3DC6A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
197
structure length
197
Chain Sequence
KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn] 1
total genus 79
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc6A02
4C7UA 1AVMA 1XDCA 1ZLZA 2ADPA 1I08A 2CDYA 1MA1A 1AP6A 1GN6A 2GDSA 5A9GA 1AP5A 4GUNA 1BSMA 1ZTEA 1N0NA 1XILA 4JYYA 1SZXA 3TJTA 3EVKA 3DC5A 3MDSA 1LUWA 1XREA 1QNMA 1B06A 1P7GA 2RCVA 3AK3A 2AW9A 1KKCA 4YIPA 1PL4A 1WB8A 1MSDA 4YIOA 1BS3A 1EM1A 3C3TA 3OT7A 1EN4A 4E4EA 4JZ2A 1D5NA 1VARA 1JR9A 4X9QA 1ZUQA 1IX9A 3K9SA 2P4KA 1GN3A 1MNGA 4F6EA 1BT8A 2QKAA 2CE4A 1EN6A 1LUVA 3CEIA 4FFKA 3LSUA 3RN4A 3IC9A 3QVNA 3KKYA 1JA8A 1Y67A 3BFRA 1IXBA 2ADQB 4JZGA 1AR4A 1XUQA 3C3SA 3AK2A 1IDSA 1WB7A 1AR5A 1N0JA 1GN4A 2QKCA 1MMMA 5AG2A 1ZSPA 1GN2A 1VEWA 3DC6A 4BR6A 1EN5A 3AK1A 1I0HA 1PM9A
chains in the Genus database with same CATH superfamily
1JPXA 4A5UB 1THZA 4XDKA 5H6RA 1G1XB 3M7MX 1N33B 1XDCA 1YDXA 4HAMA 4DV3O 1AROP 1AI7A 2PYLA 3BABA 5EIBD 4MVSA 1BL8A 4DV0O 4FPPA 2EINB 4JYYA 3TJTA 3AG1C 3T1HO 2HP8A 4LNUB 2Q0OC 4NR1A 1L1FA 4DR3O 4OPAA 1RPRA 5CBHA 3SPCA 1F23A 2RDCA 3CCEV 3UM7A 3E2EA 1K73W 4FVMA 2IJKA 4PA3A 2P7TC 4L87A 5J2UB 2BTOA 3OEHG 1K97A 3KCXA 3RBZA 2LFRA 2E5LB 1FKAO 3GWKC 2XNDG 2QWOB 1BHBA 4K8XA 4HZ3A 1JR9A 2K9PA 1TVKA 1MNGA 3CCQV 3E22B 1YJWV 5GW7A 4ZKIA 3QNEA 2B1IA 5LP6C 3GVMA 4LH7A 1V55B 4J9ZB 4LFAB 1UPGA 2IH1C 3MHSC 4Q20A 1OCCB 1NBMG 3QVNA 4FZ1A 1WP8A 4TQDA 2BOCC 1H2KA 2ITCC 2YICA 2ATKC 3AG1B 3ASNC 4X20B 3UO3A 1TUBA 1TVKB 3ZRSA 1KQSU 3E22A 2L35A 4G28B 4O4JA 3K5MA 1DK1A 1XMQO 3THOA 1NH2D 1YHQV 2Z0AA 4JI3O 1L0LH 1FD9A 5KA5A 3RW0A 4P30A 1I0HA 4X65O 4WFGA 3G6EV 1XHZA 3HKBB 2P90A 3JALB 2WLKA 3CRRA 3N2GA 2Q73A 2ADPA 4NTYA 4DV4O 5LHHA 2CDYA 4X20A 1TUBB 5LMUB 1G8MA 4DR1O 5L3EA 4W4KA 3D3IA 4O4JB 2ZE7A 4AI8A 2JGUA 5L3GA 2UUBO 1P7GA 2R9IA 3JALA 2O57A 3APOA 2KG7B 2MK3A 3VQXA 2XAJA 3AG3C 5H6QA 3JD4A 2XASA 2JK5C 5CA3A 1HNZB 1FXHA 3O9OA 2ZE6A 2YI8A 5CB4A 1VQLV 3CE2A 2ZKOA 2WLHA 5IJ9B 3ABLB 1K7DA 2QWPB 1V54B 2OYQA 3G71V 4LF7O 2B1GA 4DRXA 1BGYH 4FZ0A 1BMFG 3STZC 2QKSA 2KG7A 4LFCB 2QM7A 1QCEA 3IC9A 3K3WA 4PHZA 4L8JA 3MHHC 4RWUA 3ZRVA 3K0DA 5CB4B 1QLNA 1FXKA 4DV1O 4NTWA 3H1LH 2DYRB 3ABMB 2WLMA 3RGBA 1KP2A 1VIBA 4MVZA 2UXNA 4BAYA 1MZEA 2P67A 3B77A 2DOSA 3ZMSA 5K1PA 1GRJA 3JAWB 2HEPA 1GM9A 2H94A 1S3JA 3ZEDA 4EKWA 1A32A 3AG4C 3HB3B 4GYCB 3B8NA 3FYEB 5DEDA 1XMOO 4XDJA 3HKEA 4WFFA 3CCRV 5GONB 4X62B 1ZLZA 3K08A 3IFXA 2HKOA 1V54C 4AILC 4RUEA 3W7TA 3KCYA 1GN6A 3SPJA 1AP5A 3E8GA 1VQPV 4NXNO 3VQWA 3JAWA 5BZBA 1F4MA 1CP9A 3GWOA 1R1BA 2HJDA 3CRAA 3I56V 2ZM6B 1PPJH 1ZX3A 2AGAA 2LO1A 1MSWD 1OCRC 5TISZ 4X8AA 3UT5B 1KUQA 1MSDA 2VWJA 2CTPA 4AHCA 5JCOA 3R65A 4IT5A 1GTOA 3B2EE 4FJCC 4X88A 3W7XA 1SERA 4PI0A 5K1XA 3C3TA 1Q82W 4X64O 1M9NA 2P6JA 3H1JH 3JD3A 1RPOA 2ETNA 4LF8B 1VARA 3CRCA 5EBMC 3SJQC 2P06A 1OHHG 4DV5B 2QDOA 3RVZA 4RQEA 4TWKA 3SPIA 5LYJA 4PDVA 4UV8A 2UUAB 2GTAA 1HNXO 4UCUA 1JJ2U 3ZS8C 3FFQA 5KUKA 3ZMTA 2ZD9A 4FLTA 3OR6C 3ZN0A 4JV5B 4I55A 2V7QG 2WA3A 3OFNG 4B3TB 4UCTA 3JAKA 3A8TA 3IC7A 3RYHA 2F1MA 5J9PC 1H2GA 1FJGO 2DE0X 2ZIOA 4F6RA 3VQVA 2VQFB 1R3KC 2LW1A 3T1YB 4MTGA 1NKDA 3O65A 4JTAB 4P2ZA 1OCCC 2GHYA 4WCEV 2Y69C 1QVGU 2HG5C 4J7ZA 1SF9A 4CH6A 2V1DA 4LWSB 3EHBB 4DV2O 4I55B 5ITZB 5IWAB 1GK9A 5L3CA 2PI4A 1YJ9V 4JTDB 2YC0A 2HJFC 4J80A 2ODMA 3D3QA 2ZXWC 3OGIB 1VQKV 2VRZA 3H9VA 5IYZA 4ZHQB 1K4CC 5HFMA 1FFTB 4NTXA 4DK1A 1GMGA 2JEUA 3W7UA 1M57C 4F4LA 4DUYO 3ZIAG 3BAAA 3QO7A 1SZTA 5JWPA 4PDRA 3CCVV 4E4EA 4JZ2A 3LDCA 3S3XA 1DTOA 3K9SA 4DV4B 5CMUA 4YJ2A 2JS5A 3CJHA 4PA6A 3X2QC 2Q67A 1XMQB 1YI2V 1FS0G 5KAFZ 1SRYA 3G4SV 3BFRA 4WF9V 4PELA 4PV1B 3T4DA 4LCUC 4TQFA 2IU0A 1R73A 1Y4MA 4B3SO 4D6TH 3CJHB 3U11A 4J42A 2A9HA 1W59A 2R9RB 1FAFA 3CCSV 2JGDB 4YXWG 2ZIMA 3OD4A 2Q0AA 3RVYA 4ZI7B 2EZPA 3IGAC 4I50A 3JD2A 2IJHA 2Z5UA 4IHJB 5H2FZ 4LF7B 1I94B 3OUFA 2A3QA 2VS0A 4KHPB 5E1AC 1VF6C 1AI6A 5IYCO 1MG1A 3WFVA 1FOUA 5EBWC 1SQFA 2YIDA 1KYOF 3AG4B 2QTOA 2Q7HA 3RYIA 1Y74A 4ZI7A 3ASNB 3M8AA 3CS5A 5B66Z 1M57B 1V9PA 1IBKO 4JI5B 3CMEV 3BVOA 4GX1A 1IBMB 4R8CA 