3DC6A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
197
Chain Sequence
KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 1
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 79
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc6A02
1ZTEA 3KKYA 4X9QA 1XREA 1Y67A 1B06A 1IX9A 2P4KA 3TJTA 1PM9A 1IXBA 1EM1A 1XDCA 1WB8A 1AP5A 4GUNA 1LUWA 3K9SA 2QKAA 1AVMA 1VEWA 1MA1A 1XUQA 3C3SA 1XILA 1MMMA 1GN4A 1P7GA 4JZ2A 4FFKA 1EN4A 4JYYA 3AK1A 3IC9A 1KKCA 1PL4A 3MDSA 2ADQB 1ZSPA 1GN3A 3AK3A 3AK2A 1AP6A 2AW9A 2RCVA 2GDSA 1BT8A 3CEIA 1N0JA 1I0HA 1LUVA 1ZLZA 3EVKA 5AG2A 2CE4A 1ZUQA 1AR4A 1D5NA 1BS3A 2QKCA 1IDSA 5A9GA 1SZXA 1JA8A 3QVNA 3C3TA 1I08A 4JZGA 4BR6A 4YIPA 1QNMA 1N0NA 1MSDA 3OT7A 4F6EA 1BSMA 2ADPA 2CDYA 3LSUA 1EN5A 3DC6A 1WB7A 1AR5A 4C7UA 3DC5A 1MNGA 1EN6A 1GN6A 3RN4A 1VARA 1JR9A 4YIOA 3BFRA 1GN2A 4E4EA
chains in the Genus database with same CATH superfamily
1PPJH 3K5LA 1PV0A 1YHQV 1J5EB 2LW1A 4JYBA 2EX3A 3T1CA 1Y67A 2HVJC 2PTMA 3ZIAG 4B3TB 2N74A 3T4DA 4TQDA 1M56C 1YEWA 1M4UA 2XOKG 3UO2A 4CZZA 1O9GA 2VQEB 3OGIB 2ZNIA 3ZMSA 1L1FA 1Q3EA 3K57A 2FMLA 2CTRA 1JNBA 4DV5B 4DO2A 3UKMA 2E74B 3L72H 4FLTA 3IAYA 1K7DA 2HJDA 3BY6A 4JI4B 3KCXA 5EIBC 4RUFA 1SA0B 2JK5C 4GX5A 1NH2D 2EZOA 1R6NA 2ZQMA 1FFXA 3VQVA 1H2GA 1P49A 5CA3A 4MVSA 2QE7G 3BRCA 4QPJA 5LGTA 2YIBD 5K1XA 4JI3B 4AILC 5CBHA 4UV9A 3ABMC 1SS3A 4P2ZA 2LFRA 2N04A 3HKCA 1NKDA 4X1KB 1WB7A 4PHZA 1H2KA 1M5IA 4LR3A 1V54C 2PYJA 4FM0A 4DV3B 3QTCA 2WLLB 2EILB 1G6UA 4X1YA 1HNXB 4IYHA 1YJNV 3SJBC 1VARA 5BMVA 2AGAA 4ABMA 4BAYA 3SGIA 2Z0AA 2B5UA 4I5SA 1AJQA 2JEXA 1NBMG 2ZXWC 2UUAB 1H8HG 4EKWA 1KMIZ 3D36C 4LNUB 1I5YA 4FVMA 3THOA 4H0LB 1RPOA 2HFEC 3JALB 1JCHA 3CC7V 3CMEV 3RYIA 3RYCA 1WB8A 5KA5A 2W6IG 3CHXA 3CJHA 1K97A 4DV1O 3J7AU 3DTUB 1LUWA 1HR0O 1IURA 2JDIG 3C90A 2F4VO 4LFBB 5HFLA 3IC7A 4EB6B 2DYSC 3CCVV 4Z1VA 2ZIOA 5A2QN 2P6JA 1OHHG 4FPPA 5BZBA 4YHHO 2YEVA 4X66O 2ATKC 1GO3F 4PI0A 1DLBA 3K0DA 1ZSPA 3L75H 1P84F 5FPOA 2LQTA 3AK3A 2PF4E 5CMUA 4DR4B 1WLEA 2ETNA 1BT8A 3CRRA 3H1LH 3P32A 3SPCA 4H37A 3RFRA 4W4LA 2ITDC 3BHPA 2ZR3A 4PV1B 3ZHSA 2OCCC 3T4ZA 4W4KA 5LYJA 2KG7A 4RWUA 5DECA 1HW7A 2R70A 2ZDIC 4X62B 2DWDC 4PA9A 1IBMO 4OPAA 3CSXA 2YIDA 1H2LA 5JJJB 4H33A 4UFZA 3DC5A 1QVGU 3FYEB 2JVDA 4DR5B 4YIOA 4CBCA 1YXBA 4FJCC 1IBKB 1AB3A 1OCCC 1Y6XA 2ZE6A 3VQXA 3FKSG 2QEXV 2EIKB 3RYFA 1B06A 3VOUA 4JTDB 1JOYA 3HKCB 3ZHVA 3JAKA 1R3IC 5KA6A 3K04A 5H2FZ 3I55V 4JI2O 4I50A 3K9SA 2QKAA 4B7EA 4X1YB 3UQ8A 3LDDA 5BMVB 4ZHQA 3R66A 4JAUA 5LMNO 1XUQA 2WLKA 1XILA 2HLDG 5B1BC 1PL0A 3JD0A 5J2UA 4GCZA 5KMGA 1R6TA 1E1QG 3G80A 1CP9A 3RYCB 1N36B 3K59A 3CJHB 2XAFA 1GMGA 1LNQA 5LHIA 3OTOO 4JAAA 2QM8A 3ASOC 5EK0A 1K92A 4X8AA 1KP3A 4UB6Z 4JI5O 2YEVB 2WLHA 2NNUA 4JI7O 2EBOA 2RNBA 1QVFU 2Q8VA 4CH4A 2Z5UA 4MTGA 2E3CA 4B3RO 1VF6A 1QLEB 5KHHA 3JCUZ 4FZ1A 3RGBA 1OCOC 3RT3C 3SDLA 1XMOO 4ASUG 5LA6A 4EFEA 4Q6GA 2DOSA 3OM3B 1S5LZ 5H6QA 4HAMA 5JCOA 1XREA 5LYJB 4PELA 2KG7B 2CH7A 5CA0A 2HKOA 2DWEC 4DRXA 3B77A 1D5AA 1YZBA 4DYLA 2XNDG 3X2QC 5F2VO 4FLVA 1SERA 1SQVH 4GKKB 4GUNA 3S3XA 1GM9A 1NTMH 1ORQC 4BIUA 4DUZB 2B9ZA 2JIZG 4P9OA 1N33O 5EZYA 2D2CB 2OCHA 1UFIA 2IJJA 3CE2A 4U3JA 4MVOA 1GAXA 3OR6C 1NTKH 3RYFB 3OEHG 1XNRB 4RAIA 3JAKB 4UCOA 3SPJA 4NB5A 5D5PA 4PA3A 3WB1A 2W0FC 3CYOA 4I50B 4JAVA 5LOVA 1IBLB 1LR1A 1KB9F 4CC5A 5LHGA 3BA9A 2E5LB 1CEZA 3C3TA 3QO5A 3JYCA 4IYIA 2JS3A 3ICXA 4MVRA 1BQZA 2Q9LA 2R9RB 1HNZB 3CRCA 2ADPA 5J2UB 2HVKC 3LSUA 3JCZA 4IL6Z 1HP8A 3ZMTA 1WPBA 4D7TA 5KMGB 3I56V 4P9PA 5LP6A 4DV4O 4JI6O 5KX5A 4NKGB 3F5TA 4MVUA 2UUCO 2QDOA 1NTZH 1HNWB 3OW2U 1JR9A 2P7TC 1WP8A 3CRQA 3GB7C 4IGGA 1ZWIC 1J5EO 3CC4V 1GN2A 4XBFA 2QR4A 4O4IA 3KKYA 4B3TO 4JI8O 2UXXA 3ABLB 2A9HA 1FJGB 4TOIA 2NR5A 1IJGA 5EIBD 2X6CA 4QIWF 5EYPA 3LDEA 1SETA 1Q8IA 4K8XA 1AP5A 2H8PC 3ZMUA 1UPGA 2EJ7A 5KUKA 1VQ7V 1A32A 2XASA 1MA1A 4DV5O 1NVPD 2Y4UA 4OX9O 4QGPA 5LA6B 1HWYA 4JYCA 1P7GA 2LO1A 5LGUA 2QTSA 5JH7A 1AROP 2KSDA 1N8RW 4XDKA 1IXMA 1Q90D 2CH7B 1XL6A 5H9CA 2YSUB 5CA0B 5L3CA 2WAMA 4DRXB 4PDLA 2RCVA 4KHPB 1ZX3A 1X59A 3CCQV 3SYQA 1US6A 3G6EV 2Q4PA 4GKJB 1Y74A 