3DD3A

Crystal structure of the glutathione transferase pi enzyme in complex with the bifunctional inhibitor, etharapta
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
b'MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Rational design of an organometallic glutathione transferase inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3dd3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dd3A01
2VCVA 4EO3A 4XRAA 2HSNB 1FVJA 1DE1A 4RQXA 4POLA 2I4AA 4HS1A 5CRGA 5E59A 3QOUA 5GAND 5D9TA 2FCHA 4O5RA 1R4WA 3FHKA 1B9XC 2DJJA 5ECLB 4HU7A 3OR5A 2LRTA 4MMMA 4KE3A 2ZCTA 1SD9A 4HOJA 3APQA 1E2YA 1O81A 1U87A 3QD9A 1W4VA 1MTCA 3SWLA 3L9SA 1QGVA 1FOVA 5DDLA 13GSA 1AAZA 1GSYA 3VFIA 2CVBA 3VI7A 3APOA 1A2MA 3DYRA 4PNGA 4WR5A 1AW9A 1N2AA 4ISDA 2F51A 2YJ7A 3EURA 5H5SA 1OYJA 1SU9A 2UZ8A 3F4TA 3FR3A 1ZYEA 3GUSA 4QQ7A 2PERA 2B3SA 2H74A 1F2EA 3CSHA 4WF5A 1KEBA 3ZFLA 1GTAA 1A24A 2F3MA 5GZZB 3BBYA 5J3RA 4LL1B 1SL0B 1V98A 2LEGA 2R37A 4GLTA 1ST9A 5IMZA 2ON7A 4YQVA 4NWYA 2BTOT 4RQRA 1QQ2A 3W8JA 5LCZA 2KHPA 3KJYA 2CA8A 4N11A 2WB9A 2ZNMA 3HKRA 2C1YA 3VI5A 3Q74A 2HRFA 4GXZA 1T1VA 1GSDA 5G5EA 2DLXA 1YY7A 4ECJA 5CO3A 2C0DA 2CV4A 3M8NA 4BVXB 5KEJA 2JZSA 4V2LA 2C8UA 3EVIA 1PGTA 1N8JA 5ECOB 4WXTA 3ZYWA 2M72A 2C0EA 2GTUA 2VUPA 4K6XA 1OC9A 4TR1B 1HYUA 1QUWA 3CMIA 1WOUA 5ECRB 3TJKA 1BX9A 3BOAA 4TR3A 4OD7A 1S3DA 4KX4A 2CVKA 5FWGA 2GSSA 1VF3A 1M7TA 3TUEA 4O32A 4NMUA 2VCTA 3C1RA 4AJ8A 3DKSA 3WD6A 2RM5A 2H6YA 1SYRA 1Y25A 3GKXA 6GSTA 3GN3A 4N10A 2CX4A 5IO0A 3IE3A 1YQ1A 5H5QA 3TKSA 2DJKA 2R2JA 1XOAA 4BWSA 1OKDA 14GSA 1B4PA 2J23A 4MPGA 4JRRA 2B5XA 2G2QA 2V32A 1FG4A 2MBSA 3KTLA 3VLNA 2YOIA 4IGJA 2TRCP 4KDYA 1TJDA 1W89A 2IFQB 1GRXA 5IMDA 3TKSC 1GNWA 1M9BA 4IP1A 2DJ3A 2KOKA 1X5EA 4EL1A 2F8FA 5JWOB 1DBYA 3FZAA 2B7JA 2J9HA 3NIVA 5D8IA 5DQYA 4GSTA 2IMIA 4KUNA 1TI1A 3KH7A 3GNJA 2FY6A 4JR4A 3DVXA 1MEKA 3ERFA 4XRDA 4HJMA 1XVQA 3F6DA 1NHYA 5IMCA 3GV1A 4GQFA 2H72A 3LXZA 4TW5A 3MNGA 2V41A 2H0IA 2YP6A 4F2IA 4OFMA 1TRUA 2KUCA 1PX6A 3A5WA 4Q5RA 1O85A 2LUSA 1GSEA 1A0RP 5FHIA 3M0FA 3AY8A 4MZWA 2GDRA 3WT1A 2VD0A 2P5RA 3GSTA 1DSBA 1X9WB 4MJBA 5G1KA 5EL8A 1JLVA 4PTSA 3GRXA 3IC8A 1A23A 1V58A 1THOA 3KZQA 1URMA 4I5QA 2XC2A 3HVXA 2NVLA 3ZITA 3GKNA 1SL2B 2N5FA 3WYWA 2R4VA 2H19A 5D9WA 1WWJA 5IM9A 1F9MA 2ALBA 4BL7A 4ZBDA 5B6MA 2C0FA 3IC4A 4TXOA 4CW9A 1GTIA 4XS1A 4G0KA 4ZL9A 4WEYA 3P2AA 3HY2A 1GL8A 2L57A 1XWAA 1B8XA 1GULA 2H73A 4EF0A 2H75A 3NZNA 2GZYA 2XPEA 4KSOA 2L5OA 4MZCA 3PINA 2DJ1A 5G1LA 2B5YA 1EV4A 2JSYA 1EOHA 2QC7A 2LJRA 4MJCA 2DC5A 3DGQA 1SENA 4FYCA 4WBRD 1TTZA 5F07A 3QDNA 3HA9A 2AB6A 5JCGA 1X5CA 3KGKA 4X0XA 1VF1A 5IOXA 1EEMA 2X99A 3TJGA 5B6NA 4KDUA 1TRVA 3G9BA 1T4YA 4ZXGA 5ELAA 2MYGA 2HSYA 3TRXA 3TOTA 3GTUA 1YZXA 1K0BA 3FR9A 10GSA 1NM3A 1PL2A 1GUKA 3D6IA 3DMLA 4KCAA 1RK4A 2DBCA 1XW6A 3ZLPA 1Z3EA 3TOUA 3IAM2 2LV3A 2YN1A 4PQ1A 3C7MA 2M80A 4PXOA 4ZBBA 1ACVA 2CT6A 5ID2A 4NV5A 4TKYA 1FHEA 3H1NA 5AGYA 2A2RA 3G7YA 2HZFA 2IWTA 2VL2A 2NPBA 4G2EA 4RUVA 1MDKA 2GSTA 2RUFA 1TU8A 4DEJA 1SJIA 2R3XA 2R6KA 3TCOA 1GSQA 5GSSA 4DSQA 2H0GA 1ZYQB 5G31A 6GSXA 1EP7A 2ON5A 4TVEA 4I2TA 4FYUA 1PMTA 4TR0A 5JCWA 2L6DA 2NTOA 3ZTLA 4G0LA 5ECPB 4PGTA 2VL2C 2FUG2 4V2MA 3I9V2 3A2WA 1GSUA 4K0GA 3MAKA 2O7KA 2CAIA 1OC9B 3QPMA 5D96A 4FIWA 1X5DA 5J9BA 20GSA 1Z7PA 5EPFA 2GQKA 2EC4A 3LYKA 4H86A 1XWBA 3BCKA 3HVSA 4DSSA 1UN2A 1OC3A 1GTUA 2XBQA 5C04A 2YWOA 3DEXA 3G7IA 1R5PA 1U3IA 4L8EA 2B6MA 2H1GA 3EYTA 2V6OA 4MP4A 2FA8A 1TRWA 2L59A 1BYEA 2IMKA 4WETA 4XS6A 1IYHA 2L4QA 4NHWA 3U5RE 3IAS2 3NOFA 4XHMA 2C3NA 1XOBA 3M9KA 3DIEA 1XWKA 3EU3A 1Z5YE 1XFLA 4K2DA 3IK7A 2VO4A 2PWJA 1FB0A 3C1SA 4EE0A 2LNTA 1MD3A 3KMNA 3RPNA 2YANA 1TP9A 4HI7A 1PQNA 2QSIA 2OE0A 2VIMA 3EC3A 2H71A 4PUFC 2LRNA 1YEXA 2FWGA 5DALA 3LWAA 5DCGA 4ID0A 2OADA 4EUYA 2PMTA 3LORA 2YV9A 3M9JA 3SBCA 2H30A 3EMPA 3R2QA 1G6YA 3CRTA 4MABA 4FH8A 1HD2A 2RLIA 1U6TA 4POBA 3L0HA 2GGTA 5C00A 1HNBA 5HQPA 3D4MA 1SK1A 2VCXA 5JCUA 4J2FA 2WCIA 3I69A 3VWUA 2X8GA 3ZRDA 2H8LA 4OCFA 2DMLA 2Z9SA 5KN2A 3F3QA 4JEDA 3ZMLA 1GP1A 1A0FA 1PA3A 4YAPA 2H0HA 2MMOA 4FQUA 4BPYA 4HZ4A 2YZUA 3LEFA 3F3RA 4BVYA 1TKDB 2DMMA 3WT2A 4OCEA 5D9XA 1SK2A 1PRXA 2REMA 2YJHA 2EIOA 17GSA 3C8EA 3FZ9A 1GUHA 19GSA 1ZGNA 1G7EA 4BL7B 1SKWB 6GSYA 4IQAA 1ZCPA 3UARA 2F9SA 2DJ0A 4TXOB 2TIRA 2P5QA 1GLPA 3KCMA 1TW9A 1OKTA 4PQIA 5A5KA 4IHUA 1TK8B 4ZBAA 4K8MA 5ECHB 5E4WA 3TDGA 3E9JB 3WGDA 5GAPD 1XWCA 2GQMA 1UA5A 4ZB8A 3IA1A 3O76A 2WS2A 2LTKA 4KF9A 6GSWA 4MK3A 2VM1A 3VK9A 4L0WA 2JL4A 5A4UA 3Q6OA 2H1AA 3CXGA 1XXUA 3DWVA 3FZ4A 5IIZA 4K7IA 1GSSA 3QFBC 2DIZA 2H66A 2OA7A 2E2GA 2E0QA 3BD2A 4IW9A 5CREA 1T7PB 3TRQA 3US3A 1TK5B 1ON4A 4GCIA 2B1LA 5HR1A 2GZPA 4LA1A 3LYPA 1PN9A 5AISA 1ZOFA 3CSIA 4GTUA 3GTUB 1GWCA 1ERTA 4F82A 5L71A 2AV4A 3JCML 3GIXA 1ILOA 3EWLA 2I1UA 1K0AA 1B4QA 3ISOA 3UJ1A 3UEMA 1Q98A 1TRSA 3UL3A 4OMVA 2PUKC 1M2BA 4J57E 5AN1A 5ECNB 2V2GA 3LG6A 3O3TA 2IMDA 4GSSA 1B9YC 3QAWA 3FKFA 4IELA 2O85A 1V40A 1PX7A 4PUAA 5ID2B 5J41A 4YAVA 4XCSA 5LD0A 1JFUA 3KP8A 2GQLA 2GSQA 1EP8A 1Q4JA 2IIYA 1M2DA 4K7NA 2CX3A 4N0ZA 3HJMA 1XIYA 3PGTA 2BJXA 3ZL5A 3Q19A 4G9HA 4E8HA 1K0DA 2CAQA 2IN3A 4MCUA 1VGLA 3UAPA 1WRYA 4GRFA 2KP1A 2FWFA 1V2AA 2B5EA 4XS4A 4MF6A 16GSA 4KDXA 3F63A 5CRWA 4TR4A 3WGEA 4DSSB 1EV9A 5FT3A 4JBBA 3IRAA 2DIYA 5HR3A 1F3BA 4K9ZA 3LSZA 3CBUA 1UC7A 3KP9A 3QMXA 1QFNA 2VAFA 4AJ7A 4L5LA 3PR8A 1QXHA 4DSRA 2HRKA 5IPGA 1Y6EA 3TKPA 3TRPA 1XVWA 3U6VA 1QMVA 2IJYA 2VL3A 4FO5A 3LQ7A 2PGTA 3S9FA 2H1DA 2I3YA 1FB6A 3TB2A 2L4CA 3HDCA 5D93A 3DXBA 2HLSA 5GSTA 5IOWA 3UIWA 1TOFA 2EIQA 2GT5A 2RUEA 4AGSA 2R5GA 1GUMA 3D0ZA 5F05A 1WJKA 3C71A 1TDIA 1I9DA 1ZZYA 2KLXA 2P31A 1XW5A 1A8YA 3MWHA 1BQ7A 2C4JA 5COHA 1X9MB 3HYPA 2LJKA 1JHBA 4X43A 2PPTA 2K8SA 2X8CA 3TKRA 3A2XA 2EIRA 3CTGA 5D9VA 5DALB 1TU7A 2YCDA 1WP0A 5HFGA 1FVKA 4N0VA 4BA7A 3L4NA 1PKWA 5ENUA 1TK0B 2VM2A 3I43A 1OC8A 2WZ9A 3L9UA 3O6TA 1JZOA 2CZ2A 2XBIA 2VCWA 1QK8A 4IQ1A 1S3CA 3FK8A 4ML6A 5EY6A 1X0RA 4EKZA 4WR4A 4KGIA 4PURA 2O87A 4IP6A 2LJAA 4JZQA 1KTEA 2IMEA 2PVQA 4HJ2A 3EMXA 4ZILA 9GSSA 3A3TA 2N5AA 2DSAA 3ZIVA 4EDYA 2ES7A 4GSNA 5AIVA 4AJ6A 4LL4B 2OKAA 3HHVA 2MMAA 5DAKA 3N5OA 4LMWA 4KAEA 5B8AA 4OFTA 1O8WA 2K8VA 4MJEA 2O8VB 3MSZA 3R3EA 2X64A 3G7JA 2YWIA 1R7HA 3PH9A 1V9WA 4BVYB 4MA9A 1GNEA 3GH9A 4G19A 3QR6A 1K3YA 5HFIA 2C3QA 5DCHA 2HSMA 2A4VA 1EZKA 2PBJA 1EGOA 5H5RA 5ECMB 3LXTA 5IMAA 2P0GA 3GX0A 4N30A 4X1UA 3P8WA 2GT6A 2NBSA 4NXIA 4L5OA 1AXDA 4ULXA 2V6KA 1CQGA 2VLVA 3EE2A 1JZWA 4TN8A 1BG5A 2MMZA 1O8XA 2OACA 2H70A 4TOPA 4EVMA 4EC0A 1ZL9A 4JU5A 1JLWA 1PSQA 3UOMA 3EINA 2I81A 3FY7A 3E3EA 1RQMA 1USBA 1ML6A 4NHZA 4HDEA 3ERGA 2AUVA 1O6JA 1HQOA 5IMVA 1OE8A 2HQTA 3IDVA 4J56E 3CTFA 4USSA 4KCEA 1MDIA 3ZMKA 4F03A 5J9CA 2V1MA 1MD4A 4LLRA 3GHAA 3GKMA 3W6GA 2I9HA 1VRSD 5ELGA 1GH2A 5AIXA 2HYXA 4L0UA 6GSVA 1XW9A 4KW6A 1AQVA 5CRHA 3L78A 2VL9A 5KN3A 2NDOA 2HSHA 4O92A 5HFKA 1VF4A 4EDZA 2JZRA 3GFKA 4V1Ag 5ABRA 2B7KA 4ILFA 1K0CA 1AIUA 4P3YB 1EGRA 4KB3A 2FHEA 1ERUA 3LJRA 3KH9A 2VD1A 3J7Yb 2GVPA 2BMXA 3D5JA 4NV2A 5INYA 2JU5A 4HUAA 2C3TA 2JADA 2OE1A 1HNAA 2HI7A 4ECBA 1JZDA 3D4TA 2VLTA 1YKCA 3FYGA 4XIHA 4JR6A 6GSSA 2M46A 3RPPA 5CYYA 3DVWA 4ECCA 3TKQA 2YNXA 3GH6A 3E0UA 3DD3A 5CNWA 4WF4A 1AQWA 2K6VA 3ED3A 1YF0A 2DJ2A 3IXRA 3PPUA 1X9SB 3FW2A 3FZ5A 2O89A 1I5GA 5IPHA 4D73A 3F9UA 4IVFA 5DVBA 1FW1A 4OO5A 3VPQA 1SK0A 2CQ9A 2PU9C 3KEBA 3KD0A 3H79A 3HZ4A 4RI7A 3HCZA 1ZMAA 3F0IA 3ZVJD 1G0TA 3H8QA 3GX8A 3APSA 3VWWA 3TGZA 4BWQA 1FO5A 2CZ3A 5CP1A 1BAYA 2VCQA 3QAVA 2OE3A 1K0NA 4IBPA 5D73A 4XS4B 4MF5A 1YJ6A 4KA0A 4E8EA 5J5NA 1BEDA 5A4WA 3RDWA 3H4KA 3IV4A 2LS5A 4NPBA 2MZCA 4F0BA 2OBKA 6GSUA 1SJZA 5F8BA 1EWXA 1F37A 2CVDA 1M99A 3UVTA 1Z9HA 1T4ZA 2YWNA 3D22A 2HRKB 3IR4A 1AQXA 2AAWA 1SYXA 1THXA 3M3MA 1SKRB 4OFNA 1XPVA 3KM6A 4HZ2A 1WPIA 1KBNA 4OO4A 2YPMA 1LU4A 3EU4A 4ACSA 2HZEA 4ZL7A 4WBJA 4FYBA 5G2ZA 2YV7A 5ECQB 1R5AA 3TJBA 5BMUA 1F3AA 2E7PA 4ZB6A 3F4SA 4KSMA 1K0MA 4LMVA 1GLQA 2L5LA 3N9JA 3DRNA 5DJLA 3IOSA 2RIIA 2HRNA 2FA4A 2K18A 4K7OA 8GSSA 5KN1A 2LQQA 5IMFA 2OJLA 3HJPA 1KNGA 1Z7RA 2JACA 3WGXA 1H75A 2HT9A 1SL1B 3P90A 4ECIA 1OE7A 1JZRA 4CHSA 4QL7A 4YQMA 4MLYA 1NW2A 2FWHA 3TJJA 4MZBA 18GSA 4MDCA 5EVOA 4YQUA 1UVZA 2JSZA 3ME7A 2G0FA 2L6CA 1M2AA 4YH2A 5A4VA 3D21A 2IMFA 5B7CA 3F8UA 5DAKB 2E2MA 3HZ8A 5JWQB 4IKHA 1WMJA 2AYTA 3KMOA 3GA4A 1A2JA 1OVNA 1B48A 1YF1A 3MDKA 1ERWA 7GSSA 4GQCA 3ZFBA 5IQYA 2K9FA 3GL3A 2HE3A 1K0OA 5DQSA 2C80A 2FNOA 4V1Ap 3IHQA 2HSMB 1ABAA 3UBLA 4KH7A 2ZUPA 4IJ3A 3CRUA 2AJQB 2HXKA 3CSJA 1V57A 3J7Yk 1YDKA 1Z6NA 5IO2A 3RHBA 5ECSA 3LFLA 4ML1A 3HXSA 2LKUA 4AF2A 3ZREA 1PKZA 3IBHA 4Q5NA 2OBIA 3GSSA 2LRCA 3VWVA 4HU9A 1LBKA 2FD3A 4MH3A 3VURA 1A2LA 2WJUA 4KNDA 3RBTA 1OAZA 2WDUA 2IL3A 2AHEA 2HNLA 2N5BA 3M1GA 1AC1A 5F06A 2TRXA 4POMA 2H01A 4MPFA 3CYNA 4OWYA 4BVXA 1G7OA 3KTBA 1YEPA 1J08A 3ZVJA 4IN0A 3KIJA 3FRCA 1IYIA 4TR1A 4EXJA 1MDJA 3TJFA 3GMFA 1R26A 1K3LA 3RHCA 4I2UA 1M9AA 3FR6A 4ZB9A 1SD8A 1LJRA 4QL9A 2XPDA 1M0UA 1F6MC 2QGVA 1XWGA 4HQZA 1TXXA 3Q18A 3ZIJA 4TRXA 1AUCA 4PX1A 3P7XA 3HVVA 22GSA 5JWRB 3HD5A 2F8AA 3ME8A 4TXVA 4V2NA 5DBQA 2H1BA 1XBSA 2WFCA 3ZZXA 2H6ZA 2B1KA 2LNSA 5HR2A 2C0GA 3A2VA 1H4OA 1E6BA 1NSWA 5J4UA 2IFQA 1GTBA 4NAXA 1DE2A 4Z7XA 5G5FA 3I6AA 2YWMA 3BJ5A 3UBKA 1A8LA 1CQHA 3GYKA 5G30A 1VF2A 3QAGA 5CRDA 4D73B 1SJ6A 2IPAA 5F0GA 1PD21 2WRTA 1T8EB 3C73A 4I6XA 1EEJA 2VCZA 2VOCA 1O7UA 2RM6A 4MJAA 2XHFA 4RI6A 2LQOA 5CAXA 5B8BA 2VLUA 4O7HA 2MMNA 4HQSA 3TKSE 2WGRA 4MF7A 5ECIB 3F6FA 4G0IA 2GZZA 2FWEA 3UMAA 4I97A 2PVOC 2FGXA 1O73A 2KP2A 4Q5FA 4XTSA 3IK9A 3IPZA 1U88A 2A2SA 1XZOA 2WULA 4PNFA 1G6WA 3VWXA 1J9BA 2JZTA 5ECKB 3QFAC 4F0CA 4Q5QA 2QKEA 1WIKA 2D2ZA 4IS0A 1TI3A 1SKSB 4POKA 2MBTA 1J0FA 4GF0A 3GKKA 12GSA 2LSTA 1WE0A 2YZHA 4I8BA 4JE1A 2GS3A 4DVCA 2FLSA 2GLRA 4GWRA 3K8NA 3LGCA 3RAZA 11GSA 1Z6MA 4HEA2 1U3AA 1YKAA 1T3BA 3ERWA 2HRAA 3L9VA 4K0NA 3V1WA 3QCPA 2HZEB 4K1FA 5HR0A 1C72A 1RW1A 4CDOA 2H76A 2PN8A 1PL1A 5KN0A 4IJIA 3H93A 3GL5A 3UVHA 1BJXA 3KXOA 2X8HA 1EOGA 4ZL8A 1K3OA 4ZIJA 1T00A 1DUGA 1NHOA 3W8SA 2H6XA 3VPTA 1S3AA 5LNKe 3F4RA 3GURA 3FEUA 1XCCA 2HFDA 4G10A 1HNCA 4WKWA 3BCIA 4F9ZA 2GSRA 1ERVA 1FAAA 1GSFA 3HJOA 5DJMA 4MH2A 4PQHA