4U7NA 2WLIA 2LFSA 3T4ZA 2HHHB 1ZUQA 2NLJC 4CS2A 4WBNA 3NXSA 1N33O 5KA6A 1KD1W 1SQXH 3E8FA 1K92A 2GUZA 2Q5ZA 1GM7A 1OCOB 4LF5O 3QTCA 3RN4A 1P49A 2LJ2A 1E1QG 3CXHF 4JYBA 2ZM6O 3TXQA 4UFZA 4WFAV 2Y0PA 3BHPA 1X4TA 3A0HZ 2WLIB 5KX5A 3K0GA 2UU9O 3SJCC 1L0NH 4NXNB 1OV9A 3TXSA 2EILB 4OPHA 3RYFB 3H1IH 2PI5A 4CBCA 1N0JA 4LF5B 2Y48A 4TUYB 1JNBA 2GUZB 1YJNV 2EILC 2BSKA 5CBGA 2QA4V 1CPYA 3P3NA 4U3JA 4DR4B 2NN4A 1XMOB 2HHHO 2FTKA 2NNUA 4KUMA 2PF4E 1PP9H 5KX5B 4PD4F 2QR4A 2Q7EA 2UXDB 4O4HB 5LGNA 2XT9A 1NQTA 1N34O 2ZE8A 5FL7G 2YI9A 5BMVB 5B1BB 4DV1B 1XILA 2BSKB 1H2MA 3SYPA 5FPRA 1SQPH 3F7YC 5IT9N 4U3JB 5JVDA 3D36C 4B08A 4LR3A 3OM3B 2W0XA 4UB6Z 3OTOB 1SETA 3N2KB 2IJJA 4X1YA 4FM0A 4PDLA 5JJJB 3CD6V 4YY3B 2WPDG 4JYAB 4I7ZB 2GTSA 1EM1A 1MABG 1H8HG 5H9CA 1H2NA 4X9QA 1IX9A 1IBLB 2IU3A 1N32B 5JVDB 4UB8Z 2CAZC 4FFKA 5FNVA 1V55C 2RJZA 4B3SB 1JFFA 1XNRB 4DW1A 1PL0A 2JIZG 1BZKA 1YF2A 2XAGA 4X1YB 1Z2GA 1MOFA 5B3SB 2ZNIA 1G4YB 2ZCEA 2EULA 3K5OA 3OMIB 3DTUB 3PN1A 3C3SA 4CH5A 2M6YA 1IDSA 1WB7A 1Z5VA 4DV6O 2EIJB 3JATA 5DN6G 1I5YA 5AG2A 2UXBB 4NXMO 2PYJA 2WWWA 1LNQA 1R3JC 5EBLC 3STLC 4LF6O 3TGUH 2EBOA 3QO8A 3RT3C 1I08A 4YJ3B 1PKXA 1KU9A 4DUYB 3DXRA 5B1NA 1BSMA 5CBFA 2QE7G 5B3SC 3TCUA 3ASOC 1EZJA 2WSSG 3L75H 3MDSA 1E1RG 5D5QA 1Y76A 1YTFD 1XNQB 1GH6A 2LP7A 4LF9O 1SQGA 1K9MW 1D2DA 2HVKC 2UUCB 1T5EA 5IWAO 5LMNO 2YIBD 4FIPC 2W6IG 3QG5A 3A0RA 2CGNA 4YIOA 5D5PA 4Z1VA 2ZXWB 3ZBHA 3JCUZ 2EZOA 5EC1C 3OTOO 1QU7A 2RNBA 3FKSG 3B8MA 4R7CA 1DGSA 3OW2U 3H1KH 4OX9O 4IGGA 1FJGB 1XI1A 4LH6A 1NTMH 3L71H 2AHZA 3K5NA 3TETA 2ZINA 4EB6B 4K3AA 1NH2B 2P5OA 1Q86W 3F5TA 5J2TB 3ETDA 1HNWB 3Q4HB 3I55V 5KUMA 3WG7C 1OCZC 5KHJA 2KQXA 3AK2A 4X1IB 5LP6A 4FMTA 4DO2A 4DR4O 2IM9A 3W7WA 1F51A 4JI4B 1I7FA 4KFMA 3C90A 1XQ8A 3W7SA 1VQ6V 2QEXV 2OTJV 4EB6A 4BR6A 1NZ6A 2Q68A 2N04A 5JJNB 4FFBA 1RM1C 1NTZH 3Q4HA 2R70A 4X1IA 5BR8B 2GDSA 5LP6B 1BQZA 2D2CB 4O2AA 1CEZA 5DECA 4B7EA 3SJBC 4DXWA 4GKJO 4DV7B 4GKJB 1DF5A 1XREA 1AR1B 2EIJC 1B06A 3BEHA 4E2LA 3DGEA 4PDMA 1Q90D 3RWRD 2AW9A 2HR3A 4K0KB 5LGTA 2WLJA 4FLXA 4RQFA 1VF6A 2OT5A 1G6UA 4O2AB 4FM1A 4JI5O 3HKCB 4LFBB 2IW5A 2P4VA 2UXXA 1DF4A 1YTFB 1RSOA 1GN3A 3ETEA 4JI7B 1JMKC 4QIWF 4DR5B 3DSQA 1VQ8V 3AG7A 1J5EB 3LSUA 1KB9F 3K04A 4KXRA 4KHPO 1HNWO 3MAQA 5L3FA 5IY5B 1I94O 3L70H 1SA0B 3ZMVA 2UXCO 1AB3A 3B4SA 3CHXA 3WU2Z 2EIMB 1R3IC 2E3CA 4OGQB 3HKCA 2A7WA 1ZL8B 5JCOC 3G6BA 2X6CA 4P9PA 4AQYO 1PV0A 2JDIG 4W4LA 5HFLA 2OCCB 4UCVA 1Q6HA 2CGOA 2YEVB 4XBFA 5CN0A 1I5XA 5IJ9A 4TV9A 1GN2A 1N36B 1DLBA 1J95A 4Q6GA 1KECA 1SA0A 3BPZA 3SYAA 4JI6O 4DR7B 4UCRA 1IJGA 1K5SA 4DRXB 1QLEC 1ZL8A 2PUSA 4EFBA 2VQEO 3OUSA 3NR7A 4EEQA 1KKDA 3E86A 4LF9B 4JI7O 1FXVA 1ZTEA 3JSNA 1HDJA 3OMAB 3KZIZ 1H38A 2ZR2A 1D5AA 2YEVA 3EVKA 3DC5A 4MTFA 4FLZA 5LA6A 3ML0A 4BWAA 4TV9B 1XHXA 1OZ0A 3K79A 3EXAA 3AK3A 4OXSA 3WB0A 1GKFA 1S5JA 4YIPA 4QPJA 1FXKC 3I5DA 3WB1A 3AG3B 1BQ0A 2XAHA 2DWDC 2RMKB 1URFA 1F7YA 3SYOA 1M93A 4FK5C 1RM1B 3ZRWA 4PA7A 2EIMC 3WB2A 3F7VC 2D3OW 1JQ0A 2B5UA 3CC2V 5LA6B 2XHBA 1YZBA 5IY5C 3CX5F 3AEIA 1JJOA 3HKDB 1Q7YW 4PA4A 2MW2B 5KHGA 4FM2A 2NR5A 5CA0B 3TK1A 1AI4A 1SS3A 3L74H 4BW5A 3CCMV 2JRIA 2VQEB 3E83A 3ZHVA 1HR0B 2DW4A 2Q7GA 2JEXA 4TT3G 4DV2B 4I4TA 4ZOLA 2Y4UA 3A2FA 3ZRWB 3ZHSA 5EYPB 4J7KA 1XUQA 2HVJC 4IYIA 3ASOB 1MZFA 1L8DA 1P4RA 3UT5A 3HKDA 3CWBH 4U7OA 3OAAG 4GKKB 5CA0A 2H3OA 5LXTA 1NR1A 1VQ9V 3L73H 4UCSA 5IDJA 4JGSA 3OE7G 4JYAO 3UCSC 1WA8B 4CH3A 1VQNV 4JI8B 2UXCB 4JYCA 4ZOLB 3JAMN 2E5LO 2JVDA 3OMNB 4JAVA 5LYJB 1Q6UA 3K06A 1N0NA 4JI2B 4U3FH 2QWNB 2BE3A 2E76B 3SYQA 5LXTB 1R6KA 1LUWA 2R9AA 1AI5A 4B3MO 1QNMA 3ABTA 1P7BA 1VQOV 4LFBO 1KKCA 3RYHB 1VF5B 2BTQA 3JASA 1Q8IA 3K57A 4F6RB 4O4IB 2GV9A 4R6ZA 3G80A 4NVPA 4JI1B 5KMGB 3B09A 2A0LA 2P4KA 5L3BA 1QR8A 2EINC 1BT8A 4WFBV 3AG2B 1UFIA 3ABKC 4LWSA 1X59A 4IIJA 4HYOA 1YIJV 2DYSC 2VWKA 4LF6B 4Z2WA 4PI2A 1QBZA 2BTQB 3JASB 3N27A 1S5LZ 1IXBA 2Z3YA 1AR4A 5GTHZ 2OCCC 3P32A 1AILA 5KMGA 2UXBO 2P22C 5IYZB 4JF3A 1SESA 4DUZO 4X62O 2Q8VA 5LOVB 3CP1A 2H8PC 3P3PA 3ZHRA 1M5IA 3FX7A 4IIJB 1K33A 4GCZA 4X1KA 4MVRA 2QWQB 3CRQA 5J2UA 3DC6A 3BA9A 1KBHA 