2Q69A 4FMTA 2GTAA 4Z1MG 3VBBA 3EVKA 2Q0AA 5EZYB 5IY5B 4G28B 2YXYA 1JA8A 1MABG 3RYHA 3F7VC 4NXNB 2VWJA 4U3JB 2ZT9B 3FB7C 3HKDB 3OT7A 2CDYA 3OEEG 4UCVA 4J41A 2IJIA 1FXKA 4DV3O 4B3SO 3NXSA 2X0LA 5EBWC 2FYUH 3AEIA 1TVKA 2F93B 3PN1A 3K5MA 5LOVB 1VIBA 5GTIZ 4DR6O 1YTFB 4FM1A 2EILC 1S77D 2C2AA 2YIAA 3SPHA 1S5JA 3IFXA 2LP7A 2PYLA 1KD1W 3E8HA 2IJKA 2A06H 1FS0G 4DUYB 3QG5A 3CCEV 1THZA 1R3JC 5LP6B 4QJFB 5EC1C 4JI0B 5KX5B 3K9AA 4DV7O 3ZHRA 4LF5B 4LFBO 4NTYA 1XNQO 1OCRC 3ETGA 1JJOA 3J81N 5DM6V 4UCRA 4DR3B 3B40A 4O2BA 3C3SA 4RO2A 1EBOA 1ROPA 3CRAA 3BAAA 1AI7A 3JAMN 3E2EA 1GN3A 3FB6C 4K8ZA 2VQFO 2EIJB 2JJ2G 1VQMV 3TCUA 1PNKA 1GM8A 2UU9O 1TUBA 3JASA 5EYPB 4JI1B 2A79B 5L3GA 2LGQA 4J42A 2B1GA 5GONA 1FD9A 5E1AC 2M7WA 3IGAC 2P22C 2OIGA 3ZHTA 4UB8Z 2QWQB 2Y0IA 1QNMA 4E2LA 3QO8A 5JH7B 4LF8B 4MTXA 5CB4A 3K5OA 1H2NA 1VQPV 1M93A 2EJRA 3G71V 1SQGA 1QR9A 2L6LA 2P90A 3ZHUA 1Y74B 1EN6A 5B1AB 4PA4A 3ZEDA 1IBKO 1E79G 4D6TH 3RN4A 3CB2A 4K35A 2ZINA 4LFCB 1I7FA 4NXMB 3B09A 4RQFA 4NTWA 2QWPB 3RYHB 4MS2A 4FZ0A 1W0JG 1K5SA 5KUMA 2IBZH 2QJ1A 5GW7A 2QA4V 2NN4A 4LF7B 4X64O 1PM9A 2K1EA 1XMQO 1FXKB 1L8DA 1OJHA 1IXBA 1XQ8A 2EIKC 2N05A 3QF7A 1U96A 1KU9A 1TVKB 4TV8A 4O2AA 1AVMA 3VQYA 1FXVA 4NVPA 2YXLA 1COWG 1S72V 3A0RA 4JYYA 1Q82W 1PL4A 2UUBO 1N36O 1Q6UA 3UT5A 5LGNA 3E86A 2X6BA 2QKSA 2HHHB 1KC8W 2V1DA 1KYOF 4DR7B 1OCZB 5B3SB 4I9WA 1V9PA 3AG4B 1G4YB 4JGSA 3BVOA 4J9ZB 4WBNA 1XI1A 2Q6AA 5EBLC 3RVYA 2QSAA 4O2BB 1NI8A 2P67A 4NTXA 4RUEA 4BR6A 4LF9B 1MSDA 4FK5C 4JF3A 1RFYA 3GWKC 2P4VA 3J80N 2DW4A 4LFAB 2OT5A 1FPOA 2R9IA 4X1IA 3BA8A 3WG7B 2WLIA 4Z2WA 1SZTA 1TUBB 3JASB 1DF4A 4IIJA 2UXCB 2WA3A 2BOBC 2Y48A 1QLEC 2E75B 2ZD9A 1RSOA 4DW1A 3E83A 3EHBB 5GONB 4U7OA 2UXDB 4B08A 4JYAO 5L3DA 4X9QA 4X20A 5FLXN 1RM1B 2RJZA 3T2MA 2DJVA 4GKKO 2A7WA 2G38A 5CB4B 3KG2A 5IT9N 1EM1A 4DUZO 1FFXB 3VQWA 1PD3A 2KB1A 3B4SA 4DR1O 4J11A 2YS8A 2Q67A 4LF6B 4UVBA 3CMAV 4DV2B 4B7KA 1SESA 1AJNA 1WP7A 4TSFG 3IJ4A 1XNRO 1KECA 4G2KA 3RW0A 1KKCA 1V55C 3BEHA 3RVZA 3MDSA 4LCUC 4RQEA 2DQ3A 1GTOA 2ZR2A 4ZI7A 3FYIB 3CC2V 1Z5VA 2IH3C 2UXBO 1DTOA 3Q4HA 2AHYA 4TV8B 4O2AB 4JPRA 2E5LO 2YIBA 1SKVA 1XHXA 1ENVA 1CPYA 4N21A 2QWNB 1BHBA 3P30A 1VQ5V 1ZL8A 3CCSV 1R1BA 2R72A 2B1IA 1G8MA 3WFVA 3H01A 3RYIB 5KHGA 3STLC 4G27B 3DC6A 3N2GA 4JV5O 1SQQH 2CTQA 2RDCA 2GV9A 3UT5B 5CBGA 2VRZA 1H2MA 4C7UA 2F23A 4AQYO 4FM2A 1Y66A 4IT5A 4K0KO 2BCCH 4UCTA 4WBNB 4QPKA 3AG2B 5H6RA 4DV1B 4UUJC 4MVMA 1NZ6A 3AG1C 1UJWB 1RPRA 2FTKA 3H1IH 1B6QA 3H9VA 2F4VB 4X1IB 1VQNV 3ABLC 2WLIB 1IVSA 4WFFA 3AG7A 3MAQA 3M7MX 4IIJB 1KKDA 3ZHQA 2BTQA 4JTAB 1Q81W 1VF6C 3OAAG 4WCEV 1RSOB 5IJ9A 3FX7A 2RQ6A 3T1YO 1MZEA 2ARHA 1QR8A 2CGOA 4JZ2A 1AR1B 5KHJA 4FFKA 3I5DA 1S0VA 2GHYA 1EN4A 4X20B 3UM7A 5IYBO 1VF5B 3CCUV 4DR2B 3N27A 1W0KG 3CX5F 4GKJO 1QLNA 1AP6A 1J95A 1GRJA 5JCOC 4HYOA 1NR1A 3JD2A 3ABKB 3OE7G 1FFTB 1ZLZA 2Q7HA 1PKXA 5J2TA 2OYQA 3L74H 1IBMB 2Y69B 2QKCA 2WLNA 4FLYA 1YI2V 5BR8O 3LSSA 5CN0A 1OCCB 4B3MB 2Y0PA 1Q43A 2ZE8A 4MW8A 2HEPA 1YVWA 5IY5C 3SYAA 3JARA 1R6KA 4MTOA 4BWAA 2EINB 4F6EA 2GBOA 2Q7EA 3A0BZ 1DGSA 2EIMC 5CBFA 1M57B 1NH2B 3BPZA 4JTCB 4ZI7B 3QNEA 4WFEA 4O4HA 2IU3A 3Q4HB 1FXHA 2QM4A 4ZHQB 4FLZA 1VP7A 4PD4F 2W0XA 3K06A 4PI2A 4F4LA 4DV6B 3JD1A 3FB5C 3EXAA 4JI2B 3F5WC 3L73H 1ZL8B 3K5NA 2JEUA 3PJSK 2RMKB 2P06A 1FYJA 5GTHZ 4JI0O 4WFBV 5LMNB 4J80A 3TGUH 3N2GB 3JATA 1K33A 1SQXH 2ZIMA 3P3PA 1H5WA 3HKBA 1B04A 1X4TA 5LP6C 2E76B 1F4MA 1GN4A 4FIPC 1WN7A 4LH6A 4YJ2A 1NU1H 1MSWD 3OGCC 3K08A 1OZ0A 2NLJC 2WA4A 2VQEO 2JJ1G 1F51A 3AG3B 2WPDG 2DMXA 5CA1A 4J10A 5KLVH 3H1KH 4H13B 3HB3B 4DV0B 1YF2A 1AILA 3E35A 4JI5B 2CTWA 2EIJC 4JI7B 2BTQB 4GX1A 1ZUQA 2OIEA 1D5NA 2Q7GA 1Y4MA 3DSQA 4YJ3A 4B3RB 5IJ9B 1BZKA 1TAEA 1JVMA 4JI4O 2XUMA 5L3FA 4F6RA 1I08A 1KQSU 5L3EA 4TUYA 4YIPA 1XL4A 1HDJA 4J7KA 3TXSA 3ETDA 1PNMA 1Q7YW 3SJQC 4IHJA 1N32B 3FAVA 1AR5A 2QTOA 1JQ0A 4I4TA 4MVZA 5JVDA 3ZN1A 1NQTA 1JFFA 4J7JA 4EFBA 4JI3O 4O4JA 3CCRV 3ZCCA 3OUFA 2LGWA 4J9YB 5J2TB 1AI6A 1JPXA 4CH5A 5B1AC 3OMNB 4LF7O 1S76D 4HBNA 3SYCA 2A0LA 3JARB 3L9DA 4O4LA 5L3BA 2JGUA 1HNXO 4UVAA 2P4KA 5IDJA 3E8FA 4LF4B 