3DC6A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
197
Chain Sequence
KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 1
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 79
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc6A02
4X9QA 1LUWA 4F6EA 3QVNA 1QNMA 1EN6A 4E4EA 4BR6A 1IXBA 3K9SA 1IX9A 1JR9A 1XDCA 1XILA 2P4KA 3LSUA 1AVMA 1N0NA 3EVKA 3RN4A 1VEWA 1AR5A 1MMMA 1I08A 1EN4A 1ZSPA 1IDSA 2AW9A 1SZXA 3CEIA 4JZ2A 1BSMA 1N0JA 1BS3A 1ZLZA 3OT7A 1WB8A 1EM1A 3AK3A 1I0HA 2CE4A 4JYYA 4FFKA 3C3SA 5A9GA 1GN6A 5AG2A 2CDYA 3BFRA 4JZGA 1VARA 1Y67A 4GUNA 1ZTEA 1JA8A 1PM9A 4C7UA 1PL4A 2QKAA 1WB7A 3AK2A 1KKCA 1LUVA 1EN5A 1AP5A 1ZUQA 3AK1A 1P7GA 2GDSA 1BT8A 3C3TA 4YIPA 1GN2A 1AR4A 1B06A 1MNGA 1GN3A 1GN4A 1XUQA 3IC9A 1MSDA 4YIOA 1MA1A 3MDSA 1AP6A 2QKCA 3KKYA 3TJTA 3DC6A 2ADPA 1XREA 2RCVA 2ADQB 3DC5A 1D5NA
chains in the Genus database with same CATH superfamily
2GHYA 2A3QA 5IJ0B 4X62O 2WLIA 2IH3C 2YIBA 4I0XB 1R6NA 1NVPD 2UU9O 1FXVA 3K9SA 2H8PC 2HR3A 2L35A 5E79Z 2F4VO 2EINC 4LF6B 1TGOA 1ZAUA 2Y69B 1B04A 5LP6C 3T1YO 1QCEA 5KAIZ 4JI8B 2ZCEA 3QO8A 2UXCB 1HR0O 1TA8A 1NR1A 2JIZG 4FLUA 1HNZO 1HW7A 1IBLO 2DWEC 4H44B 5KX5B 1EFRG 3QO7A 5C93A 1XMQB 1SC5B 1B6QA 1KU9A 4LF7O 1M90W 4HYOA 3FFQA 1NT2B 1RPOA 4GX5A 1NI8A 4DV5O 4PV1B 5A9GA 4B3TO 2UUBO 1R73A 4JI2B 4TT3G 5KHJA 3ICXA 4FLZA 1K3EA 1V54B 2VWKA 2RN9A 1TUBA 1H8HG 4LF5O 2Y4TA 1K8AW 2N74A 1PL4A 1JJOA 2QKAA 4D7TA 2YEVA 2IJIA 1I94B 4NB5A 3E22A 3A0BZ 4F4LA 2HVKC 5B3SB 1K33A 2ATKC 2ITCC 3ZHQA 5H9CA 4DV0B 1SERA 5EZYB 2UXXA 3CRQA 1CXZB 1UFIA 4HBNA 3CWBH 1JOYA 4TUYB 3UO3A 1GK9A 3ZRXA 3QTCA 3OTOB 2EJ7A 4DV2B 1GO3F 3CCVV 1S76D 5CBFA 1L1FA 3SR2C 1OV9A 1D5NA 3VQVA 1QNMA 4QIWF 4E4EA 4TV8A 4ZOLA 2IJHA 1WLEA 4DV6B 2XHBA 4IYIA 1P84F 2YC0A 1V55B 3SDLA 2WLLA 1FPOA 5FPRA 1DLBA 3CRRA 4O2AA 4PHZA 2NN4A 4QPJA 2FTKA 5BR8O 3I5DA 1XL6A 2ZXWB 1ZSPA 1KQSU 3SPIA 3ABKB 1GAXA 1JPXA 4O4IB 2V4DA 2PUSA 4CH4A 4LP8A 4WBNA 3AK3A 2MK3A 3T1HB 4TQFA 1O9HA 1MZEA 3OGCC 2E3CA 2KG7B 3JSLA 5IJ0A 1XHZA 4I0XA 3ZJZA 3K5LA 2DWDC 2GV9A 4KHPB 2B1IA 3ZS8C 2EIKC 1KKDA 1EN5A 2BTQB 2JVDA 3CCEV 5EK0A 4DW0A 4LH7A 1K73W 3SGIA 2IU0A 2XASA 1OCOC 5DN6G 2QSAA 4J11A 5KX5A 5LMUO 3T4DA 2ZKOA 3ZEDA 4UCVA 2QM7A 4PI2A 2F43G 1F4MA 1R6TA 2OWOA 2CTRA 3ZRWB 4QE7A 1KUQA 2ZDIA 4LF9O 3UCSC 1N33B 1FXHA 3ZBHA 3BRCA 2QM8A 2EIMC 4F6EA 2PGGA 5CN0A 1FXKB 4OXSA 4DUYB 1CPYA 5JJEB 3AG3C 4YHHO 4DV4O 1VMGA 3SPJA 4YY3O 3THOA 4UFZA 3A2FA 1K34A 4DR5B 1DGSA 4CS3A 3LSUA 4RQFA 4X62B 1FYJA 5CBHA 2HLDG 1PL0A 3HKDB 1NR7A 2IM9A 2UU9B 3TXQA 4Z1VA 1M57C 2FKXA 5K1PA 3Q4HB 1NTMH 3OFNG 3JSNA 2F4VB 3H9VA 3SYQA 5IWAO 3NXSA 3CMAV 3K0DA 5EZYA 1SZXA 1N0JA 3B4SA 3FB5C 4W4LA 4WCEV 2ZNJA 4EFBA 4ZI7B 4TUYA 1D5AA 2RDCA 1AR1B 3CJHB 1Q81W 1KP2A 1QBZA 1HR0B 2FYUH 5JJJB 5EBWC 4EFEA 1HNZB 1NBMG 2QWQB 1IBLB 1FKAO 4FFKA 3C3SA 3UQ8A 3SYPA 4LC1A 2OTLV 5B1NA 1HNWO 1OZ0A 1ZTEA 2P67A 4UCTA 1N32O 4DV5B 4KFMA 4B3TB 2UUBB 3E8GA 5TISZ 2VQFB 4CBCA 1YI2V 2GTAA 5B1AC 4LF5B 2LW1A 3CRMA 1AR4A 1RM1C 3NR7A 5CBGA 1WN7A 4UB8Z 1NJIW 1XUQA 3G80A 1Y4MA 4U3JB 4O4IA 1JFFB 4JYCA 4FPPA 4MVMA 1SA0B 2QKCA 3L9DA 3QF7A 3AG1C 5EYPB 1HWYA 1N36O 3CCUV 1SESA 2KG7A 3OTFA 2Q7HA 5LXTB 2Q5ZA 4JTDB 1NQTA 3E2EA 3BCCH 3K5MA 5IYBO 2BTQA 4LFAO 5KA6A 1VP7A 4RQEA 1VEWA 3G6EV 3I56V 3OEEG 3UO2A 3L74H 3H1JH 2CGNA 2PYJA 1M56B 5BR8B 1EM1A 1PPJH 4NTYA 4XDJA 4YJ2B 3STZC 3ZRWA 3ZMTA 2WLHA 4TWKA 5LA6A 4ABMA 3TETA 5AG2A 4WFAV 1QLNA 1J95A 3ZMUA 4J42A 3ZCCA 1FXKA 2HHHO 4PD4F 1JA8A 2HP8A 3FB8C 1Y6XA 2HEPA 2QWRB 1S77D 5LHGA 3HKDA 4CH6A 2W0XA 3G6BA 3D36A 3Q4HA 2OYQA 3BPZA 3GWKC 1OCRB 1FJGB 4PDLA 3SJAC 1VQOV 1BGYH 4PDMA 2ZNIA 2DYSC 4ZI7A 3FYEB 2HG5C 1NKDA 1QLEB 2DQ3A 4D7SA 3CJHA 1VF7A 4OPHA 2YXLA 4KP4A 3W7SA 1HP8A 2F93B 5KHGA 3CPWU 4BR6A 1BZKA 3APQA 2QDOA 3KZIZ 1IX9A 5J2UB 4OPAA 2P90A 1NTKH 2O57A 1G1XB 1JQ0A 1TVKB 1N0NA 1MABG 1RPRA 3RFRA 4I50B 4EB6B 4DV4B 1SQFA 5KHHA 4YY3B 2CGOA 1AR5A 2QKSA 1VQ5V 4MSWC 4NXNO 2UXNA 1H8EG 2ZT9B 3ABMB 3CEIA 3F5WC 4F6RB 2Y69C 4U3JA 4OGQB 1JFFA 1OCCB 4X1YB 5JCOC 2XAFA 4FM2A 1SA0A 2A0LA 3ASOB 2Z5UA 3X2QB 4FZ1A 4HAMA 