1W0JG 2ITDC 1SQVH 3K03A 4ICGA 4CH4A 5B1AB 3OGCC 4YJ2B 4H44B 2CH7B 1RFYA 3SJAC 2ZT9B 5KLVH 2FYUH 1N32O 5LOVA 1WLEA 4GUNA 4X66O 2JJ1G 3HPLC 4LP8A 2LQTA 4GX0A 4GZRB 4NKGB 1SZXA 4X1KB 4YHHB 1FYJA 2KKWA 3BY6A 2GBOA 2XOKG 5C93A 1HP8A 1GAXA 4O4LB 1B04A 2OIEA 5IE9A 3PJSK 4QJFB 1M56B 1VQ5V 4UVCA 2HFEC 1O9HA 4B3RO 1B3QA 2L6LA 2CH7A 1FFXA 4DR6O 3JD0A 4K35A 4YHHO 2EIKC 3P30A 5LMNB 2UUCO 3VOUA 4G2KA 2JGDA 3OT7A 2IJIA 4CS4A 1EN4A 5BXZA 2YIAA 4B7KA 3HKBA 1H2SB 4TSFG 2K1EA 2LW7A 1U96A 4GT1A 2QKAA 3N2GB 4IHJA 1K5QA 4O4LA 1YITV 1LUVA 3CEIA 2AXTZ 2YS8A 1Q43A 2KSDA 3KG2A 3OR7C 4KP4A 2F4VB 1YEWA 1IURA 4BIZA 1FFXB 3ZMUA 2EJ7A 4LBEC 1JA8A 1VF7A 3E8HA 1AJPA 4Z1MG 1SKVA 3BA8A 1JX9A 3RYIB 1US6A 3LNNA 1Y74B 4D7TA 2N05A 1WP7A 3CCJV 1IVSA 4IL6Z 1VMGA 2W6JG 4NXMB 5B1AC 4X65B 1OCZB 4MVQA 3ABLC 4MW8A 3QO5A 3IJ4A 4H13B 2Y0IA 1PNKA 4PA9A 1OJHA 3ZRXA 2QJ1A 3SGIA 4J41A 4WBNB 3R66A 1AVMA 4QNHB 2Y4TA 4MVOA 1MA1A 4J10A 2ZNJA 3CCLV 1XNRO 4JI1O 1WJZA 3OTFA 1RP3B 4MTXA 1BHAA 3ZCCA 3MD0A 1CXZB 4FLWA 4EFEA 4LFAO 2EX3A 4HBNA 3ZHQA 1FXKB 1K4DC 5C8YA 4MVUA 2PTMA 1IBMO 4X89A 3AG2C 2RCVA 1OCRB 1H2LA 4DK0A 1HW7A 3SPGA 4B3MB 1XOUA 3UQ8A 1PL4A 1SQQH 1PD3A 3T1YO 4JI2O 1TA8A 2A79B 2E74B 3FB8C 3JARB 4MSWC 3LUTB 4JPRA 4X66B 3HKEB 1QLEB 3EFFK 1AJQA 5GONA 5C8YB 4O4HA 2CE4A 2ZE5A 4JV5O 5L3DA 5BMVA 4BIOA 2ZDIA 3KKYA 3JSLA 4UUJC 1M1KW 2E75B 4MTOA 2UUAO 4DW0A 2ZR3A 2WLNA 2B9ZA 1QR9A 3JARA 3CMAV 4DV3B 1ZAUA 4DV5O 1KC8W 3RFRA 2X7RB 2CTQA 2JJ2G 1GN4A 4RO2A 4LC1A 4DYLA 1HR0O 1SQBH 2IBZH 2DQ3A 2CTWA 1K34A 1S76D 2DJVA 1PM9A 3SDLA 1W0KG 1JOYA 2UU9B 4MW3A 1COWG 1P84F 4P9OA 4UCOA 5FNVB 5KHHA 1PNMA 1JFFB 1TUEB 3CC7V 2LGQA 1Q5OA 5LBQA 2C2AA 3SR2C 4H0LB 4UVAA 4R50A 3GB7C 3OEEG 2DYSB 2AZ2A 2OTLV 3FB6C 4MVMA 2F4VO 1TAEA 3FB5C 2PGGA 1VQMV 2DN9A 2XTAA 3JATB 4J11A 1IBKB 1Y66A 4RAIA 4UVBA 3JAKB 4MS2A 1FPOA 2YXLA 4ZBMA 4PJ0Z 2OCHA 3L72H 1N8RW 3A0BZ 4QE9A 5LHIA 4DR6B 4F6EA 4DR7O 3K58A 4JI0O 1UJWB 3VBBA 3K5LA 3E35A 3BCCH 3E89A 1YXBA 2LGWA 4CS3A 3UO2A 2F93B 4TV8A 4I5SA 4QPKA 1NI8A 5ITZA 3FYIB 5FPOA 1K3EA 3LSSA 2VQFO 3ABKB 1U97A 5A2QN 5JQGB 4TOIA 4ZHQA 2RN9A 3ZX6A 2WA4A 4CC5A 3D8CA 4CZZA 3LSQA 2QM8A 2QM4A 1Q3EA 1KP3A 1ZWIC 3CC4V 4JI0B 2XAFA 5IJ0A 2M7WA 4TV8B 1EBOA 3FAVB 5EZYB 4RUFA 1Z5WA 1NTKH 1M90W 5JQGA 1OCOC 1F4NA 4FLUA 4UXNA 1R6TA 5A9GA 4DUZB 5EK0A 1Q81W 1SC5B 1ROPA 5J2TA 2WAMA 2XAQA 5IJ0B 3CPWU 2JS3A 5IYBO 2QWRB 2Q9LA 3ABMC 3FAVA 2EIKB 5EZYA 5LHGA 3X2QB 1BCCH 2PY5A 3SYCA 1S0VA 4JTCB 1B6QA 2IH3C 5B1OA 1BS3A 2ZQMA 5H5NA 2X0LA 4JI3B 2F95B 4FFBB 5BR8O 1EFRG 1WN7A 4MT8A 5F2VO 2OWOA 4I50B 1NS1A 2Q6AA 1S72V 4JI6B 3T2MA 3CYOA 3B40A 4O2BA 1H5WA 2DWEC 2G38A 4BIUA 2DYRC 4I9QA 2GSMB 1Y67A 3J80N 4CC6A 3JD1A 3JYCA 2FMLA 3K9AA 4JAAA 1WPBA 3G67A 1XBLA 5B5EZ 2V4DA 1M56C 4B3TO 2YIBA 2KB1A 3APQA 3M99B 4JI8O 3ZN1A 1IZ3A 5KAIZ 4O2BB 1QVFU 1VEWA 1S5HC 1EN5A 2OIGA 5JH7B 1YVWA 2QGNA 1RSOB 1J5EO 4OX9B 4GKKO 2ILMA 1Y6XA 1HNXB 1AJNA 1NR7A 2RQ6A 2ZDIC 5FLXN 2PZSA 3LDEA 1AP6A 1GO3F 3CRMA 3HR0A 4DR3B 1WPXA 3T1HB 1XL4A 2FB5A 2CUGA 2Q4PA 4GLXA 2F23A 4DV0B 4LF8O 4X64B 5JH7A 3IAYA 2YUAA 3ABUA 2CTRA 3U0ZA 1VP7A 3RYFA 1PNLA 4TUYA 2Q69A 1ORQC 2UUBB 1O9GA 1NU1H 4JAUA 4QGPA 3RYCB 1R6NA 2AHYA 2QSAA 4J9YB 4I9WA 2HLDG 2QTSA 1TGOA 3CSXA 3S3WA 3ETQA 5B1BC 2WLLB 4J7JA 4DR1B 2YXHA 3KDRA 1EN6A 5LMUO 1GM8A 5LL6Y 5IYDO 3U10A 4LF4B 1NVPB 4HNAB 3JCZA 4QE7A 1H8EG 3LDDA 2DMXA 3FD9A 2YDEA 1NT2B 2BOBC 1ENVA 3ETGA 4G27B 4DV6B 3E8BA 4KL1A 3RYCA 4JI4O 4NB5A 4IYHA 4ABMA 1QHTA 3CCUV 2EJRA 2WLLA 2BCCH 2DQ0A 5EC2C 3CB2A 3J7AU 4FLVA 2F43G 3N2KA 4H33A 3FB7C 4HNAA 3H1HH 1M4UA 1N36O 3AK1A 4I0XA 4N23A 2A06H 4C7UA 3CXCU 1IBLO 2R72A 3ZHUA 2AZ0A 1YSCA 2ARHA 1BE3H 4AQYB 1NVPD 4LFCO 1VQ7V 4B3RB 2XUMA 2Y69B 4YY3O 1HWYA 2FKXA 3F5WC 5E79Z 1K8AW 5KHKA 4I4TB 4XDLA 4ASUG 2YSUB 5EYPA 4I0XB 2X6AA 3J81N 5EIBC 2FL4A 4DR5O 4FLYA 4NYKA 1HNZO 4WFHA 3SPHA 1WB8A 1S77D 1XNQO 2W0FC 3LNMB 5KHIA 4WFEA 1Q6IA 1WNSA 1QQCA 2X6BA 1WA8A 3WG7B 1N34B 1D5NA 3QF7A 3L9DA 1YCIA 1IXMA 1JVMA 2N74A 5DM6V 2UXDO 1JCHA 4GX5A 4H37A 3ZJZA 1XEQA 4K8ZA 1N4CA 1E79G 4YJ3A 4K0KO 3ZHTA 1R3LC 2F66C 4N21A 4D7SA 3DXRB 5LGUA 5CA1B 4ZIBA 2YXYA 1LR1A 3K59A 1WAZA 4DV7O 1VQ4V 1XL6A 3ZMZA 1Y76B 2ADQB 4JZGA 1W2BU 4LF4O 3H01A 4DR2B 2CK3G 5GTIZ 4BW9A 4JASA 1AR5A 2QKCA 3D36A 3UKMA 4UV9A 1MMMA 1NJIW 3T1CA 4O4IA 4DR2O 5BY1A 1ZSPA 1KMIZ 3VQYA 3BRCA 4GX2A 5JJEB 5CA1A 1EZVH 4LNUA 3ICXA