3TETA 1Q86W 2GTSA 4N23A 3O65A 2AHZA 4O4HB 1SC5B 1FXKC 4MT8A 2UUAO 1VEWA 2F66C 3ZS8C 2A3QA 3BCCH 2DE0X 3CRMA 4LWSA 2F1MA 4CH6A 3TXQA 4KXRA 1YJ9V 2BSKA 2YICA 3W7WA 3T1HB 2HG5C 3FD9A 2QM7A 3CS5A 3ZRXA 2PI5A 4DR7O 3OMAB 5KHKA 2AW9A 1K4DC 4PDVA 2GDSA 4GX0A 3JSNA 3ETQA 3L70H 2Q73A 3JATB 4FLXA 2YC0A 5AG2A 3HKBB 4I55A 2Z3YA 2IM9A 4PA7A 3HKEA 3DXRA 1N34B 4O4IB 5IYDO 5FNVA 3JD4A 4DR4O 4CS3A 5A9GA 1SZXA 1OCZC 3QVNA 5B3SC 4DV4B 4JI6B 4YJ2B 3AG4C 2UUCB 4CH3A 4LFAO 1NR7A 1QU7A 3QO7A 5JJNB 4HNAA 2Y4TA 2UXCO 1YSCA 1L0NH 1SQPH 4LBEC 5LMUB 5CA1B 1W2BU 4TT3G 2BOCC 1WA8A 2UXDO 4JI8B 5IJ0A 5DN6G 3WG7C 4X62O 1VQ8V 1K5QA 3KCYA 4LC1A 5JWPA 4YJ3B 4ICGA 1GK9A 5BXZA 1SF9A 4MW3A 2KKWA 4F6RB 3W7SA 1ZTEA 4D7SA 1BMFG 4TUYB 1NJIW 3D3IA 4WFHA 4MTFA 1KUQA 1AI4A 1SQFA 2W6JG 4OX9B 2X6AA 4DR5O 4BW9A 3G67A 2CGNA 4IHJB 3G6BA 2HR3A 5D5QA 5K1PA 1RM1C 1URFA 2FL4A 3FAVB 4I4TB 5JVDB 4R7CA 2PZSA 1N4CA 3E22A 4AI8A 1JFFB 1M9NA 4LF6O 4NR1A 4O4JB 1K73W 4DV2O 3A0HZ 3ETEA 4R6ZA 4ZBMA 5JQGA 1VQ4V 3CXCU 3G4SV 2O57A 2K9PA 5KHIA 1BCCH 2ZCEA 3ABUA 4O4LB 2ILMA 4X88A 2ADQB 3CPWU 5LL6Y 1QCEA 1WAZA 2YI8A 4WFAV 4YY3B 3JAWA 4LH7A 3ABTA 1LUVA 1XHZA 3ZBHA 2JRIA 3ASNB 1D2DA 5FL7G 2WWWA 4DXWA 5KAIZ 4B3SB 4LWSB 2LFSA 3D36A 5EBMC 1VQLV 1I94B 3E8GA 4KP4A 1MG1A 3ZJZA 2BSKB 2YUAA 3B8MA 2F43G 5IYCO 3UO3A 1K4CC 4EEQA 4DR6B 2ZM6B 3ZMZA 4QE9A 5IWAB 1GKFA 3H1JH 1TGOA 1MOFA 1XEQA 2JS5A 2DYRB 2LJ2A 5FPRA 1OCRB 1E1RG 1OV9A 4I55B 5H5NA 3HKEB 3DXRB 3SR2C 5FNVB 4HZ3A 4X65B 2PUSA 1Z2GA 3UCSC 2R9AA 4DV7B 2IJHA 1BE3H 1M56B 3AG2C 1XNQB 2H3OA 3SJAC 4CS4A 5LBQA 4HNAB 3SJCC 2IU0A 3CCJV 1U97A 3OUSA 3MD0A 1WA8B 1Q5OA 5IJ0B 2V4DA 2AZ2A 2VQFB 4GLXA 2ZDIA 4DR2O 4BIZA 1R3KC 2MK3A 2VWKA 1MMMA 2UU9B 1VQ9V 1FAFA 3LDCA 3IC9A 1NT2B 1VQOV 1DF5A 4XDJA 1XOUA 5C93A 3AK2A 3MHSC 4TQFA 4FLUA 3E22B 1NVPB 1FOUA 3EFFK 3SPGA 2AXTZ 3CWBH 4CC6A 3OR7C 4B3MO 5LHHA 3W7XA 1QHTA 3D3QA 5JQGB 2CK3G 2GUZA 3ABKC 3ZRSA 1B3QA 3W7UA 5HFMA 2BTOA 4U7NA 1P4RA 3L71H 5EC2C 3ABMB 1YTFD 3S3WA 2Y69C 1N0NA 3SPIA 3APOA 5BY1A 4UVCA 1V54B 4GYCB 1JJ2U 1IBLO 1NS1A 3WB0A 4UV8A 4QNHB 1K8AW 2PGGA 3LSQA 3JAWB 2Q68A 1R73A 2EINC 1KBHA 2WSSG 4GZRB 4R50A 1M57C 1XBLA 4DV6O 3E8BA 1GN6A 1HNZO 1BL8A 4MVQA 4X64B 1XMQB 1VMGA 2ZXWB 5B5EZ 2UXNA 3BFRA 4OPHA 3W7TA 4GX2A 5ITZA 1VQKV 1SRYA 3GWOA 1CXZB 4KFMA 2LW7A 5DEDA 4PJ0Z 4I0XA 1HNWO 5C8YA 1IX9A 3TJTA 5IYZA 4FLWA 1XDCA 3B8NA 2CUGA 2YDEA 4CS2A 4JASA 2XTAA 4ZKIA 5KAFZ 2DYSB 2HJFC 2UUBB 4OXSA 4WFGA 4PA6A 1FJGO 1K9MW 3OD4A 4YXWG 1HR0B 2GSMB 4FFBA 3P3NA 1S3JA 4MSWC 2WLMA 4DV0O 3CCMV 4YHHB 1YIJV 4X66B 3LUTB 5E79Z 2D3OW 1N0JA 3STZC 3AG3C 2H94A 4Q20A 3ML0A 2OCCB 1YDXA 1QQCA 2CE4A 1AR4A 1K34A 1BS3A 4PDMA 1QBZA 2XAQA 4KHPO 1Q6HA 4H44B 4LP8A 5LXTA 4JZGA 1N32O 2Q5ZA 2QWOB 2VS0A 3TK1A 4AHCA 3A2FA 2IW5A 2ZE7A 2XT9A 3N2KA 1P7BA 4I9QA 4JYAB 1EZVH 4NXNO 2EULA 3K0GA 1WPXA 1F7YA 3CCLV 3SYPA 4X89A 4A5UB 2GUZB 2JGDA 1I5XA 4E4EA 2FKXA 3ZN0A 4XDLA 4ZOLA 4DR1B 2ODMA 1V55B 1TA8A 3A8TA 1H8EG 4LF4O 3KZIZ 5B66Z 4K3AA 1Z5WA 2ITCC 1Q6IA 3HKDA 1W59A 2Q0OC 2QGNA 3F7YC 2XAJA 2CAZC 4DK0A 3OMIB 1R3LC 5B1NA 4OGQB 5B1BB 3D8CA 4DUYO 3U10A 3T1HO 1FKAO 1Y76A 1WJZA 2UXBB 3ZRWA 3FFQA 5ITZB 1EZJA 3AK1A 4LF5O 3APQA 1F23A 1S5HC 1YITV 2F95B 3ZRVA 4I0XB 5C8YB 2IH1C 4DR3O 3GVMA 1WNSA 1H38A 2XAHA 5IYZB 1SQBH 3CEIA 1EFRG 2EZPA 3K03A 3U11A 2YI9A 1N34O 4TV9A 5JJEB 3ASOB 3LNMB 1GH6A 4JV5B 1IDSA 2MW2B 2PY5A 1PP9H 3CP1A 4FFBB 2X7RB 4AQYB 4JI1O 3U0ZA 3AG1B 5LMUO 3OTOB 1KP2A 4K0KB 1BSMA 2PI4A 1G1XB 3FB8C 2ZKOA 4R8CA 2ZE5A 2RN9A 1ZAUA 3O9OA 2BE3A 1OCOB 1DK1A 3CD6V 1VF7A 1YJWV 3K58A 1MZFA 1MNGA 3K3WA 3E89A 1L0LH 4LF8O 3LNNA 4L8JA 1BHAA 3CXHF 2P5OA 1TUEB 4BIOA 2CTPA 1XMOB 5LXTB 1YCIA 1JX9A 4P30A 3RBZA 2HP8A 2QWRB 4PDRA 3M8AA 3X2QB 1GM7A 3BABA 3ZX6A 2FB5A 4BW5A 3T1YB 4LFCO 3NR7A 2YXHA 3H1HH 4DW0A 4NXMO 1SA0A 1VQ6V 1BGYH 3N2KB 5B1OA 2ZNJA 2DN9A 5J9PC 3DGEA 5IE9A 3ZMVA 3RWRD 1AI5A 2XAGA 3SYOA 4UCSA 1BQ0A 2OTJV 2JGDB 1F4NA 4J7ZA 1N33B 4L87A 3HR0A 4YY3O 3JSLA 4GT1A 4ZOLB 3JD3A 5TISZ 1AJPA 2DQ0A 2EIMB 4X1KA 1PNLA 5BR8B 3MHHC 1RP3B 3R65A 2OWOA 2M6YA 2AZ0A 4NYKA 1I0HA 1T5EA 3M99B 2WLLA 4DK1A 2XHBA 1I94O 4QE7A 1H2SB 1JMKC 4UCUA 3ASNC 4KL1A 1M90W 1Y76B 2ZM6O 2HHHO 4ZIBA 5IWAO 2WLJA 4I7ZB 3ZRWB 3KDRA 4TWKA 2V7QG 3WB2A 3B2EE 3OTFA 2L35A 4LNUA 1EN5A 3JALA 4KUMA 3HPLC 2OTLV 1K3EA 3K79A 4WF9V 4LF9O 4TV9B 4X65O 3OFNG 3WU2Z 1M1KW 4U3FH 2DYRC 1O9HA 1IZ3A 2KQXA 4EB6A 4UXNA