chains in the Genus database with same CATH superfamily
2VCVA 4EO3A 4XRAA 2HSNB 1FVJA 1DE1A 4RQXA 3CQFA 4POLA 2I4AA 4HS1A 5CRGA 5E59A 3QOUA 4A5PA 5GAND 5D9TA 2FCHA 4O5RA 1R4WA 3FHKA 1B9XC 2DJJA 5ECLB 4HU7A 3OR5A 2LRTA 4MMMA 4KE3A 2ZCTA 1SD9A 4HOJA 3APQA 1E2YA 1O81A 1U87A 3QD9A 2R0GA 1M3IA 1W4VA 1MTCA 3SWLA 3L9SA 1QGVA 1FOVA 5DDLA 13GSA 1AAZA 1GSYA 3VFIA 2CVBA 3VI7A 3APOA 1A2MA 3DYRA 4PNGA 4WR5A 1AW9A 1N2AA 4ISDA 2F51A 1S4BP 5KOXA 2YJ7A 3EURA 5H5SA 1OYJA 1SU9A 2UZ8A 3F4TA 4Z2RA 3FR3A 1ZYEA 4AKXB 3GUSA 4QQ7A 2PERA 2B3SA 2H74A 1F2EA 3CSHA 4WF5A 4FXYP 1KEBA 4K5RA 3ZFLA 1GTAA 1A24A 2F3MA 5GZZB 3BBYA 2WZSA 5J3RA 4LL1B 1SL0B 1V98A 2LEGA 2R37A 4GLTA 2DKHA 1ST9A 5IMZA 2ON7A 4YQVA 4NWYA 2BTOT 4RQRA 1QQ2A 3W8JA 5LCZA 2KHPA 2WVXA 3KJYA 2CA8A 4N11A 2WB9A 2ZNMA 3HKRA 2C1YA 3HMJG 3VI5A 3Q74A 2HRFA 4GXZA 1T1VA 1GSDA 5G5EA 2DLXA 1YY7A 4ECJA 5CO3A 2C0DA 2CV4A 2WW0A 3M8NA 4BVXB 5KEJA 2JZSA 2X4AA 4V2LA 2C8UA 3EVIA 1PGTA 1N8JA 5ECOB 4WXTA 3ZYWA 2M72A 2C0EA 2GTUA 2VUPA 4K6XA 1OC9A 4TR1B 4X4JA 1HYUA 1QUWA 3CMIA 1WOUA 5ECRB 3TJKA 1BX9A 3BOAA 4TR3A 4OD7A 1S3DA 5J4YA 4KX4A 2CVKA 5FWGA 2GSSA 1VF3A 1M7TA 3TUEA 4O32A 4NMUA 2VCTA 3C1RA 4AJ8A 3DKSA 3WD6A 2RM5A 2H6YA 1SYRA 1Y25A 3GKXA 6GSTA 3GN3A 4N10A 2CX4A 5IO0A 3IE3A 1YQ1A 5H5QA 3TKSA 2DJKA 2R2JA 1XOAA 4BWSA 1OKDA 14GSA 1B4PA 2J23A 4MPGA 4JRRA 2B5XA 2G2QA 4AKHA 2V32A 1FG4A 2MBSA 3KTLA 3VLNA 2YOIA 4IGJA 2TRCP 4KDYA 1TJDA 1W89A 2IFQB 4PHZC 1GRXA 5IMDA 3TKSC 1GNWA 1M9BA 4ICYA 4IP1A 2DJ3A 2KOKA 1X5EA 4EL1A 2F8FA 5JWOB 1DBYA 3FZAA 2B7JA 2J9HA 3NIVA 5D8IA 5DQYA 4GSTA 2IMIA 4KUNA 1TI1A 3KH7A 3GNJA 2FY6A 4JR4A 3DVXA 1MEKA 3ERFA 4XRDA 4HJMA 1XVQA 3F6DA 1NHYA 5IMCA 3GV1A 4GQFA 2H72A 3LXZA 1ZYPA 4TW5A 3MNGA 2V41A 2H0IA 2WVZA 2YP6A 4F2IA 4OFMA 1TRUA 2KUCA 1PX6A 3A5WA 4Q5RA 1O85A 2LUSA 1GSEA 1A0RP 5FHIA 3M0FA 3AY8A 4MZWA 2GDRA 3WT1A 2VD0A 2P5RA 3GSTA 1DSBA 1X9WB 4MJBA 5G1KA 5EL8A 1JLVA 4PTSA 3GRXA 3IC8A 1A23A 1V58A 1THOA 3KZQA 1URMA 4I5QA 1SVOA 2XC2A 3HVXA 2NVLA 3ZITA 3GKNA 1SL2B 2N5FA 3WYWA 2R4VA 2H19A 5D9WA 1WWJA 5IM9A 1F9MA 2ALBA 4BL7A 4ZBDA 5B6MA 2C0FA 3IC4A 4TXOA 4CW9A 1GTIA 4XS1A 4G0KA 4ZL9A 4WEYA 3P2AA 3HY2A 2WW3A 1GL8A 2L57A 1XWAA 1B8XA 1GULA 2H73A 4EF0A 2H75A 3NZNA 2GZYA 2XPEA 4KSOA 2L5OA 4MZCA 3PINA 2DJ1A 3CHXC 5G1LA 2B5YA 3HVNA 1EV4A 2JSYA 1EOHA 2QC7A 2LJRA 4MJCA 2DC5A 3DGQA 1SENA 4FYCA 4WBRD 1TTZA 5F07A 3QDNA 3HA9A 2AB6A 5JCGA 1X5CA 3KGKA 4X0XA 1VF1A 5IOXA 1EEMA 2X99A 3TJGA 5B6NA 4KDUA 1TRVA 3G9BA 1T4YA 4ZXGA 5ELAA 2MYGA 2HSYA 3TRXA 3TOTA 3GTUA 1YZXA 1K0BA 3FR9A 10GSA 3LW9A 1NM3A 1PL2A 1GUKA 3D6IA 3DMLA 4KCAA 1RK4A 2DBCA 1XW6A 3ZLPA 1Z3EA 3TOUA 3IAM2 2LV3A 2YN1A 4PQ1A 3C7MA 2M80A 4PXOA 4ZBBA 1ACVA 2CT6A 5ID2A 2QA2A 4NV5A 4TKYA 1FHEA 2UV8G 3H1NA 5AGYA 2A2RA 3G7YA 2HZFA 2IWTA 2VL2A 2NPBA 4G2EA 4RUVA 1MDKA 2GSTA 2RUFA 1TU8A 4DEJA 1SJIA 2R3XA 2WVXB 2R6KA 3TCOA 1GSQA 5GSSA 4DSQA 2H0GA 1ZYQB 5G31A 6GSXA 1EP7A 2ON5A 4TVEA 4I2TA 4FYUA 1PMTA 4TR0A 5JCWA 2L6DA 2NTOA 3ZTLA 4G0LA 5ECPB 4PGTA 2VL2C 4ZB7A 2FUG2 4V2MA 3I9V2 3A2WA 1GSUA 4K0GA 3MAKA 2A4HA 2O7KA 2CAIA 1OC9B 3QPMA 5D96A 4FIWA 1X5DA 5J9BA 20GSA 1Z7PA 1ZYNA 5EPFA 2GQKA 2EC4A 3FMWA 3LYKA 4H86A 1XWBA 3BCKA 3HVSA 4DSSA 1UN2A 1OC3A 1GTUA 2XBQA 5C04A 2YWOA 3DEXA 3G7IA 1R5PA 1U3IA 4L8EA 2B6MA 2H1GA 3EYTA 2V6OA 4MP4A 2FA8A 1TRWA 2L59A 5A34A 4MNNA 1BYEA 2IMKA 4WETA 4XS6A 1IYHA 2L4QA 4NHWA 3U5RE 3IAS2 3NOFA 4XHMA 2C3NA 1XOBA 4E68A 3M9KA 2O5VA 3DIEA 1XWKA 3EU3A 1Z5YE 1XFLA 4K2DA 3IK7A 2VO4A 2PWJA 1FB0A 3C1SA 4EE0A 2LNTA 1MD3A 2EFCA 3KMNA 3RPNA 2YANA 1TP9A 4HI7A 1PQNA 2QSIA 2EFDA 2OE0A 2VIMA 3EC3A 2H71A 4PUFC 2LRNA 1YEXA 2FWGA 5DALA 3LWAA 5DCGA 4ID0A 2OADA 4EUYA 2PMTA 3LORA 2YV9A 3M9JA 3SBCA 1S3RA 2H30A 4AI6A 3EMPA 3R2QA 1G6YA 3CRTA 4MABA 4FH8A 1HD2A 2RLIA 1U6TA 4POBA 3L0HA 2GGTA 5C00A 1HNBA 3RFRC 5HQPA 3D4MA 1SK1A 2VCXA 5JCUA 4J2FA 2WCIA 3I69A 3VWUA 2X8GA 3ZRDA 2H8LA 4OCFA 2DMLA 2Z9SA 5KN2A 3F3QA 4JEDA 3ZMLA 2R0CA 1GP1A 1A0FA 1PA3A 4YAPA 2H0HA 2MMOA 4FQUA 2OT3A 4BPYA 4HZ4A 2YZUA 3LEFA 3F3RA 4BVYA 1TKDB 2DMMA 3WT2A 4OCEA 5D9XA 1SK2A 1PRXA 2REMA 2YJHA 2EIOA 1M3JA 17GSA 3C8EA 3FZ9A 1GUHA 19GSA 2EFEA 1ZGNA 1G7EA 4BL7B 1SKWB 6GSYA 4IQAA 1ZCPA 3UARA 2F9SA 2DJ0A 4TXOB 2TIRA 5A5HA 2P5QA 1GLPA 3KCMA 1TW9A 1YVLA 1OKTA 4PQIA 5A5KA 4IHUA 1TK8B 4ZBAA 4K8MA 5ECHB 5E4WA 3TDGA 3E9JB 3WGDA 5GAPD 1XWCA 2GQMA 1UA5A 4ZB8A 3IA1A 3O76A 2WS2A 2LTKA 4KF9A 6GSWA 4MK3A 2VM1A 3VK9A 4L0WA 2JL4A 5A4UA 3Q6OA 2H1AA 3CXGA 1XXUA 3DWVA 3FZ4A 2WW1A 5IIZA 4K7IA 1GSSA 3QFBC 2DIZA 2H66A 2OA7A 2E2GA 2E0QA 3BD2A 4IW9A 5CREA 1T7PB 3TRQA 3US3A 1TK5B 1ON4A 4GCIA 2B1LA 5HR1A 2GZPA 4LA1A 3LYPA 1PN9A 5AISA 1ZOFA 3MIXA 3CSIA 4GTUA 3GTUB 1GWCA 1ERTA 4F82A 5L71A 2AV4A 3JCML 3GIXA 1ILOA 3EWLA 2I1UA 1K0AA 1B4QA 3ISOA 3UJ1A 3UEMA 1Q98A 1TRSA 3UL3A 4OMVA 2PUKC 1M2BA 4J57E 5AN1A 5ECNB 4G01A 2V2GA 3LG6A 3O3TA 2IMDA 4GSSA 1B9YC 3QAWA 3FKFA 4IELA 2O85A 4Z2TA 1V40A 1PX7A 4PUAA 5ID2B 5J41A 2QA1A 4YAVA 4XCSA 5LD0A 1JFUA 3KP8A 2GQLA 2GSQA 1EP8A 1Q4JA 2IIYA 1M2DA 4K7NA 2CX3A 4N0ZA 3HJMA 1XIYA 3PGTA 2BJXA 1I1IP 3ZL5A 3Q19A 4G9HA 4E8HA 1K0DA 2CAQA 2IN3A 4MCUA 1VGLA 3UAPA 1WRYA 4GRFA 2KP1A 2FWFA 1V2AA 2B5EA 4XS4A 4MF6A 16GSA 4YKGA 4KDXA 3F63A 5CRWA 4TR4A 3WGEA 4DSSB 1EV9A 5FT3A 4JBBA 3IRAA 2DIYA 5HR3A 1F3BA 4K9ZA 3LSZA 3CBUA 1UC7A 3KP9A 3QMXA 1QFNA 5A34B 2VAFA 4AJ7A 4L5LA 3PR8A 1QXHA 4DSRA 2HRKA 5IPGA 1Y6EA 3TKPA 3TRPA 1XVWA 3U6VA 1QMVA 2IJYA 2VL3A 4FO5A 3LQ7A 2PGTA 3S9FA 2H1DA 2I3YA 1FB6A 3TB2A 2L4CA 3HDCA 5D93A 3DXBA 2HLSA 5GSTA 5BRTA 5IOWA 3UIWA 1TOFA 2EIQA 2GT5A 2RUEA 4AGSA 2R5GA 1GUMA 3D0ZA 5F05A 1WJKA 3C71A 1TDIA 1I9DA 1ZZYA 2KLXA 2P31A 1XW5A 1A8YA 3MWHA 1BQ7A 2C4JA 5COHA 1X9MB 3HYPA 2LJKA 1JHBA 4EIPA 4X43A 2PPTA 2K8SA 2X8CA 3TKRA 3A2XA 2EIRA 3CTGA 5D9VA 5DALB 1TU7A 2YCDA 1WP0A 5HFGA 1FVKA 4N0VA 4BA7A 3L4NA 1XG8A 1PKWA 5ENUA 1TK0B 2VM2A 3I43A 1OC8A 2WZ9A 3L9UA 3O6TA 1JZOA 2CZ2A 2XBIA 2VCWA 1QK8A 4IQ1A 1S3CA 3FK8A 4ML6A 5EY6A 1X0RA 4EKZA 4WR4A 4KGIA 4PURA 2O87A 4IP6A 2LJAA 4JZQA 1KTEA 2IMEA 2PVQA 4HJ2A 3EMXA 4ZILA 9GSSA 3A3TA 2N5AA 2DSAA 3ZIVA 4EDYA 2ES7A 4GSNA 5AIVA 3RGBC 4AJ6A 4LL4B 2OKAA 3IHGA 3HHVA 2MMAA 5DAKA 3N5OA 4LMWA 4KAEA 5B8AA 4OFTA 1O8WA 2K8VA 4MJEA 4K5SA 2O8VB 3MSZA 3R3EA 2X64A 3G7JA 2YWIA 1R7HA 3PH9A 1V9WA 4BIKA 4BVYB 4MA9A 1GNEA 1PFOA 3GH9A 4G19A 3QR6A 1K3YA 5HFIA 2A2PA 2C3QA 5DCHA 2HSMA 2A4VA 1EZKA 2PBJA 1EGOA 5H5RA 5ECMB 3LXTA 5IMAA 2P0GA 3GX0A 4N30A 4X1UA 3P8WA 2GT6A 2NBSA 3CWGA 4NXIA 4CY8A 4L5OA 1AXDA 4ULXA 2V6KA 1CQGA 2VLVA 5A5HB 3EE2A 1JZWA 4TN8A 1BG5A 2MMZA 1O8XA 2OACA 2H70A 4TOPA 4EVMA 4EC0A 1ZL9A 4JU5A 1JLWA 1PSQA 3UOMA 3EINA 2I81A 3FY7A 3E3EA 1RQMA 1USBA 1ML6A 4NHZA 5A1NA 4HDEA 3ERGA 2AUVA 1O6JA 1HQOA 5IMVA 1OE8A 2HQTA 3IDVA 4J56E 3CTFA 4USSA 4KCEA 1MDIA 3ZMKA 4F03A 5J9CA 2V1MA 1MD4A 4LLRA 3GHAA 3GKMA 3W6GA 2I9HA 1VRSD 5ELGA 1GH2A 5AIXA 2HYXA 4L0UA 6GSVA 1XW9A 4KW6A 1AQVA 5CRHA 2O36A 3L78A 2VL9A 5KN3A 2NDOA 2HSHA 4O92A 5HFKA 1VF4A 4EDZA 2JZRA 3GFKA 4V1Ag 2H1LA 5ABRA 2B7KA 4ILFA 1K0CA 1AIUA 4Z2UA 4P3YB 1EGRA 4KB3A 2FHEA 1ERUA 3LJRA 3KH9A 2VD1A 3J7Yb 4W66A 2GVPA 2BMXA 3D5JA 4NV2A 5INYA 2JU5A 4HUAA 2C3TA 2JADA 2OE1A 1HNAA 2HI7A 4ECBA 4PI0C 1JZDA 3D4TA 2VLTA 1YKCA 3FYGA 4XIHA 4JR6A 6GSSA 2M46A 3RPPA 5CYYA 3DVWA 4ECCA 3TKQA 2YNXA 3GH6A 3E0UA 3DD3A 5CNWA 3TU3B 4WF4A 1AQWA 2K6VA 3ED3A 1YF0A 2DJ2A 3IXRA 3PPUA 1X9SB 3FW2A 3FZ5A 2O89A 1I5GA 5IPHA 4D73A 3F9UA 4IVFA 5DVBA 1FW1A 4OO5A 3VPQA 1SK0A 2CQ9A 2PU9C 3KEBA 3KD0A 3H79A 3HZ4A 4RI7A 3HCZA 1ZMAA 3F0IA 3ZVJD 1G0TA 3H8QA 3GX8A 3APSA 3VWWA 3TGZA 4BWQA 1FO5A 4O5UA 2CZ3A 5CP1A 4AKIA 1BAYA 2VCQA 3QAVA 2OE3A 1K0NA 2EFHA 4IBPA 5D73A 4XS4B 4MF5A 4PI2C 1YJ6A 4KA0A 4E8EA 5J5NA 1BEDA 5A4WA 3RDWA 3H4KA 3IV4A 2LS5A 4NPBA 2WVYA 2MZCA 4F0BA 2OBKA 6GSUA 1SJZA 4YKFA 5F8BA 4CY6A 1EWXA 1F37A 2CVDA 1M99A 3UVTA 1BG1A 1Z9HA 1T4ZA 4GDFA 2YWNA 3D22A 2HRKB 3IR4A 1AQXA 2AAWA 1SYXA 1N25A 1THXA 3M3MA 1SKRB 4OFNA 1XPVA 3KM6A 4HZ2A 1WPIA 1KBNA 4OO4A 2YPMA 4QMKA 1LU4A 3EU4A 4ACSA 2HZEA 4ZL7A 4WBJA 4FYBA 5G2ZA 2YV7A 5ECQB 1R5AA 3TJBA 5BMUA 1F3AA 2E7PA 4ZB6A 3F4SA 4KSMA 4AKGA 1K0MA 4LMVA 1GLQA 2L5LA 2DKIA 3N9JA 5J47A 3DRNA 5DJLA 3IOSA 2RIIA 1BF5A 2HRNA 2R0PA 2FA4A 2K18A 4K7OA 8GSSA 5KN1A 2LQQA 5IMFA 2OJLA 3HJPA 1KNGA 3A5IA 1Z7RA 2JACA 3WGXA 1H75A 2HT9A 1SL1B 3P90A 4ECIA 1OE7A 1JZRA 4CHSA 4QL7A 4YQMA 2HSNA 4MLYA 1NW2A 2FWHA 3TJJA 4MZBA 18GSA 4MDCA 5EVOA 4YQUA 1UVZA 2JSZA 1Y1UA 3ME7A 4HSCX 2G0FA 2L6CA 1M2AA 4YH2A 5A4VA 3D21A 2IMFA 5B7CA 3F8UA 5DAKB 2E2MA 3HZ8A 5JWQB 4K2XA 4IKHA 1WMJA 2AYTA 3KMOA 3GA4A 1A2JA 1OVNA 1B48A 1YF1A 3MDKA 1ERWA 7GSSA 4GQCA 3ZFBA 5IQYA 2K9FA 3GL3A 2HE3A 1K0OA 5DQSA 2C80A 2FNOA 4V1Ap 3IHQA 2HSMB 1ABAA 3UBLA 5J4VA 4KH7A 2ZUPA 4IJ3A 3CRUA 2AJQB 2HXKA 3CSJA 2O3EA 1V57A 3J7Yk 1YDKA 1Z6NA 5IO2A 3RHBA 5ECSA 3LFLA 4ML1A 3HXSA 2LKUA 4AF2A 3ZREA 1PKZA 3IBHA 4Q5NA 2OBIA 3GSSA 2LRCA 3VWVA 4HU9A 1LBKA 2FD3A 4MH3A 3VURA 1A2LA 2WJUA 5A1NB 1YEWC 4KNDA 3RBTA 1OAZA 2WDUA 2IL3A 2AHEA 2HNLA 2N5BA 3M1GA 1AC1A 5F06A 2TRXA 4POMA 2H01A 4MPFA 3CYNA 4OWYA 4BVXA 1G7OA 3KTBA 1YEPA 1J08A 