chains in the Genus database with same CATH topology
4C7UA 1AVMA 1XDCA 1ZLZA 2ADPA 1I08A 2CDYA 1MA1A 1AP6A 1GN6A 2GDSA 5A9GA 1AP5A 4GUNA 1BSMA 1ZTEA 1N0NA 1XILA 4JYYA 1SZXA 3TJTA 3EVKA 3DC5A 3MDSA 1LUWA 1XREA 1QNMA 1B06A 1P7GA 2RCVA 3AK3A 2AW9A 1KKCA 4YIPA 1PL4A 1WB8A 1MSDA 4YIOA 1BS3A 1EM1A 3C3TA 3OT7A 1EN4A 4E4EA 4JZ2A 1D5NA 1VARA 1JR9A 4X9QA 1ZUQA 1IX9A 3K9SA 2P4KA 1GN3A 1MNGA 4F6EA 1BT8A 3KDRA 2QKAA 2CE4A 1EN6A 1LUVA 3CEIA 4FFKA 3LSUA 3RN4A 3IC9A 3QVNA 3KKYA 1JA8A 1Y67A 3BFRA 1IXBA 2ADQB 4JZGA 1AR4A 1XUQA 3C3SA 3AK2A 1IDSA 1WB7A 1AR5A 1N0JA 1GN4A 2QKCA 1MMMA 5AG2A 1ZSPA 1GN2A 1VEWA 3DC6A 4BR6A 1EN5A 3AK1A 1I0HA 1PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7U A;  1AVM A;  1XDC A;  1ZLZ A;  2ADP A;  1I08 A;  2CDY A;  1MA1 A;  1AP6 A;  1GN6 A;  2GDS A;  5A9G A;  1AP5 A;  4GUN A;  1BSM A;  1ZTE A;  1N0N A;  1XIL A;  4JYY A;  1SZX A;  3TJT A;  3EVK A;  3DC5 A;  3MDS A;  1LUW A;  1XRE A;  1QNM A;  1B06 A;  1P7G A;  2RCV A;  3AK3 A;  2AW9 A;  1KKC A;  4YIP A;  1PL4 A;  1WB8 A;  1MSD A;  4YIO A;  1BS3 A;  1EM1 A;  3C3T A;  3OT7 A;  1EN4 A;  4E4E A;  4JZ2 A;  1D5N A;  1VAR A;  1JR9 A;  4X9Q A;  1ZUQ A;  1IX9 A;  3K9S A;  2P4K A;  1GN3 A;  1MNG A;  4F6E A;  1BT8 A;  2QKA A;  2CE4 A;  1EN6 A;  1LUV A;  3CEI A;  4FFK A;  3LSU A;  3RN4 A;  3IC9 A;  3QVN A;  3KKY A;  1JA8 A;  1Y67 A;  3BFR A;  1IXB A;  2ADQ B;  4JZG A;  1AR4 A;  1XUQ A;  3C3S A;  3AK2 A;  1IDS A;  1WB7 A;  1AR5 A;  1N0J A;  1GN4 A;  2QKC A;  1MMM A;  5AG2 A;  1ZSP A;  1GN2 A;  1VEW A;  3DC6 A;  4BR6 A;  1EN5 A;  3AK1 A;  1I0H A;  1PM9 A; 
#chains in the Genus database with same CATH topology
 1JPX A;  4A5U B;  1THZ A;  4XDK A;  5H6R A;  1G1X B;  3M7M X;  1N33 B;  1XDC A;  1YDX A;  4HAM A;  4DV3 O;  1ARO P;  1AI7 A;  2PYL A;  3BAB A;  5EIB D;  4MVS A;  1BL8 A;  4DV0 O;  4FPP A;  2EIN B;  4JYY A;  3TJT A;  3AG1 C;  3T1H O;  2HP8 A;  4LNU B;  2Q0O C;  4NR1 A;  1L1F A;  4DR3 O;  4OPA A;  1RPR A;  5CBH A;  3SPC A;  1F23 A;  2RDC A;  3CCE V;  3UM7 A;  3E2E A;  1K73 W;  4FVM A;  2IJK A;  4PA3 A;  2P7T C;  4L87 A;  5J2U B;  2BTO A;  3OEH G;  1K97 A;  3KCX A;  3RBZ A;  2LFR A;  2E5L B;  1FKA O;  3GWK C;  2XND G;  2QWO B;  1BHB A;  4K8X A;  4HZ3 A;  1JR9 A;  2K9P A;  1TVK A;  1MNG A;  3CCQ V;  3E22 B;  1YJW V;  5GW7 A;  4ZKI A;  3QNE A;  2B1I A;  5LP6 C;  3GVM A;  4LH7 A;  1V55 B;  4J9Z B;  4LFA B;  1UPG A;  2IH1 C;  3MHS C;  4Q20 A;  1OCC B;  1NBM G;  3QVN A;  4FZ1 A;  1WP8 A;  4TQD A;  2BOC C;  1H2K A;  2ITC C;  2YIC A;  2ATK C;  3AG1 B;  3ASN C;  4X20 B;  3UO3 A;  1TUB A;  1TVK B;  3ZRS A;  1KQS U;  3E22 A;  2L35 A;  4G28 B;  4O4J A;  3K5M A;  1DK1 A;  1XMQ O;  3THO A;  1NH2 D;  1YHQ V;  2Z0A A;  4JI3 O;  1L0L H;  1FD9 A;  5KA5 A;  3RW0 A;  4P30 A;  1I0H A;  4X65 O;  4WFG A;  3G6E V;  1XHZ A;  3HKB B;  2P90 A;  3JAL B;  2WLK A;  3CRR A;  3N2G A;  2Q73 A;  2ADP A;  4NTY A;  4DV4 O;  5LHH A;  2CDY A;  4X20 A;  1TUB B;  5LMU B;  1G8M A;  4DR1 O;  5L3E A;  4W4K A;  3D3I A;  4O4J B;  2ZE7 A;  4AI8 A;  2JGU A;  5L3G A;  2UUB O;  1P7G A;  2R9I A;  3JAL A;  2O57 A;  3APO A;  2KG7 B;  2MK3 A;  3VQX A;  2XAJ A;  3AG3 C;  5H6Q A;  3JD4 A;  2XAS A;  2JK5 C;  5CA3 A;  1HNZ B;  1FXH A;  3O9O A;  2ZE6 A;  2YI8 A;  5CB4 A;  1VQL V;  3CE2 A;  2ZKO A;  2WLH A;  5IJ9 B;  3ABL B;  1K7D A;  2QWP B;  1V54 B;  2OYQ A;  3G71 V;  4LF7 O;  2B1G A;  4DRX A;  1BGY H;  4FZ0 A;  1BMF G;  3STZ C;  2QKS A;  2KG7 A;  4LFC B;  2QM7 A;  1QCE A;  3IC9 A;  3K3W A;  4PHZ A;  4L8J A;  3MHH C;  4RWU A;  3ZRV A;  3K0D A;  5CB4 B;  1QLN A;  1FXK A;  4DV1 O;  4NTW A;  3H1L H;  2DYR B;  3ABM B;  2WLM A;  3RGB A;  1KP2 A;  1VIB A;  4MVZ A;  2UXN A;  4BAY A;  1MZE A;  2P67 A;  3B77 A;  2DOS A;  3ZMS A;  5K1P A;  1GRJ A;  3JAW B;  