chains in the Genus database with same CATH topology
1ZTEA 3KKYA 4X9QA 1XREA 1Y67A 1B06A 1IX9A 2P4KA 3TJTA 1PM9A 1IXBA 1EM1A 1XDCA 1WB8A 1AP5A 4GUNA 1LUWA 3K9SA 2QKAA 1AVMA 1VEWA 1MA1A 1XUQA 3C3SA 1XILA 1MMMA 1GN4A 1P7GA 4JZ2A 4FFKA 1EN4A 4JYYA 3AK1A 3IC9A 1KKCA 1PL4A 3MDSA 2ADQB 1ZSPA 1GN3A 3AK3A 3AK2A 1AP6A 2AW9A 2RCVA 2GDSA 1BT8A 3CEIA 1N0JA 1I0HA 1LUVA 1ZLZA 3EVKA 5AG2A 2CE4A 1ZUQA 1AR4A 1D5NA 1BS3A 2QKCA 1IDSA 5A9GA 1SZXA 1JA8A 3QVNA 3C3TA 1I08A 4JZGA 4BR6A 4YIPA 1QNMA 3KDRA 1N0NA 1MSDA 3OT7A 4F6EA 1BSMA 2ADPA 2CDYA 3LSUA 1EN5A 3DC6A 1WB7A 1AR5A 4C7UA 3DC5A 1MNGA 1EN6A 1GN6A 3RN4A 1VARA 1JR9A 4YIOA 3BFRA 1GN2A 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTE A;  3KKY A;  4X9Q A;  1XRE A;  1Y67 A;  1B06 A;  1IX9 A;  2P4K A;  3TJT A;  1PM9 A;  1IXB A;  1EM1 A;  1XDC A;  1WB8 A;  1AP5 A;  4GUN A;  1LUW A;  3K9S A;  2QKA A;  1AVM A;  1VEW A;  1MA1 A;  1XUQ A;  3C3S A;  1XIL A;  1MMM A;  1GN4 A;  1P7G A;  4JZ2 A;  4FFK A;  1EN4 A;  4JYY A;  3AK1 A;  3IC9 A;  1KKC A;  1PL4 A;  3MDS A;  2ADQ B;  1ZSP A;  1GN3 A;  3AK3 A;  3AK2 A;  1AP6 A;  2AW9 A;  2RCV A;  2GDS A;  1BT8 A;  3CEI A;  1N0J A;  1I0H A;  1LUV A;  1ZLZ A;  3EVK A;  5AG2 A;  2CE4 A;  1ZUQ A;  1AR4 A;  1D5N A;  1BS3 A;  2QKC A;  1IDS A;  5A9G A;  1SZX A;  1JA8 A;  3QVN A;  3C3T A;  1I08 A;  4JZG A;  4BR6 A;  4YIP A;  1QNM A;  1N0N A;  1MSD A;  3OT7 A;  4F6E A;  1BSM A;  2ADP A;  2CDY A;  3LSU A;  1EN5 A;  3DC6 A;  1WB7 A;  1AR5 A;  4C7U A;  3DC5 A;  1MNG A;  1EN6 A;  1GN6 A;  3RN4 A;  1VAR A;  1JR9 A;  4YIO A;  3BFR A;  1GN2 A;  4E4E A; 
#chains in the Genus database with same CATH topology
 1PPJ H;  3K5L A;  1PV0 A;  1YHQ V;  1J5E B;  2LW1 A;  4JYB A;  2EX3 A;  3T1C A;  1Y67 A;  2HVJ C;  2PTM A;  3ZIA G;  4B3T B;  2N74 A;  3T4D A;  4TQD A;  1M56 C;  1YEW A;  1M4U A;  2XOK G;  3UO2 A;  4CZZ A;  1O9G A;  2VQE B;  3OGI B;  2ZNI A;  3ZMS A;  1L1F A;  1Q3E A;  3K57 A;  2FML A;  2CTR A;  1JNB A;  4DV5 B;  4DO2 A;  3UKM A;  2E74 B;  3L72 H;  4FLT A;  3IAY A;  1K7D A;  2HJD A;  3BY6 A;  4JI4 B;  3KCX A;  5EIB C;  4RUF A;  1SA0 B;  2JK5 C;  4GX5 A;  1NH2 D;  2EZO A;  1R6N A;  2ZQM A;  1FFX A;  3VQV A;  1H2G A;  1P49 A;  5CA3 A;  4MVS A;  2QE7 G;  3BRC A;  4QPJ A;  5LGT A;  2YIB D;  5K1X A;  4JI3 B;  4AIL C;  5CBH A;  4UV9 A;  3ABM C;  1SS3 A;  4P2Z A;  2LFR A;  2N04 A;  3HKC A;  1NKD A;  4X1K B;  1WB7 A;  4PHZ A;  1H2K A;  1M5I A;  4LR3 A;  1V54 C;  2PYJ A;  4FM0 A;  4DV3 B;  3QTC A;  2WLL B;  2EIL B;  1G6U A;  4X1Y A;  1HNX B;  4IYH A;  1YJN V;  3SJB C;  1VAR A;  5BMV A;  2AGA A;  4ABM A;  4BAY A;  3SGI A;  2Z0A A;  2B5U A;  4I5S A;  1AJQ A;  2JEX A;  1NBM G;  2ZXW C;  2UUA B;  1H8H G;  4EKW A;  1KMI Z;  3D36 C;  4LNU B;  1I5Y A;  4FVM A;  3THO A;  4H0L B;  1RPO A;  2HFE C;  3JAL B;  1JCH A;  3CC7 V;  3CME V;  3RYI A;  3RYC A;  1WB8 A;  5KA5 A;  2W6I G;  3CHX A;  3CJH A;  1K97 A;  4DV1 O;  3J7A U;  3DTU B;  1LUW A;  1HR0 O;  1IUR A;  2JDI G;  3C90 A;  2F4V O;  4LFB B;  5HFL A;  3IC7 A;  4EB6 B;  2DYS C;  3CCV V;  4Z1V A;  2ZIO A;  5A2Q N;  2P6J A;  1OHH G;  4FPP A;  5BZB A;  4YHH O;  2YEV A;  4X66 O;  2ATK C;  1GO3 F;  4PI0 A;  1DLB A;  3K0D A;  1ZSP A;  3L75 H;  1P84 F;  5FPO A;  2LQT A;  3AK3 A;  2PF4 E;  5CMU A;  4DR4 B;  1WLE A;  2ETN A;  1BT8 A;  3CRR A;  3H1L H;  3P32 A;  3SPC A;  4H37 A;  3RFR A;  4W4L A;  2ITD C;  3BHP A;  2ZR3 A;  4PV1 B;  3ZHS A;  2OCC C;  3T4Z A;  4W4K A;  5LYJ A;  2KG7 A;  4RWU A;  5DEC A;  1HW7 A;  2R70 A;  2ZDI C;  4X62 B;  2DWD C;  4PA9 A;  1IBM O;  4OPA A;  3CSX A;  2YID A;  1H2L A;  5JJJ B;  4H33 A;  4UFZ A;  3DC5 A;  1QVG U;  3FYE B;  2JVD A;  4DR5 B;  4YIO A;  4CBC A;  1YXB A;  4FJC C;  1IBK B;  1AB3 A;  1OCC C;  1Y6X A;  2ZE6 A;  3VQX A;  