4UXNA 5BXZA 2IBZH 1JJ2U 5EYPA 4I5SA 3ETEA 4GX2A 2HJFC 4JGSA 5LXTA 4FLVA 3BA9A 2GBOA 2Q7GA 1RSOB 3BVOA 4I4TB 1AILA 5F2VO 2EILB 2ZDIC 1XMOO 3LUTB 1LUVA 4JAUA 1HNWB 1XBLA 2IU3A 3CS5A 1ZUQA 3ETDA 1P7GA 1N32B 1V54C 4LF8O 2UUAO 4J9YB 4O2BB 4GX1A 5KHKA 1K92A 3AG4C 4WFHA 3ZHTA 2YXYA 3A8TA 1JCHA 2YIBD 3B8NA 4ZIBA 1DF4A 1ZWIC 4O2AB 4YJ2A 2A79B 5B3SC 2RCVA 4MTXA 5JVDB 1K7DA 4X9QA 5D5PA 4DK0A 1JNBA 4Z2WA 2PY5A 1DF5A 3JCUZ 2A9HA 5LYJB 3H1LH 1F4NA 1JR9A 5B5EZ 5KUKA 5HFLA 3CCJV 2ZD9A 1N36B 4UCRA 4P9OA 1AVMA 4WFFA 4MVOA 1K4DC 3RWRD 3O9OA 4FLWA 3TCUA 1XNRO 1G8MA 2A7WA 2QTOA 2VQEO 1NZ6A 2GSMB 1EN4A 5FNVB 4JI3O 4U7NA 1M4UA 1V55C 4X66O 1Y74B 3OE7G 1SF9A 4LFAB 4GX0A 2CE4A 1NU1H 3DTUB 1Q86W 2OT5A 2ZXWC 5GONB 1SQBH 4DR7O 4DR1O 1ENVA 1GM8A 2UXDB 2IH1C 1BE3H 4MTGA 5GTIZ 1VF6A 1XOUA 4BWAA 5GW7A 5J2UA 1PV0A 4H13B 3JYCA 1TVKA 4GKKO 2Q7EA 3P30A 4I50A 4EB6A 2GDSA 5HFMA 1VQ7V 4U7OA 4A5UB 4WF9V 5BY1A 3ETQA 1B06A 3ZHRA 4R50A 4J7JA 3BAAA 3JAWB 2QE7G 4F6RA 4GT1A 3BA8A 3IAYA 4X1YA 2OCHA 5LOVB 1KB9F 3JALB 2R70A 3CP1A 4PJ0Z 3K9AA 2EBOA 2JK5C 1KECA 4H33A 4GYCB 1S3JA 2P7TC 4DR3O 4JI5O 3J80N 3BABA 1RSOA 4XDKA 1NH2B 4I4TA 4JF3A 3EFFK 1QR9A 1MOFA 3CC4V 1DTOA 1IZ3A 1QVFU 3SJBC 4QNHB 4DUZB 3LNMB 3L70H 3SPGA 2QM4A 1SZTA 4JI7B 3B09A 3GB7C 4O2BA 4O4LA 3JARB 4KXRA 1XHXA 2OCCB 2F66C 2JJ1G 2C2AA 1QR8A 4CC6A 3QNEA 3W7TA 3D36C 4LFCB 2XAHA 3K0GA 1OCZC 4DR6B 1Y66A 5JVDA 4ZKIA 4ICGA 4R8CA 4PDRA 5KLVH 1N34O 4B7KA 5LYJA 3GVMA 4BW9A 3FYIB 2DN9A 1AI4A 4X8AA 2R9AA 3VQXA 1H38A 1WB7A 4UVAA 5FLXN 1VQ6V 4PA3A 5LMNB 3J7AU 3G67A 1YJNV 2ZIMA 4WFEA 4FK5C 2V7QG 1GN2A 5L3EA 1OHHG 1MNGA 4O4JA 4JV5O 5FNVA 1K4CC 3MHHC 3K04A 1Y74A 2PTMA 3JD1A 1GH6A 2UUAB 2DJVA 1URFA 3H1HH 4X20B 1RP3B 5GONA 3RT3C 4IYHA 5C8YB 5DEDA 3IC7A 3ZMSA 3APOA 3ETGA 4FLYA 3JAKB 1H2KA 1XQ8A 5E1AC 3FB6C 4B3MO 2X6CA 4E2LA 1LNQA 2B1GA 4RAIA 2Y0PA 3E35A 2EIJB 3G71V 1UJWB 4UCSA 1PNLA 2WWWA 3RYFB 2DQ0A 4MT8A 1CP9A 5LA6B 3UT5B 4NVPA 4FM1A 4LF4B 2V1DA 5L3DA 4WFBV 4MVSA 3JAWA 2JGDB 3ZMVA 2UXBO 1QVGU 1XNRB 1UPGA 1YITV 2L6LA 4K8ZA 2Q0OC 2AHYA 3W7UA 1IBKO 3CYOA 1YHQV 2QWOB 2JGUA 1AROP 3LDCA 5LOVA 1E1QG 1H2LA 4JI3B 3JALA 4X66B 2CTPA 4PI0A 4JI4O 3CX5F 1YXBA 1Y67A 1N8RW 1M56C 2DW4A 5JQGB 1VQMV 3T1YB 5KA5A 2BE3A 2XAJA 4C7UA 3B40A 1FOUA 3F7VC 4DR1B 2F23A 2ETNA 4N21A 4FLTA 1Y76B 4ZBMA 3C3TA 1Q3EA 4J80A 3OUSA 4LF7B 1NTZH 4BIOA 1GN4A 2CTQA 2P5OA 3JARA 1U96A 4XBFA 4DYLA 2AGAA 1V9PA 2LO1A 1YIJV 4DV3O 1VIBA 2RMKB 4I55B 4DV1O 3KKYA 3MAQA 3DC6A 3S3WA 1XREA 1OCRC 1F23A 3SPCA 1WP8A 2DYRB 4JI6O 2Q67A 3CRCA 3CXCU 1Z5VA 1WP7A 4OX9O 1QLEC 4G27B 3KG2A 3UKMA 3ZN1A 2BCCH 3RVZA 3HPLC 4JASA 4DR4O 2ZE7A 2E5LO 1H2NA 3EVKA 4JI5B 4KL1A 1R3LC 1XNQO 1O9GA 3CSXA 1VF6C 4MVUA 4UCOA 1I08A 5L3FA 1P4RA 1OCOB 3AG2B 2XT9A 3K59A 5EIBC 1WPBA 1YZBA 4X65O 1YTFD 1NS1A 5J9PC 4FJCC 4X89A 2AXTZ 2D3OW 3W7XA 1IURA 4AILC 5CB4B 4J9ZB 4X20A 5H6QA 2YUAA 5C8YA 2OTJV 1I5YA 5JH7B 3CD6V 5LHHA 3ABMC 1PKXA 3JAKA 1QHTA 1W0KG 1OCCC 3PJSK 2FL4A 3ASOC 4HZ3A 2QR4A 4UV9A 4AQYO 1N34B 2NR5A 3RYFA 4K8XA 3CMEV 2AZ0A 3UT5A 2ITDC 2ZINA 4DV7O 1M1KW 1BL8A 4LFBO 3O65A 2EX3A 3MD0A 4RUFA 5KAFZ 4LH6A 3SJQC 5L3BA 2Q8VA 5LGTA 3WG7B 2EILC 1HDJA 1VQ8V 2JGDA 2YSUB 4DW1A 2WAMA 4MW8A 1L0LH 1U97A 2HVJC 2WSSG 1XMQO 4JV5B 4G28B 5B1OA 2P4VA 4MVZA 3RYHB 3OAAG 3OMAB 4MW3A 4GLXA 4IHJB 3TK1A 4JI1O 4PELA 2WA4A 1P7BA 1AI7A 2Z3YA 5JQGA 3U10A 4J7KA 3N27A 3E8FA 3RYIB 2Y0IA 4O4HB 4K0KO 5IJ9B 1US6A 4B3MB 1Y76A 5IT9N 2OIGA 5LMUB 5B1AB 4B08A 1KMIZ 2VWJA 4B3SO 2WLKA 4GCZA 2JEXA 1BHBA 1F51A 4KUMA 4LF9B 4JAAA 3OMIB 4DV0O 4I55A 3HKCB 3B2EE 1ROPA 4JYYA 4YHHB 2DE0X 3PN1A 2CDYA 1VQLV 4UB6Z 2A06H 3F5TA 1TUEB 1SKVA 2YDEA 2PZSA 4P9PA 1IBKB 3SYAA 3L75H 3QO5A 1EBOA 3HR0A 2WLNA 3ZN0A 3CCRV 4CZZA 3DXRB 4X1IB 1YJ9V 4JI4B 2JRIA 1GKFA 2PYLA 3WB0A 1SQQH 1R3IC 1NVPB 2CAZC 2X7RB 5BMVB 1Z5WA 5IWAB 4X64O 2M7WA 4J7ZA 2R72A 4JPRA 3CCQV 3OUFA 3W7WA 1S5LZ 4QE9A 3D8CA 5B1BB 3IC9A 1FD9A 4PA9A 2VS0A 1IBMO 2DOSA 5IY5B 1AJNA 2ZM6O 2Q4PA 3E86A 2LFSA 3CCLV 5CA0B 4CC5A 3DGEA 5CB4A 3N2GB 4TV9B 4DV3B 4PDVA 1EN6A 3JD0A 5JH7A 4O4LB 4DV1B 1XI1A 3TXSA 5IYDO 1F7YA 1R3KC 