3DC6A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
197
Chain Sequence
KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn] 1
total genus 79
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc6A02
1PL4A 1EM1A 1MA1A 2ADQB 3RN4A 5AG2A 4YIOA 2P4KA 1AP6A 4JZ2A 4JZGA 1D5NA 1LUVA 2CDYA 1VARA 4F6EA 1XREA 1BSMA 1ZUQA 2GDSA 1GN6A 3AK1A 1AR5A 2QKCA 3K9SA 1JA8A 1ZSPA 4GUNA 1B06A 1GN3A 3TJTA 1WB8A 3MDSA 3BFRA 1MNGA 2QKAA 1N0NA 4BR6A 1XUQA 1QNMA 1WB7A 3C3SA 1I08A 1AR4A 3AK2A 4C7UA 4YIPA 1GN4A 1EN5A 2RCVA 4X9QA 4JYYA 1XILA 3KKYA 4FFKA 3IC9A 1KKCA 1BT8A 1AP5A 4E4EA 1SZXA 1GN2A 3QVNA 1IDSA 3EVKA 3C3TA 3LSUA 1P7GA 1N0JA 3DC6A 1MSDA 1JR9A 1EN4A 1IXBA 1LUWA 1ZLZA 2AW9A 3CEIA 2CE4A 1Y67A 5A9GA 1EN6A 1I0HA 1MMMA 3AK3A 1VEWA 3OT7A 1PM9A 1AVMA 1IX9A 1XDCA 1ZTEA 1BS3A 3DC5A 2ADPA
chains in the Genus database with same CATH superfamily
2F4VO 1EM1A 1WN7A 4ASUG 3CRMA 2B5UA 2YEVA 5A2QN 4YIOA 2X6CA 4RUFA 2QWNB 4JV5B 4FLYA 1MZFA 1M9NA 3X2QB 2HLDG 4DV5B 5EIBD 4EEQA 3SPJA 3HKCA 5FLXN 1YSCA 5LHHA 1AI6A 2XTAA 5EZYA 1ZUQA 2GDSA 2FMLA 3PN1A 2CGOA 1P84F 1TA8A 3K5MA 1Y76B 2V7QG 1N36O 4FPPA 4LFCO 2ZXWC 1L1FA 3X2QC 1RFYA 2QWPB 4IGGA 4DV0B 4YHHB 3J80N 5HFMA 4X89A 2PI4A 3P32A 3A0HZ 3O9OA 3OGCC 5B1BC 1Z5VA 3KZIZ 2QTSA 4B3TO 2P90A 3THOA 2Q0AA 4DUYO 1WJZA 3S3WA 3BPZA 4UB6Z 1NU1H 5H6RA 5BR8O 4P30A 2KKWA 1H2SB 1EFRG 3CRCA 2JK5C 2ZIMA 3G6BA 1TUEB 4K3AA 3B2EE 3E86A 2UXCO 4JI8B 1LR1A 4NVPA 2X6BA 2W6IG 3K59A 2FL4A 4LFBB 1W0JG 4DW0A 4H13B 2KB1A 4TV9A 1S5LZ 1VF6A 4F4LA 4KHPO 2VQFO 2Z0AA 4MTGA 5IY5B 4X62O 3CXCU 2DQ0A 1SS3A 3OE7G 1VMGA 1BMFG 2O57A 4ICGA 4X65O 4FLVA 3JATB 1D5NA 1HNXB 5LMUO 4AI8A 4O2AB 4DR6B 2Q6AA 2ITDC 3AG2B 3K5LA 2A3QA 2B1IA 3T1HO 2EIKC 4JTDB 3OW2U 1ZL8B 3AG3B 2WA4A 3OR7C 5JH7A 1GAXA 2QWRB 1RPRA 3K9SA 3D3IA 3ZMTA 5LYJB 2D2CB 1K4DC 2JEUA 4G27B 2KG7B 2Q9LA 1VQ7V 4GKJB 2JJ1G 3ZRXA 4B7EA 1PD3A 5IT9N 5L3GA 3AG2C 2IM9A 4JI4B 4YJ3B 4JI1B 2X0LA 4FM1A 3FYEB 2A9HA 3QO7A 3DSQA 4LC1A 4TQFA 1V9PA 4HNAB 4QGPA 1LNQA 2L6LA 4HNAA 1XBLA 3G6EV 2WLLB 4DV2O 1NZ6A 1R6TA 3HR0A 4MVSA 1AB3A 5D5QA 1DF4A 1H2KA 2XASA 4CBCA 5DEDA 3LNNA 1SKVA 3UT5B 4DR1O 2DYSC 4IYHA 4B3RB 3K0DA 3N27A 4X66B 2UXBO 4F6RB 2DN9A 4RWUA 4BIOA 1SQPH 3ABKC 4JV5O 1KQSU 4CC5A 1K3EA 1IXMA 3W7UA 1Q6HA 4HAMA 1K7DA 3CB2A 4LWSA 1AJPA 2QWQB 4I4TA 1HDJA 3DC5A 3SGIA 3EXAA 4CS3A 2PI5A 2YC0A 5IJ0B 4TUYB 4YXWG 3HKDA 4MVOA 3TK1A 1URFA 3OM3B 4DO2A 1S72V 5CBHA 1QR8A 4P2ZA 4J7KA 4PA9A 4JAUA 3LSSA 4I9WA 3SPHA 3SJQC 3RYHB 2PGGA 4DR3B 1R3LC 2ZD9A 1V55B 3L75H 1Q82W 5D5PA 1XREA 2IJHA 1N32O 3AK1A 3KCYA 2WLNA 5IDJA 3ZHQA 1H8EG 3Q4HB 3RBZA 2Q7EA 1J95A 1SQVH 5EC2C 4JAAA 1P49A 5H2FZ 2LW1A 2OIEA 2IJJA 1Q90D 3APQA 4B3TB 4U7NA 3K9AA 2EBOA 1R6KA 4UVCA 2RN9A 4K35A 3TETA 4JYAB 1Q43A 3UQ8A 5EC1C 2A06H 2OCCC 1N33O 4FLUA 1ZX3A 3ZEDA 2R70A 1NR1A 4KP4A 4EFBA 2ZM6B 4I4TB 5KX5A 2DOSA 1I94B 2AHZA 1FFTB 3RGBA 2EILB 5KHHA 4OXSA 1AI5A 3ZBHA 4DRXA 4UXNA 4DR4B 2NN4A 4J7JA 4GX5A 1G4YB 1OCCB 3BEHA 1M1KW 2JVDA 2ZIOA 5C93A 2R9RB 2QGNA 3CCLV 1OHHG 3K03A 4LWSB 1OV9A 1M5IA 1AVMA 4DR6O 3FAVB 2EILC 1W0KG 1NR7A 4IHJB 5B1AC 4YJ3A 2ADQB 3RN4A 4DV0O 1EBOA 1YDXA 3LUTB 5J2UB 2JGDB 4CH5A 1FPOA 2OTJV 1Q6UA 5LOVA 4JASA 2QKSA 4DUYB 4YY3O 3K5NA 4GKJO 4JTAB 1AJQA 1HNWO 1L0LH 4H44B 1FJGO 1S0VA 4EKWA 3IGAC 4PDMA 4DV1B 5BY1A 5B1AB 3CCVV 4DR4O 2OCHA 3CCSV 2HVJC 2IBZH 1PNKA 2K9PA 3DGEA 4LFBO 1AJNA 1F51A 3GWKC 2PUSA 4UV9A 5KAIZ 2ZCEA 2N74A 2WLHA 4HZ3A 1M56B 2P5OA 3A0BZ 2OWOA 4ZI7A 3RYIB 4LF7B 4DR1B 1QBZA 4BW9A 5IWAO 3H1JH 4XDLA 1NQTA 1YIJV 4N21A 1KD1W 2IW5A 2XAJA 4TV8A 4NXMO 4DV7O 5IYCO 3MHSC 3ABLC 4YY3B 1EN4A 3E8GA 3H01A 2M6YA 5KHKA 3QNEA 1GMGA 1F4MA 3OD4A 5JCOC 1WA8A 5A9GA 2DE0X 3NXSA 4I0XA 3RYIA 3BVOA 4NB5A 5ITZB 4UB8Z 1BQ0A 3OMIB 4X64O 1BE3H 4JI7B 3A8TA 3WB1A 3DXRB 1PL4A 1NBMG 1B04A 2LW7A 1I5YA 2BE3A 1V54C 3QO5A 4PDLA 4DUZO 2P06A 2P22C 1AP6A 2WPDG 3RVYA 1Q3EA 5CBGA 2HHHB 4X1IA 2HKOA 4LF6B 4LF7O 1FXKA 2Q67A 4LH7A 1VQLV 2GSMB 4DR7B 2ZT9B 3ZMVA 3ZIAG 1MZEA 5EZYB 2CTWA 2G38A 5LHGA 3JALB 2LFSA 3PJSK 1N33B 3UO3A 1SESA 1ZSPA 1NTZH 3ZHSA 4DV5O 4EFEA 4QPKA 3CS5A 