2HEP A;  1GM9 A;  2H94 A;  1S3J A;  3ZED A;  4EKW A;  1A32 A;  3AG4 C;  3HB3 B;  4GYC B;  3B8N A;  3FYE B;  5DED A;  1XMO O;  4XDJ A;  3HKE A;  4WFF A;  3CCR V;  5GON B;  4X62 B;  1ZLZ A;  3K08 A;  3IFX A;  2HKO A;  1V54 C;  4AIL C;  4RUE A;  3W7T A;  3KCY A;  1GN6 A;  3SPJ A;  1AP5 A;  3E8G A;  1VQP V;  4NXN O;  3VQW A;  3JAW A;  5BZB A;  1F4M A;  1CP9 A;  3GWO A;  1R1B A;  2HJD A;  3CRA A;  3I56 V;  2ZM6 B;  1PPJ H;  1ZX3 A;  2AGA A;  2LO1 A;  1MSW D;  1OCR C;  5TIS Z;  4X8A A;  3UT5 B;  1KUQ A;  1MSD A;  2VWJ A;  2CTP A;  4AHC A;  5JCO A;  3R65 A;  4IT5 A;  1GTO A;  3B2E E;  4FJC C;  4X88 A;  3W7X A;  1SER A;  4PI0 A;  5K1X A;  3C3T A;  1Q82 W;  4X64 O;  1M9N A;  2P6J A;  3H1J H;  3JD3 A;  1RPO A;  2ETN A;  4LF8 B;  1VAR A;  3CRC A;  5EBM C;  3SJQ C;  2P06 A;  1OHH G;  4DV5 B;  2QDO A;  3RVZ A;  4RQE A;  4TWK A;  3SPI A;  5LYJ A;  4PDV A;  4UV8 A;  2UUA B;  2GTA A;  1HNX O;  4UCU A;  1JJ2 U;  3ZS8 C;  3FFQ A;  5KUK A;  3ZMT A;  2ZD9 A;  4FLT A;  3OR6 C;  3ZN0 A;  4JV5 B;  4I55 A;  2V7Q G;  2WA3 A;  3OFN G;  4B3T B;  4UCT A;  3JAK A;  3A8T A;  3IC7 A;  3RYH A;  2F1M A;  5J9P C;  1H2G A;  1FJG O;  2DE0 X;  2ZIO A;  4F6R A;  3VQV A;  2VQF B;  1R3K C;  2LW1 A;  3T1Y B;  4MTG A;  1NKD A;  3O65 A;  4JTA B;  4P2Z A;  1OCC C;  2GHY A;  4WCE V;  2Y69 C;  1QVG U;  2HG5 C;  4J7Z A;  1SF9 A;  4CH6 A;  2V1D A;  4LWS B;  3EHB B;  4DV2 O;  4I55 B;  5ITZ B;  5IWA B;  1GK9 A;  5L3C A;  2PI4 A;  1YJ9 V;  4JTD B;  2YC0 A;  2HJF C;  4J80 A;  2ODM A;  3D3Q A;  2ZXW C;  3OGI B;  1VQK V;  2VRZ A;  3H9V A;  5IYZ A;  4ZHQ B;  1K4C C;  5HFM A;  1FFT B;  4NTX A;  4DK1 A;  1GMG A;  2JEU A;  3W7U A;  1M57 C;  4F4L A;  4DUY O;  3ZIA G;  3BAA A;  3QO7 A;  1SZT A;  5JWP A;  4PDR A;  3CCV V;  4E4E A;  4JZ2 A;  3LDC A;  3S3X A;  1DTO A;  3K9S A;  4DV4 B;  5CMU A;  4YJ2 A;  2JS5 A;  3CJH A;  4PA6 A;  3X2Q C;  2Q67 A;  1XMQ B;  1YI2 V;  1FS0 G;  5KAF Z;  1SRY A;  3G4S V;  3BFR A;  4WF9 V;  4PEL A;  4PV1 B;  3T4D A;  4LCU C;  4TQF A;  2IU0 A;  1R73 A;  1Y4M A;  4B3S O;  4D6T H;  3CJH B;  3U11 A;  4J42 A;  2A9H A;  1W59 A;  2R9R B;  1FAF A;  3CCS V;  2JGD B;  4YXW G;  2ZIM A;  3OD4 A;  2Q0A A;  3RVY A;  4ZI7 B;  2EZP A;  3IGA C;  4I50 A;  3JD2 A;  2IJH A;  2Z5U A;  4IHJ B;  5H2F Z;  4LF7 B;  1I94 B;  3OUF A;  2A3Q A;  2VS0 A;  4KHP B;  5E1A C;  1VF6 C;  1AI6 A;  5IYC O;  1MG1 A;  3WFV A;  1FOU A;  5EBW C;  1SQF A;  2YID A;  1KYO F;  3AG4 B;  2QTO A;  2Q7H A;  3RYI A;  1Y74 A;  4ZI7 A;  3ASN B;  3M8A A;  3CS5 A;  5B66 Z;  1M57 B;  1V9P A;  1IBK O;  4JI5 B;  3CME V;  3BVO A;  4GX1 A;  1IBM B;  4R8C A;  4U7N A;  2WLI A;  2LFS A;  3T4Z A;  2HHH B;  1ZUQ A;  2NLJ C;  4CS2 A;  4WBN A;  3NXS A;  1N33 O;  5KA6 A;  1KD1 W;  1SQX H;  3E8F A;  1K92 A;  2GUZ A;  2Q5Z A;  1GM7 A;  1OCO B;  4LF5 O;  3QTC A;  3RN4 A;  1P49 A;  2LJ2 A;  1E1Q G;  3CXH F;  4JYB A;  2ZM6 O;  3TXQ A;  4UFZ A;  4WFA V;  2Y0P A;  3BHP A;  1X4T A;  3A0H Z;  2WLI B;  5KX5 A;  3K0G A;  2UU9 O;  3SJC C;  1L0N H;  4NXN B;  1OV9 A;  3TXS A;  2EIL B;  4OPH A;  3RYF B;  3H1I H;  2PI5 A;  4CBC A;  1N0J A;  4LF5 B;  2Y48 A;  4TUY B;  1JNB A;  2GUZ B;  1YJN V;  2EIL C;  2BSK A;  5CBG A;  2QA4 V;  1CPY A;  3P3N A;  4U3J A;  4DR4 B;  2NN4 A;  1XMO B;  2HHH O;  2FTK A;  2NNU A;  4KUM A;  2PF4 E;  1PP9 H;  5KX5 B;  4PD4 F;  2QR4 A;  2Q7E A;  2UXD B;  4O4H B;  5LGN A;  2XT9 A;  1NQT A;  1N34 O;  2ZE8 A;  5FL7 G;  2YI9 A;  5BMV B;  5B1B B;  4DV1 B;  1XIL A;  2BSK B;  1H2M A;  3SYP A;  5FPR A;  1SQP H;  3F7Y C;  5IT9 N;  4U3J B;  5JVD A;  3D36 C;  4B08 A;  4LR3 A;  3OM3 B;  2W0X A;  4UB6 Z;  3OTO B;  1SET A;  3N2K B;  2IJJ A;  4X1Y A;  4FM0 A;  4PDL A;  5JJJ B;  3CD6 V;  4YY3 B;  2WPD G;  4JYA B;  4I7Z B;  2GTS A;  1EM1 A;  1MAB G;  1H8H G;  5H9C A;  1H2N A;  4X9Q A;  1IX9 A;  1IBL B;  2IU3 A;  1N32 B;  5JVD B;  4UB8 Z;  2CAZ C;  4FFK A;  5FNV A;  1V55 C;  2RJZ A;  4B3S B;  1JFF A;  1XNR B;  4DW1 A;  1PL0 A;  2JIZ G;  1BZK A;  1YF2 A;  2XAG A;  4X1Y B;  1Z2G A;  1MOF A;  5B3S B;  2ZNI A;  1G4Y B;  2ZCE