4I9WA 5H5NA 3K06A 4L87A 2P4KA 1XL4A 5ITZB 4BAYA 4CH3A 4JI6B 5EBLC 3L72H 4YXWG 1MMMA 2Q68A 1P49A 3ASNB 1B3QA 2XUMA 4I9QA 2YI9A 2E5LB 3P3NA 2W0FC 1ZX3A 4RO2A 3CHXA 3ZMZA 3JASA 1XNQB 1Q6HA 2DYSB 2OIEA 5CMUA 4RWUA 2B9ZA 3BEHA 5B66Z 2K9PA 4NR1A 3RYHA 3B77A 4IGGA 4X65B 2OCCC 4IHJA 3WU2Z 4O4JB 2YICA 2XTAA 1BCCH 1R1BA 2KSDA 4DUYO 2Q0AA 3AK2A 3RYIA 1KKCA 2BTOA 4O4HA 1FAFA 2Q9LA 4UVBA 3LNNA 2ODMA 4JAVA 5IJ9A 3L71H 4PA7A 4R7CA 2QWPB 2D2CB 1BHAA 1TAEA 3ABKC 4AQYB 1R6KA 2H3OA 2ZE6A 1A32A 2H94A 1IXMA 3MHSC 3IGAC 3RW0A 3T4ZA 4DV7B 4LFBB 2BOBC 3HKCA 1QQCA 4K35A 1YDXA 4TOIA 4EEQA 2HJDA 2HHHB 2ADQB 2LP7A 1ZL8B 1PNKA 3ABTA 3QVNA 2P22C 4U3FH 4ASUG 2E75B 1Z2GA 3L73H 3JD2A 4UV8A 3OW2U 2PI5A 5L3GA 2Q73A 1WNSA 4D6TH 5CA1B 2RJZA 3DXRA 4X1IA 1H2GA 3OGIB 4JI1B 2AZ2A 3KCXA 5BMVA 2CTWA 4JYAO 3ABLB 4NKGB 3S3XA 2UUCO 2R9RB 2VQFO 5EC2C 3SYOA 4DRXB 2P06A 5LHIA 2EIJC 3AG4B 1VQKV 4NTXA 1L0NH 1COWG 4K0KB 3M8AA 5D5QA 4J41A 1WAZA 3T1CA 1ZLZA 2PF4E 1Q8IA 1T5EA 1KBHA 3CCMV 3H1IH 4B3SB 1GN6A 5CA0A 1FXKC 3N2GA 4L8JA 1AJQA 3E83A 4TV9A 2Q6AA 3VQYA 2CUGA 2BOCC 3SYCA 2Q69A 1FFXB 2LGQA 2YS8A 2Y48A 5IYZB 1PM9A 3HB3B 3CCSV 5J2TB 1E79G 4DR2O 1WJZA 3VOUA 2JS3A 5ITZA 5EC1C 2EZOA 2LQTA 1YSCA 4NXNB 1VQPV 3RVYA 2YXHA 3P32A 3RYCB 3ML0A 3LSSA 2R9IA 5FPOA 3IJ4A 1Q82W 1SQGA 3K57A 1BQZA 2X0LA 1L8DA 3CC7V 2Y4UA 4X64B 3JCZA 2JJ2G 5LGNA 3C90A 1LR1A 1I5XA 1EZJA 3OEHG 2WA3A 2EINB 1W0JG 4TSFG 1HNXO 4FMTA 5LP6B 1IBMB 3DSQA 1BQ0A 1H5WA 3R66A 1XMOB 2ZM6B 2CK3G 3ZRVA 1AI5A 3K58A 5LBQA 3K08A 1S5HC 4LF8B 4NXMO 3D3IA 3F7YC 2K1EA 2Z0AA 2EJRA 2DMXA 2DYRC 5H2FZ 2EULA 4HNAB 4FLXA 1J5EO 3SJCC 1YVWA 2ZR2A 4LNUB 1VQNV 4GZRB 4UCUA 4PA4A 4EKWA 3VQWA 1FJGO 3FX7A 3OD4A 3H01A 2NNUA 1GRJA 3R65A 1NH2D 1E1RG 5JCOA 4DO2A 2QA4V 1ZL8A 2G38A 1Q5OA 3AG2C 2GUZB 1D2DA 1VARA 1WA8B 4LR3A 3VBBA 2XAGA 2FMLA 1RFYA 1YF2A 4CH5A 5CA1A 3HKBB 2VQEB 1CEZA 3B8MA 1KD1W 3HKEB 1THZA 2KQXA 3AK1A 3G4SV 1YJWV 3QG5A 3E89A 1G6UA 1YTFB 1M9NA 4QGPA 2QWNB 4JI0O 3I55V 4DRXA 3JATB 4B7EA 2NLJC 4K3AA 2N04A 4YIOA 1JMKC 3J81N 4QJFB 2CH7B 1AB3A 4DR7B 4Q20A 1GM7A 2ZE8A 1VQ4V 4QPKA 4IIJB 4Z1MG 1OCZB 1QU7A 2WLMA 4P2ZA 4H37A 4NTWA 4DXWA 5H6RA 3WG7C 4B3RO 4AI8A 2N05A 5KUMA 1W2BU 5GTHZ 2BSKB 1FFXA 4GKKB 5LGUA 5IYZA 1VF5B 5JWPA 5J2TA 4X1KB 3UM7A 1K5QA 4J10A 2YIDA 1H2SB 2AHZA 2KB1A 4CS4A 3RN4A 3LDDA 2W6IG 3K79A 5KHIA 4N23A 1K9MW 3RYCA 1W59A 2ZR3A 3K5OA 1FS0G 3H1KH 4NYKA 5IYCO 2QJ1A 4JYAB 1WB8A 2RQ6A 5EBMC 2UUCB 1I0HA 4W4KA 2EIKB 1SRYA 4DR3B 5LP6A 4JZGA 4IL6Z 3U0ZA 3LSQA 3N2KB 2E74B 2JS5A 1GM9A 1WPXA 2ZE5A 3U11A 1Q6UA 3AG7A 1PNMA 1AJPA 4LWSB 1AP5A 1JVMA 1G4YB 1SETA 4P30A 1GTOA 4GKJO 4X88A 3ZX6A 4YIPA 4FIPC 4ZHQB 1S0VA 3OM3B 4CS2A 4HNAA 1N4CA 2LW7A 4DR2B 1IVSA 4FM0A 3P3PA 2EIMB 2P6JA 3SPHA 2RNBA 3AG3B 4LNUA 2JEUA 1FFTB 4DK1A 5BZBA 5CA3A 3A0HZ 5DECA 3TGUH 3TJTA 3X2QC 1MG1A 4BW5A 3CC2V 2ADPA 1M93A 3K03A 2F95B 3DC5A 1SS3A 5IDJA 5B1BC 4FFBB 4LF6O 1M57B 1Q43A 2GUZA 1WA8A 4WFGA 5IY5C 4JI8O 2QTSA 2XNDG 2UXCO 2UXDO 1HNXB 1XILA 2HFEC 4UUJC 2JDIG 3JASB 4YJ3B 2F1MA 3HKBA 2VRZA 5DM6V 1GMGA 3HKEA 2KKWA 1YEWA 3OR7C 2YIAA 3EHBB 3FKSG 4FVMA 4NXMB 5KMGB 2WPDG 3JATA 2AW9A 4JI2O 1AI6A 2EZPA 3KDRA 3BHPA 3OT7A 2PI4A 2CH7A 1ORQC 3FAVB 4MVQA 2MW2B 1X59A 1J5EB 2ARHA 3JAMN 3GWOA 4IIJA 3BFRA 1VQ9V 3WFVA 3ASNC 1Q6IA 2WLIB 1I94O 2YI8A 2XOKG 1DK1A 5LL6Y 1RM1B 2IJJA 1Q90D 2BSKA 3T2MA 4MS2A 2B5UA 3A0RA 4PA6A 3EXAA 4X1KA 4LBEC 1MZFA 2ZQMA 5A2QN 4I7ZB 3WB1A 3JD4A 3AG1B 4JYBA 3OTOO 2FB5A 4DV2O 2UXBB 1GN3A 2QGNA 1BMFG 4DUZO 1S5JA 3E8HA 4G2KA 2QEXV 3ZHSA 4JI7O 3MDSA 4XDLA 4DV6O 3K5NA 3FB7C 4JI0B 1SQXH 2LFRA 3KCYA 1PP9H 1LUWA 3LDEA 1H2MA 4LCUC 4LFCO 3RGBA 3N2KA 4DR6O 3OMNB 1TUBB 4AHCA 1IXBA 2M6YA 4FZ0A 1K5SA 3ZHVA 1K97A 2HKOA 4H0LB 2YEVB 1XDCA 3CB2A 1YCIA 2WLJA 4MTOA 4BIZA 1R3JC 5JJNB 3K3WA 4BIUA 4B3RB 3BY6A 4LWSA 4R6ZA 1JX9A 3E22B 1M5IA 5LMNO 3CRAA 4ZHQA 2XAQA 4JTCB 1OJHA 3T1HO 2X6AA 5IE9A 1IDSA 4JZ2A 3CE2A 1BSMA 1BS3A 2ILMA 3STLC 3JD3A 3ABUA 4TQDA 4MVRA 4IT5A 4KHPO 3M7MX 3ABLC 2IJKA 3IFXA 1IJGA 1S72V 1MSWD 2GTSA 1KC8W 4OX9B 4FFBA 1SQPH 4TV8B 4RUEA 4GUNA 4ZOLB 5FL7G 3OR6C 4DR4B 3WB2A 2WLLB 2LJ2A 3ZRSA 4YJ3A 3CXHF 1XEQA 3FD9A 4Q6GA 2ZIOA 2IW5A 1BT8A 1KP3A 1PD3A 5EIBD 1SQVH 2X6BA 2LGWA 2W6JG 1X4TA 4JTAB 2E76B 3AEIA 1Q7YW 5KMGA 1N33O 4LF4O 5K1XA 5L3CA 1KYOF 1MSDA 1EZVH 1MA1A 4GKJB 1AP6A 3E8BA 1I7FA 4WBNB 4UVCA 3ZIAG 4MTFA 3ZHUA 3FAVA 3RBZA 3M99B 3D3QA 4DR5O