3TCUA 4BWAA 1FXVA 2Q8VA 2ZE6A 2AZ2A 2IU0A 4NTXA 1QQCA 1PL0A 2HEPA 2JJ2G 3SJBC 1NKDA 3BHPA 4FLWA 4C7UA 4JI3O 3UM7A 4DR2O 5ITZA 1W59A 1VQOV 4PD4F 4LF5O 4PA6A 2DYRB 3CRRA 1NVPB 4UCVA 3JASB 4J11A 3JARA 1D5AA 1IBLO 1XHZA 1XNRO 1Y66A 1Y4MA 3K58A 2VQFB 1JJOA 1MSDA 1K5QA 1IBMO 3OUSA 1ZAUA 3H1LH 3NR7A 3TGUH 5KMGB 1VQ5V 1YTFD 2YDEA 4O4IA 2JGDA 4JI2O 4KL1A 1PKXA 2ODMA 3BAAA 4Q6GA 1PM9A 4NKGB 1JQ0A 5L3CA 3ASOC 1NTKH 1N4CA 2R9IA 3N2GA 1VQMV 5JQGB 2EJRA 1HW7A 5JJJB 2YUAA 3B09A 1FJGB 4MS2A 2E74B 1XNQB 2P4KA 1JOYA 2P67A 3D36C 5B1NA 4JZGA 2ZM6O 1XMQO 4GCZA 3G71V 2H3OA 3H9VA 4O4HB 2YIBA 4PI2A 3T4DA 2Z5UA 4RQFA 1D2DA 4MVMA 1HNZB 3D8CA 2GBOA 1M93A 2YXHA 3CC7V 4D7TA 2QKCA 1BL8A 2CAZC 1JCHA 1AROP 5DM6V 2GV9A 5GONB 2OTLV 2E76B 4XDJA 3QO8A 4D6TH 3VQYA 4Q20A 3BFRA 2KQXA 3STLC 4WBNB 3SDLA 1XI1A 4JI2B 1KC8W 4GX0A 4NTWA 4WFFA 3WFVA 3MAQA 2W6JG 4O2BB 1ROPA 2JGUA 4MTOA 1OCCC 4GLXA 4U3FH 3R66A 1SZXA 2W0FC 4WF9V 2WAMA 5JJNB 5B5EZ 4UCSA 1FFXB 5LMNB 3FAVA 1RP3B 1N0JA 3SJAC 1BQZA 4LF8O 5IYDO 3ZRVA 5LGNA 1IXBA 4PDRA 3UO2A 4DK1A 3SJCC 1YF2A 2A7WA 2FTKA 2BSKA 4KXRA 2RMKB 3N2KB 1R3IC 1SQXH 5FL7G 1QR9A 1MMMA 3E8HA 4CS2A 3A2FA 1KB9F 3AG1C 2Y4TA 3JASA 2N05A 3KG2A 3I55V 3CE2A 2Q69A 3P3NA 3FD9A 4AQYO 2LJ2A 1PNLA 1XEQA 3BABA 2ADPA 4DR3O 4FK5C 3VQXA 1VQ4V 2E75B 1H8HG 3K79A 3L70H 2F43G 3C90A 4IHJA 4O4JA 2Q73A 2YICA 3L71H 4LH6A 2UU9O 3ETQA 4MW8A 2NR5A 2Y69C 5LP6C 4JI8O 1YITV 1FAFA 4LCUC 1T5EA 4GX2A 2F4VB 2ITCC 3CSXA 1QCEA 5IJ9A 2BCCH 4NYKA 2EJ7A 2M7WA 3GWOA 3FB5C 1M56C 1QHTA 4JYCA 5DN6G 3AG7A 3ICXA 4FFBA 4R6ZA 3WB0A 3I56V 2WLIB 2QKAA 3U11A 5CA3A 3IAYA 3ZHRA 3MHHC 4CH3A 1IBLB 1XNRB 5JQGA 2ZE7A 3AK2A 3WG7C 3ZHVA 4O2BA 4R8CA 2QA4V 1QVFU 1QVGU 4YJ2B 4PDVA 3F7VC 4QJFB 5J2TA 2DJVA 2ATKC 5B3SB 2R9AA 4LFCB 1FXKC 4UVBA 3AG4B 3D36A 1YEWA 4I0XB 4O4LB 1IDSA 1K34A 4O4IB 3E89A 3JAWB 1KP2A 2D3OW 3J7AU 2IJKA 3HKEB 4FZ0A 3CD6V 3MD0A 1VQ6V 1QLEB 1VF5B 3WU2Z 3LNMB 2UUCO 2EINC 3O65A 3DTUB 3OTFA 1DK1A 2VS0A 4X1YB 4WFAV 4PI0A 3OT7A 3RYCA 4Z2WA 4J9ZB 1FXKB 2XAFA 3E8FA 3JD0A 4O2AA 3OTOO 2YSUB 1WPXA 5EIBC 4MVQA 1DLBA 4DW1A 4ZHQA 4LFAB 3LDEA 4XDKA 5FPOA 1BGYH 4FM2A 1GTOA 4UV8A 4MVRA 4QE7A 2ZE5A 1LUVA 5H6QA 2DWDC 4TQDA 4LP8A 2YIAA 1K73W 5L3FA 3OAAG 4F6EA 1AI4A 4BIUA 4TUYA 2PZSA 3UT5A 1SC5B 1SQBH 2BTQA 1VP7A 5EYPB 1Y74A 1I7FA 3BRCA 4BIZA 4ZOLB 3G80A 1TVKB 3N2KA 5LBQA 1GK9A 4O4JB 2DYRC 2ETNA 1THZA 1NTMH 3CCQV 4LF4O 1MNGA 1U96A 4AILC 3T1CA 1TUBB 1Y76A 2RDCA 4X1KB 1JMKC 2FB5A 2XAGA 1IZ3A 2DWEC 3M7MX 5CBFA 1XILA 4TWKA 2YI8A 2XNDG 2CTQA 1HR0B 3GB7C 5IYZB 1OCRB 3HKCB 4PELA 1OZ0A 1K97A 1XNQO 1XL6A 1H2NA 1MOFA 4LR3A 3T4ZA 1XMQB 2OCCB 1NH2B 4TV8B 2UXXA 4ZIBA 4FM0A 2Q7GA 1NH2D 2HR3A 3ABTA 1GKFA 1GM9A 1S77D 2CE4A 2P6JA 4GKKO 2H8PC 1EN6A 4PHZA 3BY6A 3CCUV 5DECA 2AZ0A 1K9MW 1R6NA 2CK3G 5KMGA 4FLTA 3GVMA 3JD2A 3SYOA 2UXDO 4LF6O 1BS3A 5C8YB 4DR7O 2XHBA 2WWWA 4MTXA 2YEVB 5AG2A 5CN0A 2ZXWB 2NNUA 4JI6O 5LGUA 2VQEB 2JIZG 4JI5O 4X1IB 1B6QA 2UXNA 5GTIZ 2JS3A 4IYIA 1M57C 2DW4A 4R7CA 4TT3G 4H0LB 1JVMA 1GM8A 5B1BB 3RW0A 1K8AW 5CA1B 1R1BA 3QTCA 5KHIA 3TXQA 3FKSG 3HKBA 4L87A 2LP7A 5HFLA 4LF5B 3TJTA 3RT3C 4X62B 1EZVH 2WLKA 1PP9H 4FVMA 4BW5A 1AR1B 3OMNB 1GO3F 4CH4A 4WBNA 4X65B 1WP8A 1GN4A 1M57B 3JD4A 3E35A 3OEHG 1CEZA 1X4TA 1A32A 3CP1A 1O9GA 4JPRA 1UFIA 1ENVA 1VF6C 2UUCB 2CTPA 3JARB 5E79Z 5BZBA 3W7TA 1YXBA 4JYBA 3AG1B 3EVKA 4FLXA 4R50A 2Y48A 4DR2B 1G1XB 1OCOB 4X20B 3Q4HA 3RWRD 4ABMA 1E1RG 2HFEC 4PV1B 4O4HA 4LBEC 2FKXA 3DXRA 1TAEA 3AG3C 4J10A 2XT9A 3ABMB 4JI4O 5LOVB 5K1PA 3ABLB 2IH3C 4U3JA 2QSAA 3IFXA 2OIGA 4B3SO 4W4KA 1L8DA 3ETEA 2DMXA 1YJNV 1KKDA 3ZJZA 3TXSA 1YTFB 4X88A 1PV0A 2QWOB 3JAWA 2UUAO 1TGOA 5BMVB 3OGIB 1XMOO 2GTSA 4X66O 3ZN1A 2A0LA 1HWYA 4FMTA 5KHJA 4DXWA 3HB3B 2Q4PA 1SA0A 5B3SC 1CP9A 1S5HC 2E5LO 3P30A 1FXHA 1OJHA 1AILA 2UUBO 3AG4C 4FZ1A 1OCZC 1KBHA 1O9HA 1DF5A 2XAQA 1XQ8A 1SETA 1WPBA 2DYSB 3M99B 4DUZB 3EFFK 4H37A 5L3EA 3ABKB 3KKYA 1BT8A 3BA9A 1TUBA 1QLNA 2RJZA 5JCOA 4X1YA 5CB4B 2KG7A 3ZCCA 2Q5ZA 3RVZA 1OCZB 1GRJA 2CTRA 4I50A 1R3KC 2IH1C 3T1HB 2BTQB 4IT5A 3M8AA 5IWAB 2BSKB 1Y67A 1JJ2U 4K0KO 1IBKB 2PTMA 