3FKS G;  2QEX V;  2EIK B;  3RYF A;  1B06 A;  3VOU A;  4JTD B;  1JOY A;  3HKC B;  3ZHV A;  3JAK A;  1R3I C;  5KA6 A;  3K04 A;  5H2F Z;  3I55 V;  4JI2 O;  4I50 A;  3K9S A;  2QKA A;  4B7E A;  4X1Y B;  3UQ8 A;  3LDD A;  5BMV B;  4ZHQ A;  3R66 A;  4JAU A;  5LMN O;  1XUQ A;  2WLK A;  1XIL A;  2HLD G;  5B1B C;  1PL0 A;  3JD0 A;  5J2U A;  4GCZ A;  5KMG A;  1R6T A;  1E1Q G;  3G80 A;  1CP9 A;  3RYC B;  1N36 B;  3K59 A;  3CJH B;  2XAF A;  1GMG A;  1LNQ A;  5LHI A;  3OTO O;  4JAA A;  2QM8 A;  3ASO C;  5EK0 A;  1K92 A;  4X8A A;  1KP3 A;  4UB6 Z;  4JI5 O;  2YEV B;  2WLH A;  2NNU A;  4JI7 O;  2EBO A;  2RNB A;  1QVF U;  2Q8V A;  4CH4 A;  2Z5U A;  4MTG A;  2E3C A;  4B3R O;  1VF6 A;  1QLE B;  5KHH A;  3JCU Z;  4FZ1 A;  3RGB A;  1OCO C;  3RT3 C;  3SDL A;  1XMO O;  4ASU G;  5LA6 A;  4EFE A;  4Q6G A;  2DOS A;  3OM3 B;  1S5L Z;  5H6Q A;  4HAM A;  5JCO A;  1XRE A;  5LYJ B;  4PEL A;  2KG7 B;  2CH7 A;  5CA0 A;  2HKO A;  2DWE C;  4DRX A;  3B77 A;  1D5A A;  1YZB A;  4DYL A;  2XND G;  3X2Q C;  5F2V O;  4FLV A;  1SER A;  1SQV H;  4GKK B;  4GUN A;  3S3X A;  1GM9 A;  1NTM H;  1ORQ C;  4BIU A;  4DUZ B;  2B9Z A;  2JIZ G;  4P9O A;  1N33 O;  5EZY A;  2D2C B;  2OCH A;  1UFI A;  2IJJ A;  3CE2 A;  4U3J A;  4MVO A;  1GAX A;  3OR6 C;  1NTK H;  3RYF B;  3OEH G;  1XNR B;  4RAI A;  3JAK B;  4UCO A;  3SPJ A;  4NB5 A;  5D5P A;  4PA3 A;  3WB1 A;  2W0F C;  3CYO A;  4I50 B;  4JAV A;  5LOV A;  1IBL B;  1LR1 A;  1KB9 F;  4CC5 A;  5LHG A;  3BA9 A;  2E5L B;  1CEZ A;  3C3T A;  3QO5 A;  3JYC A;  4IYI A;  2JS3 A;  3ICX A;  4MVR A;  1BQZ A;  2Q9L A;  2R9R B;  1HNZ B;  3CRC A;  2ADP A;  5J2U B;  2HVK C;  3LSU A;  3JCZ A;  4IL6 Z;  1HP8 A;  3ZMT A;  1WPB A;  4D7T A;  5KMG B;  3I56 V;  4P9P A;  5LP6 A;  4DV4 O;  4JI6 O;  5KX5 A;  4NKG B;  3F5T A;  4MVU A;  2UUC O;  2QDO A;  1NTZ H;  1HNW B;  3OW2 U;  1JR9 A;  2P7T C;  1WP8 A;  3CRQ A;  3GB7 C;  4IGG A;  1ZWI C;  1J5E O;  3CC4 V;  1GN2 A;  4XBF A;  2QR4 A;  4O4I A;  3KKY A;  4B3T O;  4JI8 O;  2UXX A;  3ABL B;  2A9H A;  1FJG B;  4TOI A;  2NR5 A;  1IJG A;  5EIB D;  2X6C A;  4QIW F;  5EYP A;  3LDE A;  1SET A;  1Q8I A;  4K8X A;  1AP5 A;  2H8P C;  3ZMU A;  1UPG A;  2EJ7 A;  5KUK A;  1VQ7 V;  1A32 A;  2XAS A;  1MA1 A;  4DV5 O;  1NVP D;  2Y4U A;  4OX9 O;  4QGP A;  5LA6 B;  1HWY A;  4JYC A;  1P7G A;  2LO1 A;  5LGU A;  2QTS A;  5JH7 A;  1ARO P;  2KSD A;  1N8R W;  4XDK A;  1IXM A;  1Q90 D;  2CH7 B;  1XL6 A;  5H9C A;  2YSU B;  5CA0 B;  5L3C A;  2WAM A;  4DRX B;  4PDL A;  2RCV A;  4KHP B;  1ZX3 A;  1X59 A;  3CCQ V;  3SYQ A;  1US6 A;  3G6E V;  2Q4P A;  4GKJ B;  1Y74 A;  2Q69 A;  4FMT A;  2GTA A;  4Z1M G;  3VBB A;  3EVK A;  2Q0A A;  5EZY B;  5IY5 B;  4G28 B;  2YXY A;  1JA8 A;  1MAB G;  3RYH A;  3F7V C;  4NXN B;  2VWJ A;  4U3J B;  2ZT9 B;  3FB7 C;  3HKD B;  3OT7 A;  2CDY A;  3OEE G;  4UCV A;  4J41 A;  2IJI A;  1FXK A;  4DV3 O;  4B3S O;  3NXS A;  2X0L A;  5EBW C;  2FYU H;  3AEI A;  1TVK A;  2F93 B;  3PN1 A;  3K5M A;  5LOV B;  1VIB A;  5GTI Z;  4DR6 O;  1YTF B;  4FM1 A;  2EIL C;  1S77 D;  2C2A A;  2YIA A;  3SPH A;  1S5J A;  3IFX A;  2LP7 A;  2PYL A;  1KD1 W;  3E8H A;  2IJK A;  2A06 H;  1FS0 G;  4DUY B;  3QG5 A;  3CCE V;  1THZ A;  1R3J C;  5LP6 B;  4QJF B;  5EC1 C;  4JI0 B;  5KX5 B;  3K9A A;  4DV7 O;  3ZHR A;  4LF5 B;  4LFB O;  4NTY A;  1XNQ O;  1OCR C;  3ETG A;  1JJO A;  3J81 N;  5DM6 V;  4UCR A;  4DR3 B;  3B40 A;  4O2B A;  3C3S A;  4RO2 A;  1EBO A;  1ROP A;  3CRA A;  3BAA A;  1AI7 A;  3JAM N;  3E2E A;  1GN3 A;  3FB6 C;  4K8Z A;  2VQF O;  2EIJ B;  2JJ2 G;  1VQM V;  3TCU A;  1PNK A;  1GM8 A;  2UU9 O;  1TUB A;  3JAS A;  5EYP B;  4JI1 B;  2A79 B;  5L3G A;  2LGQ A;  4J42 A;  2B1G A;  5GON A;  1FD9 A;  5E1A C;  2M7W A;  3IGA C;  2P22 C;  2OIG A;  3ZHT A;  4UB8 Z;  2QWQ B;  2Y0I A;  1QNM A;  4E2L A;  3QO8 A;  5JH7 B;  4LF8 B;  4MTX A;  5CB4 A;  3K5O A;  1H2N A;  1VQP V;  1M93 A;  2EJR A;  3G71 V;  1SQG A;  1QR9 A;  2L6L A;  2P90 A;  3ZHU A;  1Y74 B;  1EN6 A;  5B1A B;  4PA4 A;  3ZED A;  1IBK O;  1E79 G;  4D6T H;  3RN4 A;  3CB2 A;  4K35 A;  2ZIN