chains in the Genus database with same CATH topology
4X9QA 1LUWA 4F6EA 3QVNA 1QNMA 1EN6A 4E4EA 4BR6A 1IXBA 3K9SA 1IX9A 1JR9A 1XDCA 1XILA 2P4KA 3LSUA 1AVMA 1N0NA 3EVKA 3RN4A 1VEWA 1AR5A 1MMMA 1I08A 1EN4A 1ZSPA 1IDSA 2AW9A 1SZXA 3CEIA 4JZ2A 1BSMA 1N0JA 1BS3A 1ZLZA 3KDRA 3OT7A 1WB8A 1EM1A 3AK3A 1I0HA 2CE4A 4JYYA 4FFKA 3C3SA 5A9GA 1GN6A 5AG2A 2CDYA 3BFRA 4JZGA 1VARA 1Y67A 4GUNA 1ZTEA 1JA8A 1PM9A 4C7UA 1PL4A 2QKAA 1WB7A 3AK2A 1KKCA 1LUVA 1EN5A 1AP5A 1ZUQA 3AK1A 1P7GA 2GDSA 1BT8A 3C3TA 4YIPA 1GN2A 1AR4A 1B06A 1MNGA 1GN3A 1GN4A 1XUQA 3IC9A 1MSDA 4YIOA 1MA1A 3MDSA 1AP6A 2QKCA 3KKYA 3TJTA 3DC6A 2ADPA 1XREA 2RCVA 2ADQB 3DC5A 1D5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9Q A;  1LUW A;  4F6E A;  3QVN A;  1QNM A;  1EN6 A;  4E4E A;  4BR6 A;  1IXB A;  3K9S A;  1IX9 A;  1JR9 A;  1XDC A;  1XIL A;  2P4K A;  3LSU A;  1AVM A;  1N0N A;  3EVK A;  3RN4 A;  1VEW A;  1AR5 A;  1MMM A;  1I08 A;  1EN4 A;  1ZSP A;  1IDS A;  2AW9 A;  1SZX A;  3CEI A;  4JZ2 A;  1BSM A;  1N0J A;  1BS3 A;  1ZLZ A;  3OT7 A;  1WB8 A;  1EM1 A;  3AK3 A;  1I0H A;  2CE4 A;  4JYY A;  4FFK A;  3C3S A;  5A9G A;  1GN6 A;  5AG2 A;  2CDY A;  3BFR A;  4JZG A;  1VAR A;  1Y67 A;  4GUN A;  1ZTE A;  1JA8 A;  1PM9 A;  4C7U A;  1PL4 A;  2QKA A;  1WB7 A;  3AK2 A;  1KKC A;  1LUV A;  1EN5 A;  1AP5 A;  1ZUQ A;  3AK1 A;  1P7G A;  2GDS A;  1BT8 A;  3C3T A;  4YIP A;  1GN2 A;  1AR4 A;  1B06 A;  1MNG A;  1GN3 A;  1GN4 A;  1XUQ A;  3IC9 A;  1MSD A;  4YIO A;  1MA1 A;  3MDS A;  1AP6 A;  2QKC A;  3KKY A;  3TJT A;  3DC6 A;  2ADP A;  1XRE A;  2RCV A;  2ADQ B;  3DC5 A;  1D5N A; 
#chains in the Genus database with same CATH topology
 2GHY A;  2A3Q A;  5IJ0 B;  4X62 O;  2WLI A;  2IH3 C;  2YIB A;  4I0X B;  1R6N A;  1NVP D;  2UU9 O;  1FXV A;  3K9S A;  2H8P C;  2HR3 A;  2L35 A;  5E79 Z;  2F4V O;  2EIN C;  4LF6 B;  1TGO A;  1ZAU A;  2Y69 B;  1B04 A;  5LP6 C;  3T1Y O;  1QCE A;  5KAI Z;  4JI8 B;  2ZCE A;  3QO8 A;  2UXC B;  1HR0 O;  1TA8 A;  1NR1 A;  2JIZ G;  4FLU A;  1HNZ O;  1HW7 A;  1IBL O;  2DWE C;  4H44 B;  5KX5 B;  1EFR G;  3QO7 A;  5C93 A;  1XMQ B;  1SC5 B;  1B6Q A;  1KU9 A;  4LF7 O;  1M90 W;  4HYO A;  3FFQ A;  1NT2 B;  1RPO A;  4GX5 A;  1NI8 A;  4DV5 O;  4PV1 B;  5A9G A;  4B3T O;  2UUB O;  1R73 A;  4JI2 B;  4TT3 G;  5KHJ A;  3ICX A;  4FLZ A;  1K3E A;  1V54 B;  2VWK A;  2RN9 A;  1TUB A;  1H8H G;  4LF5 O;  2Y4T A;  1K8A W;  2N74 A;  1PL4 A;  1JJO A;  2QKA A;  4D7T A;  2YEV A;  2IJI A;  1I94 B;  4NB5 A;  3E22 A;  3A0B Z;  4F4L A;  2HVK C;  5B3S B;  1K33 A;  2ATK C;  2ITC C;  3ZHQ A;  5H9C A;  4DV0 B;  1SER A;  5EZY B;  2UXX A;  3CRQ A;  1CXZ B;  1UFI A;  4HBN A;  3CWB H;  1JOY A;  4TUY B;  3UO3 A;  1GK9 A;  3ZRX A;  3QTC A;  3OTO B;  2EJ7 A;  4DV2 B;  1GO3 F;  3CCV V;  1S76 D;  5CBF A;  1L1F A;  3SR2 C;  1OV9 A;  1D5N A;  3VQV A;  1QNM A;  4QIW F;  4E4E A;  4TV8 A;  4ZOL A;  2IJH A;  1WLE A;  4DV6 B;  2XHB A;  4IYI A;  1P84 F;  2YC0 A;  1V55 B;  3SDL A;  2WLL A;  1FPO A;  5FPR A;  1DLB A;  3CRR A;  4O2A A;  4PHZ A;  2NN4 A;  4QPJ A;  2FTK A;  5BR8 O;  3I5D A;  1XL6 A;  2ZXW B;  1ZSP A;  1KQS U;  3SPI A;  3ABK B;  1GAX A;  1JPX A;  4O4I B;  2V4D A;  2PUS A;  4CH4 A;  4LP8 A;  4WBN A;  3AK3 A;  2MK3 A;  3T1H B;  4TQF A;  1O9H A;  1MZE A;  3OGC C;  2E3C A;  2KG7 B;  3JSL A;  5IJ0 A;  1XHZ A;  4I0X A;  3ZJZ A;  3K5L A;  2DWD C;  2GV9 A;  4KHP B;  2B1I A;  3ZS8 C;  2EIK C;  1KKD A;  1EN5 A;  2BTQ B;  2JVD A;  3CCE V;  5EK0 A;  4DW0 A;  4LH7 A;  1K73 W;  3SGI A;  2IU0 A;  2XAS A;  1OCO C;  5DN6 G;  2QSA A;  4J11 A;  5KX5 A;  5LMU O;  3T4D A;  2ZKO A;  3ZED A;  4UCV A;  2QM7 A;  4PI2 A;  2F43 G;  1F4M A;  1R6T A;  2OWO A;  2CTR A;  3ZRW B;  4QE7 A;  1KUQ A;  2ZDI A;  4LF9 O;  3UCS C;  1N33 B;  1FXH A;  3ZBH A;  3BRC A;  