2Q0OC 1YHQV 5EK0A 2F95B 4Z1VA 5E1AC 3L72H 4JI5B 2YIDA 4JTCB 1FS0G 2BOCC 2RQ6A 1FFXA 1XL4A 2C2AA 2H94A 3ZRWB 3HKDB 3ZHUA 2B1GA 1YCIA 4B3MO 2OYQA 1Q8IA 1VQ8V 1F4NA 2CDYA 2IJIA 2LGWA 2Q68A 3IJ4A 2DQ3A 3N2GB 4MT8A 3CJHA 3E22B 1AI7A 3FFQA 4JAVA 4WFHA 2PY5A 3A0RA 4OX9B 1Q5OA 4RUEA 1N34B 4LF9O 2ZDIA 2NLJC 2AGAA 1OCRC 4QPJA 3CC2V 2K1EA 1E1QG 1Q81W 3BA8A 4OPAA 3OFNG 2Y0IA 4YIPA 2OT5A 2X7RB 4DV6B 5KA6A 4DV4B 4X20A 4IL6Z 1VQNV 4KFMA 5GW7A 2WLLA 1GM7A 2AHYA 1WA8B 3CPWU 1AP5A 4UCUA 1HNWB 1YJWV 4DV3O 2QM7A 3H1KH 3T1YO 1P7GA 4J7ZA 3OEEG 1NS1A 2QDOA 1MSWD 3SPCA 3ZN0A 2JS5A 2AW9A 4BAYA 3SYAA 1N32B 1G6UA 2JRIA 4LFAO 1I0HA 3F5WC 4W4LA 3CCMV 2CUGA 3K08A 4CZZA 1KMIZ 3RYCB 5LA6B 2V1DA 4OGQB 1XDCA 4ZI7B 1ZWIC 4CS4A 1LUWA 4P9PA 4WFEA 1WLEA 3W7WA 2QJ1A 1EZJA 2EIJB 4ZHQB 5J2UA 4UVAA 5TISZ 3JD1A 4XBFA 2EIMC 2F1MA 1WAZA 3B77A 5CB4A 3T2MA 2PYJA 4LF8B 4U7OA 1VQKV 1R3JC 2HJFC 3H1IH 3VQVA 3ZRSA 1SF9A 3CXHF 5LGTA 2QE7G 1JPXA 2EX3A 2HVKC 2ZR2A 3IC7A 1FKAO 3D3QA 4GT1A 1L0NH 1NJIW 1FYJA 3HKEA 1RPOA 1US6A 4ZOLA 1DGSA 1GN3A 1HR0O 2QTOA 4AQYB 3ZMZA 4MVUA 4JI7O 1S5JA 4UCRA 1FD9A 3CMAV 1YJ9V 1WB7A 2EIMB 4QIWF 4KHPB 1NI8A 4DYLA 4DV2B 5EBWC 1BHAA 4FFKA 3IC9A 4WFBV 4PJ0Z 3OR6C 3K57A 1KP3A 2UXBB 4E4EA 1M90W 4B3SB 1GN2A 1S3JA 3JALA 1COWG 3UCSC 5KHGA 4NTYA 5LMUB 3ABMC 5IY5C 3LSUA 4LNUA 1V54B 3B40A 4MW3A 3J81N 3JATA 2LQTA 1H2GA 1UJWB 1RSOB 4B3MB 4DV1O 3AK3A 3JD3A 1F23A 4I5SA 5EYPA 4JI6B 4H33A 5LXTA 5LXTB 4QE9A 3P3PA 2KSDA 4K8XA 5BMVA 3VOUA 2V4DA 1ZTEA 1IJGA 1KU9A 1QLEC 1JFFB 4GKKB 3CX5F 1P4RA 2CGNA 1Z5WA 5LHIA 3SPGA 3K5OA 1Y6XA 3WB2A 1SA0B 4B7KA 1Q86W 4JZ2A 2F23A 2UXDB 2YXYA 4MTFA 1SQFA 2Z3YA 2ZNIA 1VARA 1N34O 2P7TC 2ZR3A 3SYCA 4RAIA 5L3DA 5CMUA 4ZBMA 2XUMA 4NR1A 5KA5A 2FYUH 4DV7B 3CCRV 3CC4V 3JAMN 4GUNA 4JI0O 5B66Z 4G28B 4DV4O 5JVDA 3JSLA 4X1KA 3ZX6A 3MDSA 2N04A 1IBKO 1XUQA 2HJDA 2F66C 1YI2V 2L35A 3OMAB 1KYOF 4TOIA 3LSQA 1VF7A 1CXZB 4X8AA 3B4SA 2UXCB 1XHXA 1ORQC 4MVZA 4HYOA 1KKCA 4FIPC 3ASOB 3W7SA 1SZTA 3K04A 1HNZO 5FNVA 3B8NA 3LDDA 1JR9A 1RM1B 1X59A 1ZLZA 3CEIA 1WP7A 1I5XA 4GYCB 1PNMA 5BR8B 5CA1A 3RYHA 4OX9O 1B3QA 3JAKA 2JEXA 1SQGA 2ZKOA 3SPIA 2BOBC 1GH6A 4NXNB 2JDIG 1R73A 5IJ9B 2PYLA 2ILMA 3ZHTA 3OUFA 5IE9A 3ABUA 3CWBH 4P9OA 1DTOA 4JI3B 1RM1C 3ASNC 5IJ0A 1VQ9V 2YS8A 3AEIA 4O4LA 1TVKA 5KUKA 5C8YA 3OTOB 3VBBA 2AXTZ 3L73H 4HBNA 2ZNJA 1GN6A 5JH7B 4N23A 1AR5A 3CCEV 1FOUA 3T1YB 4IIJB 4I7ZB 1HNXO 5J9PC 1IBMB 4GX1A 2YI9A 1K33A 2EZOA 1K92A 2YIBD 3ASNB 2WLMA 1QNMA 3C3SA 3HPLC 2XOKG 5LL6Y 1Y74B 1EN5A 1K5SA 2UU9B 4NXNO 3JCUZ 4LNUB 2UUBB 1JX9A 5K1XA 3QG5A 4EB6B 4KUMA 1WNSA 3QVNA 3L9DA 3SR2C 1SRYA 3RYFB 2GTAA 1K4CC 3EHBB 1QU7A 4JI1O 2EULA 2IU3A 4X64B 2F93B 5JWPA 3K3WA 2WLJA 1P7BA 1KUQA 3ETGA 5B1OA 4J42A 4FLZA 1N36B 4RQEA 2EIJC 2GHYA 1JFFA 4F6RA 1ZL8A 4ZKIA 4PA3A 2R72A 3RFRA 4DR5B 1VEWA 4YHHO 4D7SA 2HHHO 3CJHB 3E22A 2LFRA 2EZPA 1SERA 1OCOC 2WSSG 1M4UA 2X6AA 2ZE8A 2B9ZA 5FPRA 2Q7HA 4OPHA 1E79G 3K0GA 1RSOA 3SYPA 2WA3A 5GTHZ 4I50B 3E83A 2HG5C 3ZMUA 5IYBO 4JI0B 1SQQH 1VIBA 4E2LA 2RNBA 5KUMA 2P4VA 1J5EO 2QEXV 2W0XA 1U97A 1BSMA 4IIJA 4UFZA 4RO2A 5J2TB 1PPJH 5KX5B 1IVSA 4UCOA 5LMNO 3CYOA 1H38A 4A5UB 3ZMSA 3QF7A 5LA6A 1B06A 1KECA 2ZDIC 1Q7YW 3JCZA 2WLIA 1I94O 1F7YA 1CPYA 2EIKB 2Y69B 5JJEB 3JSNA 5LP6B 2ARHA 1AR4A 4CC6A 3F5TA 2PF4E 4X9QA 5F2VO 4CH6A 3CMEV 1HP8A 4JYYA 4PA4A 1YZBA 4LF9B 2BTOA 5CA0B 4UCTA 2VWJA 4Z1MG 1NT2B 3C3TA 4DV6O 1MG1A 2LGQA 3ETDA 3G67A 2MW2B 3S3XA 3R65A 3WG7B 4LF4B 3JYCA 2QM8A 5LYJA 5BXZA 1H2LA 4B08A 5H9CA 4DV3B 1MABG 3FX7A 5CA0A 3ZS8C 3CCJV 2HP8A 1H5WA 4PA7A 2Y4UA 4JF3A 3K06A 5L3BA 2VRZA 4K8ZA 2A79B 3FB8C 3B8MA 2ZINA 1MA1A 2MK3A 1VQPV 1Z2GA 3CRQA 2QM4A 5JVDB 3F7YC 3HKBB 5KLVH 4YJ2A 3FB7C 1NVPD 1S76D 4J41A 4TSFG 4U3JB 3KCXA 2EINB 2QR4A 2VWKA 4FJCC 4DK0A 1BCCH 4L8JA 3STZC 2CH7B 2CH7A 5KAFZ 4B3RO 3FB6C 5EBMC 1YVWA 4UUJC 3ZRWA 4K0KB 3CRAA 2YXLA 3LDCA 4I55A 1IURA 3G4SV 3BCCH 5IYZA 4I9QA 4WCEV 1JA8A 2XAHA 3KDRA 1BZKA 3I5DA 3ML0A 1WB8A 3UKMA 1UPGA 5FNVB 2UUAB 1G8MA 1N0NA 4MSWC 4WFGA 4BR6A 1V55C 3FYIB 1W2BU 1XMOB 1I08A 2E3CA 5EBLC 3U10A 3E2EA 1H2MA 5GONA 2RCVA 2GUZB 2GUZA 2ZQMA 2VQEO 3L74H 2E5LB 3U0ZA 4JGSA 3E8BA 3H1HH 4J9YB 4DR5O 4G2KA 3SYQA 3DC6A 4QNHB 3W7XA 3VQWA 4EB6A 4GZRB 1Q6IA 1JNBA 3CHXA 3RYFA 4I55B 4JYAO 4FFBB 1N8RW 2LO1A 4NXMB 1IX9A 4J80A 1XOUA 2Y0PA 5H5NA 4TV9B 4AHCA 5LP6A 1BHBA 4DRXB 3APOA 1J5EB 3JAKB