3ZVJA 4IN0A 3KIJA 3FRCA 1IYIA 4TR1A 4EXJA 1MDJA 3TJFA 3GMFA 2X49A 1R26A 1K3LA 3RHCA 4I2UA 1M9AA 3FR6A 4ZB9A 1SD8A 4EIQA 1LJRA 4QL9A 2XPDA 1M0UA 1F6MC 2QGVA 1XWGA 4HQZA 1TXXA 5KOWA 3Q18A 3ZIJA 4TRXA 1AUCA 4PX1A 3P7XA 3HVVA 22GSA 5JWRB 3HD5A 2F8AA 3ME8A 4TXVA 4V2NA 5DBQA 2H1BA 1XBSA 2WFCA 3ZZXA 2H6ZA 5J40A 2B1KA 2LNSA 5HR2A 2C0GA 3A2VA 1H4OA 1E6BA 1NSWA 5J4UA 2IFQA 1GTBA 4NAXA 1DE2A 4Z7XA 5G5FA 3I6AA 2YWMA 2WW2A 3BJ5A 3UBKA 1A8LA 1CQHA 3GYKA 5G30A 1VF2A 3QAGA 5CRDA 4D73B 2VKZG 1SJ6A 2IPAA 5F0GA 1PD21 2WRTA 1T8EB 3C73A 4I6XA 1EEJA 2VCZA 2VOCA 1O7UA 2RM6A 4MJAA 2XHFA 4RI6A 2LQOA 5CAXA 5B8BA 2VLUA 4O7HA 2MMNA 4HQSA 3TKSE 2WGRA 4MF7A 5ECIB 3F6FA 4G0IA 2GZZA 2FWEA 3UMAA 4I97A 2PVOC 2FGXA 1O73A 2KP2A 4Q5FA 4XTSA 3IK9A 3IPZA 1U88A 2A2SA 1XZOA 2WULA 4PNFA 1G6WA 3VWXA 1J9BA 2JZTA 5ECKB 3QFAC 1TXUA 4F0CA 4Q5QA 2QKEA 1WIKA 2D2ZA 4IS0A 1TI3A 1SKSB 4POKA 2MBTA 1J0FA 4GF0A 3GKKA 12GSA 2LSTA 1WE0A 2YZHA 4I8BA 4JE1A 2GS3A 4DVCA 2FLSA 2GLRA 4GWRA 3K8NA 3LGCA 3RAZA 11GSA 1Z6MA 4HEA2 1U3AA 1YKAA 1T3BA 4N3ZA 1SVMA 3ERWA 2HRAA 3L9VA 4K0NA 1FOHA 3V1WA 3QCPA 1SVLA 2HZEB 4K1FA 5HR0A 1C72A 1PN0A 1RW1A 4CDOA 2H76A 5BMUB 2PN8A 1PL1A 5KN0A 4IJIA 3H93A 3GL5A 3UVHA 1BJXA 3KXOA 2X8HA 1EOGA 4ZL8A 1K3OA 4ZIJA 1T00A 1DUGA 1NHOA 3W8SA 2H6XA 3VPTA 3MYDA 1S3AA 5LNKe 3F4RA 3GURA 3FEUA 1XCCA 2HFDA 4G10A 1HNCA 4WKWA 3EPTA 3BCIA 4F9ZA 2GSRA 1ERVA 1FAAA 1GSFA 3HJOA 5DJMA 4O5QA 4MH2A 4PQHA
chains in the Genus database with same CATH topology
2VCVA 4EO3A 4XRAA 2HSNB 1FVJA 1DE1A 4RQXA 4POLA 2I4AA 4HS1A 5CRGA 5E59A 3QOUA 4A5PA 5GAND 5D9TA 2FCHA 4O5RA 1R4WA 3FHKA 1B9XC 2DJJA 5ECLB 4HU7A 3OR5A 2LRTA 4MMMA 4KE3A 2ZCTA 1SD9A 4HOJA 3APQA 1E2YA 1O81A 1U87A 3QD9A 2R0GA 1W4VA 1MTCA 3SWLA 3L9SA 1QGVA 1FOVA 5DDLA 13GSA 1AAZA 1GSYA 3VFIA 2CVBA 3VI7A 3APOA 1A2MA 3DYRA 4PNGA 4WR5A 1AW9A 1N2AA 4ISDA 2F51A 5KOXA 2YJ7A 3EURA 5H5SA 1OYJA 1SU9A 2UZ8A 3F4TA 4Z2RA 3FR3A 1ZYEA 4AKXB 3GUSA 4QQ7A 2PERA 2B3SA 2H74A 1F2EA 3CSHA 4WF5A 1KEBA 4K5RA 3ZFLA 1GTAA 1A24A 2F3MA 5GZZB 3BBYA 5J3RA 4LL1B 1SL0B 1V98A 2LEGA 2R37A 4GLTA 2DKHA 1ST9A 5IMZA 2ON7A 4YQVA 4NWYA 2BTOT 4RQRA 1QQ2A 3W8JA 5LCZA 2KHPA 3KJYA 2CA8A 4N11A 2WB9A 2ZNMA 3HKRA 2C1YA 3HMJG 3VI5A 3Q74A 2HRFA 4GXZA 1T1VA 1GSDA 5G5EA 2DLXA 1YY7A 4ECJA 5CO3A 2C0DA 2CV4A 3M8NA 4BVXB 5KEJA 2JZSA 2X4AA 4V2LA 2C8UA 3EVIA 1PGTA 1N8JA 5ECOB 4WXTA 3ZYWA 2M72A 2C0EA 2GTUA 2VUPA 4K6XA 1OC9A 4TR1B 4X4JA 1HYUA 1QUWA 3CMIA 1WOUA 5ECRB 3TJKA 1BX9A 3BOAA 4TR3A 4OD7A 1S3DA 5J4YA 4KX4A 2CVKA 5FWGA 2GSSA 1VF3A 1M7TA 3TUEA 4O32A 4NMUA 2VCTA 3C1RA 4AJ8A 3DKSA 3WD6A 2RM5A 2H6YA 1SYRA 1Y25A 3GKXA 6GSTA 3GN3A 4N10A 2CX4A 5IO0A 3IE3A 1YQ1A 5H5QA 3TKSA 2DJKA 2R2JA 1XOAA 4BWSA 1OKDA 14GSA 1B4PA 2J23A 4MPGA 4JRRA 2B5XA 2G2QA 4AKHA 2V32A 1FG4A 2MBSA 3KTLA 3VLNA 2YOIA 4IGJA 2TRCP 4KDYA 1TJDA 1W89A 2IFQB 1GRXA 5IMDA 3TKSC 1GNWA 1M9BA 4ICYA 4IP1A 2DJ3A 2KOKA 1X5EA 4EL1A 2F8FA 5JWOB 1DBYA 3FZAA 2B7JA 2J9HA 3NIVA 5D8IA 5DQYA 4GSTA 2IMIA 4KUNA 1TI1A 3KH7A 3GNJA 2FY6A 4JR4A 3DVXA 1MEKA 3ERFA 4XRDA 4HJMA 1XVQA 3F6DA 1NHYA 5IMCA 3GV1A 4GQFA 2H72A 3LXZA 1ZYPA 4TW5A 3MNGA 2V41A 2H0IA 2YP6A 4F2IA 4OFMA 1TRUA 2KUCA 1PX6A 3A5WA 4Q5RA 1O85A 2LUSA 1GSEA 1A0RP 5FHIA 3M0FA 3AY8A 4MZWA 2GDRA 3WT1A 2VD0A 2P5RA 3GSTA 1DSBA 1X9WB 4MJBA 5G1KA 5EL8A 1JLVA 4PTSA 3GRXA 3IC8A 1A23A 1V58A 1THOA 3KZQA 1URMA 4I5QA 1SVOA 2XC2A 3HVXA 2NVLA 3ZITA 3GKNA 1SL2B 2N5FA 3WYWA 2R4VA 2H19A 5D9WA 1WWJA 5IM9A 1F9MA 2ALBA 4BL7A 4ZBDA 5B6MA 2C0FA 3IC4A 4TXOA 4CW9A 1GTIA 4XS1A 4G0KA 4ZL9A 4WEYA 3P2AA 3HY2A 1GL8A 2L57A 1XWAA 1B8XA 1GULA 2H73A 4EF0A 2H75A 3NZNA 2GZYA 2XPEA 4KSOA 2L5OA 4MZCA 3PINA 2DJ1A 5G1LA 2B5YA 1EV4A 2JSYA 1EOHA 2QC7A 2LJRA 4MJCA 2DC5A 3DGQA 1SENA 4FYCA 4WBRD 1TTZA 5F07A 3QDNA 3HA9A 2AB6A 5JCGA 1X5CA 3KGKA 4X0XA 1VF1A 5IOXA 1EEMA 2X99A 3TJGA 5B6NA 4KDUA 1TRVA 3G9BA 1T4YA 4ZXGA 5ELAA 2MYGA 2HSYA 3TRXA 3TOTA 3GTUA 1YZXA 1K0BA 3FR9A 10GSA 3LW9A 1NM3A 1PL2A 1GUKA 3D6IA 3DMLA 4KCAA 1RK4A 2DBCA 1XW6A 3ZLPA 1Z3EA 3TOUA 3IAM2 2LV3A 2YN1A 4PQ1A 3C7MA 2M80A 4PXOA 4ZBBA 1ACVA 2CT6A 5ID2A 2QA2A 4NV5A 4TKYA 1FHEA 2UV8G 3H1NA 5AGYA 2A2RA 3G7YA 2HZFA 2IWTA 2VL2A 2NPBA 4G2EA 4RUVA 1MDKA 2GSTA 2RUFA 1TU8A 4DEJA 1SJIA 2R3XA 2R6KA 3TCOA 1GSQA 5GSSA 4DSQA 2H0GA 1ZYQB 5G31A 6GSXA 1EP7A 2ON5A 4TVEA 4I2TA 4FYUA 1PMTA 4TR0A 5JCWA 2L6DA 2NTOA 3ZTLA 4G0LA 5ECPB 4PGTA 2VL2C 4ZB7A 2FUG2 4V2MA 3I9V2 3A2WA 1GSUA 4K0GA 3MAKA 2A4HA 2O7KA 2CAIA 1OC9B 3QPMA 5D96A 4FIWA 1X5DA 5J9BA 20GSA 1Z7PA 1ZYNA 5EPFA 2GQKA 2EC4A 3FMWA 3LYKA 4H86A 1XWBA 3BCKA 3HVSA 4DSSA 1UN2A 1OC3A 1GTUA 2XBQA 5C04A 2YWOA 3DEXA 3G7IA 1R5PA 1U3IA 4L8EA 2B6MA 2H1GA 3EYTA 2V6OA 4MP4A 2FA8A 1TRWA 2L59A 5A34A 4MNNA 1BYEA 2IMKA 4WETA 4XS6A 1IYHA 2L4QA 4NHWA 3U5RE 3IAS2 3NOFA 4XHMA 2C3NA 1XOBA 4E68A 3M9KA 2O5VA 3DIEA 1XWKA 3EU3A 1Z5YE 1XFLA 4K2DA 3IK7A 2VO4A 2PWJA 1FB0A 3C1SA 4EE0A 2LNTA 1MD3A 2EFCA 3KMNA 3RPNA 2YANA 1TP9A 4HI7A 1PQNA 2QSIA 2EFDA 2OE0A 2VIMA 3EC3A 2H71A 4PUFC 2LRNA 1YEXA 2FWGA 5DALA 3LWAA 5DCGA 4ID0A 2OADA 4EUYA 2PMTA 3LORA 2YV9A 3M9JA 3SBCA 2H30A 4AI6A 3EMPA 3R2QA 1G6YA 3CRTA 4MABA 4FH8A 1HD2A 2RLIA 1U6TA 4POBA 3L0HA 2GGTA 5C00A 1HNBA 5HQPA 3D4MA 1SK1A 2VCXA 5JCUA 4J2FA 2WCIA 3I69A 3VWUA 2X8GA 3ZRDA 2H8LA 4OCFA 2DMLA 2Z9SA 5KN2A 3F3QA 4JEDA 3ZMLA 2R0CA 1GP1A 1A0FA 1PA3A 4YAPA 2H0HA 2MMOA 4FQUA 2OT3A 4BPYA 4HZ4A 2YZUA 3LEFA 3F3RA 4BVYA 1TKDB 2DMMA 3WT2A 4OCEA 5D9XA 1SK2A 1PRXA 2REMA 2YJHA 2EIOA 17GSA 3C8EA 3FZ9A 1GUHA 19GSA 2EFEA 1ZGNA 1G7EA 4BL7B 1SKWB 6GSYA 4IQAA 1ZCPA 3UARA 2F9SA 2DJ0A 4TXOB 2TIRA 5A5HA 2P5QA 1GLPA 3KCMA 1TW9A 1YVLA 1OKTA 4PQIA 5A5KA 4IHUA 1TK8B 4ZBAA 4K8MA 5ECHB 5E4WA 3TDGA 3E9JB 3WGDA 5GAPD 1XWCA 2GQMA 1UA5A 4ZB8A 3IA1A 3O76A 2WS2A 2LTKA 4KF9A 6GSWA 4MK3A 2VM1A 3VK9A 4L0WA 2JL4A 5A4UA 3Q6OA 2H1AA 3CXGA 1XXUA 3DWVA 3FZ4A 5IIZA 4K7IA 1GSSA 3QFBC 2DIZA 2H66A 2OA7A 2E2GA 2E0QA 3BD2A 4IW9A 5CREA 1T7PB 3TRQA 3US3A 1TK5B 1ON4A 4GCIA 2B1LA 5HR1A 2GZPA 4LA1A 3LYPA 1PN9A 5AISA 1ZOFA 3MIXA 3CSIA 4GTUA 3GTUB 1GWCA 1ERTA 4F82A 5L71A 2AV4A 3JCML 3GIXA 1ILOA 3EWLA 2I1UA 1K0AA 1B4QA 3ISOA 3UJ1A 3UEMA 1Q98A 1TRSA 3UL3A 4OMVA 2PUKC 1M2BA 4J57E 5AN1A 5ECNB 4G01A 2V2GA 3LG6A 3O3TA 2IMDA 4GSSA 1B9YC 3QAWA 3FKFA 4IELA 2O85A 4Z2TA 1V40A 1PX7A 4PUAA 5ID2B 5J41A 2QA1A 4YAVA 4XCSA 5LD0A 1JFUA 3KP8A 2GQLA 2GSQA 1EP8A 1Q4JA 2IIYA 1M2DA 4K7NA 2CX3A 4N0ZA 3HJMA 1XIYA 3PGTA 2BJXA 3ZL5A 3Q19A 4G9HA 4E8HA 1K0DA 2CAQA 2IN3A 4MCUA 1VGLA 3UAPA 1WRYA 4GRFA 2KP1A 2FWFA 1V2AA 2B5EA 4XS4A 4MF6A 16GSA 4YKGA 4KDXA 3F63A 5CRWA 4TR4A 3WGEA 4DSSB 1EV9A 5FT3A 4JBBA 3IRAA 2DIYA 5HR3A 1F3BA 4K9ZA 3LSZA 3CBUA 1UC7A 3KP9A 3QMXA 1QFNA 5A34B 2VAFA 4AJ7A 4L5LA 3PR8A 1QXHA 4DSRA 2HRKA 5IPGA 1Y6EA 3TKPA 3TRPA 1XVWA 3U6VA 1QMVA 2IJYA 2VL3A 4FO5A 3LQ7A 2PGTA 3S9FA 2H1DA 2I3YA 1FB6A 3TB2A 2L4CA 3HDCA 5D93A 3DXBA 2HLSA 5GSTA 5BRTA 5IOWA 3UIWA 1TOFA 2EIQA 2GT5A 2RUEA 4AGSA 2R5GA 1GUMA 3D0ZA 5F05A 1WJKA 3C71A 1TDIA 1I9DA 1ZZYA 2KLXA 2P31A 1XW5A 1A8YA 3MWHA 1BQ7A 2C4JA 5COHA 1X9MB 3HYPA 2LJKA 1JHBA 4EIPA 4X43A 2PPTA 2K8SA 2X8CA 3TKRA 3A2XA 2EIRA 3CTGA 5D9VA 5DALB 1TU7A 2YCDA 1WP0A 5HFGA 1FVKA 4N0VA 4BA7A 3L4NA 1PKWA 5ENUA 1TK0B 2VM2A 3I43A 1OC8A 2WZ9A 3L9UA 3O6TA 1JZOA 2CZ2A 2XBIA 2VCWA 1QK8A 4IQ1A 1S3CA 3FK8A 4ML6A 5EY6A 1X0RA 4EKZA 4WR4A 4KGIA 4PURA 2O87A 4IP6A 2LJAA 4JZQA 1KTEA 2IMEA 2PVQA 4HJ2A 3EMXA 4ZILA 9GSSA 3A3TA 2N5AA 2DSAA 3ZIVA 4EDYA 2ES7A 4GSNA 5AIVA 4AJ6A 4LL4B 2OKAA 3IHGA 3HHVA 2MMAA 5DAKA 3N5OA 4LMWA 4KAEA 5B8AA 4OFTA 1O8WA 2K8VA 4MJEA 4K5SA 2O8VB 3MSZA 3R3EA 2X64A 3G7JA 2YWIA 1R7HA 3PH9A 1V9WA 4BVYB 4MA9A 1GNEA 3GH9A 4G19A 3QR6A 1K3YA 5HFIA 2A2PA 2C3QA 5DCHA 2HSMA 2A4VA 1EZKA 2PBJA 1EGOA 5H5RA 5ECMB 3LXTA 5IMAA 2P0GA 3GX0A 4N30A 4X1UA 3P8WA 2GT6A 2NBSA 3CWGA 4NXIA 4CY8A 4L5OA 1AXDA 4ULXA 2V6KA 1CQGA 2VLVA 5A5HB 3EE2A 1JZWA 4TN8A 1BG5A 2MMZA 1O8XA 2OACA 2H70A 4TOPA 4EVMA 4EC0A 1ZL9A 4JU5A 1JLWA 1PSQA 3UOMA 3EINA 2I81A 3FY7A 3E3EA 1RQMA 1USBA 1ML6A 4NHZA 5A1NA 4HDEA 3ERGA 2AUVA 1O6JA 1HQOA 5IMVA 1OE8A 2HQTA 3IDVA 4J56E 3CTFA 4USSA 4KCEA 1MDIA 3ZMKA 4F03A 5J9CA 2V1MA 1MD4A 4LLRA 3GHAA 3GKMA 3W6GA 2I9HA 1VRSD 5ELGA 1GH2A 5AIXA 2HYXA 4L0UA 6GSVA 1XW9A 4KW6A 1AQVA 5CRHA 3L78A 2VL9A 5KN3A 2NDOA 2HSHA 4O92A 5HFKA 1VF4A 4EDZA 2JZRA 3GFKA 4V1Ag 2H1LA 5ABRA 2B7KA 4ILFA 1K0CA 1AIUA 4Z2UA 4P3YB 1EGRA 4KB3A 2FHEA 1ERUA 3LJRA 3KH9A 2VD1A 3J7Yb 4W66A 2GVPA 2BMXA 3D5JA 4NV2A 5INYA 2JU5A 4HUAA 2C3TA 2JADA 2OE1A 1HNAA 2HI7A 4ECBA 1JZDA 3D4TA 2VLTA 1YKCA 3FYGA 4XIHA 4JR6A 6GSSA 2M46A 3RPPA 5CYYA 3DVWA 4ECCA 3TKQA 2YNXA 3GH6A 3E0UA 3DD3A 5CNWA 3TU3B 4WF4A 1AQWA 2K6VA 3ED3A 1YF0A 2DJ2A 3IXRA 3PPUA 1X9SB 3FW2A 3FZ5A 2O89A 1I5GA 5IPHA 4D73A 3F9UA 4IVFA 5DVBA 1FW1A 4OO5A 3VPQA 1SK0A 2CQ9A 2PU9C 3KEBA 3KD0A 3H79A 3HZ4A 4RI7A 3HCZA 1ZMAA 3F0IA 3ZVJD 1G0TA 3H8QA 3GX8A 3APSA 3VWWA 3TGZA 4BWQA 1FO5A 4O5UA 2CZ3A 5CP1A 4AKIA 1BAYA 2VCQA 3QAVA 2OE3A 1K0NA 2EFHA 4IBPA 5D73A 4XS4B 4MF5A 1YJ6A 4KA0A 4E8EA 5J5NA 1BEDA 5A4WA 3RDWA 3H4KA 3IV4A 2LS5A 4NPBA 2MZCA 4F0BA 2OBKA 6GSUA 1SJZA 4YKFA 5F8BA 4CY6A 1EWXA 1F37A 2CVDA 1M99A 3UVTA 1BG1A 1Z9HA 1T4ZA 4GDFA 2YWNA 3D22A 2HRKB 3IR4A 1AQXA 2AAWA 1SYXA 1N25A 1THXA 3M3MA 1SKRB 4OFNA 1XPVA 3KM6A 4HZ2A 1WPIA 1KBNA 4OO4A 2YPMA 4QMKA 1LU4A 3EU4A 4ACSA 2HZEA 4ZL7A 4WBJA 4FYBA 5G2ZA 2YV7A 5ECQB 1R5AA 3TJBA 5BMUA 1F3AA 2E7PA 4ZB6A 3F4SA 4KSMA 4AKGA 1K0MA 4LMVA 1GLQA 2L5LA 2DKIA 3N9JA 5J47A 3DRNA 5DJLA 3IOSA 2RIIA 1BF5A 2HRNA 2R0PA 2FA4A 2K18A 4K7OA 8GSSA 5KN1A 2LQQA 5IMFA 2OJLA 3HJPA 1KNGA 3A5IA 1Z7RA 2JACA 3WGXA 1H75A 2HT9A 1SL1B 3P90A 4ECIA 1OE7A 1JZRA 4CHSA 4QL7A 