2QM8 A;  2EIM C;  4F6E A;  2PGG A;  5CN0 A;  1FXK B;  4OXS A;  4DUY B;  1CPY A;  5JJE B;  3AG3 C;  4YHH O;  4DV4 O;  1VMG A;  3SPJ A;  4YY3 O;  3THO A;  4UFZ A;  3A2F A;  1K34 A;  4DR5 B;  1DGS A;  4CS3 A;  3LSU A;  4RQF A;  4X62 B;  1FYJ A;  5CBH A;  2HLD G;  1PL0 A;  3HKD B;  1NR7 A;  2IM9 A;  2UU9 B;  3TXQ A;  4Z1V A;  1M57 C;  2FKX A;  5K1P A;  3Q4H B;  1NTM H;  3OFN G;  3JSN A;  2F4V B;  3H9V A;  3SYQ A;  5IWA O;  3NXS A;  3CMA V;  3K0D A;  5EZY A;  1SZX A;  1N0J A;  3B4S A;  3FB5 C;  4W4L A;  4WCE V;  2ZNJ A;  4EFB A;  4ZI7 B;  4TUY A;  1D5A A;  2RDC A;  1AR1 B;  3CJH B;  1Q81 W;  1KP2 A;  1QBZ A;  1HR0 B;  2FYU H;  5JJJ B;  5EBW C;  4EFE A;  1HNZ B;  1NBM G;  2QWQ B;  1IBL B;  1FKA O;  4FFK A;  3C3S A;  3UQ8 A;  3SYP A;  4LC1 A;  2OTL V;  5B1N A;  1HNW O;  1OZ0 A;  1ZTE A;  2P67 A;  4UCT A;  1N32 O;  4DV5 B;  4KFM A;  4B3T B;  2UUB B;  3E8G A;  5TIS Z;  2VQF B;  4CBC A;  1YI2 V;  2GTA A;  5B1A C;  4LF5 B;  2LW1 A;  3CRM A;  1AR4 A;  1RM1 C;  3NR7 A;  5CBG A;  1WN7 A;  4UB8 Z;  1NJI W;  1XUQ A;  3G80 A;  1Y4M A;  4U3J B;  4O4I A;  1JFF B;  4JYC A;  4FPP A;  4MVM A;  1SA0 B;  2QKC A;  3L9D A;  3QF7 A;  3AG1 C;  5EYP B;  1HWY A;  1N36 O;  3CCU V;  1SES A;  2KG7 A;  3OTF A;  2Q7H A;  5LXT B;  2Q5Z A;  4JTD B;  1NQT A;  3E2E A;  3BCC H;  3K5M A;  5IYB O;  2BTQ A;  4LFA O;  5KA6 A;  1VP7 A;  4RQE A;  1VEW A;  3G6E V;  3I56 V;  3OEE G;  3UO2 A;  3L74 H;  3H1J H;  2CGN A;  2PYJ A;  1M56 B;  5BR8 B;  1EM1 A;  1PPJ H;  4NTY A;  4XDJ A;  4YJ2 B;  3STZ C;  3ZRW A;  3ZMT A;  2WLH A;  4TWK A;  5LA6 A;  4ABM A;  3TET A;  5AG2 A;  4WFA V;  1QLN A;  1J95 A;  3ZMU A;  4J42 A;  3ZCC A;  1FXK A;  2HHH O;  4PD4 F;  1JA8 A;  2HP8 A;  3FB8 C;  1Y6X A;  2HEP A;  2QWR B;  1S77 D;  5LHG A;  3HKD A;  4CH6 A;  2W0X A;  3G6B A;  3D36 A;  3Q4H A;  2OYQ A;  3BPZ A;  3GWK C;  1OCR B;  1FJG B;  4PDL A;  3SJA C;  1VQO V;  1BGY H;  4PDM A;  2ZNI A;  2DYS C;  4ZI7 A;  3FYE B;  2HG5 C;  1NKD A;  1QLE B;  2DQ3 A;  4D7S A;  3CJH A;  1VF7 A;  4OPH A;  2YXL A;  4KP4 A;  3W7S A;  1HP8 A;  2F93 B;  5KHG A;  3CPW U;  4BR6 A;  1BZK A;  3APQ A;  2QDO A;  3KZI Z;  1IX9 A;  5J2U B;  4OPA A;  2P90 A;  1NTK H;  2O57 A;  1G1X B;  1JQ0 A;  1TVK B;  1N0N A;  1MAB G;  1RPR A;  3RFR A;  4I50 B;  4EB6 B;  4DV4 B;  1SQF A;  5KHH A;  4YY3 B;  2CGO A;  1AR5 A;  2QKS A;  1VQ5 V;  4MSW C;  4NXN O;  2UXN A;  1H8E G;  2ZT9 B;  3ABM B;  3CEI A;  3F5W C;  4F6R B;  2Y69 C;  4U3J A;  4OGQ B;  1JFF A;  1OCC B;  4X1Y B;  5JCO C;  2XAF A;  4FM2 A;  1SA0 A;  2A0L A;  3ASO B;  2Z5U A;  3X2Q B;  4FZ1 A;  4HAM A;  4UXN A;  5BXZ A;  2IBZ H;  1JJ2 U;  5EYP A;  4I5S A;  3ETE A;  4GX2 A;  2HJF C;  4JGS A;  5LXT A;  4FLV A;  3BA9 A;  2GBO A;  2Q7G A;  1RSO B;  3BVO A;  4I4T B;  1AIL A;  5F2V O;  2EIL B;  2ZDI C;  1XMO O;  3LUT B;  1LUV A;  4JAU A;  1HNW B;  1XBL A;  2IU3 A;  3CS5 A;  1ZUQ A;  3ETD A;  1P7G A;  1N32 B;  1V54 C;  4LF8 O;  2UUA O;  4J9Y B;  4O2B B;  4GX1 A;  5KHK A;  1K92 A;  3AG4 C;  4WFH A;  3ZHT A;  2YXY A;  3A8T A;  1JCH A;  2YIB D;  3B8N A;  4ZIB A;  1DF4 A;  1ZWI C;  4O2A B;  4YJ2 A;  2A79 B;  5B3S C;  2RCV A;  4MTX A;  5JVD B;  1K7D A;  4X9Q A;  5D5P A;  4DK0 A;  1JNB A;  4Z2W A;  2PY5 A;  1DF5 A;  3JCU Z;  2A9H A;  5LYJ B;  3H1L H;  1F4N A;  1JR9 A;  5B5E Z;  5KUK A;  5HFL A;  3CCJ V;  2ZD9 A;  1N36 B;  4UCR A;  4P9O A;  1AVM A;  4WFF A;  4MVO A;  1K4D C;  3RWR D;  3O9O A;  4FLW A;  3TCU A;  1XNR O;  1G8M A;  2A7W A;  2QTO A;  2VQE O;  1NZ6 A;  2GSM B;  1EN4 A;  5FNV B;  4JI3 O;  4U7N A;  1M4U A;  1V55 C;  4X66 O;  1Y74 B;  3OE7 G;  1SF9 A;  4LFA B;  4GX0 A;  2CE4 A;  1NU1 H;  3DTU B;  1Q86 W;  2OT5 A;  2ZXW C;  5GON B;  1SQB H;  4DR7 O;  4DR1 O;  1ENV A;  1GM8 A;  2UXD B;  2IH1 C;  1BE3 H;  4MTG A;  5GTI Z;  1VF6 A;  1XOU A;  4BWA A;  5GW7 A;  5J2U A;  1PV0 A;  4H13 B;  3JYC A;  1TVK A;  4GKK O;  2Q7E A;  3P30 A;  4I50 A;  4EB6 A;  2GDS A;  5HFM A;  1VQ7 V;  4U7O A;  4A5U B;  4WF9 V;  5BY1 A;  3ETQ A;  1B06 A;  3ZHR A;  4R50 A;  4J7J A;  3BAA A;  3JAW B;  2QE7 