chains in the Genus database with same CATH topology
1PL4A 1EM1A 1MA1A 2ADQB 3RN4A 5AG2A 4YIOA 2P4KA 1AP6A 4JZ2A 4JZGA 1D5NA 1LUVA 2CDYA 1VARA 4F6EA 1XREA 1BSMA 1ZUQA 2GDSA 1GN6A 3AK1A 1AR5A 2QKCA 3K9SA 1JA8A 1ZSPA 3KDRA 4GUNA 1B06A 1GN3A 3TJTA 1WB8A 3MDSA 3BFRA 1MNGA 2QKAA 1N0NA 4BR6A 1XUQA 1QNMA 1WB7A 3C3SA 1I08A 1AR4A 3AK2A 4C7UA 4YIPA 1GN4A 1EN5A 2RCVA 4X9QA 4JYYA 1XILA 3KKYA 4FFKA 3IC9A 1KKCA 1BT8A 1AP5A 4E4EA 1SZXA 1GN2A 3QVNA 1IDSA 3EVKA 3C3TA 3LSUA 1P7GA 1N0JA 3DC6A 1MSDA 1JR9A 1EN4A 1IXBA 1LUWA 1ZLZA 2AW9A 3CEIA 2CE4A 1Y67A 5A9GA 1EN6A 1I0HA 1MMMA 3AK3A 1VEWA 3OT7A 1PM9A 1AVMA 1IX9A 1XDCA 1ZTEA 1BS3A 3DC5A 2ADPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PL4 A;  1EM1 A;  1MA1 A;  2ADQ B;  3RN4 A;  5AG2 A;  4YIO A;  2P4K A;  1AP6 A;  4JZ2 A;  4JZG A;  1D5N A;  1LUV A;  2CDY A;  1VAR A;  4F6E A;  1XRE A;  1BSM A;  1ZUQ A;  2GDS A;  1GN6 A;  3AK1 A;  1AR5 A;  2QKC A;  3K9S A;  1JA8 A;  1ZSP A;  4GUN A;  1B06 A;  1GN3 A;  3TJT A;  1WB8 A;  3MDS A;  3BFR A;  1MNG A;  2QKA A;  1N0N A;  4BR6 A;  1XUQ A;  1QNM A;  1WB7 A;  3C3S A;  1I08 A;  1AR4 A;  3AK2 A;  4C7U A;  4YIP A;  1GN4 A;  1EN5 A;  2RCV A;  4X9Q A;  4JYY A;  1XIL A;  3KKY A;  4FFK A;  3IC9 A;  1KKC A;  1BT8 A;  1AP5 A;  4E4E A;  1SZX A;  1GN2 A;  3QVN A;  1IDS A;  3EVK A;  3C3T A;  3LSU A;  1P7G A;  1N0J A;  3DC6 A;  1MSD A;  1JR9 A;  1EN4 A;  1IXB A;  1LUW A;  1ZLZ A;  2AW9 A;  3CEI A;  2CE4 A;  1Y67 A;  5A9G A;  1EN6 A;  1I0H A;  1MMM A;  3AK3 A;  1VEW A;  3OT7 A;  1PM9 A;  1AVM A;  1IX9 A;  1XDC A;  1ZTE A;  1BS3 A;  3DC5 A;  2ADP A; 
#chains in the Genus database with same CATH topology
 2F4V O;  1EM1 A;  1WN7 A;  4ASU G;  3CRM A;  2B5U A;  2YEV A;  5A2Q N;  4YIO A;  2X6C A;  4RUF A;  2QWN B;  4JV5 B;  4FLY A;  1MZF A;  1M9N A;  3X2Q B;  2HLD G;  4DV5 B;  5EIB D;  4EEQ A;  3SPJ A;  3HKC A;  5FLX N;  1YSC A;  5LHH A;  1AI6 A;  2XTA A;  5EZY A;  1ZUQ A;  2GDS A;  2FML A;  3PN1 A;  2CGO A;  1P84 F;  1TA8 A;  3K5M A;  1Y76 B;  2V7Q G;  1N36 O;  4FPP A;  4LFC O;  2ZXW C;  1L1F A;  3X2Q C;  1RFY A;  2QWP B;  4IGG A;  4DV0 B;  4YHH B;  3J80 N;  5HFM A;  4X89 A;  2PI4 A;  3P32 A;  3A0H Z;  3O9O A;  3OGC C;  5B1B C;  1Z5V A;  3KZI Z;  2QTS A;  4B3T O;  2P90 A;  3THO A;  2Q0A A;  4DUY O;  1WJZ A;  3S3W A;  3BPZ A;  4UB6 Z;  1NU1 H;  5H6R A;  5BR8 O;  4P30 A;  2KKW A;  1H2S B;  1EFR G;  3CRC A;  2JK5 C;  2ZIM A;  3G6B A;  1TUE B;  4K3A A;  3B2E E;  3E86 A;  2UXC O;  4JI8 B;  1LR1 A;  4NVP A;  2X6B A;  2W6I G;  3K59 A;  2FL4 A;  4LFB B;  1W0J G;  4DW0 A;  4H13 B;  2KB1 A;  4TV9 A;  1S5L Z;  1VF6 A;  4F4L A;  4KHP O;  2VQF O;  2Z0A A;  4MTG A;  5IY5 B;  4X62 O;  3CXC U;  2DQ0 A;  1SS3 A;  3OE7 G;  1VMG A;  1BMF G;  2O57 A;  4ICG A;  4X65 O;  4FLV A;  3JAT B;  1D5N A;  1HNX B;  5LMU O;  4AI8 A;  4O2A B;  4DR6 B;  2Q6A A;  2ITD C;  3AG2 B;  3K5L A;  2A3Q A;  2B1I A;  3T1H O;  2EIK C;  4JTD B;  3OW2 U;  1ZL8 B;  3AG3 B;  2WA4 A;  3OR7 C;  5JH7 A;  1GAX A;  2QWR B;  1RPR A;  3K9S A;  3D3I A;  3ZMT A;  5LYJ B;  2D2C B;  1K4D C;  2JEU A;  4G27 B;  2KG7 B;  2Q9L A;  1VQ7 V;  4GKJ B;  2JJ1 G;  3ZRX A;  4B7E A;  1PD3 A;  5IT9 N;  5L3G A;  3AG2 C;  2IM9 A;  4JI4 B;  4YJ3 B;  4JI1 B;  2X0L A;  4FM1 A;  3FYE B;  2A9H A;  3QO7 A;  3DSQ A;  4LC1 A;  4TQF A;  1V9P A;  4HNA B;  4QGP A;  1LNQ A;  2L6L A;  4HNA A;  1XBL A;  3G6E V;  2WLL B;  4DV2 O;  1NZ6 A;  1R6T A;  3HR0 A;  4MVS A;  1AB3 A;  5D5Q A;  1DF4 A;  1H2K A;  2XAS A;  4CBC A;  5DED A;  3LNN A;  1SKV A;  3UT5 B;  4DR1 O;  2DYS C;  4IYH A;  4B3R B;  3K0D A;  3N27 A;  4X66 B;  2UXB O;  4F6R B;  2DN9 A;  4RWU A;  4BIO A;  1SQP H;  3ABK C;  4JV5 O;  1KQS U;  4CC5 A;  1K3E A;  1IXM A;  3W7U A;  1Q6H A;  4HAM A;  1K7D A;  3CB2 A;  4LWS A;  1AJP A;  2QWQ B;  