4YQMA 2HSNA 4MLYA 1NW2A 2FWHA 3TJJA 4MZBA 18GSA 4MDCA 5EVOA 4YQUA 1UVZA 2JSZA 1Y1UA 3ME7A 2G0FA 2L6CA 1M2AA 4YH2A 5A4VA 3D21A 2IMFA 5B7CA 3F8UA 5DAKB 2E2MA 3HZ8A 5JWQB 4K2XA 4IKHA 1WMJA 2AYTA 3KMOA 3GA4A 1A2JA 1OVNA 1B48A 1YF1A 3MDKA 1ERWA 7GSSA 4GQCA 3ZFBA 5IQYA 2K9FA 3GL3A 2HE3A 1K0OA 5DQSA 2C80A 2FNOA 4V1Ap 3IHQA 2HSMB 1ABAA 3UBLA 5J4VA 4KH7A 2ZUPA 4IJ3A 3CRUA 2AJQB 2HXKA 3CSJA 1V57A 3J7Yk 1YDKA 1Z6NA 5IO2A 3RHBA 5ECSA 3LFLA 4ML1A 3HXSA 2LKUA 4AF2A 3ZREA 1PKZA 3IBHA 4Q5NA 2OBIA 3GSSA 2LRCA 3VWVA 4HU9A 1LBKA 2FD3A 4MH3A 3VURA 1A2LA 2WJUA 5A1NB 4KNDA 3RBTA 1OAZA 2WDUA 2IL3A 2AHEA 2HNLA 2N5BA 3M1GA 1AC1A 5F06A 2TRXA 4POMA 2H01A 4MPFA 3CYNA 4OWYA 4BVXA 1G7OA 3KTBA 1YEPA 1J08A 3ZVJA 4IN0A 3KIJA 3FRCA 1IYIA 4TR1A 4EXJA 1MDJA 3TJFA 3GMFA 2X49A 1R26A 1K3LA 3RHCA 4I2UA 1M9AA 3FR6A 4ZB9A 1SD8A 4EIQA 1LJRA 4QL9A 2XPDA 1M0UA 1F6MC 2QGVA 1XWGA 4HQZA 1TXXA 5KOWA 3Q18A 3ZIJA 4TRXA 1AUCA 4PX1A 3P7XA 3HVVA 22GSA 5JWRB 3HD5A 2F8AA 3ME8A 4TXVA 4V2NA 5DBQA 2H1BA 1XBSA 2WFCA 3ZZXA 2H6ZA 5J40A 2B1KA 2LNSA 5HR2A 2C0GA 3A2VA 1H4OA 1E6BA 1NSWA 5J4UA 2IFQA 1GTBA 4NAXA 1DE2A 4Z7XA 5G5FA 3I6AA 2YWMA 3BJ5A 3UBKA 1A8LA 1CQHA 3GYKA 5G30A 1VF2A 3QAGA 5CRDA 4D73B 2VKZG 1SJ6A 2IPAA 5F0GA 1PD21 2WRTA 1T8EB 3C73A 4I6XA 1EEJA 2VCZA 2VOCA 1O7UA 2RM6A 4MJAA 2XHFA 4RI6A 2LQOA 5CAXA 5B8BA 2VLUA 4O7HA 2MMNA 4HQSA 3TKSE 2WGRA 4MF7A 5ECIB 3F6FA 4G0IA 2GZZA 2FWEA 3UMAA 4I97A 2PVOC 2FGXA 1O73A 2KP2A 4Q5FA 4XTSA 3IK9A 3IPZA 1U88A 2A2SA 1XZOA 2WULA 4PNFA 1G6WA 3VWXA 1J9BA 2JZTA 5ECKB 3QFAC 1TXUA 4F0CA 4Q5QA 2QKEA 1WIKA 2D2ZA 4IS0A 1TI3A 1SKSB 4POKA 2MBTA 1J0FA 4GF0A 3GKKA 12GSA 2LSTA 1WE0A 2YZHA 4I8BA 4JE1A 2GS3A 4DVCA 2FLSA 2GLRA 4GWRA 3K8NA 3LGCA 3RAZA 11GSA 1Z6MA 4HEA2 1U3AA 1YKAA 1T3BA 4N3ZA 1SVMA 3ERWA 2HRAA 3L9VA 4K0NA 1FOHA 3V1WA 3QCPA 1SVLA 2HZEB 4K1FA 5HR0A 1C72A 1PN0A 1RW1A 4CDOA 2H76A 5BMUB 2PN8A 1PL1A 5KN0A 4IJIA 3H93A 3GL5A 3UVHA 1BJXA 3KXOA 2X8HA 1EOGA 4ZL8A 1K3OA 4ZIJA 1T00A 1DUGA 1NHOA 3W8SA 2H6XA 3VPTA 3MYDA 1S3AA 5LNKe 3F4RA 3GURA 3FEUA 1XCCA 2HFDA 4G10A 1HNCA 4WKWA 3EPTA 3BCIA 4F9ZA 2GSRA 1ERVA 1FAAA 1GSFA 3HJOA 5DJMA 4O5QA 4MH2A 4PQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCV A;  4EO3 A;  4XRA A;  2HSN B;  1FVJ A;  1DE1 A;  4RQX A;  4POL A;  2I4A A;  4HS1 A;  5CRG A;  5E59 A;  3QOU A;  5GAN D;  5D9T A;  2FCH A;  4O5R A;  1R4W A;  3FHK A;  1B9X C;  2DJJ A;  5ECL B;  4HU7 A;  3OR5 A;  2LRT A;  4MMM A;  4KE3 A;  2ZCT A;  1SD9 A;  4HOJ A;  3APQ A;  1E2Y A;  1O81 A;  1U87 A;  3QD9 A;  1W4V A;  1MTC A;  3SWL A;  3L9S A;  1QGV A;  1FOV A;  5DDL A;  13GS A;  1AAZ A;  1GSY A;  3VFI A;  2CVB A;  3VI7 A;  3APO A;  1A2M A;  3DYR A;  4PNG A;  4WR5 A;  1AW9 A;  1N2A A;  4ISD A;  2F51 A;  2YJ7 A;  3EUR A;  5H5S A;  1OYJ A;  1SU9 A;  2UZ8 A;  3F4T A;  3FR3 A;  1ZYE A;  3GUS A;  4QQ7 A;  2PER A;  2B3S A;  2H74 A;  1F2E A;  3CSH A;  4WF5 A;  1KEB A;  3ZFL A;  1GTA A;  1A24 A;  2F3M A;  5GZZ B;  3BBY A;  5J3R A;  4LL1 B;  1SL0 B;  1V98 A;  2LEG A;  2R37 A;  4GLT A;  1ST9 A;  5IMZ A;  2ON7 A;  4YQV A;  4NWY A;  2BTO T;  4RQR A;  1QQ2 A;  3W8J A;  5LCZ A;  2KHP A;  3KJY A;  2CA8 A;  4N11 A;  2WB9 A;  2ZNM A;  3HKR A;  2C1Y A;  3VI5 A;  3Q74 A;  2HRF A;  4GXZ A;  1T1V A;  1GSD A;  5G5E A;  2DLX A;  1YY7 A;  4ECJ A;  5CO3 A;  2C0D A;  2CV4 A;  3M8N A;  4BVX B;  5KEJ A;  2JZS A;  4V2L A;  2C8U A;  3EVI A;  1PGT A;  1N8J A;  5ECO B;  4WXT A;  3ZYW A;  2M72 A;  2C0E A;  2GTU A;  2VUP A;  4K6X A;  1OC9 A;  4TR1 B;  1HYU A;  1QUW A;  3CMI A;  1WOU A;  5ECR B;  3TJK A;  1BX9 A;  3BOA A;  4TR3 A;  4OD7 A;  1S3D A;  4KX4 A;  2CVK A;  5FWG A;  2GSS A;  1VF3 A;  1M7T A;  3TUE A;  4O32 A;  4NMU A;  2VCT A;  3C1R A;  4AJ8 A;  3DKS A;  3WD6 A;  2RM5 A;  2H6Y A;  1SYR A;  1Y25 A;  3GKX A;  6GST A;  3GN3 A;  4N10 A;  2CX4 A;  5IO0 A;  3IE3 A;  1YQ1 A;  5H5Q A;  3TKS A;  2DJK A;  2R2J A;  1XOA A;  4BWS A;  1OKD A;  14GS A;  1B4P A;  2J23 A;  4MPG A;  4JRR A;  2B5X A;  2G2Q A;  2V32 A;  1FG4 A;  2MBS A;  3KTL A;  3VLN A;  2YOI A;  4IGJ A;  2TRC P;  4KDY A;  1TJD A;  1W89 A;  2IFQ B;  1GRX A;  5IMD A;  3TKS C;  1GNW A;  1M9B A;  4IP1 A;  2DJ3 A;  2KOK A;  1X5E A;  4EL1 A;  2F8F A;  5JWO B;  1DBY A;  3FZA A;  2B7J A;  2J9H A;  3NIV A;  5D8I A;  5DQY A;  4GST A;  2IMI A;  4KUN A;  1TI1 A;  3KH7 A;  3GNJ A;  2FY6 A;  4JR4 A;  3DVX A;  1MEK A;  3ERF A;  4XRD A;  4HJM A;  1XVQ A;  3F6D A;  1NHY A;  5IMC A;  3GV1 A;  4GQF A;  2H72 A;  3LXZ A;  4TW5 A;  3MNG A;  2V41 A;  2H0I A;  2YP6 A;  4F2I A;  4OFM A;  1TRU A;  2KUC A;  1PX6 A;  3A5W A;  4Q5R A;  1O85 A;  2LUS A;  1GSE A;  1A0R P;  5FHI A;  3M0F A;  3AY8 A;  4MZW A;  2GDR A;  3WT1 A;  2VD0 A;  2P5R A;  3GST A;  1DSB A;  1X9W B;  4MJB A;  5G1K A;  5EL8 A;  1JLV A;  4PTS A;  3GRX A;  3IC8 A;  1A23 A;  1V58 A;  1THO A;  3KZQ A;  1URM A;  4I5Q A;  2XC2 A;  3HVX A;  2NVL A;  3ZIT A;  3GKN A;  1SL2 B;  2N5F A;  3WYW A;  2R4V A;  2H19 A;  5D9W A;  1WWJ A;  5IM9 A;  1F9M A;  2ALB A;  4BL7 A;  4ZBD A;  5B6M A;  2C0F A;  3IC4 A;  4TXO A;  4CW9 A;  1GTI A;  4XS1 A;  4G0K A;  4ZL9 A;  4WEY A;  3P2A A;  3HY2 A;  1GL8 A;  2L57 A;  1XWA A;  1B8X A;  1GUL A;  2H73 A;  4EF0 A;  2H75 A;  3NZN A;  2GZY A;  2XPE A;  4KSO A;  2L5O A;  4MZC A;  3PIN A;  2DJ1 A;  5G1L A;  2B5Y A;  1EV4 A;  2JSY A;  1EOH A;  2QC7 A;  2LJR A;  4MJC A;  2DC5 A;  3DGQ A;  1SEN A;  4FYC A;  4WBR D;  1TTZ A;  5F07 A;  3QDN A;  3HA9 A;  2AB6 A;  5JCG A;  1X5C A;  3KGK A;  4X0X A;  1VF1 A;  5IOX A;  1EEM A;  2X99 A;  3TJG A;  5B6N A;  4KDU A;  1TRV A;  3G9B A;  1T4Y A;  4ZXG A;  5ELA A;  2MYG A;  2HSY A;  3TRX A;  3TOT A;  3GTU A;  1YZX A;  1K0B A;  3FR9 A;  10GS A;  1NM3 A;  1PL2 A;  1GUK A;  3D6I A;  3DML A;  4KCA A;  1RK4 A;  2DBC A;  1XW6 A;  3ZLP A;  1Z3E A;  3TOU A;  3IAM 2;  2LV3 A;  2YN1 A;  4PQ1 A;  3C7M A;  2M80 A;  4PXO A;  4ZBB A;  1ACV A;  2CT6 A;  5ID2 A;  4NV5 A;  4TKY A;  1FHE A;  3H1N A;  5AGY A;  2A2R A;  3G7Y A;  2HZF A;  2IWT A;  2VL2 A;  2NPB A;  4G2E A;  4RUV A;  1MDK A;  2GST A;  2RUF A;  1TU8 A;  4DEJ A;  1SJI A;  2R3X A;  2R6K A;  3TCO A;  1GSQ A;  5GSS A;  4DSQ A;  2H0G A;  1ZYQ B;  5G31 A;  6GSX A;  1EP7 A;  2ON5 A;  4TVE A;  4I2T A;  4FYU A;  1PMT A;  4TR0 A;  5JCW A;  2L6D A;  2NTO A;  3ZTL A;  4G0L A;  5ECP B;  4PGT A;  2VL2 C;  2FUG 2;  4V2M A;  3I9V 2;  3A2W A;  1GSU A;  4K0G A;  3MAK A;  2O7K A;  2CAI A;  1OC9 B;  3QPM A;  5D96 A;  4FIW A;  1X5D A;  5J9B A;  20GS A;  1Z7P A;  5EPF A;  2GQK A;  2EC4 A;  3LYK A;  4H86 A;  1XWB A;  3BCK A;  3HVS A;  4DSS A;  1UN2 A;  1OC3 A;  1GTU A;  2XBQ A;  5C04 A;  2YWO A;  3DEX A;  3G7I A;  1R5P A;  1U3I A;  4L8E A;  2B6M A;  2H1G A;  3EYT A;  2V6O A;  4MP4 A;  2FA8 A;  1TRW A;  2L59 A;  1BYE A;  2IMK A;  4WET A;  4XS6 A;  1IYH A;  2L4Q A;  4NHW A;  3U5R E;  3IAS 2;  3NOF A;  4XHM A;  2C3N A;  1XOB A;  3M9K A;  3DIE A;  1XWK A;  3EU3 A;  1Z5Y E;  1XFL A;  4K2D A;  3IK7 A;  2VO4 A;  2PWJ A;  1FB0 A;  3C1S A;  4EE0 A;  2LNT A;  1MD3 A;  3KMN A;  3RPN A;  2YAN A;  1TP9 A;  4HI7 A;  1PQN A;  2QSI A;  2OE0 A;  2VIM A;  3EC3 A;  2H71 A;  4PUF C;  2LRN A;  1YEX A;  2FWG A;  5DAL A;  3LWA A;  5DCG A;  4ID0 A;  2OAD A;  4EUY A;  2PMT A;  3LOR A;  2YV9 A;  3M9J A;  3SBC A;  2H30 A;  3EMP A;  3R2Q A;  1G6Y A;  3CRT A;  4MAB A;  4FH8 A;  1HD2 A;  2RLI A;  1U6T A;  4POB A;  3L0H A;  2GGT A;  5C00 A;  1HNB A;  5HQP A;  3D4M A;  1SK1 A;  2VCX A;  5JCU A;  4J2F A;  2WCI A;  3I69 A;  3VWU A;  2X8G A;  3ZRD A;  2H8L A;  4OCF A;  2DML A;  2Z9S A;  5KN2 A;  3F3Q A;  4JED A;  3ZML A;  1GP1 A;  1A0F A;  1PA3 A;  4YAP A;  2H0H A;  2MMO A;  4FQU A;  4BPY A;  4HZ4 A;  2YZU A;  3LEF A;  3F3R A;  4BVY A;  1TKD B;  2DMM A;  3WT2 A;  4OCE A;  5D9X A;  1SK2 A;  1PRX A;  2REM A;  2YJH A;  2EIO A;  17GS A;  3C8E A;  3FZ9 A;  1GUH A;  19GS A;  1ZGN A;  1G7E A;  4BL7 B;  1SKW B;  6GSY A;  4IQA A;  1ZCP A;  3UAR A;  2F9S A;  2DJ0 A;  4TXO B;  2TIR A;  2P5Q A;  1GLP A;  3KCM A;  1TW9 A;  1OKT A;  4PQI A;  5A5K A;  4IHU A;  1TK8 B;  4ZBA A;  4K8M A;  5ECH B;  5E4W A;  3TDG A;  3E9J B;  3WGD A;  5GAP D;  1XWC A;  2GQM A;  1UA5 A;  4ZB8 A;  3IA1 A;  3O76 A;  2WS2 A;  2LTK A;  4KF9 A;  6GSW A;  4MK3 A;  2VM1 A;  3VK9 A;  4L0W A;  2JL4 A;  5A4U A;  3Q6O A;  2H1A A;  3CXG A;  1XXU A;  3DWV A;  3FZ4 A;  5IIZ A;  4K7I A;  1GSS A;  3QFB C;  2DIZ A;  2H66 A;  2OA7 A;  2E2G A;  2E0Q A;  3BD2 A;  4IW9 A;  5CRE A;  1T7P B;  3TRQ A;  3US3 A;  1TK5 B;  1ON4 A;  4GCI A;  2B1L A;  5HR1 A;  2GZP A;  4LA1 A;  3LYP A;  1PN9 A;  5AIS A;  1ZOF A;  3CSI A;  4GTU A;  3GTU B;  1GWC A;  1ERT A;  4F82 A;  5L71 A;  2AV4 A;  3JCM L;  3GIX A;  1ILO A;  3EWL A;  2I1U A;  1K0A A;  1B4Q A;  3ISO A;  3UJ1 A;  3UEM A;  1Q98 A;  1TRS A;  3UL3 A;  4OMV A;  2PUK C;  1M2B A;  4J57 E;  5AN1 A;  5ECN B;  2V2G A;  3LG6 A;  3O3T A;  2IMD A;  4GSS A;  1B9Y C;  3QAW A;  3FKF A;  4IEL A;  2O85 A;  1V40 A;  1PX7 A;  4PUA A;  5ID2 B;  5J41 A;  4YAV A;  4XCS A;  5LD0 A;  1JFU A;  3KP8 A;  2GQL A;  2GSQ A;  1EP8 A;  1Q4J A;  2IIY A;  1M2D A;  4K7N A;  2CX3 A;  4N0Z A;  3HJM A;  1XIY A;  3PGT A;  2BJX A;  3ZL5 A;  3Q19 A;  4G9H A;  4E8H A;  1K0D A;  2CAQ A;  2IN3 A;  4MCU A;  1VGL A;  3UAP A;  1WRY A;  4GRF A;  2KP1 A;  2FWF A;  1V2A A;  2B5E A;  4XS4 A;  4MF6 A;  16GS A;  4KDX A;  3F63 A;  5CRW A;  4TR4 A;  3WGE A;  4DSS B;  1EV9 A;  5FT3 A;  4JBB A;  3IRA A;  2DIY A;  5HR3 A;  1F3B A;  4K9Z A;  3LSZ A;  3CBU A;  1UC7 A;  3KP9 A;  3QMX A;  1QFN A;  2VAF A;  4AJ7 A;  4L5L A;  3PR8 