A;  2EUL A;  3K5O A;  3OMI B;  3DTU B;  3PN1 A;  3C3S A;  4CH5 A;  2M6Y A;  1IDS A;  1WB7 A;  1Z5V A;  4DV6 O;  2EIJ B;  3JAT A;  5DN6 G;  1I5Y A;  5AG2 A;  2UXB B;  4NXM O;  2PYJ A;  2WWW A;  1LNQ A;  1R3J C;  5EBL C;  3STL C;  4LF6 O;  3TGU H;  2EBO A;  3QO8 A;  3RT3 C;  1I08 A;  4YJ3 B;  1PKX A;  1KU9 A;  4DUY B;  3DXR A;  5B1N A;  1BSM A;  5CBF A;  2QE7 G;  5B3S C;  3TCU A;  3ASO C;  1EZJ A;  2WSS G;  3L75 H;  3MDS A;  1E1R G;  5D5Q A;  1Y76 A;  1YTF D;  1XNQ B;  1GH6 A;  2LP7 A;  4LF9 O;  1SQG A;  1K9M W;  1D2D A;  2HVK C;  2UUC B;  1T5E A;  5IWA O;  5LMN O;  2YIB D;  4FIP C;  2W6I G;  3QG5 A;  3A0R A;  2CGN A;  4YIO A;  5D5P A;  4Z1V A;  2ZXW B;  3ZBH A;  3JCU Z;  2EZO A;  5EC1 C;  3OTO O;  1QU7 A;  2RNB A;  3FKS G;  3B8M A;  4R7C A;  1DGS A;  3OW2 U;  3H1K H;  4OX9 O;  4IGG A;  1FJG B;  1XI1 A;  4LH6 A;  1NTM H;  3L71 H;  2AHZ A;  3K5N A;  3TET A;  2ZIN A;  4EB6 B;  4K3A A;  1NH2 B;  2P5O A;  1Q86 W;  3F5T A;  5J2T B;  3ETD A;  1HNW B;  3Q4H B;  3I55 V;  5KUM A;  3WG7 C;  1OCZ C;  5KHJ A;  2KQX A;  3AK2 A;  4X1I B;  5LP6 A;  4FMT A;  4DO2 A;  4DR4 O;  2IM9 A;  3W7W A;  1F51 A;  4JI4 B;  1I7F A;  4KFM A;  3C90 A;  1XQ8 A;  3W7S A;  1VQ6 V;  2QEX V;  2OTJ V;  4EB6 A;  4BR6 A;  1NZ6 A;  2Q68 A;  2N04 A;  5JJN B;  4FFB A;  1RM1 C;  1NTZ H;  3Q4H A;  2R70 A;  4X1I A;  5BR8 B;  2GDS A;  5LP6 B;  1BQZ A;  2D2C B;  4O2A A;  1CEZ A;  5DEC A;  4B7E A;  3SJB C;  4DXW A;  4GKJ O;  4DV7 B;  4GKJ B;  1DF5 A;  1XRE A;  1AR1 B;  2EIJ C;  1B06 A;  3BEH A;  4E2L A;  3DGE A;  4PDM A;  1Q90 D;  3RWR D;  2AW9 A;  2HR3 A;  4K0K B;  5LGT A;  2WLJ A;  4FLX A;  4RQF A;  1VF6 A;  2OT5 A;  1G6U A;  4O2A B;  4FM1 A;  4JI5 O;  3HKC B;  4LFB B;  2IW5 A;  2P4V A;  2UXX A;  1DF4 A;  1YTF B;  1RSO A;  1GN3 A;  3ETE A;  4JI7 B;  1JMK C;  4QIW F;  4DR5 B;  3DSQ A;  1VQ8 V;  3AG7 A;  1J5E B;  3LSU A;  1KB9 F;  3K04 A;  4KXR A;  4KHP O;  1HNW O;  3MAQ A;  5L3F A;  5IY5 B;  1I94 O;  3L70 H;  1SA0 B;  3ZMV A;  2UXC O;  1AB3 A;  3B4S A;  3CHX A;  3WU2 Z;  2EIM B;  1R3I C;  2E3C A;  4OGQ B;  3HKC A;  2A7W A;  1ZL8 B;  5JCO C;  3G6B A;  2X6C A;  4P9P A;  4AQY O;  1PV0 A;  2JDI G;  4W4L A;  5HFL A;  2OCC B;  4UCV A;  1Q6H A;  2CGO A;  2YEV B;  4XBF A;  5CN0 A;  1I5X A;  5IJ9 A;  4TV9 A;  1GN2 A;  1N36 B;  1DLB A;  1J95 A;  4Q6G A;  1KEC A;  1SA0 A;  3BPZ A;  3SYA A;  4JI6 O;  4DR7 B;  4UCR A;  1IJG A;  1K5S A;  4DRX B;  1QLE C;  1ZL8 A;  2PUS A;  4EFB A;  2VQE O;  3OUS A;  3NR7 A;  4EEQ A;  1KKD A;  3E86 A;  4LF9 B;  4JI7 O;  1FXV A;  1ZTE A;  3JSN A;  1HDJ A;  3OMA B;  3KZI Z;  1H38 A;  2ZR2 A;  1D5A A;  2YEV A;  3EVK A;  3DC5 A;  4MTF A;  4FLZ A;  5LA6 A;  3ML0 A;  4BWA A;  4TV9 B;  1XHX A;  1OZ0 A;  3K79 A;  3EXA A;  3AK3 A;  4OXS A;  3WB0 A;  1GKF A;  1S5J A;  4YIP A;  4QPJ A;  1FXK C;  3I5D A;  3WB1 A;  3AG3 B;  1BQ0 A;  2XAH A;  2DWD C;  2RMK B;  1URF A;  1F7Y A;  3SYO A;  1M93 A;  4FK5 C;  1RM1 B;  3ZRW A;  4PA7 A;  2EIM C;  3WB2 A;  3F7V C;  2D3O W;  1JQ0 A;  2B5U A;  3CC2 V;  5LA6 B;  2XHB A;  1YZB A;  5IY5 C;  3CX5 F;  3AEI A;  1JJO A;  3HKD B;  1Q7Y W;  4PA4 A;  2MW2 B;  5KHG A;  4FM2 A;  2NR5 A;  5CA0 B;  3TK1 A;  1AI4 A;  1SS3 A;  3L74 H;  4BW5 A;  3CCM V;  2JRI A;  2VQE B;  3E83 A;  3ZHV A;  1HR0 B;  2DW4 A;  2Q7G A;  2JEX A;  4TT3 G;  4DV2 B;  4I4T A;  4ZOL A;  2Y4U A;  3A2F A;  3ZRW B;  3ZHS A;  5EYP B;  4J7K A;  1XUQ A;  2HVJ C;  4IYI A;  3ASO B;  1MZF A;  1L8D A;  1P4R A;  3UT5 A;  3HKD A;  3CWB H;  4U7O A;  3OAA G;  4GKK B;  5CA0 A;  2H3O A;  5LXT A;  1NR1 A;  1VQ9 V;  3L73 H;  4UCS A;  5IDJ A;  4JGS A;  3OE7 G;  4JYA O;  3UCS C;  1WA8 B;  4CH3 A;  1VQN V;  4JI8 B;  2UXC B;  4JYC A;  4ZOL B;  3JAM N;  2E5L O;  2JVD A;  3OMN B;  4JAV A;  5LYJ B;  1Q6U A;  3K06 A;  1N0N A;  4JI2 B;  4U3F H;  2QWN B;  2BE3 A;  2E76 B;  3SYQ A;  5LXT B;  1R6K A;  1LUW A;  2R9A A;  1AI5 A;  4B3M O;  1QNM A;  3ABT A;  1P7B A;  1VQO V;  4LFB O;  1KKC A;  3RYH B;  1VF5 B;  2BTQ A;  3JAS A;  1Q8I A;  3K57 A;  4F6R B;  4O4I B;  2GV9 A;  4R6Z A;  3G80 A;  