4I4T A;  1HDJ A;  3DC5 A;  3SGI A;  3EXA A;  4CS3 A;  2PI5 A;  2YC0 A;  5IJ0 B;  4TUY B;  4YXW G;  3HKD A;  4MVO A;  3TK1 A;  1URF A;  3OM3 B;  4DO2 A;  1S72 V;  5CBH A;  1QR8 A;  4P2Z A;  4J7K A;  4PA9 A;  4JAU A;  3LSS A;  4I9W A;  3SPH A;  3SJQ C;  3RYH B;  2PGG A;  4DR3 B;  1R3L C;  2ZD9 A;  1V55 B;  3L75 H;  1Q82 W;  5D5P A;  1XRE A;  2IJH A;  1N32 O;  3AK1 A;  3KCY A;  2WLN A;  5IDJ A;  3ZHQ A;  1H8E G;  3Q4H B;  3RBZ A;  2Q7E A;  1J95 A;  1SQV H;  5EC2 C;  4JAA A;  1P49 A;  5H2F Z;  2LW1 A;  2OIE A;  2IJJ A;  1Q90 D;  3APQ A;  4B3T B;  4U7N A;  3K9A A;  2EBO A;  1R6K A;  4UVC A;  2RN9 A;  4K35 A;  3TET A;  4JYA B;  1Q43 A;  3UQ8 A;  5EC1 C;  2A06 H;  2OCC C;  1N33 O;  4FLU A;  1ZX3 A;  3ZED A;  2R70 A;  1NR1 A;  4KP4 A;  4EFB A;  2ZM6 B;  4I4T B;  5KX5 A;  2DOS A;  1I94 B;  2AHZ A;  1FFT B;  3RGB A;  2EIL B;  5KHH A;  4OXS A;  1AI5 A;  3ZBH A;  4DRX A;  4UXN A;  4DR4 B;  2NN4 A;  4J7J A;  4GX5 A;  1G4Y B;  1OCC B;  3BEH A;  1M1K W;  2JVD A;  2ZIO A;  5C93 A;  2R9R B;  2QGN A;  3CCL V;  1OHH G;  3K03 A;  4LWS B;  1OV9 A;  1M5I A;  1AVM A;  4DR6 O;  3FAV B;  2EIL C;  1W0K G;  1NR7 A;  4IHJ B;  5B1A C;  4YJ3 A;  2ADQ B;  3RN4 A;  4DV0 O;  1EBO A;  1YDX A;  3LUT B;  5J2U B;  2JGD B;  4CH5 A;  1FPO A;  2OTJ V;  1Q6U A;  5LOV A;  4JAS A;  2QKS A;  4DUY B;  4YY3 O;  3K5N A;  4GKJ O;  4JTA B;  1AJQ A;  1HNW O;  1L0L H;  4H44 B;  1FJG O;  1S0V A;  4EKW A;  3IGA C;  4PDM A;  4DV1 B;  5BY1 A;  5B1A B;  3CCV V;  4DR4 O;  2OCH A;  3CCS V;  2HVJ C;  2IBZ H;  1PNK A;  2K9P A;  3DGE A;  4LFB O;  1AJN A;  1F51 A;  3GWK C;  2PUS A;  4UV9 A;  5KAI Z;  2ZCE A;  2N74 A;  2WLH A;  4HZ3 A;  1M56 B;  2P5O A;  3A0B Z;  2OWO A;  4ZI7 A;  3RYI B;  4LF7 B;  4DR1 B;  1QBZ A;  4BW9 A;  5IWA O;  3H1J H;  4XDL A;  1NQT A;  1YIJ V;  4N21 A;  1KD1 W;  2IW5 A;  2XAJ A;  4TV8 A;  4NXM O;  4DV7 O;  5IYC O;  3MHS C;  3ABL C;  4YY3 B;  1EN4 A;  3E8G A;  3H01 A;  2M6Y A;  5KHK A;  3QNE A;  1GMG A;  1F4M A;  3OD4 A;  5JCO C;  1WA8 A;  5A9G A;  2DE0 X;  3NXS A;  4I0X A;  3RYI A;  3BVO A;  4NB5 A;  5ITZ B;  4UB8 Z;  1BQ0 A;  3OMI B;  4X64 O;  1BE3 H;  4JI7 B;  3A8T A;  3WB1 A;  3DXR B;  1PL4 A;  1NBM G;  1B04 A;  2LW7 A;  1I5Y A;  2BE3 A;  1V54 C;  3QO5 A;  4PDL A;  4DUZ O;  2P06 A;  2P22 C;  1AP6 A;  2WPD G;  3RVY A;  1Q3E A;  5CBG A;  2HHH B;  4X1I A;  2HKO A;  4LF6 B;  4LF7 O;  1FXK A;  2Q67 A;  4LH7 A;  1VQL V;  2GSM B;  4DR7 B;  2ZT9 B;  3ZMV A;  3ZIA G;  1MZE A;  5EZY B;  2CTW A;  2G38 A;  5LHG A;  3JAL B;  2LFS A;  3PJS K;  1N33 B;  3UO3 A;  1SES A;  1ZSP A;  1NTZ H;  3ZHS A;  4DV5 O;  4EFE A;  4QPK A;  3CS5 A;  3TCU A;  4BWA A;  1FXV A;  2Q8V A;  2ZE6 A;  2AZ2 A;  2IU0 A;  4NTX A;  1QQC A;  1PL0 A;  2HEP A;  2JJ2 G;  3SJB C;  1NKD A;  3BHP A;  4FLW A;  4C7U A;  4JI3 O;  3UM7 A;  4DR2 O;  5ITZ A;  1W59 A;  1VQO V;  4PD4 F;  4LF5 O;  4PA6 A;  2DYR B;  3CRR A;  1NVP B;  4UCV A;  3JAS B;  4J11 A;  3JAR A;  1D5A A;  1IBL O;  1XHZ A;  1XNR O;  1Y66 A;  1Y4M A;  3K58 A;  2VQF B;  1JJO A;  1MSD A;  1K5Q A;  1IBM O;  3OUS A;  1ZAU A;  3H1L H;  3NR7 A;  3TGU H;  5KMG B;  1VQ5 V;  1YTF D;  2YDE A;  4O4I A;  2JGD A;  4JI2 O;  4KL1 A;  1PKX A;  2ODM A;  3BAA A;  4Q6G A;  1PM9 A;  4NKG B;  1JQ0 A;  5L3C A;  3ASO C;  1NTK H;  1N4C A;  2R9I A;  3N2G A;  1VQM V;  5JQG B;  2EJR A;  1HW7 A;  5JJJ B;  2YUA A;  3B09 A;  1FJG B;  4MS2 A;  2E74 B;  1XNQ B;  2P4K A;  1JOY A;  2P67 A;  3D36 C;  5B1N A;  4JZG A;  2ZM6 O;  1XMQ O;  4GCZ A;  3G71 V;  2H3O A;  3H9V A;  4O4H B;  2YIB A;  4PI2 A;  3T4D A;  2Z5U A;  4RQF A;  1D2D A;  4MVM A;  1HNZ B;  3D8C A;  2GBO A;  1M93 A;  2YXH A;  3CC7 V;  4D7T A;  2QKC A;  1BL8 A;  2CAZ C;  1JCH A;  1ARO P;  5DM6 V;  2GV9 A;  5GON B;  2OTL V;  2E76 B;  4XDJ A;  3QO8 A;  4D6T H;  3VQY A;  4Q20 A;  3BFR A;  2KQX A;  3STL C;  4WBN B;  3SDL A;  1XI1 A;  4JI2 B;  1KC8 W;  4GX0 A;  4NTW A;  4WFF A;  3WFV A;  3MAQ A;  2W6J G;  4O2B B;  1ROP A;  2JGU A;  4MTO A;  1OCC C;  4GLX A;  4U3F H;  3R66 A;  1SZX A;  2W0F C;  4WF9 V;  2WAM A;  5JJN