A;  4LFC B;  1I7F A;  4NXM B;  3B09 A;  4RQF A;  4NTW A;  2QWP B;  3RYH B;  4MS2 A;  4FZ0 A;  1W0J G;  1K5S A;  5KUM A;  2IBZ H;  2QJ1 A;  5GW7 A;  2QA4 V;  2NN4 A;  4LF7 B;  4X64 O;  1PM9 A;  2K1E A;  1XMQ O;  1FXK B;  1L8D A;  1OJH A;  1IXB A;  1XQ8 A;  2EIK C;  2N05 A;  3QF7 A;  1U96 A;  1KU9 A;  1TVK B;  4TV8 A;  4O2A A;  1AVM A;  3VQY A;  1FXV A;  4NVP A;  2YXL A;  1COW G;  1S72 V;  3A0R A;  4JYY A;  1Q82 W;  1PL4 A;  2UUB O;  1N36 O;  1Q6U A;  3UT5 A;  5LGN A;  3E86 A;  2X6B A;  2QKS A;  2HHH B;  1KC8 W;  2V1D A;  1KYO F;  4DR7 B;  1OCZ B;  5B3S B;  4I9W A;  1V9P A;  3AG4 B;  1G4Y B;  4JGS A;  3BVO A;  4J9Z B;  4WBN A;  1XI1 A;  2Q6A A;  5EBL C;  3RVY A;  2QSA A;  4O2B B;  1NI8 A;  2P67 A;  4NTX A;  4RUE A;  4BR6 A;  4LF9 B;  1MSD A;  4FK5 C;  4JF3 A;  1RFY A;  3GWK C;  2P4V A;  3J80 N;  2DW4 A;  4LFA B;  2OT5 A;  1FPO A;  2R9I A;  4X1I A;  3BA8 A;  3WG7 B;  2WLI A;  4Z2W A;  1SZT A;  1TUB B;  3JAS B;  1DF4 A;  4IIJ A;  2UXC B;  2WA3 A;  2BOB C;  2Y48 A;  1QLE C;  2E75 B;  2ZD9 A;  1RSO A;  4DW1 A;  3E83 A;  3EHB B;  5GON B;  4U7O A;  2UXD B;  4B08 A;  4JYA O;  5L3D A;  4X9Q A;  4X20 A;  5FLX N;  1RM1 B;  2RJZ A;  3T2M A;  2DJV A;  4GKK O;  2A7W A;  2G38 A;  5CB4 B;  3KG2 A;  5IT9 N;  1EM1 A;  4DUZ O;  1FFX B;  3VQW A;  1PD3 A;  2KB1 A;  3B4S A;  4DR1 O;  4J11 A;  2YS8 A;  2Q67 A;  4LF6 B;  4UVB A;  3CMA V;  4DV2 B;  4B7K A;  1SES A;  1AJN A;  1WP7 A;  4TSF G;  3IJ4 A;  1XNR O;  1KEC A;  4G2K A;  3RW0 A;  1KKC A;  1V55 C;  3BEH A;  3RVZ A;  3MDS A;  4LCU C;  4RQE A;  2DQ3 A;  1GTO A;  2ZR2 A;  4ZI7 A;  3FYI B;  3CC2 V;  1Z5V A;  2IH3 C;  2UXB O;  1DTO A;  3Q4H A;  2AHY A;  4TV8 B;  4O2A B;  4JPR A;  2E5L O;  2YIB A;  1SKV A;  1XHX A;  1ENV A;  1CPY A;  4N21 A;  2QWN B;  1BHB A;  3P30 A;  1VQ5 V;  1ZL8 A;  3CCS V;  1R1B A;  2R72 A;  2B1I A;  1G8M A;  3WFV A;  3H01 A;  3RYI B;  5KHG A;  3STL C;  4G27 B;  3DC6 A;  3N2G A;  4JV5 O;  1SQQ H;  2CTQ A;  2RDC A;  2GV9 A;  3UT5 B;  5CBG A;  2VRZ A;  1H2M A;  4C7U A;  2F23 A;  4AQY O;  4FM2 A;  1Y66 A;  4IT5 A;  4K0K O;  2BCC H;  4UCT A;  4WBN B;  4QPK A;  3AG2 B;  5H6R A;  4DV1 B;  4UUJ C;  4MVM A;  1NZ6 A;  3AG1 C;  1UJW B;  1RPR A;  2FTK A;  3H1I H;  1B6Q A;  3H9V A;  2F4V B;  4X1I B;  1VQN V;  3ABL C;  2WLI B;  1IVS A;  4WFF A;  3AG7 A;  3MAQ A;  3M7M X;  4IIJ B;  1KKD A;  3ZHQ A;  2BTQ A;  4JTA B;  1Q81 W;  1VF6 C;  3OAA G;  4WCE V;  1RSO B;  5IJ9 A;  3FX7 A;  2RQ6 A;  3T1Y O;  1MZE A;  2ARH A;  1QR8 A;  2CGO A;  4JZ2 A;  1AR1 B;  5KHJ A;  4FFK A;  3I5D A;  1S0V A;  2GHY A;  1EN4 A;  4X20 B;  3UM7 A;  5IYB O;  1VF5 B;  3CCU V;  4DR2 B;  3N27 A;  1W0K G;  3CX5 F;  4GKJ O;  1QLN A;  1AP6 A;  1J95 A;  1GRJ A;  5JCO C;  4HYO A;  1NR1 A;  3JD2 A;  3ABK B;  3OE7 G;  1FFT B;  1ZLZ A;  2Q7H A;  1PKX A;  5J2T A;  2OYQ A;  3L74 H;  1IBM B;  2Y69 B;  2QKC A;  2WLN A;  4FLY A;  1YI2 V;  5BR8 O;  3LSS A;  5CN0 A;  1OCC B;  4B3M B;  2Y0P A;  1Q43 A;  2ZE8 A;  4MW8 A;  2HEP A;  1YVW A;  5IY5 C;  3SYA A;  3JAR A;  1R6K A;  4MTO A;  4BWA A;  2EIN B;  4F6E A;  2GBO A;  2Q7E A;  3A0B Z;  1DGS A;  2EIM C;  5CBF A;  1M57 B;  1NH2 B;  3BPZ A;  4JTC B;  4ZI7 B;  3QNE A;  4WFE A;  4O4H A;  2IU3 A;  3Q4H B;  1FXH A;  2QM4 A;  4ZHQ B;  4FLZ A;  1VP7 A;  4PD4 F;  2W0X A;  3K06 A;  4PI2 A;  4F4L A;  4DV6 B;  3JD1 A;  3FB5 C;  3EXA A;  4JI2 B;  3F5W C;  3L73 H;  1ZL8 B;  3K5N A;  2JEU A;  3PJS K;  2RMK B;  2P06 A;  1FYJ A;  5GTH Z;  4JI0 O;  4WFB V;  5LMN B;  4J80 A;  3TGU H;  3N2G B;  3JAT A;  1K33 A;  1SQX H;  2ZIM A;  3P3P A;  1H5W A;  3HKB A;  1B04 A;  1X4T A;  5LP6 C;  2E76 B;  1F4M A;  1GN4 A;  4FIP C;  1WN7 A;  4LH6 A;  4YJ2 A;  1NU1 H;  1MSW D;  3OGC C;  3K08 A;  1OZ0 A;  2NLJ C;  2WA4 A;  2VQE O;  2JJ1 G;  1F51 A;  3AG3 B;  2WPD G;  2DMX A;  5CA1 A;  4J10 A;  5KLV H;  3H1K H;  4H13 B;  3HB3 B;  4DV0 B;  1YF2 A;  1AIL A;  3E35 A;  4JI5 B;  2CTW A;  2EIJ C;  4JI7 B;  2BTQ B;  4GX1 A;  1ZUQ A;  2OIE A;  1D5N A;  2Q7G A;  1Y4M A;  3DSQ A;  4YJ3 A;  4B3R B;  5IJ9 B;  1BZK A;  1TAE A;  