4NVP A;  4JI1 B;  5KMG B;  3B09 A;  2A0L A;  2P4K A;  5L3B A;  1QR8 A;  2EIN C;  1BT8 A;  4WFB V;  3AG2 B;  1UFI A;  3ABK C;  4LWS A;  1X59 A;  4IIJ A;  4HYO A;  1YIJ V;  2DYS C;  2VWK A;  4LF6 B;  4Z2W A;  4PI2 A;  1QBZ A;  2BTQ B;  3JAS B;  3N27 A;  1S5L Z;  1IXB A;  2Z3Y A;  1AR4 A;  5GTH Z;  2OCC C;  3P32 A;  1AIL A;  5KMG A;  2UXB O;  2P22 C;  5IYZ B;  4JF3 A;  1SES A;  4DUZ O;  4X62 O;  2Q8V A;  5LOV B;  3CP1 A;  2H8P C;  3P3P A;  3ZHR A;  1M5I A;  3FX7 A;  4IIJ B;  1K33 A;  4GCZ A;  4X1K A;  4MVR A;  2QWQ B;  3CRQ A;  5J2U A;  3DC6 A;  3BA9 A;  1KBH A;  1W0J G;  2ITD C;  1SQV H;  3K03 A;  4ICG A;  4CH4 A;  5B1A B;  3OGC C;  4YJ2 B;  4H44 B;  2CH7 B;  1RFY A;  3SJA C;  2ZT9 B;  5KLV H;  2FYU H;  1N32 O;  5LOV A;  1WLE A;  4GUN A;  4X66 O;  2JJ1 G;  3HPL C;  4LP8 A;  2LQT A;  4GX0 A;  4GZR B;  4NKG B;  1SZX A;  4X1K B;  4YHH B;  1FYJ A;  2KKW A;  3BY6 A;  2GBO A;  2XOK G;  5C93 A;  1HP8 A;  1GAX A;  4O4L B;  1B04 A;  2OIE A;  5IE9 A;  3PJS K;  4QJF B;  1M56 B;  1VQ5 V;  4UVC A;  2HFE C;  1O9H A;  4B3R O;  1B3Q A;  2L6L A;  2CH7 A;  1FFX A;  4DR6 O;  3JD0 A;  4K35 A;  4YHH O;  2EIK C;  3P30 A;  5LMN B;  2UUC O;  3VOU A;  4G2K A;  2JGD A;  3OT7 A;  2IJI A;  4CS4 A;  1EN4 A;  5BXZ A;  2YIA A;  4B7K A;  3HKB A;  1H2S B;  4TSF G;  2K1E A;  2LW7 A;  1U96 A;  4GT1 A;  2QKA A;  3N2G B;  4IHJ A;  1K5Q A;  4O4L A;  1YIT V;  1LUV A;  3CEI A;  2AXT Z;  2YS8 A;  1Q43 A;  2KSD A;  3KG2 A;  3OR7 C;  4KP4 A;  2F4V B;  1YEW A;  1IUR A;  4BIZ A;  1FFX B;  3ZMU A;  2EJ7 A;  4LBE C;  1JA8 A;  1VF7 A;  3E8H A;  1AJP A;  4Z1M G;  1SKV A;  3BA8 A;  1JX9 A;  3RYI B;  1US6 A;  3LNN A;  1Y74 B;  4D7T A;  2N05 A;  1WP7 A;  3CCJ V;  1IVS A;  4IL6 Z;  1VMG A;  2W6J G;  4NXM B;  5B1A C;  4X65 B;  1OCZ B;  4MVQ A;  3ABL C;  4MW8 A;  3QO5 A;  3IJ4 A;  4H13 B;  2Y0I A;  1PNK A;  4PA9 A;  1OJH A;  3ZRX A;  2QJ1 A;  3SGI A;  4J41 A;  4WBN B;  3R66 A;  1AVM A;  4QNH B;  2Y4T A;  4MVO A;  1MA1 A;  4J10 A;  2ZNJ A;  3CCL V;  1XNR O;  4JI1 O;  1WJZ A;  3OTF A;  1RP3 B;  4MTX A;  1BHA A;  3ZCC A;  3MD0 A;  1CXZ B;  4FLW A;  4EFE A;  4LFA O;  2EX3 A;  4HBN A;  3ZHQ A;  1FXK B;  1K4D C;  5C8Y A;  4MVU A;  2PTM A;  1IBM O;  4X89 A;  3AG2 C;  2RCV A;  1OCR B;  1H2L A;  4DK0 A;  1HW7 A;  3SPG A;  4B3M B;  1XOU A;  3UQ8 A;  1PL4 A;  1SQQ H;  1PD3 A;  3T1Y O;  4JI2 O;  1TA8 A;  2A79 B;  2E74 B;  3FB8 C;  3JAR B;  4MSW C;  3LUT B;  4JPR A;  4X66 B;  3HKE B;  1QLE B;  3EFF K;  1AJQ A;  5GON A;  5C8Y B;  4O4H A;  2CE4 A;  2ZE5 A;  4JV5 O;  5L3D A;  5BMV A;  4BIO A;  2ZDI A;  3KKY A;  3JSL A;  4UUJ C;  1M1K W;  2E75 B;  4MTO A;  2UUA O;  4DW0 A;  2ZR3 A;  2WLN A;  2B9Z A;  1QR9 A;  3JAR A;  3CMA V;  4DV3 B;  1ZAU A;  4DV5 O;  1KC8 W;  3RFR A;  2X7R B;  2CTQ A;  2JJ2 G;  1GN4 A;  4RO2 A;  4LC1 A;  4DYL A;  1HR0 O;  1SQB H;  2IBZ H;  2DQ3 A;  2CTW A;  1K34 A;  1S76 D;  2DJV A;  1PM9 A;  3SDL A;  1W0K G;  1JOY A;  2UU9 B;  4MW3 A;  1COW G;  1P84 F;  4P9O A;  4UCO A;  5FNV B;  5KHH A;  1PNM A;  1JFF B;  1TUE B;  3CC7 V;  2LGQ A;  1Q5O A;  5LBQ A;  2C2A A;  3SR2 C;  4H0L B;  4UVA A;  4R50 A;  3GB7 C;  3OEE G;  2DYS B;  2AZ2 A;  2OTL V;  3FB6 C;  4MVM A;  2F4V O;  1TAE A;  3FB5 C;  2PGG A;  1VQM V;  2DN9 A;  2XTA A;  3JAT B;  4J11 A;  1IBK B;  1Y66 A;  4RAI A;  4UVB A;  3JAK B;  4MS2 A;  1FPO A;  2YXL A;  4ZBM A;  4PJ0 Z;  2OCH A;  3L72 H;  1N8R W;  3A0B Z;  4QE9 A;  5LHI A;  4DR6 B;  4F6E A;  4DR7 O;  3K58 A;  4JI0 O;  1UJW B;  3VBB A;  3K5L A;  3E35 A;  3BCC H;  3E89 A;  1YXB A;  2LGW A;  4CS3 A;  3UO2 A;  2F93 B;  4TV8 A;  4I5S A;  4QPK A;  1NI8 A;  5ITZ A;  3FYI B;  5FPO A;  1K3E A;  3LSS A;  2VQF O;  3ABK B;  1U97 A;  5A2Q N;  5JQG B;  4TOI A;  4ZHQ A;  2RN9 A;  3ZX6 A;  2WA4 A;  4CC5 A;  3D8C A;  4CZZ A;  3LSQ A;  2QM8 A;  2QM4 A;  1Q3E A;  1KP3 A;  1ZWI C;  3CC4 V;  4JI0 B;  2XAF A;  5IJ0 A;  2M7W A;  4TV8 B;  1EBO A;  3FAV B;  5EZY B;  4RUF A;  1Z5W A;  1NTK H;  1M90 W;  5JQG A;  1OCO C;  1F4N A;  4FLU A;  4UXN A;  1R6T A;  5A9G A;  4DUZ B;  5EK0 A;  