G;  4F6R A;  4GT1 A;  3BA8 A;  3IAY A;  4X1Y A;  2OCH A;  5LOV B;  1KB9 F;  3JAL B;  2R70 A;  3CP1 A;  4PJ0 Z;  3K9A A;  2EBO A;  2JK5 C;  1KEC A;  4H33 A;  4GYC B;  1S3J A;  2P7T C;  4DR3 O;  4JI5 O;  3J80 N;  3BAB A;  1RSO A;  4XDK A;  1NH2 B;  4I4T A;  4JF3 A;  3EFF K;  1QR9 A;  1MOF A;  3CC4 V;  1DTO A;  1IZ3 A;  1QVF U;  3SJB C;  4QNH B;  4DUZ B;  3LNM B;  3L70 H;  3SPG A;  2QM4 A;  1SZT A;  4JI7 B;  3B09 A;  3GB7 C;  4O2B A;  4O4L A;  3JAR B;  4KXR A;  1XHX A;  2OCC B;  2F66 C;  2JJ1 G;  2C2A A;  1QR8 A;  4CC6 A;  3QNE A;  3W7T A;  3D36 C;  4LFC B;  2XAH A;  3K0G A;  1OCZ C;  4DR6 B;  1Y66 A;  5JVD A;  4ZKI A;  4ICG A;  4R8C A;  4PDR A;  5KLV H;  1N34 O;  4B7K A;  5LYJ A;  3GVM A;  4BW9 A;  3FYI B;  2DN9 A;  1AI4 A;  4X8A A;  2R9A A;  3VQX A;  1H38 A;  1WB7 A;  4UVA A;  5FLX N;  1VQ6 V;  4PA3 A;  5LMN B;  3J7A U;  3G67 A;  1YJN V;  2ZIM A;  4WFE A;  4FK5 C;  2V7Q G;  1GN2 A;  5L3E A;  1OHH G;  1MNG A;  4O4J A;  4JV5 O;  5FNV A;  1K4C C;  3MHH C;  3K04 A;  1Y74 A;  2PTM A;  3JD1 A;  1GH6 A;  2UUA B;  2DJV A;  1URF A;  3H1H H;  4X20 B;  1RP3 B;  5GON A;  3RT3 C;  4IYH A;  5C8Y B;  5DED A;  3IC7 A;  3ZMS A;  3APO A;  3ETG A;  4FLY A;  3JAK B;  1H2K A;  1XQ8 A;  5E1A C;  3FB6 C;  4B3M O;  2X6C A;  4E2L A;  1LNQ A;  2B1G A;  4RAI A;  2Y0P A;  3E35 A;  2EIJ B;  3G71 V;  1UJW B;  4UCS A;  1PNL A;  2WWW A;  3RYF B;  2DQ0 A;  4MT8 A;  1CP9 A;  5LA6 B;  3UT5 B;  4NVP A;  4FM1 A;  4LF4 B;  2V1D A;  5L3D A;  4WFB V;  4MVS A;  3JAW A;  2JGD B;  3ZMV A;  2UXB O;  1QVG U;  1XNR B;  1UPG A;  1YIT V;  2L6L A;  4K8Z A;  2Q0O C;  2AHY A;  3W7U A;  1IBK O;  3CYO A;  1YHQ V;  2QWO B;  2JGU A;  1ARO P;  3LDC A;  5LOV A;  1E1Q G;  1H2L A;  4JI3 B;  3JAL A;  4X66 B;  2CTP A;  4PI0 A;  4JI4 O;  3CX5 F;  1YXB A;  1Y67 A;  1N8R W;  1M56 C;  2DW4 A;  5JQG B;  1VQM V;  3T1Y B;  5KA5 A;  2BE3 A;  2XAJ A;  4C7U A;  3B40 A;  1FOU A;  3F7V C;  4DR1 B;  2F23 A;  2ETN A;  4N21 A;  4FLT A;  1Y76 B;  4ZBM A;  3C3T A;  1Q3E A;  4J80 A;  3OUS A;  4LF7 B;  1NTZ H;  4BIO A;  1GN4 A;  2CTQ A;  2P5O A;  3JAR A;  1U96 A;  4XBF A;  4DYL A;  2AGA A;  1V9P A;  2LO1 A;  1YIJ V;  4DV3 O;  1VIB A;  2RMK B;  4I55 B;  4DV1 O;  3KKY A;  3MAQ A;  3DC6 A;  3S3W A;  1XRE A;  1OCR C;  1F23 A;  3SPC A;  1WP8 A;  2DYR B;  4JI6 O;  2Q67 A;  3CRC A;  3CXC U;  1Z5V A;  1WP7 A;  4OX9 O;  1QLE C;  4G27 B;  3KG2 A;  3UKM A;  3ZN1 A;  2BCC H;  3RVZ A;  3HPL C;  4JAS A;  4DR4 O;  2ZE7 A;  2E5L O;  1H2N A;  3EVK A;  4JI5 B;  4KL1 A;  1R3L C;  1XNQ O;  1O9G A;  3CSX A;  1VF6 C;  4MVU A;  4UCO A;  1I08 A;  5L3F A;  1P4R A;  1OCO B;  3AG2 B;  2XT9 A;  3K59 A;  5EIB C;  1WPB A;  1YZB A;  4X65 O;  1YTF D;  1NS1 A;  5J9P C;  4FJC C;  4X89 A;  2AXT Z;  2D3O W;  3W7X A;  1IUR A;  4AIL C;  5CB4 B;  4J9Z B;  4X20 A;  5H6Q A;  2YUA A;  5C8Y A;  2OTJ V;  1I5Y A;  5JH7 B;  3CD6 V;  5LHH A;  3ABM C;  1PKX A;  3JAK A;  1QHT A;  1W0K G;  1OCC C;  3PJS K;  2FL4 A;  3ASO C;  4HZ3 A;  2QR4 A;  4UV9 A;  4AQY O;  1N34 B;  2NR5 A;  3RYF A;  4K8X A;  3CME V;  2AZ0 A;  3UT5 A;  2ITD C;  2ZIN A;  4DV7 O;  1M1K W;  1BL8 A;  4LFB O;  3O65 A;  2EX3 A;  3MD0 A;  4RUF A;  5KAF Z;  4LH6 A;  3SJQ C;  5L3B A;  2Q8V A;  5LGT A;  3WG7 B;  2EIL C;  1HDJ A;  1VQ8 V;  2JGD A;  2YSU B;  4DW1 A;  2WAM A;  4MW8 A;  1L0L H;  1U97 A;  2HVJ C;  2WSS G;  1XMQ O;  4JV5 B;  4G28 B;  5B1O A;  2P4V A;  4MVZ A;  3RYH B;  3OAA G;  3OMA B;  4MW3 A;  4GLX A;  4IHJ B;  3TK1 A;  4JI1 O;  4PEL A;  2WA4 A;  1P7B A;  1AI7 A;  2Z3Y A;  5JQG A;  3U10 A;  4J7K A;  3N27 A;  3E8F A;  3RYI B;  2Y0I A;  4O4H B;  4K0K O;  5IJ9 B;  1US6 A;  4B3M B;  1Y76 A;  5IT9 N;  2OIG A;  5LMU B;  5B1A B;  4B08 A;  1KMI Z;  2VWJ A;  4B3S O;  2WLK A;  4GCZ A;  2JEX A;  1BHB A;  1F51 A;  4KUM A;  4LF9 B;  4JAA A;  3OMI B;  4DV0 O;  4I55 A;  3HKC B;  3B2E E;  1ROP A;  4JYY A;  4YHH B;  2DE0 X;  3PN1 A;  2CDY A;  1VQL V;  4UB6 Z;  2A06 H;  3F5T A;  1TUE B;  1SKV A;  2YDE A;  2PZS A;  4P9P A;  1IBK B;  3SYA A;  3L75 H;  3QO5 A;  1EBO A;  3HR0 A;  2WLN A;  3ZN0 