3DDCB

Crystal structure of nore1a in complex with ras
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
133
Chain Sequence
b'PPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPSFYLPLDAIKQMHISSTTTVSEVIQGLLDKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTPase HRas
molecule tags Hydrolase/apoptosis
source organism Homo sapiens
publication title Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II
pubmed doi rcsb
total genus 28
structure length 133
sequence length 158
ec nomenclature
pdb deposition date 2008-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ddcB00
2RR9A 4NY0A 3WALA 3NY5A 3S2AA 1C3TA 1G6JA 2JWZA 2BPSA 4BKSA 4BOZB 3D32A 4TQ0A 4W9JA 2OOBB 4BKSD 3LDZE 1P1AA 4K7SA 5DCNA 2FIDA 3C0RB 2FUHB 4BBNC 2WWZA 5G55A 5KHQA 2CHZA 4IW0A 3RZFA 1XT9B 2ZZPB 1XQQA 4GN1A 1YJ1A 5KHOA 1Q0WB 2RSUA 4E3CA 4X57B 4WJNA 3KUDB 1YX6B 1H8CA 1E7UA 5HKHA 2NS5A 1WYWB 4DHZB 4E71A 4DK5A 2BYFA 4IM2A 2LZ6A 1TGZB 4HJKA 4FLHA 2KFJA 3PV1A 2PPHA 2LXAA 1C1YB 2M1MA 3K9PB 3RZWC 3KVFB 1WGGA 2Y5BB 4ZRJA 1RLFA 5AZFA 2KNBA 1EF5A 1ZGUB 1RFAA 3K9OB 2NCNA 3DBSA 4RM8A 4ICVA 1OQYA 2NBUA 1WFYA 2NBWB 3HK0A 3HHMA 1RRBA 1WXMA 1ISNA 2M8SA 4EUTA 3CSTA 3HM3A 4HPMB 2YVCA 4AJWA 2ZNVB 3VUYA 4W9KA 4G11A 1EF1A 1E90A 2KMCA 1Q5WB 3OJ3A 3QWZB 2J0JA 5JHAA 1Q1OA 1TBEA 2K39A 2N1VA 3B08A 3NZUA 1UD7A 5CX3A 3A4RA 4DHZE 2LVOA 2O6VD 3QCAA 4DHJB 2KDEB 2NVUI 3ZNZB 2R2OA 1UZXB 2C7HA 4EFOA 5C23A 3GZNI 4IWPA 2DZIA 2NR2A 4DWFA 1V6EA 3IVFA 2LWPA 1VD2A 1WMHB 4GOCA 1YIWA 3VH4B 2N7EA 3UIPB 3RULA 3AU5A 4DBGA 1WH3A 3A9KA 2CHXA 4ASWC 4MDKE 1J19A 4BBNF 2JPHA 3VTUA 3PRMB 1NDDA 2DAJA 2O2VB 1WGRA 3DBRI 4NQLB 4JGHB 3PRZA 4HPLB 3W1YA 4BKTA 1KOTA 3UQAA 1V81A 1UH6A 4WWNA 5AEKB 1LM8B 3A1QA 3JSVB 4ANUA 1GNUA 5JHBA 3AI5A 1E8ZA 1WM3A 2GBJA 4HDQA 4ICUA 3DPDA 2V4LA 3CMMB 3A1QB 2DAFA 4GMVA 2ZEQA 3APCA 2R2QA 3APDA 1GUAB 3VVWB 3U7DA 2DZJA 4MELA 1V2YA 4FHKA 5IA7A 3ZDMC 3ZIMA 3KUZA 2N9EB 4WWOA 4W9IA 4RM9A 4XZ4A 4MGZE 3ONSA 4NNJB 5CTRC 2FCMA 2KDIA 3ALBA 4TUUA 3V61A 4WAAA 5BO4B 3ZNHB 4II2B 4DDGD 4KIKA 3UIOB 3UF8A 2WYQA 4LDTB 5J17A 3QA8A 3QX1A 3DBHI 3W1SC 2PEAA 2MCNB 3WA0A 2ASQA 2N1WA 5CHWA 2KLCA 4WJQA 4NJ7A 1A5RA 4HVBA 2MBQA 2JY6A 1NBFC 