;  1W7L A;  2CH2 A;  4IXZ A;  2DGK A;  5EAV A;  3USF A;  3HT4 A;  1GC4 A;  1BQA A;  3MBB A;  1SZS A;  3N0L A;  4BHD A;  3DYD A;  3WGB A;  4P3M A;  4TMR A;  4F5M A;  2FNI A;  1BS0 A;  2PO3 A;  4W1W A;  2ZY2 A;  3RCH A;  4EU1 A;  2W7M A;  2AY7 A;  2XH1 A;  2VMQ A;  1W7N A;  4LNM A;  3FDD A;  3LWS A;  4PFN A;  3BWO A;  2HOZ A;  3K28 A;  3N4X A;  1DJU A;  5G2Q A;  1TOJ A;  3AEJ A;  1DJ9 A;  2YKU A;  3ACZ A;  2WK9 A;  2EZ2 A;  3E6G A;  5G2P A;  4ADC A;  3E2F A;  1O4S A;  4EMY A;  1RV4 A;  3HL2 A;  4Y0H A;  2YCT A;  3JU7 A;  3QBO A;  4JEZ A;  5J8Q A;  3RBF A;  3RCH B;  2X8U A;  2CFB A;  3WY7 A;  3N7N A;  5LH9 A;  2C0R A;  4CXR A;  2JG2 A;  4XJO A;  5D95 A;  4OMA A;  1GCK A;  1BKG A;  5M49 A;  1JS6 A;  2CB1 A;  2VMS A;  2W8T A;  5G0A A;  3WLX A;  4A0F A;  2VMT A;  3PDB A;  2DGL A;  4U1T A;  1MLZ A;  5G4I A;  2VLF A;  1AKA A;  3E77 A;  2WK7 A;  1N8P A;  4AZJ A;  3GZC A;  3IHJ A;  4A0R A;  4WYD A;  3ELE A;  2VMZ A;  4F5L A;  3OKS A;  2E54 A;  4ZM3 A;  3BN1 A;  1B9I A;  1AX4 A;  5D5S A;  2VI9 A;  3TAT A;  1KKJ A;  4KXK A;  4R8D A;  2PB0 A;  2ZJG A;  3DR7 A;  1BJN A;  3I16 A;  3L44 A;  3N4R A;  4E77 A;  3NU8 A;  2CH1 A;  2G6W A;  3WKR A;  4R5F A;  3AOW A;  1X28 A;  4XEW A;  4A0H A;  1UU2 A;  4I8A A;  1CQ8 A;  1YOO A;  4N0W A;  4BMK A;  2OQX A;  4DBC A;  1C7N A;  3ECD A;  4R5Z A;  4RKC A;  3BV0 A;  5HHY A;  4Y0I A;  1H0C A;  1JS3 A;  3QN6 A;  4HF8 A;  1WYV B;  4JF0 A;  4UHM A;  4AZK A;  3AEP A;  4MQQ A;  2TPL A;  3KE3 A;  3RUY A;  1TAR A;  4ZAS A;  1AIC A;  1ASM A;  3WCO A;  4J5U A;  3EIB A;  1W3U A;  3F0H A;  4Q31 A;  1DGD A;  1JG8 A;  4Q76 A;  1KMK A;  3LVL B;  1GEY A;  2AAT A;  1ASF A;  1KMJ A;  1FG3 A;  2D64 A;  1ASE A;  5EUN A;  3N5M A;  1LC7 A;  4QGR A;  5EAA A;  2VIA A;  3H9X A;  4L0O A;  3VK4 A;  4GE9 A;  2ZY5 A;  5FT6 A;  4E1O A;  4ADE A;  1FC4 A;  4XJM A;  4N0B A;  1ARI A;  4H63 Q;  1AKC A;  1Z3Z A;  3BB8 A;  3F6T A;  1LK9 A;  3B1C A;  3TCM A;  3WCN A;  3NYS A;  4RJY A;  4ATP A;  2BWN A;  3FDB A;  4GRX A;  4K2M A;  1AJS A;  1YIZ A;  4O6Z A;  2EH6 A;  1CS1 A;  4K2I A;  1O62 A;  4DQ6 A;  3PD6 A;  4RIZ A;  2CTZ A;  3CBF A;  1ECX A;  1DTY A;  2AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...