1Q81 W;  1SC5 B;  1ROP A;  5J2T A;  2WAM A;  2XAQ A;  5IJ0 B;  3CPW U;  2JS3 A;  5IYB O;  2QWR B;  2Q9L A;  3ABM C;  3FAV A;  2EIK B;  5EZY A;  5LHG A;  3X2Q B;  1BCC H;  2PY5 A;  3SYC A;  1S0V A;  4JTC B;  1B6Q A;  2IH3 C;  5B1O A;  1BS3 A;  2ZQM A;  5H5N A;  2X0L A;  4JI3 B;  2F95 B;  4FFB B;  5BR8 O;  1EFR G;  1WN7 A;  4MT8 A;  5F2V O;  2OWO A;  4I50 B;  1NS1 A;  2Q6A A;  1S72 V;  4JI6 B;  3T2M A;  3CYO A;  3B40 A;  4O2B A;  1H5W A;  2DWE C;  2G38 A;  4BIU A;  2DYR C;  4I9Q A;  2GSM B;  1Y67 A;  3J80 N;  4CC6 A;  3JD1 A;  3JYC A;  2FML A;  3K9A A;  4JAA A;  1WPB A;  3G67 A;  1XBL A;  5B5E Z;  2V4D A;  1M56 C;  4B3T O;  2YIB A;  2KB1 A;  3APQ A;  3M99 B;  4JI8 O;  3ZN1 A;  1IZ3 A;  5KAI Z;  4O2B B;  1QVF U;  1VEW A;  1S5H C;  1EN5 A;  2OIG A;  5JH7 B;  1YVW A;  2QGN A;  1RSO B;  1J5E O;  4OX9 B;  4GKK O;  2ILM A;  1Y6X A;  1HNX B;  1AJN A;  1NR7 A;  2RQ6 A;  2ZDI C;  5FLX N;  2PZS A;  3LDE A;  1AP6 A;  1GO3 F;  3CRM A;  3HR0 A;  4DR3 B;  1WPX A;  3T1H B;  1XL4 A;  2FB5 A;  2CUG A;  2Q4P A;  4GLX A;  2F23 A;  4DV0 B;  4LF8 O;  4X64 B;  5JH7 A;  3IAY A;  2YUA A;  3ABU A;  2CTR A;  3U0Z A;  1VP7 A;  3RYF A;  1PNL A;  4TUY A;  2Q69 A;  1ORQ C;  2UUB B;  1O9G A;  1NU1 H;  4JAU A;  4QGP A;  3RYC B;  1R6N A;  2AHY A;  2QSA A;  4J9Y B;  4I9W A;  2HLD G;  2QTS A;  1TGO A;  3CSX A;  3S3W A;  3ETQ A;  5B1B C;  2WLL B;  4J7J A;  4DR1 B;  2YXH A;  3KDR A;  1EN6 A;  5LMU O;  1GM8 A;  5LL6 Y;  5IYD O;  3U10 A;  4LF4 B;  1NVP B;  4HNA B;  3JCZ A;  4QE7 A;  1H8E G;  3LDD A;  2DMX A;  3FD9 A;  2YDE A;  1NT2 B;  2BOB C;  1ENV A;  3ETG A;  4G27 B;  4DV6 B;  3E8B A;  4KL1 A;  3RYC A;  4JI4 O;  4NB5 A;  4IYH A;  4ABM A;  1QHT A;  3CCU V;  2EJR A;  2WLL A;  2BCC H;  2DQ0 A;  5EC2 C;  3CB2 A;  3J7A U;  4FLV A;  2F43 G;  3N2K A;  4H33 A;  3FB7 C;  4HNA A;  3H1H H;  1M4U A;  1N36 O;  3AK1 A;  4I0X A;  4N23 A;  2A06 H;  4C7U A;  3CXC U;  1IBL O;  2R72 A;  3ZHU A;  2AZ0 A;  1YSC A;  2ARH A;  1BE3 H;  4AQY B;  1NVP D;  4LFC O;  1VQ7 V;  4B3R B;  2XUM A;  2Y69 B;  4YY3 O;  1HWY A;  2FKX A;  3F5W C;  5E79 Z;  1K8A W;  5KHK A;  4I4T B;  4XDL A;  4ASU G;  2YSU B;  5EYP A;  4I0X B;  2X6A A;  3J81 N;  5EIB C;  2FL4 A;  4DR5 O;  4FLY A;  4NYK A;  1HNZ O;  4WFH A;  3SPH A;  1WB8 A;  1S77 D;  1XNQ O;  2W0F C;  3LNM B;  5KHI A;  4WFE A;  1Q6I A;  1WNS A;  1QQC A;  2X6B A;  1WA8 A;  3WG7 B;  1N34 B;  1D5N A;  3QF7 A;  3L9D A;  1YCI A;  1IXM A;  1JVM A;  2N74 A;  5DM6 V;  2UXD O;  1JCH A;  4GX5 A;  4H37 A;  3ZJZ A;  1XEQ A;  4K8Z A;  1N4C A;  1E79 G;  4YJ3 A;  4K0K O;  3ZHT A;  1R3L C;  2F66 C;  4N21 A;  4D7S A;  3DXR B;  5LGU A;  5CA1 B;  4ZIB A;  2YXY A;  1LR1 A;  3K59 A;  1WAZ A;  4DV7 O;  1VQ4 V;  1XL6 A;  3ZMZ A;  1Y76 B;  2ADQ B;  4JZG A;  1W2B U;  4LF4 O;  3H01 A;  4DR2 B;  2CK3 G;  5GTI Z;  4BW9 A;  4JAS A;  1AR5 A;  2QKC A;  3D36 A;  3UKM A;  4UV9 A;  1MMM A;  1NJI W;  3T1C A;  4O4I A;  4DR2 O;  5BY1 A;  1ZSP A;  1KMI Z;  3VQY A;  3BRC A;  4GX2 A;  5JJE B;  5CA1 A;  1EZV H;  4LNU A;  3ICX A; 
#chains in the Genus database with same CATH homology
 4C7U A;  1AVM A;  1XDC A;  1ZLZ A;  2ADP A;  1I08 A;  2CDY A;  1MA1 A;  1AP6 A;  1GN6 A;  2GDS A;  5A9G A;  1AP5 A;  4GUN A;  1BSM A;  1ZTE A;  1N0N A;  1XIL A;  4JYY A;  1SZX A;  3TJT A;  3EVK A;  3DC5 A;  3MDS A;  1LUW A;  1XRE A;  1QNM A;  1B06 A;  1P7G A;  2RCV A;  3AK3 A;  2AW9 A;  1KKC A;  4YIP A;  1PL4 A;  1WB8 A;  1MSD A;  4YIO A;  1BS3 A;  1EM1 A;  3C3T A;  3OT7 A;  1EN4 A;  4E4E A;  4JZ2 A;  1D5N A;  1VAR A;  1JR9 A;  4X9Q A;  1ZUQ A;  1IX9 A;  3K9S A;  2P4K A;  1GN3 A;  1MNG A;  4F6E A;  1BT8 A;  3KDR A;  2QKA A;  2CE4 A;  1EN6 A;  1LUV A;  3CEI A;  4FFK A;  3LSU A;  3RN4 A;  3IC9 A;  3QVN A;  3KKY A;  1JA8 A;  1Y67 A;  3BFR A;  1IXB A;  2ADQ B;  4JZG A;  1AR4 A;  1XUQ A;  3C3S A;  3AK2 A;  1IDS A;  1WB7 A;  1AR5 A;  1N0J A;  1GN4 A;  2QKC A;  1MMM A;  5AG2 A;  1ZSP A;  1GN2 A;  1VEW A;  3DC6 A;  4BR6 A;  1EN5 A;  3AK1 A;  1I0H A;  1PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...