A;  3CCR V;  4CZZ A;  3DXR B;  4X1I B;  1YJ9 V;  4JI4 B;  2JRI A;  1GKF A;  2PYL A;  3WB0 A;  1SQQ H;  1R3I C;  1NVP B;  2CAZ C;  2X7R B;  5BMV B;  1Z5W A;  5IWA B;  4X64 O;  2M7W A;  4J7Z A;  2R72 A;  4JPR A;  3CCQ V;  3OUF A;  3W7W A;  1S5L Z;  4QE9 A;  3D8C A;  5B1B B;  3IC9 A;  1FD9 A;  4PA9 A;  2VS0 A;  1IBM O;  2DOS A;  5IY5 B;  1AJN A;  2ZM6 O;  2Q4P A;  3E86 A;  2LFS A;  3CCL V;  5CA0 B;  4CC5 A;  3DGE A;  5CB4 A;  3N2G B;  4TV9 B;  4DV3 B;  4PDV A;  1EN6 A;  3JD0 A;  5JH7 A;  4O4L B;  4DV1 B;  1XI1 A;  3TXS A;  5IYD O;  1F7Y A;  1R3K C;  4I9W A;  5H5N A;  3K06 A;  4L87 A;  2P4K A;  1XL4 A;  5ITZ B;  4BAY A;  4CH3 A;  4JI6 B;  5EBL C;  3L72 H;  4YXW G;  1MMM A;  2Q68 A;  1P49 A;  3ASN B;  1B3Q A;  2XUM A;  4I9Q A;  2YI9 A;  2E5L B;  3P3N A;  2W0F C;  1ZX3 A;  4RO2 A;  3CHX A;  3ZMZ A;  3JAS A;  1XNQ B;  1Q6H A;  2DYS B;  2OIE A;  5CMU A;  4RWU A;  2B9Z A;  3BEH A;  5B66 Z;  2K9P A;  4NR1 A;  3RYH A;  3B77 A;  4IGG A;  4X65 B;  2OCC C;  4IHJ A;  3WU2 Z;  4O4J B;  2YIC A;  2XTA A;  1BCC H;  1R1B A;  2KSD A;  4DUY O;  2Q0A A;  3AK2 A;  3RYI A;  1KKC A;  2BTO A;  4O4H A;  1FAF A;  2Q9L A;  4UVB A;  3LNN A;  2ODM A;  4JAV A;  5IJ9 A;  3L71 H;  4PA7 A;  4R7C A;  2QWP B;  2D2C B;  1BHA A;  1TAE A;  3ABK C;  4AQY B;  1R6K A;  2H3O A;  2ZE6 A;  1A32 A;  2H94 A;  1IXM A;  3MHS C;  3IGA C;  3RW0 A;  3T4Z A;  4DV7 B;  4LFB B;  2BOB C;  3HKC A;  1QQC A;  4K35 A;  1YDX A;  4TOI A;  4EEQ A;  2HJD A;  2HHH B;  2ADQ B;  2LP7 A;  1ZL8 B;  1PNK A;  3ABT A;  3QVN A;  2P22 C;  4U3F H;  4ASU G;  2E75 B;  1Z2G A;  3L73 H;  3JD2 A;  4UV8 A;  3OW2 U;  2PI5 A;  5L3G A;  2Q73 A;  1WNS A;  4D6T H;  5CA1 B;  2RJZ A;  3DXR A;  4X1I A;  1H2G A;  3OGI B;  4JI1 B;  2AZ2 A;  3KCX A;  5BMV A;  2CTW A;  4JYA O;  3ABL B;  4NKG B;  3S3X A;  2UUC O;  2R9R B;  2VQF O;  5EC2 C;  3SYO A;  4DRX B;  2P06 A;  5LHI A;  2EIJ C;  3AG4 B;  1VQK V;  4NTX A;  1L0N H;  1COW G;  4K0K B;  3M8A A;  5D5Q A;  4J41 A;  1WAZ A;  3T1C A;  1ZLZ A;  2PF4 E;  1Q8I A;  1T5E A;  1KBH A;  3CCM V;  3H1I H;  4B3S B;  1GN6 A;  5CA0 A;  1FXK C;  3N2G A;  4L8J A;  1AJQ A;  3E83 A;  4TV9 A;  2Q6A A;  3VQY A;  2CUG A;  2BOC C;  3SYC A;  2Q69 A;  1FFX B;  2LGQ A;  2YS8 A;  2Y48 A;  5IYZ B;  1PM9 A;  3HB3 B;  3CCS V;  5J2T B;  1E79 G;  4DR2 O;  1WJZ A;  3VOU A;  2JS3 A;  5ITZ A;  5EC1 C;  2EZO A;  2LQT A;  1YSC A;  4NXN B;  1VQP V;  3RVY A;  2YXH A;  3P32 A;  3RYC B;  3ML0 A;  3LSS A;  2R9I A;  5FPO A;  3IJ4 A;  1Q82 W;  1SQG A;  3K57 A;  1BQZ A;  2X0L A;  1L8D A;  3CC7 V;  2Y4U A;  4X64 B;  3JCZ A;  2JJ2 G;  5LGN A;  3C90 A;  1LR1 A;  1I5X A;  1EZJ A;  3OEH G;  2WA3 A;  2EIN B;  1W0J G;  4TSF G;  1HNX O;  4FMT A;  5LP6 B;  1IBM B;  3DSQ A;  1BQ0 A;  1H5W A;  3R66 A;  1XMO B;  2ZM6 B;  2CK3 G;  3ZRV A;  1AI5 A;  3K58 A;  5LBQ A;  3K08 A;  1S5H C;  4LF8 B;  4NXM O;  3D3I A;  3F7Y C;  2K1E A;  2Z0A A;  2EJR A;  2DMX A;  2DYR C;  5H2F Z;  2EUL A;  4HNA B;  4FLX A;  1J5E O;  3SJC C;  1YVW A;  2ZR2 A;  4LNU B;  1VQN V;  4GZR B;  4UCU A;  4PA4 A;  4EKW A;  3VQW A;  1FJG O;  3FX7 A;  3OD4 A;  3H01 A;  2NNU A;  1GRJ A;  3R65 A;  1NH2 D;  1E1R G;  5JCO A;  4DO2 A;  2QA4 V;  1ZL8 A;  2G38 A;  1Q5O A;  3AG2 C;  2GUZ B;  1D2D A;  1VAR A;  1WA8 B;  4LR3 A;  3VBB A;  2XAG A;  2FML A;  1RFY A;  1YF2 A;  4CH5 A;  5CA1 A;  3HKB B;  2VQE B;  1CEZ A;  3B8M A;  1KD1 W;  3HKE B;  1THZ A;  2KQX A;  3AK1 A;  3G4S V;  1YJW V;  3QG5 A;  3E89 A;  1G6U A;  1YTF B;  1M9N A;  4QGP A;  2QWN B;  4JI0 O;  3I55 V;  4DRX A;  3JAT B;  4B7E A;  2NLJ C;  4K3A A;  2N04 A;  4YIO A;  1JMK C;  3J81 N;  4QJF B;  2CH7 B;  1AB3 A;  4DR7 B;  4Q20 A;  1GM7 A;  2ZE8 A;  1VQ4 V;  4QPK A;  4IIJ B;  4Z1M G;  1OCZ B;  1QU7 A;  2WLM A;  4P2Z A;  4H37 A;  4NTW A;  4DXW A;  5H6R A;  3WG7 C;  4B3R O;  4AI8 A;  2N05 A;  5KUM A;  1W2B U;  5GTH Z;  2BSK B;  1FFX A;  4GKK B;  5LGU A;  5IYZ A;  1VF5 B;  5JWP A;  5J2T A;  4X1K B;  3UM7 A;  1K5Q A;  4J10 A;  2YID A;  1H2S B;  2AHZ A;  2KB1 A;  4CS4 A;  3RN4 A;  3LDD A;  2W6I G;  3K79 A;  