A;  1QXH A;  4DSR A;  2HRK A;  5IPG A;  1Y6E A;  3TKP A;  3TRP A;  1XVW A;  3U6V A;  1QMV A;  2IJY A;  2VL3 A;  4FO5 A;  3LQ7 A;  2PGT A;  3S9F A;  2H1D A;  2I3Y A;  1FB6 A;  3TB2 A;  2L4C A;  3HDC A;  5D93 A;  3DXB A;  2HLS A;  5GST A;  5IOW A;  3UIW A;  1TOF A;  2EIQ A;  2GT5 A;  2RUE A;  4AGS A;  2R5G A;  1GUM A;  3D0Z A;  5F05 A;  1WJK A;  3C71 A;  1TDI A;  1I9D A;  1ZZY A;  2KLX A;  2P31 A;  1XW5 A;  1A8Y A;  3MWH A;  1BQ7 A;  2C4J A;  5COH A;  1X9M B;  3HYP A;  2LJK A;  1JHB A;  4X43 A;  2PPT A;  2K8S A;  2X8C A;  3TKR A;  3A2X A;  2EIR A;  3CTG A;  5D9V A;  5DAL B;  1TU7 A;  2YCD A;  1WP0 A;  5HFG A;  1FVK A;  4N0V A;  4BA7 A;  3L4N A;  1PKW A;  5ENU A;  1TK0 B;  2VM2 A;  3I43 A;  1OC8 A;  2WZ9 A;  3L9U A;  3O6T A;  1JZO A;  2CZ2 A;  2XBI A;  2VCW A;  1QK8 A;  4IQ1 A;  1S3C A;  3FK8 A;  4ML6 A;  5EY6 A;  1X0R A;  4EKZ A;  4WR4 A;  4KGI A;  4PUR A;  2O87 A;  4IP6 A;  2LJA A;  4JZQ A;  1KTE A;  2IME A;  2PVQ A;  4HJ2 A;  3EMX A;  4ZIL A;  9GSS A;  3A3T A;  2N5A A;  2DSA A;  3ZIV A;  4EDY A;  2ES7 A;  4GSN A;  5AIV A;  4AJ6 A;  4LL4 B;  2OKA A;  3HHV A;  2MMA A;  5DAK A;  3N5O A;  4LMW A;  4KAE A;  5B8A A;  4OFT A;  1O8W A;  2K8V A;  4MJE A;  2O8V B;  3MSZ A;  3R3E A;  2X64 A;  3G7J A;  2YWI A;  1R7H A;  3PH9 A;  1V9W A;  4BVY B;  4MA9 A;  1GNE A;  3GH9 A;  4G19 A;  3QR6 A;  1K3Y A;  5HFI A;  2C3Q A;  5DCH A;  2HSM A;  2A4V A;  1EZK A;  2PBJ A;  1EGO A;  5H5R A;  5ECM B;  3LXT A;  5IMA A;  2P0G A;  3GX0 A;  4N30 A;  4X1U A;  3P8W A;  2GT6 A;  2NBS A;  4NXI A;  4L5O A;  1AXD A;  4ULX A;  2V6K A;  1CQG A;  2VLV A;  3EE2 A;  1JZW A;  4TN8 A;  1BG5 A;  2MMZ A;  1O8X A;  2OAC A;  2H70 A;  4TOP A;  4EVM A;  4EC0 A;  1ZL9 A;  4JU5 A;  1JLW A;  1PSQ A;  3UOM A;  3EIN A;  2I81 A;  3FY7 A;  3E3E A;  1RQM A;  1USB A;  1ML6 A;  4NHZ A;  4HDE A;  3ERG A;  2AUV A;  1O6J A;  1HQO A;  5IMV A;  1OE8 A;  2HQT A;  3IDV A;  4J56 E;  3CTF A;  4USS A;  4KCE A;  1MDI A;  3ZMK A;  4F03 A;  5J9C A;  2V1M A;  1MD4 A;  4LLR A;  3GHA A;  3GKM A;  3W6G A;  2I9H A;  1VRS D;  5ELG A;  1GH2 A;  5AIX A;  2HYX A;  4L0U A;  6GSV A;  1XW9 A;  4KW6 A;  1AQV A;  5CRH A;  3L78 A;  2VL9 A;  5KN3 A;  2NDO A;  2HSH A;  4O92 A;  5HFK A;  1VF4 A;  4EDZ A;  2JZR A;  3GFK A;  4V1A g;  5ABR A;  2B7K A;  4ILF A;  1K0C A;  1AIU A;  4P3Y B;  1EGR A;  4KB3 A;  2FHE A;  1ERU A;  3LJR A;  3KH9 A;  2VD1 A;  3J7Y b;  2GVP A;  2BMX A;  3D5J A;  4NV2 A;  5INY A;  2JU5 A;  4HUA A;  2C3T A;  2JAD A;  2OE1 A;  1HNA A;  2HI7 A;  4ECB A;  1JZD A;  3D4T A;  2VLT A;  1YKC A;  3FYG A;  4XIH A;  4JR6 A;  6GSS A;  2M46 A;  3RPP A;  5CYY A;  3DVW A;  4ECC A;  3TKQ A;  2YNX A;  3GH6 A;  3E0U A;  3DD3 A;  5CNW A;  4WF4 A;  1AQW A;  2K6V A;  3ED3 A;  1YF0 A;  2DJ2 A;  3IXR A;  3PPU A;  1X9S B;  3FW2 A;  3FZ5 A;  2O89 A;  1I5G A;  5IPH A;  4D73 A;  3F9U A;  4IVF A;  5DVB A;  1FW1 A;  4OO5 A;  3VPQ A;  1SK0 A;  2CQ9 A;  2PU9 C;  3KEB A;  3KD0 A;  3H79 A;  3HZ4 A;  4RI7 A;  3HCZ A;  1ZMA A;  3F0I A;  3ZVJ D;  1G0T A;  3H8Q A;  3GX8 A;  3APS A;  3VWW A;  3TGZ A;  4BWQ A;  1FO5 A;  2CZ3 A;  5CP1 A;  1BAY A;  2VCQ A;  3QAV A;  2OE3 A;  1K0N A;  4IBP A;  5D73 A;  4XS4 B;  4MF5 A;  1YJ6 A;  4KA0 A;  4E8E A;  5J5N A;  1BED A;  5A4W A;  3RDW A;  3H4K A;  3IV4 A;  2LS5 A;  4NPB A;  2MZC A;  4F0B A;  2OBK A;  6GSU A;  1SJZ A;  5F8B A;  1EWX A;  1F37 A;  2CVD A;  1M99 A;  3UVT A;  1Z9H A;  1T4Z A;  2YWN A;  3D22 A;  2HRK B;  3IR4 A;  1AQX A;  2AAW A;  1SYX A;  1THX A;  3M3M A;  1SKR B;  4OFN A;  1XPV A;  3KM6 A;  4HZ2 A;  1WPI A;  1KBN A;  4OO4 A;  2YPM A;  1LU4 A;  3EU4 A;  4ACS A;  2HZE A;  4ZL7 A;  4WBJ A;  4FYB A;  5G2Z A;  2YV7 A;  5ECQ B;  1R5A A;  3TJB A;  5BMU A;  1F3A A;  2E7P A;  4ZB6 A;  3F4S A;  4KSM A;  1K0M A;  4LMV A;  1GLQ A;  2L5L A;  3N9J A;  3DRN A;  5DJL A;  3IOS A;  2RII A;  2HRN A;  2FA4 A;  2K18 A;  4K7O A;  8GSS A;  5KN1 A;  2LQQ A;  5IMF A;  2OJL A;  3HJP A;  1KNG A;  1Z7R A;  2JAC A;  3WGX A;  1H75 A;  2HT9 A;  1SL1 B;  3P90 A;  4ECI A;  1OE7 A;  1JZR A;  4CHS A;  4QL7 A;  4YQM A;  4MLY A;  1NW2 A;  2FWH A;  3TJJ A;  4MZB A;  18GS A;  4MDC A;  5EVO A;  4YQU A;  1UVZ A;  2JSZ A;  3ME7 A;  2G0F A;  2L6C A;  1M2A A;  4YH2 A;  5A4V A;  3D21 A;  2IMF A;  5B7C A;  3F8U A;  5DAK B;  2E2M A;  3HZ8 A;  5JWQ B;  4IKH A;  1WMJ A;  2AYT A;  3KMO A;  3GA4 A;  1A2J A;  1OVN A;  1B48 A;  1YF1 A;  3MDK A;  1ERW A;  7GSS A;  4GQC A;  3ZFB A;  5IQY A;  2K9F A;  3GL3 A;  2HE3 A;  1K0O A;  5DQS A;  2C80 A;  2FNO A;  4V1A p;  3IHQ A;  2HSM B;  1ABA A;  3UBL A;  4KH7 A;  2ZUP A;  4IJ3 A;  3CRU A;  2AJQ B;  2HXK A;  3CSJ A;  1V57 A;  3J7Y k;  1YDK A;  1Z6N A;  5IO2 A;  3RHB A;  5ECS A;  3LFL A;  4ML1 A;  3HXS A;  2LKU A;  4AF2 A;  3ZRE A;  1PKZ A;  3IBH A;  4Q5N A;  2OBI A;  3GSS A;  2LRC A;  3VWV A;  4HU9 A;  1LBK A;  2FD3 A;  4MH3 A;  3VUR A;  1A2L A;  2WJU A;  4KND A;  3RBT A;  1OAZ A;  2WDU A;  2IL3 A;  2AHE A;  2HNL A;  2N5B A;  3M1G A;  1AC1 A;  5F06 A;  2TRX A;  4POM A;  2H01 A;  4MPF A;  3CYN A;  4OWY A;  4BVX A;  1G7O A;  3KTB A;  1YEP A;  1J08 A;  3ZVJ A;  4IN0 A;  3KIJ A;  3FRC A;  1IYI A;  4TR1 A;  4EXJ A;  1MDJ A;  3TJF A;  3GMF A;  1R26 A;  1K3L A;  3RHC A;  4I2U A;  1M9A A;  3FR6 A;  4ZB9 A;  1SD8 A;  1LJR A;  4QL9 A;  2XPD A;  1M0U A;  1F6M C;  2QGV A;  1XWG A;  4HQZ A;  1TXX A;  3Q18 A;  3ZIJ A;  4TRX A;  1AUC A;  4PX1 A;  3P7X A;  3HVV A;  22GS A;  5JWR B;  3HD5 A;  2F8A A;  3ME8 A;  4TXV A;  4V2N A;  5DBQ A;  2H1B A;  1XBS A;  2WFC A;  3ZZX A;  2H6Z A;  2B1K A;  2LNS A;  5HR2 A;  2C0G A;  3A2V A;  1H4O A;  1E6B A;  1NSW A;  5J4U A;  2IFQ A;  1GTB A;  4NAX A;  1DE2 A;  4Z7X A;  5G5F A;  3I6A A;  2YWM A;  3BJ5 A;  3UBK A;  1A8L A;  1CQH A;  3GYK A;  5G30 A;  1VF2 A;  3QAG A;  5CRD A;  4D73 B;  1SJ6 A;  2IPA A;  5F0G A;  1PD2 1;  2WRT A;  1T8E B;  3C73 A;  4I6X A;  1EEJ A;  2VCZ A;  2VOC A;  1O7U A;  2RM6 A;  4MJA A;  2XHF A;  4RI6 A;  2LQO A;  5CAX A;  5B8B A;  2VLU A;  4O7H A;  2MMN A;  4HQS A;  3TKS E;  2WGR A;  4MF7 A;  5ECI B;  3F6F A;  4G0I A;  2GZZ A;  2FWE A;  3UMA A;  4I97 A;  2PVO C;  2FGX A;  1O73 A;  2KP2 A;  4Q5F A;  4XTS A;  3IK9 A;  3IPZ A;  1U88 A;  2A2S A;  1XZO A;  2WUL A;  4PNF A;  1G6W A;  3VWX A;  1J9B A;  2JZT A;  5ECK B;  3QFA C;  4F0C A;  4Q5Q A;  2QKE A;  1WIK A;  2D2Z A;  4IS0 A;  1TI3 A;  1SKS B;  4POK A;  2MBT A;  1J0F A;  4GF0 A;  3GKK A;  12GS A;  2LST A;  1WE0 A;  2YZH A;  4I8B A;  4JE1 A;  2GS3 A;  4DVC A;  2FLS A;  2GLR A;  4GWR A;  3K8N A;  3LGC A;  3RAZ A;  11GS A;  1Z6M A;  4HEA 2;  1U3A A;  1YKA A;  1T3B A;  3ERW A;  2HRA A;  3L9V A;  4K0N A;  3V1W A;  3QCP A;  2HZE B;  4K1F A;  5HR0 A;  1C72 A;  1RW1 A;  4CDO A;  2H76 A;  2PN8 A;  1PL1 A;  5KN0 A;  4IJI A;  3H93 A;  3GL5 A;  3UVH A;  1BJX A;  3KXO A;  2X8H A;  1EOG A;  4ZL8 A;  1K3O A;  4ZIJ A;  1T00 A;  1DUG A;  1NHO A;  3W8S A;  2H6X A;  3VPT A;  1S3A A;  5LNK e;  3F4R A;  3GUR A;  3FEU A;  1XCC A;  2HFD A;  4G10 A;  1HNC A;  4WKW A;  3BCI A;  4F9Z A;  2GSR A;  1ERV A;  1FAA A;  1GSF A;  3HJO A;  5DJM A;  4MH2 A;  4PQH A; 
#chains in the Genus database with same CATH topology
 2VCV A;  4EO3 A;  4XRA A;  2HSN B;  1FVJ A;  1DE1 A;  4RQX A;  3CQF A;  4POL A;  2I4A A;  4HS1 A;  5CRG A;  5E59 A;  3QOU A;  4A5P A;  5GAN D;  5D9T A;  2FCH A;  4O5R A;  1R4W A;  3FHK A;  1B9X C;  2DJJ A;  5ECL B;  4HU7 A;  3OR5 A;  2LRT A;  4MMM A;  4KE3 A;  2ZCT A;  1SD9 A;  4HOJ A;  3APQ A;  1E2Y A;  1O81 A;  1U87 A;  3QD9 A;  2R0G A;  1M3I A;  1W4V A;  1MTC A;  3SWL A;  3L9S A;  1QGV A;  1FOV A;  5DDL A;  13GS A;  1AAZ A;  1GSY A;  3VFI A;  2CVB A;  3VI7 A;  3APO A;  1A2M A;  3DYR A;  4PNG A;  4WR5 A;  1AW9 A;  1N2A A;  4ISD A;  2F51 A;  1S4B P;  5KOX A;  2YJ7 A;  3EUR A;  5H5S A;  1OYJ A;  1SU9 A;  2UZ8 A;  3F4T A;  4Z2R A;  3FR3 A;  1ZYE A;  4AKX B;  3GUS A;  4QQ7 A;  2PER A;  2B3S A;  2H74 A;  1F2E A;  3CSH A;  4WF5 A;  4FXY P;  1KEB A;  4K5R A;  3ZFL A;  1GTA A;  1A24 A;  2F3M A;  5GZZ B;  3BBY A;  2WZS A;  5J3R A;  4LL1 B;  1SL0 B;  1V98 A;  2LEG A;  2R37 A;  4GLT A;  2DKH A;  1ST9 A;  5IMZ A;  2ON7 A;  4YQV A;  4NWY A;  2BTO T;  4RQR A;  1QQ2 A;  3W8J A;  5LCZ A;  2KHP A;  2WVX A;  3KJY A;  2CA8 A;  4N11 A;  2WB9 A;  2ZNM A;  3HKR A;  2C1Y A;  3HMJ G;  3VI5 A;  3Q74 A;  2HRF A;  4GXZ A;  1T1V A;  1GSD A;  5G5E A;  2DLX A;  1YY7 A;  4ECJ A;  5CO3 A;  2C0D A;  2CV4 A;  2WW0 A;  3M8N A;  4BVX B;  5KEJ A;  2JZS A;  2X4A A;  4V2L A;  2C8U A;  3EVI A;  1PGT A;  1N8J A;  5ECO B;  4WXT A;  3ZYW A;  2M72 A;  2C0E A;  2GTU A;  2VUP A;  4K6X A;  1OC9 A;  4TR1 B;  4X4J A;  1HYU A;  1QUW A;  3CMI A;  1WOU A;  5ECR B;  3TJK A;  1BX9 A;  3BOA A;  4TR3 A;  4OD7 A;  1S3D A;  5J4Y A;  4KX4 A;  2CVK A;  5FWG A;  2GSS A;  1VF3 A;  1M7T A;  3TUE A;  4O32 A;  4NMU A;  2VCT A;  3C1R A;  4AJ8 A;  3DKS A;  3WD6 A;  2RM5 A;  2H6Y A;  1SYR A;  1Y25 A;  3GKX A;  6GST A;  3GN3 A;  4N10 A;  2CX4 A;  5IO0 A;  3IE3 A;  1YQ1 A;  5H5Q A;  3TKS A;  2DJK A;  2R2J A;  1XOA A;  4BWS A;  1OKD A;  14GS A;  1B4P A;  2J23 A;  4MPG A;  4JRR A;  2B5X A;  2G2Q A;  4AKH A;  2V32 A;  1FG4 A;  2MBS A;  3KTL A;  3VLN A;  2YOI A;  4IGJ A;  2TRC P;  4KDY A;  1TJD A;  1W89 A;  2IFQ B;  4PHZ C;  1GRX A;  5IMD A;  3TKS C;  1GNW A;  1M9B A;  4ICY A;  4IP1 A;  2DJ3 A;  2KOK A;  1X5E A;  4EL1 A;  2F8F A;  5JWO B;  1DBY A;  3FZA A;  2B7J A;  2J9H A;  3NIV A;  5D8I A;  5DQY A;  4GST A;  2IMI A;  4KUN A;  1TI1 A;  3KH7 A;  3GNJ A;  2FY6 A;  4JR4 A;  3DVX A;  