B;  5B5E Z;  4UCS A;  1FFX B;  5LMN B;  3FAV A;  1RP3 B;  1N0J A;  3SJA C;  1BQZ A;  4LF8 O;  5IYD O;  3ZRV A;  5LGN A;  1IXB A;  4PDR A;  3UO2 A;  4DK1 A;  3SJC C;  1YF2 A;  2A7W A;  2FTK A;  2BSK A;  4KXR A;  2RMK B;  3N2K B;  1R3I C;  1SQX H;  5FL7 G;  1QR9 A;  1MMM A;  3E8H A;  4CS2 A;  3A2F A;  1KB9 F;  3AG1 C;  2Y4T A;  3JAS A;  2N05 A;  3KG2 A;  3I55 V;  3CE2 A;  2Q69 A;  3P3N A;  3FD9 A;  4AQY O;  2LJ2 A;  1PNL A;  1XEQ A;  3BAB A;  2ADP A;  4DR3 O;  4FK5 C;  3VQX A;  1VQ4 V;  2E75 B;  1H8H G;  3K79 A;  3L70 H;  2F43 G;  3C90 A;  4IHJ A;  4O4J A;  2Q73 A;  2YIC A;  3L71 H;  4LH6 A;  2UU9 O;  3ETQ A;  4MW8 A;  2NR5 A;  2Y69 C;  5LP6 C;  4JI8 O;  1YIT V;  1FAF A;  4LCU C;  1T5E A;  4GX2 A;  2F4V B;  2ITC C;  3CSX A;  1QCE A;  5IJ9 A;  2BCC H;  4NYK A;  2EJ7 A;  2M7W A;  3GWO A;  3FB5 C;  1M56 C;  1QHT A;  4JYC A;  5DN6 G;  3AG7 A;  3ICX A;  4FFB A;  4R6Z A;  3WB0 A;  3I56 V;  2WLI B;  2QKA A;  3U11 A;  5CA3 A;  3IAY A;  3ZHR A;  3MHH C;  4CH3 A;  1IBL B;  1XNR B;  5JQG A;  2ZE7 A;  3AK2 A;  3WG7 C;  3ZHV A;  4O2B A;  4R8C A;  2QA4 V;  1QVF U;  1QVG U;  4YJ2 B;  4PDV A;  3F7V C;  4QJF B;  5J2T A;  2DJV A;  2ATK C;  5B3S B;  2R9A A;  4LFC B;  1FXK C;  4UVB A;  3AG4 B;  3D36 A;  1YEW A;  4I0X B;  4O4L B;  1IDS A;  1K34 A;  4O4I B;  3E89 A;  3JAW B;  1KP2 A;  2D3O W;  3J7A U;  2IJK A;  3HKE B;  4FZ0 A;  3CD6 V;  3MD0 A;  1VQ6 V;  1QLE B;  1VF5 B;  3WU2 Z;  3LNM B;  2UUC O;  2EIN C;  3O65 A;  3DTU B;  3OTF A;  1DK1 A;  2VS0 A;  4X1Y B;  4WFA V;  4PI0 A;  3OT7 A;  3RYC A;  4Z2W A;  4J9Z B;  1FXK B;  2XAF A;  3E8F A;  3JD0 A;  4O2A A;  3OTO O;  2YSU B;  1WPX A;  5EIB C;  4MVQ A;  1DLB A;  4DW1 A;  4ZHQ A;  4LFA B;  3LDE A;  4XDK A;  5FPO A;  1BGY H;  4FM2 A;  1GTO A;  4UV8 A;  4MVR A;  4QE7 A;  2ZE5 A;  1LUV A;  5H6Q A;  2DWD C;  4TQD A;  4LP8 A;  2YIA A;  1K73 W;  5L3F A;  3OAA G;  4F6E A;  1AI4 A;  4BIU A;  4TUY A;  2PZS A;  3UT5 A;  1SC5 B;  1SQB H;  2BTQ A;  1VP7 A;  5EYP B;  1Y74 A;  1I7F A;  3BRC A;  4BIZ A;  4ZOL B;  3G80 A;  1TVK B;  3N2K A;  5LBQ A;  1GK9 A;  4O4J B;  2DYR C;  2ETN A;  1THZ A;  1NTM H;  3CCQ V;  4LF4 O;  1MNG A;  1U96 A;  4AIL C;  3T1C A;  1TUB B;  1Y76 A;  2RDC A;  4X1K B;  1JMK C;  2FB5 A;  2XAG A;  1IZ3 A;  2DWE C;  3M7M X;  5CBF A;  1XIL A;  4TWK A;  2YI8 A;  2XND G;  2CTQ A;  1HR0 B;  3GB7 C;  5IYZ B;  1OCR B;  3HKC B;  4PEL A;  1OZ0 A;  1K97 A;  1XNQ O;  1XL6 A;  1H2N A;  1MOF A;  4LR3 A;  3T4Z A;  1XMQ B;  2OCC B;  1NH2 B;  4TV8 B;  2UXX A;  4ZIB A;  4FM0 A;  2Q7G A;  1NH2 D;  2HR3 A;  3ABT A;  1GKF A;  1GM9 A;  1S77 D;  2CE4 A;  2P6J A;  4GKK O;  2H8P C;  1EN6 A;  4PHZ A;  3BY6 A;  3CCU V;  5DEC A;  2AZ0 A;  1K9M W;  1R6N A;  2CK3 G;  5KMG A;  4FLT A;  3GVM A;  3JD2 A;  3SYO A;  2UXD O;  4LF6 O;  1BS3 A;  5C8Y B;  4DR7 O;  2XHB A;  2WWW A;  4MTX A;  2YEV B;  5AG2 A;  5CN0 A;  2ZXW B;  2NNU A;  4JI6 O;  5LGU A;  2VQE B;  2JIZ G;  4JI5 O;  4X1I B;  1B6Q A;  2UXN A;  5GTI Z;  2JS3 A;  4IYI A;  1M57 C;  2DW4 A;  4R7C A;  4TT3 G;  4H0L B;  1JVM A;  1GM8 A;  5B1B B;  3RW0 A;  1K8A W;  5CA1 B;  1R1B A;  3QTC A;  5KHI A;  3TXQ A;  3FKS G;  3HKB A;  4L87 A;  2LP7 A;  5HFL A;  4LF5 B;  3TJT A;  3RT3 C;  4X62 B;  1EZV H;  2WLK A;  1PP9 H;  4FVM A;  4BW5 A;  1AR1 B;  3OMN B;  1GO3 F;  4CH4 A;  4WBN A;  4X65 B;  1WP8 A;  1GN4 A;  1M57 B;  3JD4 A;  3E35 A;  3OEH G;  1CEZ A;  1X4T A;  1A32 A;  3CP1 A;  1O9G A;  4JPR A;  1UFI A;  1ENV A;  1VF6 C;  2UUC B;  2CTP A;  3JAR B;  5E79 Z;  5BZB A;  3W7T A;  1YXB A;  4JYB A;  3AG1 B;  3EVK A;  4FLX A;  4R50 A;  2Y48 A;  4DR2 B;  1G1X B;  1OCO B;  4X20 B;  3Q4H A;  3RWR D;  4ABM A;  1E1R G;  2HFE C;  4PV1 B;  4O4H A;  4LBE C;  2FKX A;  3DXR A;  1TAE A;  3AG3 C;  4J10 A;  2XT9 A;  3ABM B;  4JI4 O;  5LOV B;  5K1P A;  3ABL B;  2IH3 C;  4U3J A;  2QSA A;  3IFX A;  2OIG A;  4B3S O;  4W4K A;  1L8D A;  3ETE A;  2DMX A;  1YJN V;  1KKD A;  3ZJZ A;  3TXS A;  1YTF B;  4X88 A;  1PV0 A;  2QWO B;  3JAW A;  2UUA O;  1TGO A;  5BMV B;  3OGI B;  1XMO O;  2GTS A;  4X66 