5KHI A;  4N23 A;  1K9M W;  3RYC A;  1W59 A;  2ZR3 A;  3K5O A;  1FS0 G;  3H1K H;  4NYK A;  5IYC O;  2QJ1 A;  4JYA B;  1WB8 A;  2RQ6 A;  5EBM C;  2UUC B;  1I0H A;  4W4K A;  2EIK B;  1SRY A;  4DR3 B;  5LP6 A;  4JZG A;  4IL6 Z;  3U0Z A;  3LSQ A;  3N2K B;  2E74 B;  2JS5 A;  1GM9 A;  1WPX A;  2ZE5 A;  3U11 A;  1Q6U A;  3AG7 A;  1PNM A;  1AJP A;  4LWS B;  1AP5 A;  1JVM A;  1G4Y B;  1SET A;  4P30 A;  1GTO A;  4GKJ O;  4X88 A;  3ZX6 A;  4YIP A;  4FIP C;  4ZHQ B;  1S0V A;  3OM3 B;  4CS2 A;  4HNA A;  1N4C A;  2LW7 A;  4DR2 B;  1IVS A;  4FM0 A;  3P3P A;  2EIM B;  2P6J A;  3SPH A;  2RNB A;  3AG3 B;  4LNU A;  2JEU A;  1FFT B;  4DK1 A;  5BZB A;  5CA3 A;  3A0H Z;  5DEC A;  3TGU H;  3TJT A;  3X2Q C;  1MG1 A;  4BW5 A;  3CC2 V;  2ADP A;  1M93 A;  3K03 A;  2F95 B;  3DC5 A;  1SS3 A;  5IDJ A;  5B1B C;  4FFB B;  4LF6 O;  1M57 B;  1Q43 A;  2GUZ A;  1WA8 A;  4WFG A;  5IY5 C;  4JI8 O;  2QTS A;  2XND G;  2UXC O;  2UXD O;  1HNX B;  1XIL A;  2HFE C;  4UUJ C;  2JDI G;  3JAS B;  4YJ3 B;  2F1M A;  3HKB A;  2VRZ A;  5DM6 V;  1GMG A;  3HKE A;  2KKW A;  1YEW A;  3OR7 C;  2YIA A;  3EHB B;  3FKS G;  4FVM A;  4NXM B;  5KMG B;  2WPD G;  3JAT A;  2AW9 A;  4JI2 O;  1AI6 A;  2EZP A;  3KDR A;  3BHP A;  3OT7 A;  2PI4 A;  2CH7 A;  1ORQ C;  3FAV B;  4MVQ A;  2MW2 B;  1X59 A;  1J5E B;  2ARH A;  3JAM N;  3GWO A;  4IIJ A;  3BFR A;  1VQ9 V;  3WFV A;  3ASN C;  1Q6I A;  2WLI B;  1I94 O;  2YI8 A;  2XOK G;  1DK1 A;  5LL6 Y;  1RM1 B;  2IJJ A;  1Q90 D;  2BSK A;  3T2M A;  4MS2 A;  2B5U A;  3A0R A;  4PA6 A;  3EXA A;  4X1K A;  4LBE C;  1MZF A;  2ZQM A;  5A2Q N;  4I7Z B;  3WB1 A;  3JD4 A;  3AG1 B;  4JYB A;  3OTO O;  2FB5 A;  4DV2 O;  2UXB B;  1GN3 A;  2QGN A;  1BMF G;  4DUZ O;  1S5J A;  3E8H A;  4G2K A;  2QEX V;  3ZHS A;  4JI7 O;  3MDS A;  4XDL A;  4DV6 O;  3K5N A;  3FB7 C;  4JI0 B;  1SQX H;  2LFR A;  3KCY A;  1PP9 H;  1LUW A;  3LDE A;  1H2M A;  4LCU C;  4LFC O;  3RGB A;  3N2K A;  4DR6 O;  3OMN B;  1TUB B;  4AHC A;  1IXB A;  2M6Y A;  4FZ0 A;  1K5S A;  3ZHV A;  1K97 A;  2HKO A;  4H0L B;  2YEV B;  1XDC A;  3CB2 A;  1YCI A;  2WLJ A;  4MTO A;  4BIZ A;  1R3J C;  5JJN B;  3K3W A;  4BIU A;  4B3R B;  3BY6 A;  4LWS A;  4R6Z A;  1JX9 A;  3E22 B;  1M5I A;  5LMN O;  3CRA A;  4ZHQ A;  2XAQ A;  4JTC B;  1OJH A;  3T1H O;  2X6A A;  5IE9 A;  1IDS A;  4JZ2 A;  3CE2 A;  1BSM A;  1BS3 A;  2ILM A;  3STL C;  3JD3 A;  3ABU A;  4TQD A;  4MVR A;  4IT5 A;  4KHP O;  3M7M X;  3ABL C;  2IJK A;  3IFX A;  1IJG A;  1S72 V;  1MSW D;  2GTS A;  1KC8 W;  4OX9 B;  4FFB A;  1SQP H;  4TV8 B;  4RUE A;  4GUN A;  4ZOL B;  5FL7 G;  3OR6 C;  4DR4 B;  3WB2 A;  2WLL B;  2LJ2 A;  3ZRS A;  4YJ3 A;  3CXH F;  1XEQ A;  3FD9 A;  4Q6G A;  2ZIO A;  2IW5 A;  1BT8 A;  1KP3 A;  1PD3 A;  5EIB D;  1SQV H;  2X6B A;  2LGW A;  2W6J G;  1X4T A;  4JTA B;  2E76 B;  3AEI A;  1Q7Y W;  5KMG A;  1N33 O;  4LF4 O;  5K1X A;  5L3C A;  1KYO F;  1MSD A;  1EZV H;  1MA1 A;  4GKJ B;  1AP6 A;  3E8B A;  1I7F A;  4WBN B;  4UVC A;  3ZIA G;  4MTF A;  3ZHU A;  3FAV A;  3RBZ A;  3M99 B;  3D3Q A;  4DR5 O; 
#chains in the Genus database with same CATH homology
 4X9Q A;  1LUW A;  4F6E A;  3QVN A;  1QNM A;  1EN6 A;  4E4E A;  4BR6 A;  1IXB A;  3K9S A;  1IX9 A;  1JR9 A;  1XDC A;  1XIL A;  2P4K A;  3LSU A;  1AVM A;  1N0N A;  3EVK A;  3RN4 A;  1VEW A;  1AR5 A;  1MMM A;  1I08 A;  1EN4 A;  1ZSP A;  1IDS A;  2AW9 A;  1SZX A;  3CEI A;  4JZ2 A;  1BSM A;  1N0J A;  1BS3 A;  1ZLZ A;  3KDR A;  3OT7 A;  1WB8 A;  1EM1 A;  3AK3 A;  1I0H A;  2CE4 A;  4JYY A;  4FFK A;  3C3S A;  5A9G A;  1GN6 A;  5AG2 A;  2CDY A;  3BFR A;  4JZG A;  1VAR A;  1Y67 A;  4GUN A;  1ZTE A;  1JA8 A;  1PM9 A;  4C7U A;  1PL4 A;  2QKA A;  1WB7 A;  3AK2 A;  1KKC A;  1LUV A;  1EN5 A;  1AP5 A;  1ZUQ A;  3AK1 A;  1P7G A;  2GDS A;  1BT8 A;  3C3T A;  4YIP A;  1GN2 A;  1AR4 A;  1B06 A;  1MNG A;  1GN3 A;  1GN4 A;  1XUQ A;  3IC9 A;  1MSD A;  4YIO A;  1MA1 A;  3MDS A;  1AP6 A;  2QKC A;  3KKY A;  3TJT A;  3DC6 A;  2ADP A;  1XRE A;  2RCV A;  2ADQ B;  3DC5 A;  1D5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...