1MEK A;  3ERF A;  4XRD A;  4HJM A;  1XVQ A;  3F6D A;  1NHY A;  5IMC A;  3GV1 A;  4GQF A;  2H72 A;  3LXZ A;  1ZYP A;  4TW5 A;  3MNG A;  2V41 A;  2H0I A;  2WVZ A;  2YP6 A;  4F2I A;  4OFM A;  1TRU A;  2KUC A;  1PX6 A;  3A5W A;  4Q5R A;  1O85 A;  2LUS A;  1GSE A;  1A0R P;  5FHI A;  3M0F A;  3AY8 A;  4MZW A;  2GDR A;  3WT1 A;  2VD0 A;  2P5R A;  3GST A;  1DSB A;  1X9W B;  4MJB A;  5G1K A;  5EL8 A;  1JLV A;  4PTS A;  3GRX A;  3IC8 A;  1A23 A;  1V58 A;  1THO A;  3KZQ A;  1URM A;  4I5Q A;  1SVO A;  2XC2 A;  3HVX A;  2NVL A;  3ZIT A;  3GKN A;  1SL2 B;  2N5F A;  3WYW A;  2R4V A;  2H19 A;  5D9W A;  1WWJ A;  5IM9 A;  1F9M A;  2ALB A;  4BL7 A;  4ZBD A;  5B6M A;  2C0F A;  3IC4 A;  4TXO A;  4CW9 A;  1GTI A;  4XS1 A;  4G0K A;  4ZL9 A;  4WEY A;  3P2A A;  3HY2 A;  2WW3 A;  1GL8 A;  2L57 A;  1XWA A;  1B8X A;  1GUL A;  2H73 A;  4EF0 A;  2H75 A;  3NZN A;  2GZY A;  2XPE A;  4KSO A;  2L5O A;  4MZC A;  3PIN A;  2DJ1 A;  3CHX C;  5G1L A;  2B5Y A;  3HVN A;  1EV4 A;  2JSY A;  1EOH A;  2QC7 A;  2LJR A;  4MJC A;  2DC5 A;  3DGQ A;  1SEN A;  4FYC A;  4WBR D;  1TTZ A;  5F07 A;  3QDN A;  3HA9 A;  2AB6 A;  5JCG A;  1X5C A;  3KGK A;  4X0X A;  1VF1 A;  5IOX A;  1EEM A;  2X99 A;  3TJG A;  5B6N A;  4KDU A;  1TRV A;  3G9B A;  1T4Y A;  4ZXG A;  5ELA A;  2MYG A;  2HSY A;  3TRX A;  3TOT A;  3GTU A;  1YZX A;  1K0B A;  3FR9 A;  10GS A;  3LW9 A;  1NM3 A;  1PL2 A;  1GUK A;  3D6I A;  3DML A;  4KCA A;  1RK4 A;  2DBC A;  1XW6 A;  3ZLP A;  1Z3E A;  3TOU A;  3IAM 2;  2LV3 A;  2YN1 A;  4PQ1 A;  3C7M A;  2M80 A;  4PXO A;  4ZBB A;  1ACV A;  2CT6 A;  5ID2 A;  2QA2 A;  4NV5 A;  4TKY A;  1FHE A;  2UV8 G;  3H1N A;  5AGY A;  2A2R A;  3G7Y A;  2HZF A;  2IWT A;  2VL2 A;  2NPB A;  4G2E A;  4RUV A;  1MDK A;  2GST A;  2RUF A;  1TU8 A;  4DEJ A;  1SJI A;  2R3X A;  2WVX B;  2R6K A;  3TCO A;  1GSQ A;  5GSS A;  4DSQ A;  2H0G A;  1ZYQ B;  5G31 A;  6GSX A;  1EP7 A;  2ON5 A;  4TVE A;  4I2T A;  4FYU A;  1PMT A;  4TR0 A;  5JCW A;  2L6D A;  2NTO A;  3ZTL A;  4G0L A;  5ECP B;  4PGT A;  2VL2 C;  4ZB7 A;  2FUG 2;  4V2M A;  3I9V 2;  3A2W A;  1GSU A;  4K0G A;  3MAK A;  2A4H A;  2O7K A;  2CAI A;  1OC9 B;  3QPM A;  5D96 A;  4FIW A;  1X5D A;  5J9B A;  20GS A;  1Z7P A;  1ZYN A;  5EPF A;  2GQK A;  2EC4 A;  3FMW A;  3LYK A;  4H86 A;  1XWB A;  3BCK A;  3HVS A;  4DSS A;  1UN2 A;  1OC3 A;  1GTU A;  2XBQ A;  5C04 A;  2YWO A;  3DEX A;  3G7I A;  1R5P A;  1U3I A;  4L8E A;  2B6M A;  2H1G A;  3EYT A;  2V6O A;  4MP4 A;  2FA8 A;  1TRW A;  2L59 A;  5A34 A;  4MNN A;  1BYE A;  2IMK A;  4WET A;  4XS6 A;  1IYH A;  2L4Q A;  4NHW A;  3U5R E;  3IAS 2;  3NOF A;  4XHM A;  2C3N A;  1XOB A;  4E68 A;  3M9K A;  2O5V A;  3DIE A;  1XWK A;  3EU3 A;  1Z5Y E;  1XFL A;  4K2D A;  3IK7 A;  2VO4 A;  2PWJ A;  1FB0 A;  3C1S A;  4EE0 A;  2LNT A;  1MD3 A;  2EFC A;  3KMN A;  3RPN A;  2YAN A;  1TP9 A;  4HI7 A;  1PQN A;  2QSI A;  2EFD A;  2OE0 A;  2VIM A;  3EC3 A;  2H71 A;  4PUF C;  2LRN A;  1YEX A;  2FWG A;  5DAL A;  3LWA A;  5DCG A;  4ID0 A;  2OAD A;  4EUY A;  2PMT A;  3LOR A;  2YV9 A;  3M9J A;  3SBC A;  1S3R A;  2H30 A;  4AI6 A;  3EMP A;  3R2Q A;  1G6Y A;  3CRT A;  4MAB A;  4FH8 A;  1HD2 A;  2RLI A;  1U6T A;  4POB A;  3L0H A;  2GGT A;  5C00 A;  1HNB A;  3RFR C;  5HQP A;  3D4M A;  1SK1 A;  2VCX A;  5JCU A;  4J2F A;  2WCI A;  3I69 A;  3VWU A;  2X8G A;  3ZRD A;  2H8L A;  4OCF A;  2DML A;  2Z9S A;  5KN2 A;  3F3Q A;  4JED A;  3ZML A;  2R0C A;  1GP1 A;  1A0F A;  1PA3 A;  4YAP A;  2H0H A;  2MMO A;  4FQU A;  2OT3 A;  4BPY A;  4HZ4 A;  2YZU A;  3LEF A;  3F3R A;  4BVY A;  1TKD B;  2DMM A;  3WT2 A;  4OCE A;  5D9X A;  1SK2 A;  1PRX A;  2REM A;  2YJH A;  2EIO A;  1M3J A;  17GS A;  3C8E A;  3FZ9 A;  1GUH A;  19GS A;  2EFE A;  1ZGN A;  1G7E A;  4BL7 B;  1SKW B;  6GSY A;  4IQA A;  1ZCP A;  3UAR A;  2F9S A;  2DJ0 A;  4TXO B;  2TIR A;  5A5H A;  2P5Q A;  1GLP A;  3KCM A;  1TW9 A;  1YVL A;  1OKT A;  4PQI A;  5A5K A;  4IHU A;  1TK8 B;  4ZBA A;  4K8M A;  5ECH B;  5E4W A;  3TDG A;  3E9J B;  3WGD A;  5GAP D;  1XWC A;  2GQM A;  1UA5 A;  4ZB8 A;  3IA1 A;  3O76 A;  2WS2 A;  2LTK A;  4KF9 A;  6GSW A;  4MK3 A;  2VM1 A;  3VK9 A;  4L0W A;  2JL4 A;  5A4U A;  3Q6O A;  2H1A A;  3CXG A;  1XXU A;  3DWV A;  3FZ4 A;  2WW1 A;  5IIZ A;  4K7I A;  1GSS A;  3QFB C;  2DIZ A;  2H66 A;  2OA7 A;  2E2G A;  2E0Q A;  3BD2 A;  4IW9 A;  5CRE A;  1T7P B;  3TRQ A;  3US3 A;  1TK5 B;  1ON4 A;  4GCI A;  2B1L A;  5HR1 A;  2GZP A;  4LA1 A;  3LYP A;  1PN9 A;  5AIS A;  1ZOF A;  3MIX A;  3CSI A;  4GTU A;  3GTU B;  1GWC A;  1ERT A;  4F82 A;  5L71 A;  2AV4 A;  3JCM L;  3GIX A;  1ILO A;  3EWL A;  2I1U A;  1K0A A;  1B4Q A;  3ISO A;  3UJ1 A;  3UEM A;  1Q98 A;  1TRS A;  3UL3 A;  4OMV A;  2PUK C;  1M2B A;  4J57 E;  5AN1 A;  5ECN B;  4G01 A;  2V2G A;  3LG6 A;  3O3T A;  2IMD A;  4GSS A;  1B9Y C;  3QAW A;  3FKF A;  4IEL A;  2O85 A;  4Z2T A;  1V40 A;  1PX7 A;  4PUA A;  5ID2 B;  5J41 A;  2QA1 A;  4YAV A;  4XCS A;  5LD0 A;  1JFU A;  3KP8 A;  2GQL A;  2GSQ A;  1EP8 A;  1Q4J A;  2IIY A;  1M2D A;  4K7N A;  2CX3 A;  4N0Z A;  3HJM A;  1XIY A;  3PGT A;  2BJX A;  1I1I P;  3ZL5 A;  3Q19 A;  4G9H A;  4E8H A;  1K0D A;  2CAQ A;  2IN3 A;  4MCU A;  1VGL A;  3UAP A;  1WRY A;  4GRF A;  2KP1 A;  2FWF A;  1V2A A;  2B5E A;  4XS4 A;  4MF6 A;  16GS A;  4YKG A;  4KDX A;  3F63 A;  5CRW A;  4TR4 A;  3WGE A;  4DSS B;  1EV9 A;  5FT3 A;  4JBB A;  3IRA A;  2DIY A;  5HR3 A;  1F3B A;  4K9Z A;  3LSZ A;  3CBU A;  1UC7 A;  3KP9 A;  3QMX A;  1QFN A;  5A34 B;  2VAF A;  4AJ7 A;  4L5L A;  3PR8 A;  1QXH A;  4DSR A;  2HRK A;  5IPG A;  1Y6E A;  3TKP A;  3TRP A;  1XVW A;  3U6V A;  1QMV A;  2IJY A;  2VL3 A;  4FO5 A;  3LQ7 A;  2PGT A;  3S9F A;  2H1D A;  2I3Y A;  1FB6 A;  3TB2 A;  2L4C A;  3HDC A;  5D93 A;  3DXB A;  2HLS A;  5GST A;  5BRT A;  5IOW A;  3UIW A;  1TOF A;  2EIQ A;  2GT5 A;  2RUE A;  4AGS A;  2R5G A;  1GUM A;  3D0Z A;  5F05 A;  1WJK A;  3C71 A;  1TDI A;  1I9D A;  1ZZY A;  2KLX A;  2P31 A;  1XW5 A;  1A8Y A;  3MWH A;  1BQ7 A;  2C4J A;  5COH A;  1X9M B;  3HYP A;  2LJK A;  1JHB A;  4EIP A;  4X43 A;  2PPT A;  2K8S A;  2X8C A;  3TKR A;  3A2X A;  2EIR A;  3CTG A;  5D9V A;  5DAL B;  1TU7 A;  2YCD A;  1WP0 A;  5HFG A;  1FVK A;  4N0V A;  4BA7 A;  3L4N A;  1XG8 A;  1PKW A;  5ENU A;  1TK0 B;  2VM2 A;  3I43 A;  1OC8 A;  2WZ9 A;  3L9U A;  3O6T A;  1JZO A;  2CZ2 A;  2XBI A;  2VCW A;  1QK8 A;  4IQ1 A;  1S3C A;  3FK8 A;  4ML6 A;  5EY6 A;  1X0R A;  4EKZ A;  4WR4 A;  4KGI A;  4PUR A;  2O87 A;  4IP6 A;  2LJA A;  4JZQ A;  1KTE A;  2IME A;  2PVQ A;  4HJ2 A;  3EMX A;  4ZIL A;  9GSS A;  3A3T A;  2N5A A;  2DSA A;  3ZIV A;  4EDY A;  2ES7 A;  4GSN A;  5AIV A;  3RGB C;  4AJ6 A;  4LL4 B;  2OKA A;  3IHG A;  3HHV A;  2MMA A;  5DAK A;  3N5O A;  4LMW A;  4KAE A;  5B8A A;  4OFT A;  1O8W A;  2K8V A;  4MJE A;  4K5S A;  2O8V B;  3MSZ A;  3R3E A;  2X64 A;  3G7J A;  2YWI A;  1R7H A;  3PH9 A;  1V9W A;  4BIK A;  4BVY B;  4MA9 A;  1GNE A;  1PFO A;  3GH9 A;  4G19 A;  3QR6 A;  1K3Y A;  5HFI A;  2A2P A;  2C3Q A;  5DCH A;  2HSM A;  2A4V A;  1EZK A;  2PBJ A;  1EGO A;  5H5R A;  5ECM B;  3LXT A;  5IMA A;  2P0G A;  3GX0 A;  4N30 A;  4X1U A;  3P8W A;  2GT6 A;  2NBS A;  3CWG A;  4NXI A;  4CY8 A;  4L5O A;  1AXD A;  4ULX A;  2V6K A;  1CQG A;  2VLV A;  5A5H B;  3EE2 A;  1JZW A;  4TN8 A;  1BG5 A;  2MMZ A;  1O8X A;  2OAC A;  2H70 A;  4TOP A;  4EVM A;  4EC0 A;  1ZL9 A;  4JU5 A;  1JLW A;  1PSQ A;  3UOM A;  3EIN A;  2I81 A;  3FY7 A;  3E3E A;  1RQM A;  1USB A;  1ML6 A;  4NHZ A;  5A1N A;  4HDE A;  3ERG A;  2AUV A;  1O6J A;  1HQO A;  5IMV A;  1OE8 A;  2HQT A;  3IDV A;  4J56 E;  3CTF A;  4USS A;  4KCE A;  1MDI A;  3ZMK A;  4F03 A;  5J9C A;  2V1M A;  1MD4 A;  4LLR A;  3GHA A;  3GKM A;  3W6G A;  2I9H A;  1VRS D;  5ELG A;  1GH2 A;  5AIX A;  2HYX A;  4L0U A;  6GSV A;  1XW9 A;  4KW6 A;  1AQV A;  5CRH A;  2O36 A;  3L78 A;  2VL9 A;  5KN3 A;  2NDO A;  2HSH A;  4O92 A;  5HFK A;  1VF4 A;  4EDZ A;  2JZR A;  3GFK A;  4V1A g;  2H1L A;  5ABR A;  2B7K A;  4ILF A;  1K0C A;  1AIU A;  4Z2U A;  4P3Y B;  1EGR A;  4KB3 A;  2FHE A;  1ERU A;  3LJR A;  3KH9 A;  2VD1 A;  3J7Y b;  4W66 A;  2GVP A;  2BMX A;  3D5J A;  4NV2 A;  5INY A;  2JU5 A;  4HUA A;  2C3T A;  2JAD A;  2OE1 A;  1HNA A;  2HI7 A;  4ECB A;  4PI0 C;  1JZD A;  3D4T A;  2VLT A;  1YKC A;  3FYG A;  4XIH A;  4JR6 A;  6GSS A;  2M46 A;  3RPP A;  5CYY A;  3DVW A;  4ECC A;  3TKQ A;  2YNX A;  3GH6 A;  3E0U A;  3DD3 A;  5CNW A;  3TU3 B;  4WF4 A;  1AQW A;  2K6V A;  3ED3 A;  1YF0 A;  2DJ2 A;  3IXR A;  3PPU A;  1X9S B;  3FW2 A;  3FZ5 A;  2O89 A;  1I5G A;  5IPH A;  4D73 A;  3F9U A;  4IVF A;  5DVB A;  1FW1 A;  4OO5 A;  3VPQ A;  1SK0 A;  2CQ9 A;  2PU9 C;  3KEB A;  3KD0 A;  3H79 A;  3HZ4 A;  4RI7 A;  3HCZ A;  1ZMA A;  3F0I A;  3ZVJ D;  1G0T A;  3H8Q A;  3GX8 A;  3APS A;  3VWW A;  3TGZ A;  4BWQ A;  1FO5 A;  4O5U A;  2CZ3 A;  5CP1 A;  4AKI A;  1BAY A;  2VCQ A;  3QAV A;  2OE3 A;  1K0N A;  2EFH A;  4IBP A;  5D73 A;  4XS4 B;  4MF5 A;  4PI2 C;  1YJ6 A;  4KA0 A;  4E8E A;  5J5N A;  1BED A;  5A4W A;  3RDW A;  3H4K A;  3IV4 A;  2LS5 A;  4NPB A;  2WVY A;  2MZC A;  4F0B A;  2OBK A;  6GSU A;  1SJZ A;  4YKF A;  5F8B A;  4CY6 A;  1EWX A;  1F37 A;  2CVD A;  1M99 A;  3UVT A;  1BG1 A;  1Z9H A;  1T4Z A;  4GDF A;  2YWN A;  3D22 A;  2HRK B;  3IR4 A;  1AQX A;  2AAW A;  1SYX A;  1N25 A;  1THX A;  3M3M A;  1SKR B;  4OFN A;  1XPV A;  3KM6 A;  4HZ2 A;  1WPI A;  1KBN A;  4OO4 A;  2YPM A;  4QMK A;  1LU4 A;  3EU4 A;  4ACS A;  2HZE A;  4ZL7 A;  4WBJ A;  4FYB A;  5G2Z A;  2YV7 A;  5ECQ B;  1R5A A;  3TJB A;  