O;  3ZN1 A;  2A0L A;  1HWY A;  4FMT A;  5KHJ A;  4DXW A;  3HB3 B;  2Q4P A;  1SA0 A;  5B3S C;  1CP9 A;  1S5H C;  2E5L O;  3P30 A;  1FXH A;  1OJH A;  1AIL A;  2UUB O;  3AG4 C;  4FZ1 A;  1OCZ C;  1KBH A;  1O9H A;  1DF5 A;  2XAQ A;  1XQ8 A;  1SET A;  1WPB A;  2DYS B;  3M99 B;  4DUZ B;  3EFF K;  4H37 A;  5L3E A;  3ABK B;  3KKY A;  1BT8 A;  3BA9 A;  1TUB A;  1QLN A;  2RJZ A;  5JCO A;  4X1Y A;  5CB4 B;  2KG7 A;  3ZCC A;  2Q5Z A;  3RVZ A;  1OCZ B;  1GRJ A;  2CTR A;  4I50 A;  1R3K C;  2IH1 C;  3T1H B;  2BTQ B;  4IT5 A;  3M8A A;  5IWA B;  2BSK B;  1Y67 A;  1JJ2 U;  4K0K O;  1IBK B;  2PTM A;  2Q0O C;  1YHQ V;  5EK0 A;  2F95 B;  4Z1V A;  5E1A C;  3L72 H;  4JI5 B;  2YID A;  4JTC B;  1FS0 G;  2BOC C;  2RQ6 A;  1FFX A;  1XL4 A;  2C2A A;  2H94 A;  3ZRW B;  3HKD B;  3ZHU A;  2B1G A;  1YCI A;  4B3M O;  2OYQ A;  1Q8I A;  1VQ8 V;  1F4N A;  2CDY A;  2IJI A;  2LGW A;  2Q68 A;  3IJ4 A;  2DQ3 A;  3N2G B;  4MT8 A;  3CJH A;  3E22 B;  1AI7 A;  3FFQ A;  4JAV A;  4WFH A;  2PY5 A;  3A0R A;  4OX9 B;  1Q5O A;  4RUE A;  1N34 B;  4LF9 O;  2ZDI A;  2NLJ C;  2AGA A;  1OCR C;  4QPJ A;  3CC2 V;  2K1E A;  1E1Q G;  1Q81 W;  3BA8 A;  4OPA A;  3OFN G;  2Y0I A;  4YIP A;  2OT5 A;  2X7R B;  4DV6 B;  5KA6 A;  4DV4 B;  4X20 A;  4IL6 Z;  1VQN V;  4KFM A;  5GW7 A;  2WLL A;  1GM7 A;  2AHY A;  1WA8 B;  3CPW U;  1AP5 A;  4UCU A;  1HNW B;  1YJW V;  4DV3 O;  2QM7 A;  3H1K H;  3T1Y O;  1P7G A;  4J7Z A;  3OEE G;  1NS1 A;  2QDO A;  1MSW D;  3SPC A;  3ZN0 A;  2JS5 A;  2AW9 A;  4BAY A;  3SYA A;  1N32 B;  1G6U A;  2JRI A;  4LFA O;  1I0H A;  3F5W C;  4W4L A;  3CCM V;  2CUG A;  3K08 A;  4CZZ A;  1KMI Z;  3RYC B;  5LA6 B;  2V1D A;  4OGQ B;  1XDC A;  4ZI7 B;  1ZWI C;  4CS4 A;  1LUW A;  4P9P A;  4WFE A;  1WLE A;  3W7W A;  2QJ1 A;  1EZJ A;  2EIJ B;  4ZHQ B;  5J2U A;  4UVA A;  5TIS Z;  3JD1 A;  4XBF A;  2EIM C;  2F1M A;  1WAZ A;  3B77 A;  5CB4 A;  3T2M A;  2PYJ A;  4LF8 B;  4U7O A;  1VQK V;  1R3J C;  2HJF C;  3H1I H;  3VQV A;  3ZRS A;  1SF9 A;  3CXH F;  5LGT A;  2QE7 G;  1JPX A;  2EX3 A;  2HVK C;  2ZR2 A;  3IC7 A;  1FKA O;  3D3Q A;  4GT1 A;  1L0N H;  1NJI W;  1FYJ A;  3HKE A;  1RPO A;  1US6 A;  4ZOL A;  1DGS A;  1GN3 A;  1HR0 O;  2QTO A;  4AQY B;  3ZMZ A;  4MVU A;  4JI7 O;  1S5J A;  4UCR A;  1FD9 A;  3CMA V;  1YJ9 V;  1WB7 A;  2EIM B;  4QIW F;  4KHP B;  1NI8 A;  4DYL A;  4DV2 B;  5EBW C;  1BHA A;  4FFK A;  3IC9 A;  4WFB V;  4PJ0 Z;  3OR6 C;  3K57 A;  1KP3 A;  2UXB B;  4E4E A;  1M90 W;  4B3S B;  1GN2 A;  1S3J A;  3JAL A;  1COW G;  3UCS C;  5KHG A;  4NTY A;  5LMU B;  3ABM C;  5IY5 C;  3LSU A;  4LNU A;  1V54 B;  3B40 A;  4MW3 A;  3J81 N;  3JAT A;  2LQT A;  1H2G A;  1UJW B;  1RSO B;  4B3M B;  4DV1 O;  3AK3 A;  3JD3 A;  1F23 A;  4I5S A;  5EYP A;  4JI6 B;  4H33 A;  5LXT A;  5LXT B;  4QE9 A;  3P3P A;  2KSD A;  4K8X A;  5BMV A;  3VOU A;  2V4D A;  1ZTE A;  1IJG A;  1KU9 A;  1QLE C;  1JFF B;  4GKK B;  3CX5 F;  1P4R A;  2CGN A;  1Z5W A;  5LHI A;  3SPG A;  3K5O A;  1Y6X A;  3WB2 A;  1SA0 B;  4B7K A;  1Q86 W;  4JZ2 A;  2F23 A;  2UXD B;  2YXY A;  4MTF A;  1SQF A;  2Z3Y A;  2ZNI A;  1VAR A;  1N34 O;  2P7T C;  2ZR3 A;  3SYC A;  4RAI A;  5L3D A;  5CMU A;  4ZBM A;  2XUM A;  4NR1 A;  5KA5 A;  2FYU H;  4DV7 B;  3CCR V;  3CC4 V;  3JAM N;  4GUN A;  4JI0 O;  5B66 Z;  4G28 B;  4DV4 O;  5JVD A;  3JSL A;  4X1K A;  3ZX6 A;  3MDS A;  2N04 A;  1IBK O;  1XUQ A;  2HJD A;  2F66 C;  1YI2 V;  2L35 A;  3OMA B;  1KYO F;  4TOI A;  3LSQ A;  1VF7 A;  1CXZ B;  4X8A A;  3B4S A;  2UXC B;  1XHX A;  1ORQ C;  4MVZ A;  4HYO A;  1KKC A;  4FIP C;  3ASO B;  3W7S A;  1SZT A;  3K04 A;  1HNZ O;  5FNV A;  3B8N A;  3LDD A;  1JR9 A;  1RM1 B;  1X59 A;  1ZLZ A;  3CEI A;  1WP7 A;  1I5X A;  4GYC B;  1PNM A;  5BR8 B;  5CA1 A;  3RYH A;  4OX9 O;  1B3Q A;  3JAK A;  2JEX A;  1SQG A;  2ZKO A;  3SPI A;  2BOB C;  1GH6 A;  4NXN B;  2JDI G;  1R73 A;  5IJ9 B;  2PYL A;  2ILM A;  3ZHT A;  3OUF A;  5IE9 A;  3ABU A;  3CWB H;  4P9O A;  1DTO A;  4JI3 B;  1RM1 C;  3ASN C;  5IJ0 A;  1VQ9 V;  2YS8 A;  3AEI A;  4O4L A;  1TVK A;  5KUK A;  5C8Y A;  3OTO