1JVM A;  4JI4 O;  2XUM A;  5L3F A;  4F6R A;  1I08 A;  1KQS U;  5L3E A;  4TUY A;  4YIP A;  1XL4 A;  1HDJ A;  4J7K A;  3TXS A;  3ETD A;  1PNM A;  1Q7Y W;  3SJQ C;  4IHJ A;  1N32 B;  3FAV A;  1AR5 A;  2QTO A;  1JQ0 A;  4I4T A;  4MVZ A;  5JVD A;  3ZN1 A;  1NQT A;  1JFF A;  4J7J A;  4EFB A;  4JI3 O;  4O4J A;  3CCR V;  3ZCC A;  3OUF A;  2LGW A;  4J9Y B;  5J2T B;  1AI6 A;  1JPX A;  4CH5 A;  5B1A C;  3OMN B;  4LF7 O;  1S76 D;  4HBN A;  3SYC A;  2A0L A;  3JAR B;  3L9D A;  4O4L A;  5L3B A;  2JGU A;  1HNX O;  4UVA A;  2P4K A;  5IDJ A;  3E8F A;  4LF4 B;  3TET A;  1Q86 W;  2GTS A;  4N23 A;  3O65 A;  2AHZ A;  4O4H B;  1SC5 B;  1FXK C;  4MT8 A;  2UUA O;  1VEW A;  2F66 C;  3ZS8 C;  2A3Q A;  3BCC H;  2DE0 X;  3CRM A;  4LWS A;  2F1M A;  4CH6 A;  3TXQ A;  4KXR A;  1YJ9 V;  2BSK A;  2YIC A;  3W7W A;  3T1H B;  2HG5 C;  3FD9 A;  2QM7 A;  3CS5 A;  3ZRX A;  2PI5 A;  4DR7 O;  3OMA B;  5KHK A;  2AW9 A;  1K4D C;  4PDV A;  2GDS A;  4GX0 A;  3JSN A;  3ETQ A;  3L70 H;  2Q73 A;  3JAT B;  4FLX A;  2YC0 A;  5AG2 A;  3HKB B;  4I55 A;  2Z3Y A;  2IM9 A;  4PA7 A;  3HKE A;  3DXR A;  1N34 B;  4O4I B;  5IYD O;  5FNV A;  3JD4 A;  4DR4 O;  4CS3 A;  5A9G A;  1SZX A;  1OCZ C;  3QVN A;  5B3S C;  4DV4 B;  4JI6 B;  4YJ2 B;  3AG4 C;  2UUC B;  4CH3 A;  4LFA O;  1NR7 A;  1QU7 A;  3QO7 A;  5JJN B;  4HNA A;  2Y4T A;  2UXC O;  1YSC A;  1L0N H;  1SQP H;  4LBE C;  5LMU B;  5CA1 B;  1W2B U;  4TT3 G;  2BOC C;  1WA8 A;  2UXD O;  4JI8 B;  5IJ0 A;  5DN6 G;  3WG7 C;  4X62 O;  1VQ8 V;  1K5Q A;  3KCY A;  4LC1 A;  5JWP A;  4YJ3 B;  4ICG A;  1GK9 A;  5BXZ A;  1SF9 A;  4MW3 A;  2KKW A;  4F6R B;  3W7S A;  1ZTE A;  4D7S A;  1BMF G;  4TUY B;  1NJI W;  3D3I A;  4WFH A;  4MTF A;  1KUQ A;  1AI4 A;  1SQF A;  2W6J G;  4OX9 B;  2X6A A;  4DR5 O;  4BW9 A;  3G67 A;  2CGN A;  4IHJ B;  3G6B A;  2HR3 A;  5D5Q A;  5K1P A;  1RM1 C;  1URF A;  2FL4 A;  3FAV B;  4I4T B;  5JVD B;  4R7C A;  2PZS A;  1N4C A;  3E22 A;  4AI8 A;  1JFF B;  1M9N A;  4LF6 O;  4NR1 A;  4O4J B;  1K73 W;  4DV2 O;  3A0H Z;  3ETE A;  4R6Z A;  4ZBM A;  5JQG A;  1VQ4 V;  3CXC U;  3G4S V;  2O57 A;  2K9P A;  5KHI A;  1BCC H;  2ZCE A;  3ABU A;  4O4L B;  2ILM A;  4X88 A;  2ADQ B;  3CPW U;  5LL6 Y;  1QCE A;  1WAZ A;  2YI8 A;  4WFA V;  4YY3 B;  3JAW A;  4LH7 A;  3ABT A;  1LUV A;  1XHZ A;  3ZBH A;  2JRI A;  3ASN B;  1D2D A;  5FL7 G;  2WWW A;  4DXW A;  5KAI Z;  4B3S B;  4LWS B;  2LFS A;  3D36 A;  5EBM C;  1VQL V;  1I94 B;  3E8G A;  4KP4 A;  1MG1 A;  3ZJZ A;  2BSK B;  2YUA A;  3B8M A;  2F43 G;  5IYC O;  3UO3 A;  1K4C C;  4EEQ A;  4DR6 B;  2ZM6 B;  3ZMZ A;  4QE9 A;  5IWA B;  1GKF A;  3H1J H;  1TGO A;  1MOF A;  1XEQ A;  2JS5 A;  2DYR B;  2LJ2 A;  5FPR A;  1OCR B;  1E1R G;  1OV9 A;  4I55 B;  5H5N A;  3HKE B;  3DXR B;  3SR2 C;  5FNV B;  4HZ3 A;  4X65 B;  2PUS A;  1Z2G A;  3UCS C;  2R9A A;  4DV7 B;  2IJH A;  1BE3 H;  1M56 B;  3AG2 C;  1XNQ B;  2H3O A;  3SJA C;  4CS4 A;  5LBQ A;  4HNA B;  3SJC C;  2IU0 A;  3CCJ V;  1U97 A;  3OUS A;  3MD0 A;  1WA8 B;  1Q5O A;  5IJ0 B;  2V4D A;  2AZ2 A;  2VQF B;  4GLX A;  2ZDI A;  4DR2 O;  4BIZ A;  1R3K C;  2MK3 A;  2VWK A;  1MMM A;  2UU9 B;  1VQ9 V;  1FAF A;  3LDC A;  3IC9 A;  1NT2 B;  1VQO V;  1DF5 A;  4XDJ A;  1XOU A;  5C93 A;  3AK2 A;  3MHS C;  4TQF A;  4FLU A;  3E22 B;  1NVP B;  1FOU A;  3EFF K;  3SPG A;  2AXT Z;  3CWB H;  4CC6 A;  3OR7 C;  4B3M O;  5LHH A;  3W7X A;  1QHT A;  3D3Q A;  5JQG B;  2CK3 G;  2GUZ A;  3ABK C;  3ZRS A;  1B3Q A;  3W7U A;  5HFM A;  2BTO A;  4U7N A;  1P4R A;  3L71 H;  5EC2 C;  3ABM B;  1YTF D;  3S3W A;  2Y69 C;  1N0N A;  3SPI A;  3APO A;  5BY1 A;  4UVC A;  1V54 B;  4GYC B;  1JJ2 U;  1IBL O;  1NS1 A;  3WB0 A;  4UV8 A;  4QNH B;  1K8A W;  2PGG A;  3LSQ A;  3JAW B;  2Q68 A;  1R73 A;  2EIN C;  1KBH A;  2WSS G;  4GZR B;  4R50 A;  1M57 C;  1XBL A;  4DV6 O;  3E8B A;  1GN6 A;  1HNZ O;  1BL8 A;  4MVQ A;  4X64 B;  1XMQ B;  1VMG A;  2ZXW B;  5B5E Z;  2UXN A;  3BFR A;  4OPH A;  3W7T A;  4GX2 A;  5ITZ A;  1VQK V;  1SRY A;  3GWO A;  1CXZ B;  4KFM A;  2LW7 A;  5DED A;  4PJ0 Z;  4I0X A;  1HNW O;  5C8Y