5BMU A;  1F3A A;  2E7P A;  4ZB6 A;  3F4S A;  4KSM A;  4AKG A;  1K0M A;  4LMV A;  1GLQ A;  2L5L A;  2DKI A;  3N9J A;  5J47 A;  3DRN A;  5DJL A;  3IOS A;  2RII A;  1BF5 A;  2HRN A;  2R0P A;  2FA4 A;  2K18 A;  4K7O A;  8GSS A;  5KN1 A;  2LQQ A;  5IMF A;  2OJL A;  3HJP A;  1KNG A;  3A5I A;  1Z7R A;  2JAC A;  3WGX A;  1H75 A;  2HT9 A;  1SL1 B;  3P90 A;  4ECI A;  1OE7 A;  1JZR A;  4CHS A;  4QL7 A;  4YQM A;  2HSN A;  4MLY A;  1NW2 A;  2FWH A;  3TJJ A;  4MZB A;  18GS A;  4MDC A;  5EVO A;  4YQU A;  1UVZ A;  2JSZ A;  1Y1U A;  3ME7 A;  4HSC X;  2G0F A;  2L6C A;  1M2A A;  4YH2 A;  5A4V A;  3D21 A;  2IMF A;  5B7C A;  3F8U A;  5DAK B;  2E2M A;  3HZ8 A;  5JWQ B;  4K2X A;  4IKH A;  1WMJ A;  2AYT A;  3KMO A;  3GA4 A;  1A2J A;  1OVN A;  1B48 A;  1YF1 A;  3MDK A;  1ERW A;  7GSS A;  4GQC A;  3ZFB A;  5IQY A;  2K9F A;  3GL3 A;  2HE3 A;  1K0O A;  5DQS A;  2C80 A;  2FNO A;  4V1A p;  3IHQ A;  2HSM B;  1ABA A;  3UBL A;  5J4V A;  4KH7 A;  2ZUP A;  4IJ3 A;  3CRU A;  2AJQ B;  2HXK A;  3CSJ A;  2O3E A;  1V57 A;  3J7Y k;  1YDK A;  1Z6N A;  5IO2 A;  3RHB A;  5ECS A;  3LFL A;  4ML1 A;  3HXS A;  2LKU A;  4AF2 A;  3ZRE A;  1PKZ A;  3IBH A;  4Q5N A;  2OBI A;  3GSS A;  2LRC A;  3VWV A;  4HU9 A;  1LBK A;  2FD3 A;  4MH3 A;  3VUR A;  1A2L A;  2WJU A;  5A1N B;  1YEW C;  4KND A;  3RBT A;  1OAZ A;  2WDU A;  2IL3 A;  2AHE A;  2HNL A;  2N5B A;  3M1G A;  1AC1 A;  5F06 A;  2TRX A;  4POM A;  2H01 A;  4MPF A;  3CYN A;  4OWY A;  4BVX A;  1G7O A;  3KTB A;  1YEP A;  1J08 A;  3ZVJ A;  4IN0 A;  3KIJ A;  3FRC A;  1IYI A;  4TR1 A;  4EXJ A;  1MDJ A;  3TJF A;  3GMF A;  2X49 A;  1R26 A;  1K3L A;  3RHC A;  4I2U A;  1M9A A;  3FR6 A;  4ZB9 A;  1SD8 A;  4EIQ A;  1LJR A;  4QL9 A;  2XPD A;  1M0U A;  1F6M C;  2QGV A;  1XWG A;  4HQZ A;  1TXX A;  5KOW A;  3Q18 A;  3ZIJ A;  4TRX A;  1AUC A;  4PX1 A;  3P7X A;  3HVV A;  22GS A;  5JWR B;  3HD5 A;  2F8A A;  3ME8 A;  4TXV A;  4V2N A;  5DBQ A;  2H1B A;  1XBS A;  2WFC A;  3ZZX A;  2H6Z A;  5J40 A;  2B1K A;  2LNS A;  5HR2 A;  2C0G A;  3A2V A;  1H4O A;  1E6B A;  1NSW A;  5J4U A;  2IFQ A;  1GTB A;  4NAX A;  1DE2 A;  4Z7X A;  5G5F A;  3I6A A;  2YWM A;  2WW2 A;  3BJ5 A;  3UBK A;  1A8L A;  1CQH A;  3GYK A;  5G30 A;  1VF2 A;  3QAG A;  5CRD A;  4D73 B;  2VKZ G;  1SJ6 A;  2IPA A;  5F0G A;  1PD2 1;  2WRT A;  1T8E B;  3C73 A;  4I6X A;  1EEJ A;  2VCZ A;  2VOC A;  1O7U A;  2RM6 A;  4MJA A;  2XHF A;  4RI6 A;  2LQO A;  5CAX A;  5B8B A;  2VLU A;  4O7H A;  2MMN A;  4HQS A;  3TKS E;  2WGR A;  4MF7 A;  5ECI B;  3F6F A;  4G0I A;  2GZZ A;  2FWE A;  3UMA A;  4I97 A;  2PVO C;  2FGX A;  1O73 A;  2KP2 A;  4Q5F A;  4XTS A;  3IK9 A;  3IPZ A;  1U88 A;  2A2S A;  1XZO A;  2WUL A;  4PNF A;  1G6W A;  3VWX A;  1J9B A;  2JZT A;  5ECK B;  3QFA C;  1TXU A;  4F0C A;  4Q5Q A;  2QKE A;  1WIK A;  2D2Z A;  4IS0 A;  1TI3 A;  1SKS B;  4POK A;  2MBT A;  1J0F A;  4GF0 A;  3GKK A;  12GS A;  2LST A;  1WE0 A;  2YZH A;  4I8B A;  4JE1 A;  2GS3 A;  4DVC A;  2FLS A;  2GLR A;  4GWR A;  3K8N A;  3LGC A;  3RAZ A;  11GS A;  1Z6M A;  4HEA 2;  1U3A A;  1YKA A;  1T3B A;  4N3Z A;  1SVM A;  3ERW A;  2HRA A;  3L9V A;  4K0N A;  1FOH A;  3V1W A;  3QCP A;  1SVL A;  2HZE B;  4K1F A;  5HR0 A;  1C72 A;  1PN0 A;  1RW1 A;  4CDO A;  2H76 A;  5BMU B;  2PN8 A;  1PL1 A;  5KN0 A;  4IJI A;  3H93 A;  3GL5 A;  3UVH A;  1BJX A;  3KXO A;  2X8H A;  1EOG A;  4ZL8 A;  1K3O A;  4ZIJ A;  1T00 A;  1DUG A;  1NHO A;  3W8S A;  2H6X A;  3VPT A;  3MYD A;  1S3A A;  5LNK e;  3F4R A;  3GUR A;  3FEU A;  1XCC A;  2HFD A;  4G10 A;  1HNC A;  4WKW A;  3EPT A;  3BCI A;  4F9Z A;  2GSR A;  1ERV A;  1FAA A;  1GSF A;  3HJO A;  5DJM A;  4O5Q A;  4MH2 A;  4PQH A; 
#chains in the Genus database with same CATH homology
 2VCV A;  4EO3 A;  4XRA A;  2HSN B;  1FVJ A;  1DE1 A;  4RQX A;  4POL A;  2I4A A;  4HS1 A;  5CRG A;  5E59 A;  3QOU A;  4A5P A;  5GAN D;  5D9T A;  2FCH A;  4O5R A;  1R4W A;  3FHK A;  1B9X C;  2DJJ A;  5ECL B;  4HU7 A;  3OR5 A;  2LRT A;  4MMM A;  4KE3 A;  2ZCT A;  1SD9 A;  4HOJ A;  3APQ A;  1E2Y A;  1O81 A;  1U87 A;  3QD9 A;  2R0G A;  1W4V A;  1MTC A;  3SWL A;  3L9S A;  1QGV A;  1FOV A;  5DDL A;  13GS A;  1AAZ A;  1GSY A;  3VFI A;  2CVB A;  3VI7 A;  3APO A;  1A2M A;  3DYR A;  4PNG A;  4WR5 A;  1AW9 A;  1N2A A;  4ISD A;  2F51 A;  5KOX A;  2YJ7 A;  3EUR A;  5H5S A;  1OYJ A;  1SU9 A;  2UZ8 A;  3F4T A;  4Z2R A;  3FR3 A;  1ZYE A;  4AKX B;  3GUS A;  4QQ7 A;  2PER A;  2B3S A;  2H74 A;  1F2E A;  3CSH A;  4WF5 A;  1KEB A;  4K5R A;  3ZFL A;  1GTA A;  1A24 A;  2F3M A;  5GZZ B;  3BBY A;  5J3R A;  4LL1 B;  1SL0 B;  1V98 A;  2LEG A;  2R37 A;  4GLT A;  2DKH A;  1ST9 A;  5IMZ A;  2ON7 A;  4YQV A;  4NWY A;  2BTO T;  4RQR A;  1QQ2 A;  3W8J A;  5LCZ A;  2KHP A;  3KJY A;  2CA8 A;  4N11 A;  2WB9 A;  2ZNM A;  3HKR A;  2C1Y A;  3HMJ G;  3VI5 A;  3Q74 A;  2HRF A;  4GXZ A;  1T1V A;  1GSD A;  5G5E A;  2DLX A;  1YY7 A;  4ECJ A;  5CO3 A;  2C0D A;  2CV4 A;  3M8N A;  4BVX B;  5KEJ A;  2JZS A;  2X4A A;  4V2L A;  2C8U A;  3EVI A;  1PGT A;  1N8J A;  5ECO B;  4WXT A;  3ZYW A;  2M72 A;  2C0E A;  2GTU A;  2VUP A;  4K6X A;  1OC9 A;  4TR1 B;  4X4J A;  1HYU A;  1QUW A;  3CMI A;  1WOU A;  5ECR B;  3TJK A;  1BX9 A;  3BOA A;  4TR3 A;  4OD7 A;  1S3D A;  5J4Y A;  4KX4 A;  2CVK A;  5FWG A;  2GSS A;  1VF3 A;  1M7T A;  3TUE A;  4O32 A;  4NMU A;  2VCT A;  3C1R A;  4AJ8 A;  3DKS A;  3WD6 A;  2RM5 A;  2H6Y A;  1SYR A;  1Y25 A;  3GKX A;  6GST A;  3GN3 A;  4N10 A;  2CX4 A;  5IO0 A;  3IE3 A;  1YQ1 A;  5H5Q A;  3TKS A;  2DJK A;  2R2J A;  1XOA A;  4BWS A;  1OKD A;  14GS A;  1B4P A;  2J23 A;  4MPG A;  4JRR A;  2B5X A;  2G2Q A;  4AKH A;  2V32 A;  1FG4 A;  2MBS A;  3KTL A;  3VLN A;  2YOI A;  4IGJ A;  2TRC P;  4KDY A;  1TJD A;  1W89 A;  2IFQ B;  1GRX A;  5IMD A;  3TKS C;  1GNW A;  1M9B A;  4ICY A;  4IP1 A;  2DJ3 A;  2KOK A;  1X5E A;  4EL1 A;  2F8F A;  5JWO B;  1DBY A;  3FZA A;  2B7J A;  2J9H A;  3NIV A;  5D8I A;  5DQY A;  4GST A;  2IMI A;  4KUN A;  1TI1 A;  3KH7 A;  3GNJ A;  2FY6 A;  4JR4 A;  3DVX A;  1MEK A;  3ERF A;  4XRD A;  4HJM A;  1XVQ A;  3F6D A;  1NHY A;  5IMC A;  3GV1 A;  4GQF A;  2H72 A;  3LXZ A;  1ZYP A;  4TW5 A;  3MNG A;  2V41 A;  2H0I A;  2YP6 A;  4F2I A;  4OFM A;  1TRU A;  2KUC A;  1PX6 A;  3A5W A;  4Q5R A;  1O85 A;  2LUS A;  1GSE A;  1A0R P;  5FHI A;  3M0F A;  3AY8 A;  4MZW A;  2GDR A;  3WT1 A;  2VD0 A;  2P5R A;  3GST A;  1DSB A;  1X9W B;  4MJB A;  5G1K A;  5EL8 A;  1JLV A;  4PTS A;  3GRX A;  3IC8 A;  1A23 A;  1V58 A;  1THO A;  3KZQ A;  1URM A;  4I5Q A;  1SVO A;  2XC2 A;  3HVX A;  2NVL A;  3ZIT A;  3GKN A;  1SL2 B;  2N5F A;  3WYW A;  2R4V A;  2H19 A;  5D9W A;  1WWJ A;  5IM9 A;  1F9M A;  2ALB A;  4BL7 A;  4ZBD A;  5B6M A;  2C0F A;  3IC4 A;  4TXO A;  4CW9 A;  1GTI A;  4XS1 A;  4G0K A;  4ZL9 A;  4WEY A;  3P2A A;  3HY2 A;  1GL8 A;  2L57 A;  1XWA A;  1B8X A;  1GUL A;  2H73 A;  4EF0 A;  2H75 A;  3NZN A;  2GZY A;  2XPE A;  4KSO A;  2L5O A;  4MZC A;  3PIN A;  2DJ1 A;  5G1L A;  2B5Y A;  1EV4 A;  2JSY A;  1EOH A;  2QC7 A;  2LJR A;  4MJC A;  2DC5 A;  3DGQ A;  1SEN A;  4FYC A;  4WBR D;  1TTZ A;  5F07 A;  3QDN A;  3HA9 A;  2AB6 A;  5JCG A;  1X5C A;  3KGK A;  4X0X A;  1VF1 A;  5IOX A;  1EEM A;  2X99 A;  3TJG A;  5B6N A;  4KDU A;  1TRV A;  3G9B A;  1T4Y A;  4ZXG A;  5ELA A;  2MYG A;  2HSY A;  3TRX A;  3TOT A;  3GTU A;  1YZX A;  1K0B A;  3FR9 A;  10GS A;  3LW9 A;  1NM3 A;  1PL2 A;  1GUK A;  3D6I A;  3DML A;  4KCA A;  1RK4 A;  2DBC A;  1XW6 A;  3ZLP A;  1Z3E A;  3TOU A;  3IAM 2;  2LV3 A;  2YN1 A;  4PQ1 A;  3C7M A;  2M80 A;  4PXO A;  4ZBB A;  1ACV A;  2CT6 A;  5ID2 A;  2QA2 A;  4NV5 A;  4TKY A;  1FHE A;  2UV8 G;  3H1N A;  5AGY A;  2A2R A;  3G7Y A;  2HZF A;  2IWT A;  2VL2 A;  2NPB A;  4G2E A;  4RUV A;  1MDK A;  2GST A;  2RUF A;  1TU8 A;  4DEJ A;  1SJI A;  2R3X A;  2R6K A;  3TCO A;  1GSQ A;  5GSS A;  4DSQ A;  2H0G A;  1ZYQ B;  5G31 A;  6GSX A;  1EP7 A;  2ON5 A;  4TVE A;  4I2T A;  4FYU A;  1PMT A;  4TR0 A;  5JCW A;  2L6D A;  2NTO A;  3ZTL A;  4G0L A;  5ECP B;  4PGT A;  2VL2 C;  4ZB7 A;  2FUG 2;  4V2M A;  3I9V 2;  3A2W A;  1GSU A;  4K0G A;  3MAK A;  2A4H A;  2O7K A;  2CAI A;  1OC9 B;  3QPM A;  5D96 A;  4FIW A;  1X5D A;  5J9B A;  20GS A;  1Z7P A;  1ZYN A;  5EPF A;  2GQK A;  2EC4 A;  3FMW A;  3LYK A;  4H86 A;  1XWB A;  3BCK A;  3HVS A;  4DSS A;  1UN2 A;  1OC3 A;  1GTU A;  2XBQ A;  5C04 A;  2YWO A;  3DEX A;  3G7I A;  1R5P A;  1U3I A;  4L8E A;  2B6M A;  2H1G A;  3EYT A;  2V6O A;  4MP4 A;  2FA8 A;  1TRW A;  2L59 A;  5A34 A;  4MNN A;  1BYE A;  2IMK A;  4WET A;  4XS6 A;  1IYH A;  2L4Q A;  4NHW A;  3U5R E;  3IAS 2;  3NOF A;  4XHM A;  2C3N A;  1XOB A;  4E68 A;  3M9K A;  2O5V A;  3DIE A;  1XWK A;  3EU3 A;  1Z5Y E;  1XFL A;  4K2D A;  3IK7 A;  2VO4 A;  2PWJ A;  1FB0 A;  3C1S A;  4EE0 A;  2LNT A;  1MD3 A;  2EFC A;  3KMN A;  3RPN A;  2YAN A;  1TP9 A;  4HI7 A;  1PQN A;  2QSI A;  2EFD A;  2OE0 A;  2VIM A;  3EC3 A;  2H71 A;  4PUF C;  2LRN A;  1YEX A;  2FWG A;  5DAL A;  3LWA A;  5DCG A;  4ID0 A;  2OAD A;  4EUY A;  2PMT A;  3LOR A;  2YV9 A;  3M9J A;  3SBC A;  2H30 A;  4AI6 A;  3EMP A;  3R2Q A;  1G6Y A;  3CRT A;  4MAB A;  4FH8 A;  1HD2 A;  2RLI A;  1U6T A;  4POB A;  3L0H A;  2GGT A;  5C00 A;  1HNB A;  5HQP A;  3D4M A;  1SK1 A;  2VCX A;  5JCU A;  4J2F A;  2WCI A;  3I69 A;  3VWU A;  2X8G A;  3ZRD A;  2H8L A;  4OCF A;  2DML A;  2Z9S A;  5KN2 A;  3F3Q A;  4JED A;  3ZML A;  2R0C A;  1GP1 A;  1A0F A;  1PA3 A;  4YAP A;  2H0H A;  2MMO A;  4FQU A;  2OT3 A;  4BPY A;  4HZ4 A;  2YZU A;  3LEF A;  3F3R A;  4BVY A;  1TKD B;  2DMM