B;  3VBB A;  2AXT Z;  3L73 H;  4HBN A;  2ZNJ A;  1GN6 A;  5JH7 B;  4N23 A;  1AR5 A;  3CCE V;  1FOU A;  3T1Y B;  4IIJ B;  4I7Z B;  1HNX O;  5J9P C;  1IBM B;  4GX1 A;  2YI9 A;  1K33 A;  2EZO A;  1K92 A;  2YIB D;  3ASN B;  2WLM A;  1QNM A;  3C3S A;  3HPL C;  2XOK G;  5LL6 Y;  1Y74 B;  1EN5 A;  1K5S A;  2UU9 B;  4NXN O;  3JCU Z;  4LNU B;  2UUB B;  1JX9 A;  5K1X A;  3QG5 A;  4EB6 B;  4KUM A;  1WNS A;  3QVN A;  3L9D A;  3SR2 C;  1SRY A;  3RYF B;  2GTA A;  1K4C C;  3EHB B;  1QU7 A;  4JI1 O;  2EUL A;  2IU3 A;  4X64 B;  2F93 B;  5JWP A;  3K3W A;  2WLJ A;  1P7B A;  1KUQ A;  3ETG A;  5B1O A;  4J42 A;  4FLZ A;  1N36 B;  4RQE A;  2EIJ C;  2GHY A;  1JFF A;  4F6R A;  1ZL8 A;  4ZKI A;  4PA3 A;  2R72 A;  3RFR A;  4DR5 B;  1VEW A;  4YHH O;  4D7S A;  2HHH O;  3CJH B;  3E22 A;  2LFR A;  2EZP A;  1SER A;  1OCO C;  2WSS G;  1M4U A;  2X6A A;  2ZE8 A;  2B9Z A;  5FPR A;  2Q7H A;  4OPH A;  1E79 G;  3K0G A;  1RSO A;  3SYP A;  2WA3 A;  5GTH Z;  4I50 B;  3E83 A;  2HG5 C;  3ZMU A;  5IYB O;  4JI0 B;  1SQQ H;  1VIB A;  4E2L A;  2RNB A;  5KUM A;  2P4V A;  1J5E O;  2QEX V;  2W0X A;  1U97 A;  1BSM A;  4IIJ A;  4UFZ A;  4RO2 A;  5J2T B;  1PPJ H;  5KX5 B;  1IVS A;  4UCO A;  5LMN O;  3CYO A;  1H38 A;  4A5U B;  3ZMS A;  3QF7 A;  5LA6 A;  1B06 A;  1KEC A;  2ZDI C;  1Q7Y W;  3JCZ A;  2WLI A;  1I94 O;  1F7Y A;  1CPY A;  2EIK B;  2Y69 B;  5JJE B;  3JSN A;  5LP6 B;  2ARH A;  1AR4 A;  4CC6 A;  3F5T A;  2PF4 E;  4X9Q A;  5F2V O;  4CH6 A;  3CME V;  1HP8 A;  4JYY A;  4PA4 A;  1YZB A;  4LF9 B;  2BTO A;  5CA0 B;  4UCT A;  2VWJ A;  4Z1M G;  1NT2 B;  3C3T A;  4DV6 O;  1MG1 A;  2LGQ A;  3ETD A;  3G67 A;  2MW2 B;  3S3X A;  3R65 A;  3WG7 B;  4LF4 B;  3JYC A;  2QM8 A;  5LYJ A;  5BXZ A;  1H2L A;  4B08 A;  5H9C A;  4DV3 B;  1MAB G;  3FX7 A;  5CA0 A;  3ZS8 C;  3CCJ V;  2HP8 A;  1H5W A;  4PA7 A;  2Y4U A;  4JF3 A;  3K06 A;  5L3B A;  2VRZ A;  4K8Z A;  2A79 B;  3FB8 C;  3B8M A;  2ZIN A;  1MA1 A;  2MK3 A;  1VQP V;  1Z2G A;  3CRQ A;  2QM4 A;  5JVD B;  3F7Y C;  3HKB B;  5KLV H;  4YJ2 A;  3FB7 C;  1NVP D;  1S76 D;  4J41 A;  4TSF G;  4U3J B;  3KCX A;  2EIN B;  2QR4 A;  2VWK A;  4FJC C;  4DK0 A;  1BCC H;  4L8J A;  3STZ C;  2CH7 B;  2CH7 A;  5KAF Z;  4B3R O;  3FB6 C;  5EBM C;  1YVW A;  4UUJ C;  3ZRW A;  4K0K B;  3CRA A;  2YXL A;  3LDC A;  4I55 A;  1IUR A;  3G4S V;  3BCC H;  5IYZ A;  4I9Q A;  4WCE V;  1JA8 A;  2XAH A;  3KDR A;  1BZK A;  3I5D A;  3ML0 A;  1WB8 A;  3UKM A;  1UPG A;  5FNV B;  2UUA B;  1G8M A;  1N0N A;  4MSW C;  4WFG A;  4BR6 A;  1V55 C;  3FYI B;  1W2B U;  1XMO B;  1I08 A;  2E3C A;  5EBL C;  3U10 A;  3E2E A;  1H2M A;  5GON A;  2RCV A;  2GUZ B;  2GUZ A;  2ZQM A;  2VQE O;  3L74 H;  2E5L B;  3U0Z A;  4JGS A;  3E8B A;  3H1H H;  4J9Y B;  4DR5 O;  4G2K A;  3SYQ A;  3DC6 A;  4QNH B;  3W7X A;  3VQW A;  4EB6 A;  4GZR B;  1Q6I A;  1JNB A;  3CHX A;  3RYF A;  4I55 B;  4JYA O;  4FFB B;  1N8R W;  2LO1 A;  4NXM B;  1IX9 A;  4J80 A;  1XOU A;  2Y0P A;  5H5N A;  4TV9 B;  4AHC A;  5LP6 A;  1BHB A;  4DRX B;  3APO A;  1J5E B;  3JAK B; 
#chains in the Genus database with same CATH homology
 1PL4 A;  1EM1 A;  1MA1 A;  2ADQ B;  3RN4 A;  5AG2 A;  4YIO A;  2P4K A;  1AP6 A;  4JZ2 A;  4JZG A;  1D5N A;  1LUV A;  2CDY A;  1VAR A;  4F6E A;  1XRE A;  1BSM A;  1ZUQ A;  2GDS A;  1GN6 A;  3AK1 A;  1AR5 A;  2QKC A;  3K9S A;  1JA8 A;  1ZSP A;  3KDR A;  4GUN A;  1B06 A;  1GN3 A;  3TJT A;  1WB8 A;  3MDS A;  3BFR A;  1MNG A;  2QKA A;  1N0N A;  4BR6 A;  1XUQ A;  1QNM A;  1WB7 A;  3C3S A;  1I08 A;  1AR4 A;  3AK2 A;  4C7U A;  4YIP A;  1GN4 A;  1EN5 A;  2RCV A;  4X9Q A;  4JYY A;  1XIL A;  3KKY A;  4FFK A;  3IC9 A;  1KKC A;  1BT8 A;  1AP5 A;  4E4E A;  1SZX A;  1GN2 A;  3QVN A;  1IDS A;  3EVK A;  3C3T A;  3LSU A;  1P7G A;  1N0J A;  3DC6 A;  1MSD A;  1JR9 A;  1EN4 A;  1IXB A;  1LUW A;  1ZLZ A;  2AW9 A;  3CEI A;  2CE4 A;  1Y67 A;  5A9G A;  1EN6 A;  1I0H A;  1MMM A;  3AK3 A;  1VEW A;  3OT7 A;  1PM9 A;  1AVM A;  1IX9 A;  1XDC A;  1ZTE A;  1BS3 A;  3DC5 A;  2ADP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...