A;  1IX9 A;  3TJT A;  5IYZ A;  4FLW A;  1XDC A;  3B8N A;  2CUG A;  2YDE A;  4CS2 A;  4JAS A;  2XTA A;  4ZKI A;  5KAF Z;  2DYS B;  2HJF C;  2UUB B;  4OXS A;  4WFG A;  4PA6 A;  1FJG O;  1K9M W;  3OD4 A;  4YXW G;  1HR0 B;  2GSM B;  4FFB A;  3P3N A;  1S3J A;  4MSW C;  2WLM A;  4DV0 O;  3CCM V;  4YHH B;  1YIJ V;  4X66 B;  3LUT B;  5E79 Z;  2D3O W;  1N0J A;  3STZ C;  3AG3 C;  2H94 A;  4Q20 A;  3ML0 A;  2OCC B;  1YDX A;  1QQC A;  2CE4 A;  1AR4 A;  1K34 A;  1BS3 A;  4PDM A;  1QBZ A;  2XAQ A;  4KHP O;  1Q6H A;  4H44 B;  4LP8 A;  5LXT A;  4JZG A;  1N32 O;  2Q5Z A;  2QWO B;  2VS0 A;  3TK1 A;  4AHC A;  3A2F A;  2IW5 A;  2ZE7 A;  2XT9 A;  3N2K A;  1P7B A;  4I9Q A;  4JYA B;  1EZV H;  4NXN O;  2EUL A;  3K0G A;  1WPX A;  1F7Y A;  3CCL V;  3SYP A;  4X89 A;  4A5U B;  2GUZ B;  2JGD A;  1I5X A;  4E4E A;  2FKX A;  3ZN0 A;  4XDL A;  4ZOL A;  4DR1 B;  2ODM A;  1V55 B;  1TA8 A;  3A8T A;  1H8E G;  4LF4 O;  3KZI Z;  5B66 Z;  4K3A A;  1Z5W A;  2ITC C;  1Q6I A;  3HKD A;  1W59 A;  2Q0O C;  2QGN A;  3F7Y C;  2XAJ A;  2CAZ C;  4DK0 A;  3OMI B;  1R3L C;  5B1N A;  4OGQ B;  5B1B B;  3D8C A;  4DUY O;  3U10 A;  3T1H O;  1FKA O;  1Y76 A;  1WJZ A;  2UXB B;  3ZRW A;  3FFQ A;  5ITZ B;  1EZJ A;  3AK1 A;  4LF5 O;  3APQ A;  1F23 A;  1S5H C;  1YIT V;  2F95 B;  3ZRV A;  4I0X B;  5C8Y B;  2IH1 C;  4DR3 O;  3GVM A;  1WNS A;  1H38 A;  2XAH A;  5IYZ B;  1SQB H;  3CEI A;  1EFR G;  2EZP A;  3K03 A;  3U11 A;  2YI9 A;  1N34 O;  4TV9 A;  5JJE B;  3ASO B;  3LNM B;  1GH6 A;  4JV5 B;  1IDS A;  2MW2 B;  2PY5 A;  1PP9 H;  3CP1 A;  4FFB B;  2X7R B;  4AQY B;  4JI1 O;  3U0Z A;  3AG1 B;  5LMU O;  3OTO B;  1KP2 A;  4K0K B;  1BSM A;  2PI4 A;  1G1X B;  3FB8 C;  2ZKO A;  4R8C A;  2ZE5 A;  2RN9 A;  1ZAU A;  3O9O A;  2BE3 A;  1OCO B;  1DK1 A;  3CD6 V;  1VF7 A;  1YJW V;  3K58 A;  1MZF A;  1MNG A;  3K3W A;  3E89 A;  1L0L H;  4LF8 O;  3LNN A;  4L8J A;  1BHA A;  3CXH F;  2P5O A;  1TUE B;  4BIO A;  2CTP A;  1XMO B;  5LXT B;  1YCI A;  1JX9 A;  4P30 A;  3RBZ A;  2HP8 A;  2QWR B;  4PDR A;  3M8A A;  3X2Q B;  1GM7 A;  3BAB A;  3ZX6 A;  2FB5 A;  4BW5 A;  3T1Y B;  4LFC O;  3NR7 A;  2YXH A;  3H1H H;  4DW0 A;  4NXM O;  1SA0 A;  1VQ6 V;  1BGY H;  3N2K B;  5B1O A;  2ZNJ A;  2DN9 A;  5J9P C;  3DGE A;  5IE9 A;  3ZMV A;  3RWR D;  1AI5 A;  2XAG A;  3SYO A;  4UCS A;  1BQ0 A;  2OTJ V;  2JGD B;  1F4N A;  4J7Z A;  1N33 B;  4L87 A;  3HR0 A;  4YY3 O;  3JSL A;  4GT1 A;  4ZOL B;  3JD3 A;  5TIS Z;  1AJP A;  2DQ0 A;  2EIM B;  4X1K A;  1PNL A;  5BR8 B;  3MHH C;  1RP3 B;  3R65 A;  2OWO A;  2M6Y A;  2AZ0 A;  4NYK A;  1I0H A;  1T5E A;  3M99 B;  2WLL A;  4DK1 A;  2XHB A;  1I94 O;  4QE7 A;  1H2S B;  1JMK C;  4UCU A;  3ASN C;  4KL1 A;  1M90 W;  1Y76 B;  2ZM6 O;  2HHH O;  4ZIB A;  5IWA O;  2WLJ A;  4I7Z B;  3ZRW B;  3KDR A;  4TWK A;  2V7Q G;  3WB2 A;  3B2E E;  3OTF A;  2L35 A;  4LNU A;  1EN5 A;  3JAL A;  4KUM A;  3HPL C;  2OTL V;  1K3E A;  3K79 A;  4WF9 V;  4LF9 O;  4TV9 B;  4X65 O;  3OFN G;  3WU2 Z;  1M1K W;  4U3F H;  2DYR C;  1O9H A;  1IZ3 A;  2KQX A;  4EB6 A;  4UXN A; 
#chains in the Genus database with same CATH homology
 1ZTE A;  3KKY A;  4X9Q A;  1XRE A;  1Y67 A;  1B06 A;  1IX9 A;  2P4K A;  3TJT A;  1PM9 A;  1IXB A;  1EM1 A;  1XDC A;  1WB8 A;  1AP5 A;  4GUN A;  1LUW A;  3K9S A;  2QKA A;  1AVM A;  1VEW A;  1MA1 A;  1XUQ A;  3C3S A;  1XIL A;  1MMM A;  1GN4 A;  1P7G A;  4JZ2 A;  4FFK A;  1EN4 A;  4JYY A;  3AK1 A;  3IC9 A;  1KKC A;  1PL4 A;  3MDS A;  2ADQ B;  1ZSP A;  1GN3 A;  3AK3 A;  3AK2 A;  1AP6 A;  2AW9 A;  2RCV A;  2GDS A;  1BT8 A;  3CEI A;  1N0J A;  1I0H A;  1LUV A;  1ZLZ A;  3EVK A;  5AG2 A;  2CE4 A;  1ZUQ A;  1AR4 A;  1D5N A;  1BS3 A;  2QKC A;  1IDS A;  5A9G A;  1SZX A;  1JA8 A;  3QVN A;  3C3T A;  1I08 A;  4JZG A;  4BR6 A;  4YIP A;  1QNM A;  3KDR A;  1N0N A;  1MSD A;  3OT7 A;  4F6E A;  1BSM A;  2ADP A;  2CDY A;  3LSU A;  1EN5 A;  3DC6 A;  1WB7 A;  1AR5 A;  4C7U A;  3DC5 A;  1MNG A;  1EN6 A;  1GN6 A;  3RN4 A;  1VAR A;  1JR9 A;  4YIO A;  3BFR A;  1GN2 A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...