A;  3WT2 A;  4OCE A;  5D9X A;  1SK2 A;  1PRX A;  2REM A;  2YJH A;  2EIO A;  17GS A;  3C8E A;  3FZ9 A;  1GUH A;  19GS A;  2EFE A;  1ZGN A;  1G7E A;  4BL7 B;  1SKW B;  6GSY A;  4IQA A;  1ZCP A;  3UAR A;  2F9S A;  2DJ0 A;  4TXO B;  2TIR A;  5A5H A;  2P5Q A;  1GLP A;  3KCM A;  1TW9 A;  1YVL A;  1OKT A;  4PQI A;  5A5K A;  4IHU A;  1TK8 B;  4ZBA A;  4K8M A;  5ECH B;  5E4W A;  3TDG A;  3E9J B;  3WGD A;  5GAP D;  1XWC A;  2GQM A;  1UA5 A;  4ZB8 A;  3IA1 A;  3O76 A;  2WS2 A;  2LTK A;  4KF9 A;  6GSW A;  4MK3 A;  2VM1 A;  3VK9 A;  4L0W A;  2JL4 A;  5A4U A;  3Q6O A;  2H1A A;  3CXG A;  1XXU A;  3DWV A;  3FZ4 A;  5IIZ A;  4K7I A;  1GSS A;  3QFB C;  2DIZ A;  2H66 A;  2OA7 A;  2E2G A;  2E0Q A;  3BD2 A;  4IW9 A;  5CRE A;  1T7P B;  3TRQ A;  3US3 A;  1TK5 B;  1ON4 A;  4GCI A;  2B1L A;  5HR1 A;  2GZP A;  4LA1 A;  3LYP A;  1PN9 A;  5AIS A;  1ZOF A;  3MIX A;  3CSI A;  4GTU A;  3GTU B;  1GWC A;  1ERT A;  4F82 A;  5L71 A;  2AV4 A;  3JCM L;  3GIX A;  1ILO A;  3EWL A;  2I1U A;  1K0A A;  1B4Q A;  3ISO A;  3UJ1 A;  3UEM A;  1Q98 A;  1TRS A;  3UL3 A;  4OMV A;  2PUK C;  1M2B A;  4J57 E;  5AN1 A;  5ECN B;  4G01 A;  2V2G A;  3LG6 A;  3O3T A;  2IMD A;  4GSS A;  1B9Y C;  3QAW A;  3FKF A;  4IEL A;  2O85 A;  4Z2T A;  1V40 A;  1PX7 A;  4PUA A;  5ID2 B;  5J41 A;  2QA1 A;  4YAV A;  4XCS A;  5LD0 A;  1JFU A;  3KP8 A;  2GQL A;  2GSQ A;  1EP8 A;  1Q4J A;  2IIY A;  1M2D A;  4K7N A;  2CX3 A;  4N0Z A;  3HJM A;  1XIY A;  3PGT A;  2BJX A;  3ZL5 A;  3Q19 A;  4G9H A;  4E8H A;  1K0D A;  2CAQ A;  2IN3 A;  4MCU A;  1VGL A;  3UAP A;  1WRY A;  4GRF A;  2KP1 A;  2FWF A;  1V2A A;  2B5E A;  4XS4 A;  4MF6 A;  16GS A;  4YKG A;  4KDX A;  3F63 A;  5CRW A;  4TR4 A;  3WGE A;  4DSS B;  1EV9 A;  5FT3 A;  4JBB A;  3IRA A;  2DIY A;  5HR3 A;  1F3B A;  4K9Z A;  3LSZ A;  3CBU A;  1UC7 A;  3KP9 A;  3QMX A;  1QFN A;  5A34 B;  2VAF A;  4AJ7 A;  4L5L A;  3PR8 A;  1QXH A;  4DSR A;  2HRK A;  5IPG A;  1Y6E A;  3TKP A;  3TRP A;  1XVW A;  3U6V A;  1QMV A;  2IJY A;  2VL3 A;  4FO5 A;  3LQ7 A;  2PGT A;  3S9F A;  2H1D A;  2I3Y A;  1FB6 A;  3TB2 A;  2L4C A;  3HDC A;  5D93 A;  3DXB A;  2HLS A;  5GST A;  5BRT A;  5IOW A;  3UIW A;  1TOF A;  2EIQ A;  2GT5 A;  2RUE A;  4AGS A;  2R5G A;  1GUM A;  3D0Z A;  5F05 A;  1WJK A;  3C71 A;  1TDI A;  1I9D A;  1ZZY A;  2KLX A;  2P31 A;  1XW5 A;  1A8Y A;  3MWH A;  1BQ7 A;  2C4J A;  5COH A;  1X9M B;  3HYP A;  2LJK A;  1JHB A;  4EIP A;  4X43 A;  2PPT A;  2K8S A;  2X8C A;  3TKR A;  3A2X A;  2EIR A;  3CTG A;  5D9V A;  5DAL B;  1TU7 A;  2YCD A;  1WP0 A;  5HFG A;  1FVK A;  4N0V A;  4BA7 A;  3L4N A;  1PKW A;  5ENU A;  1TK0 B;  2VM2 A;  3I43 A;  1OC8 A;  2WZ9 A;  3L9U A;  3O6T A;  1JZO A;  2CZ2 A;  2XBI A;  2VCW A;  1QK8 A;  4IQ1 A;  1S3C A;  3FK8 A;  4ML6 A;  5EY6 A;  1X0R A;  4EKZ A;  4WR4 A;  4KGI A;  4PUR A;  2O87 A;  4IP6 A;  2LJA A;  4JZQ A;  1KTE A;  2IME A;  2PVQ A;  4HJ2 A;  3EMX A;  4ZIL A;  9GSS A;  3A3T A;  2N5A A;  2DSA A;  3ZIV A;  4EDY A;  2ES7 A;  4GSN A;  5AIV A;  4AJ6 A;  4LL4 B;  2OKA A;  3IHG A;  3HHV A;  2MMA A;  5DAK A;  3N5O A;  4LMW A;  4KAE A;  5B8A A;  4OFT A;  1O8W A;  2K8V A;  4MJE A;  4K5S A;  2O8V B;  3MSZ A;  3R3E A;  2X64 A;  3G7J A;  2YWI A;  1R7H A;  3PH9 A;  1V9W A;  4BVY B;  4MA9 A;  1GNE A;  3GH9 A;  4G19 A;  3QR6 A;  1K3Y A;  5HFI A;  2A2P A;  2C3Q A;  5DCH A;  2HSM A;  2A4V A;  1EZK A;  2PBJ A;  1EGO A;  5H5R A;  5ECM B;  3LXT A;  5IMA A;  2P0G A;  3GX0 A;  4N30 A;  4X1U A;  3P8W A;  2GT6 A;  2NBS A;  3CWG A;  4NXI A;  4CY8 A;  4L5O A;  1AXD A;  4ULX A;  2V6K A;  1CQG A;  2VLV A;  5A5H B;  3EE2 A;  1JZW A;  4TN8 A;  1BG5 A;  2MMZ A;  1O8X A;  2OAC A;  2H70 A;  4TOP A;  4EVM A;  4EC0 A;  1ZL9 A;  4JU5 A;  1JLW A;  1PSQ A;  3UOM A;  3EIN A;  2I81 A;  3FY7 A;  3E3E A;  1RQM A;  1USB A;  1ML6 A;  4NHZ A;  5A1N A;  4HDE A;  3ERG A;  2AUV A;  1O6J A;  1HQO A;  5IMV A;  1OE8 A;  2HQT A;  3IDV A;  4J56 E;  3CTF A;  4USS A;  4KCE A;  1MDI A;  3ZMK A;  4F03 A;  5J9C A;  2V1M A;  1MD4 A;  4LLR A;  3GHA A;  3GKM A;  3W6G A;  2I9H A;  1VRS D;  5ELG A;  1GH2 A;  5AIX A;  2HYX A;  4L0U A;  6GSV A;  1XW9 A;  4KW6 A;  1AQV A;  5CRH A;  3L78 A;  2VL9 A;  5KN3 A;  2NDO A;  2HSH A;  4O92 A;  5HFK A;  1VF4 A;  4EDZ A;  2JZR A;  3GFK A;  4V1A g;  2H1L A;  5ABR A;  2B7K A;  4ILF A;  1K0C A;  1AIU A;  4Z2U A;  4P3Y B;  1EGR A;  4KB3 A;  2FHE A;  1ERU A;  3LJR A;  3KH9 A;  2VD1 A;  3J7Y b;  4W66 A;  2GVP A;  2BMX A;  3D5J A;  4NV2 A;  5INY A;  2JU5 A;  4HUA A;  2C3T A;  2JAD A;  2OE1 A;  1HNA A;  2HI7 A;  4ECB A;  1JZD A;  3D4T A;  2VLT A;  1YKC A;  3FYG A;  4XIH A;  4JR6 A;  6GSS A;  2M46 A;  3RPP A;  5CYY A;  3DVW A;  4ECC A;  3TKQ A;  2YNX A;  3GH6 A;  3E0U A;  3DD3 A;  5CNW A;  3TU3 B;  4WF4 A;  1AQW A;  2K6V A;  3ED3 A;  1YF0 A;  2DJ2 A;  3IXR A;  3PPU A;  1X9S B;  3FW2 A;  3FZ5 A;  2O89 A;  1I5G A;  5IPH A;  4D73 A;  3F9U A;  4IVF A;  5DVB A;  1FW1 A;  4OO5 A;  3VPQ A;  1SK0 A;  2CQ9 A;  2PU9 C;  3KEB A;  3KD0 A;  3H79 A;  3HZ4 A;  4RI7 A;  3HCZ A;  1ZMA A;  3F0I A;  3ZVJ D;  1G0T A;  3H8Q A;  3GX8 A;  3APS A;  3VWW A;  3TGZ A;  4BWQ A;  1FO5 A;  4O5U A;  2CZ3 A;  5CP1 A;  4AKI A;  1BAY A;  2VCQ A;  3QAV A;  2OE3 A;  1K0N A;  2EFH A;  4IBP A;  5D73 A;  4XS4 B;  4MF5 A;  1YJ6 A;  4KA0 A;  4E8E A;  5J5N A;  1BED A;  5A4W A;  3RDW A;  3H4K A;  3IV4 A;  2LS5 A;  4NPB A;  2MZC A;  4F0B A;  2OBK A;  6GSU A;  1SJZ A;  4YKF A;  5F8B A;  4CY6 A;  1EWX A;  1F37 A;  2CVD A;  1M99 A;  3UVT A;  1BG1 A;  1Z9H A;  1T4Z A;  4GDF A;  2YWN A;  3D22 A;  2HRK B;  3IR4 A;  1AQX A;  2AAW A;  1SYX A;  1N25 A;  1THX A;  3M3M A;  1SKR B;  4OFN A;  1XPV A;  3KM6 A;  4HZ2 A;  1WPI A;  1KBN A;  4OO4 A;  2YPM A;  4QMK A;  1LU4 A;  3EU4 A;  4ACS A;  2HZE A;  4ZL7 A;  4WBJ A;  4FYB A;  5G2Z A;  2YV7 A;  5ECQ B;  1R5A A;  3TJB A;  5BMU A;  1F3A A;  2E7P A;  4ZB6 A;  3F4S A;  4KSM A;  4AKG A;  1K0M A;  4LMV A;  1GLQ A;  2L5L A;  2DKI A;  3N9J A;  5J47 A;  3DRN A;  5DJL A;  3IOS A;  2RII A;  1BF5 A;  2HRN A;  2R0P A;  2FA4 A;  2K18 A;  4K7O A;  8GSS A;  5KN1 A;  2LQQ A;  5IMF A;  2OJL A;  3HJP A;  1KNG A;  3A5I A;  1Z7R A;  2JAC A;  3WGX A;  1H75 A;  2HT9 A;  1SL1 B;  3P90 A;  4ECI A;  1OE7 A;  1JZR A;  4CHS A;  4QL7 A;  4YQM A;  2HSN A;  4MLY A;  1NW2 A;  2FWH A;  3TJJ A;  4MZB A;  18GS A;  4MDC A;  5EVO A;  4YQU A;  1UVZ A;  2JSZ A;  1Y1U A;  3ME7 A;  2G0F A;  2L6C A;  1M2A A;  4YH2 A;  5A4V A;  3D21 A;  2IMF A;  5B7C A;  3F8U A;  5DAK B;  2E2M A;  3HZ8 A;  5JWQ B;  4K2X A;  4IKH A;  1WMJ A;  2AYT A;  3KMO A;  3GA4 A;  1A2J A;  1OVN A;  1B48 A;  1YF1 A;  3MDK A;  1ERW A;  7GSS A;  4GQC A;  3ZFB A;  5IQY A;  2K9F A;  3GL3 A;  2HE3 A;  1K0O A;  5DQS A;  2C80 A;  2FNO A;  4V1A p;  3IHQ A;  2HSM B;  1ABA A;  3UBL A;  5J4V A;  4KH7 A;  2ZUP A;  4IJ3 A;  3CRU A;  2AJQ B;  2HXK A;  3CSJ A;  1V57 A;  3J7Y k;  1YDK A;  1Z6N A;  5IO2 A;  3RHB A;  5ECS A;  3LFL A;  4ML1 A;  3HXS A;  2LKU A;  4AF2 A;  3ZRE A;  1PKZ A;  3IBH A;  4Q5N A;  2OBI A;  3GSS A;  2LRC A;  3VWV A;  4HU9 A;  1LBK A;  2FD3 A;  4MH3 A;  3VUR A;  1A2L A;  2WJU A;  5A1N B;  4KND A;  3RBT A;  1OAZ A;  2WDU A;  2IL3 A;  2AHE A;  2HNL A;  2N5B A;  3M1G A;  1AC1 A;  5F06 A;  2TRX A;  4POM A;  2H01 A;  4MPF A;  3CYN A;  4OWY A;  4BVX A;  1G7O A;  3KTB A;  1YEP A;  1J08 A;  3ZVJ A;  4IN0 A;  3KIJ A;  3FRC A;  1IYI A;  4TR1 A;  4EXJ A;  1MDJ A;  3TJF A;  3GMF A;  2X49 A;  1R26 A;  1K3L A;  3RHC A;  4I2U A;  1M9A A;  3FR6 A;  4ZB9 A;  1SD8 A;  4EIQ A;  1LJR A;  4QL9 A;  2XPD A;  1M0U A;  1F6M C;  2QGV A;  1XWG A;  4HQZ A;  1TXX A;  5KOW A;  3Q18 A;  3ZIJ A;  4TRX A;  1AUC A;  4PX1 A;  3P7X A;  3HVV A;  22GS A;  5JWR B;  3HD5 A;  2F8A A;  3ME8 A;  4TXV A;  4V2N A;  5DBQ A;  2H1B A;  1XBS A;  2WFC A;  3ZZX A;  2H6Z A;  5J40 A;  2B1K A;  2LNS A;  5HR2 A;  2C0G A;  3A2V A;  1H4O A;  1E6B A;  1NSW A;  5J4U A;  2IFQ A;  1GTB A;  4NAX A;  1DE2 A;  4Z7X A;  5G5F A;  3I6A A;  2YWM A;  3BJ5 A;  3UBK A;  1A8L A;  1CQH A;  3GYK A;  5G30 A;  1VF2 A;  3QAG A;  5CRD A;  4D73 B;  2VKZ G;  1SJ6 A;  2IPA A;  5F0G A;  1PD2 1;  2WRT A;  1T8E B;  3C73 A;  4I6X A;  1EEJ A;  2VCZ A;  2VOC A;  1O7U A;  2RM6 A;  4MJA A;  2XHF A;  4RI6 A;  2LQO A;  5CAX A;  5B8B A;  2VLU A;  4O7H A;  2MMN A;  4HQS A;  3TKS E;  2WGR A;  4MF7 A;  5ECI B;  3F6F A;  4G0I A;  2GZZ A;  2FWE A;  3UMA A;  4I97 A;  2PVO C;  2FGX A;  1O73 A;  2KP2 A;  4Q5F A;  4XTS A;  3IK9 A;  3IPZ A;  1U88 A;  2A2S A;  1XZO A;  2WUL A;  4PNF A;  1G6W A;  3VWX A;  1J9B A;  2JZT A;  5ECK B;  3QFA C;  1TXU A;  4F0C A;  4Q5Q A;  2QKE A;  1WIK A;  2D2Z A;  4IS0 A;  1TI3 A;  1SKS B;  4POK A;  2MBT A;  1J0F A;  4GF0 A;  3GKK A;  12GS A;  2LST A;  1WE0 A;  2YZH A;  4I8B A;  4JE1 A;  2GS3 A;  4DVC A;  2FLS A;  2GLR A;  4GWR A;  3K8N A;  3LGC A;  3RAZ A;  11GS A;  1Z6M A;  4HEA 2;  1U3A A;  1YKA A;  1T3B A;  4N3Z A;  1SVM A;  3ERW A;  2HRA A;  3L9V A;  4K0N A;  1FOH A;  3V1W A;  3QCP A;  1SVL A;  2HZE B;  4K1F A;  5HR0 A;  1C72 A;  1PN0 A;  1RW1 A;  4CDO A;  2H76 A;  5BMU B;  2PN8 A;  1PL1 A;  5KN0 A;  4IJI A;  3H93 A;  3GL5 A;  3UVH A;  1BJX A;  3KXO A;  2X8H A;  1EOG A;  4ZL8 A;  1K3O A;  4ZIJ A;  1T00 A;  1DUG A;  1NHO A;  3W8S A;  2H6X A;  3VPT A;  3MYD A;  1S3A A;  5LNK e;  3F4R A;  3GUR A;  3FEU A;  1XCC A;  2HFD A;  4G10 A;  1HNC A;  4WKW A;  3EPT A;  3BCI A;  4F9Z A;  2GSR A;  1ERV A;  1FAA A;  1GSF A;  3HJO A;  5DJM A;  4O5Q A;  4MH2 A;  4PQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...