4JLCA 4MJSB 1X1MA 1WGHA 3ZRCA 3GOEA 1KJTA 3A9JB 3ECIA 3U8ZA 2EMTA 1UBQA 1WR6E 2BKRB 2AYOB 4YL8A 2KDBA 2XEWA 3H7PA 4GGQA 2MQJA 1WE7A 2D2QA 2BGFA 3TBLD 4BOSC 1GG3A 3DDCB 3R7QA 3KUCB 3H7PB 2KK8A 4WJOA 2JRHA 2HE7A 2V1YA 4EZJA 4I6LB 4IWQA 2LJ5A 4PS3A 4GDKB 3PHXB 4F1SA 2UYZB 1WJ4A 4FA6A 3BY4B 4FJYA 3VDZA 2Z0EB 1IPGA 2WX0A 1P0RA 1TZ1A 2NPTB 3ZNID 1V49A 4GIVA 2I1KA 4GDLB 3DVNU 3QAQA 2XK5B 3DVGY 4KDIC 2C5LC 2KJ6A 2D11A 1E8WA 4IUMB 1Y8RC 1HE8A 2CS4A 3KH0A 3VH3B 1V80A 2N9XA 2FCNA 2MA9B 1LXDA 3KYCD 4MH0E 2KQSA 3U30A 2FIFA 4OVVA 1V5TA 2GBRA 2KO3A 3UINB 2KXJA 3SHQA 1TTNA 2ZVOA 4HCPB 2BYEA 1RAXA 5L95C 4DXAB 1R4MI 1PQSA 2A5UA 2KFKA 1IP9A 2IY0B 1YQBA 3V6CB 1NI2A 1WI0A 2IO2B 4AUQC 2AWTA 2FNJB 1M94A 2XBBC 3VAWA 2JZZA 3BINA 2K8HA 1WZ3A 2AEHA 2AL6A 4K1RB 4KIKB 2KHWB 1GC7A 2KQ7A 1OTRB 4A20A 4G3XB 4LJPB 2MBEA 1IYFA 2MP2B 2KLGA 4AJYB 2M4NA 1WM2A 3L0WB 1FXTB 1WX8A 2MRPA 3M63B 5DPWA 4F7ZA 2C60A 2JUOA 2LVQA 3RT3B 2M17A 3IG3A 3ML8A 2A4ZA 3QIJA 1WX7A 2KC2A 4ZRIA 2BYVE 5D2MB 3PT2B 3PVLA 3RCZA 1P3QU 3WIMA 4ANXA 4J6IA 1S1QB 4FADA 4MJSA 2KWVB 2Z0DB 2N7DA 2KANA 3EFUA 3A4SC 4KSLC 1KM7A 1V86A 3JW0X 2D10A 5DPRA 2EKEC 2IZVB 3M3JA 1AARA 3L08A 2I1JA 4JIOU 2PJHA 5E6PA 3WANA 1K8RB 1SIFA 3ENEA 5EDSA 2L76A 4EZKA 3M62B 2CR5A 4KDLB 4W9EA 2DYOA 2IO3B 3X23A 3APFA 2KVRA 2B3AA 1WXAA 2KJRA 4F8CB 3A33B 4ANWA 3H1UA 2KWUB 4IWOA 3CSFA 4GDLA 2KX0A 1UELA 4HCNB 2LGDA 2JXXA 2NPTA 2HTHA 4AWJA 4TQ1A 4WJPA 4TV3A 3VQIA 4B95A 3NZSA 3PS6A 3T8MA 3DBLI 3SDLC 3EC8A 2DHZA 4WQOB 1WGDA 2K8CA 5LXHA 2GMIC 2DX5B 5TR5A 3R66C 3ZDTA 1WXVA 2MBHA 3IBEA 1H4RA 4W9CA 3OAWA 3PTFC 3RYTA 4M8MA 2ZCCA 3R3MA 1E8XA 4KZ0A 5JZEB 3JSVA 4FJVB 3L10B 3VTWA 3TMPB 2K6QA 3HM6X 4HLEA 5L83A 2RPQA 2LRWA 1GC6A 4AOFA 2LXCA 1F9JA 3TIXA 4FJZA 4K7UA 2KFKB 4MM3A 2K6DB 2FAZA 1U4AA 3NS8A 2YLMA 3KW5B 2RGFA 2L8JA 3EECA 2C7NB 4BFRA 1EO6A 5CHFA 1XD3B 2L00B 1WRDB 2PE9A 2KOXA 3ZNGC 4MGKE 3KYDD 3A9KB 3X0WA 2MWSB 3PRPB 1WE6A 2G3QB 5E6NA 2FCQA 4FN2A 2W9NA 2JT4B 4MSQB 3UQBA 4JQWC 3VXWA 2FCSA 2WX1A 2KKCA 2M0XA 3QARA 5G2NA 1ZKHA 1CMXB 1OGWA 1WZ0A 3N32A 3QHTA 3QC8B 2O6VB 1QZEA 1E8YA 3VUWA 3ZW3A 1EUVB 2G45B 2KTRA 2IY1B 2L0FA 2UWQA 4G0NB 1WX9A 3Q3FA 1L7YA 4MGYE 2OJRA 3AULA 2O6VA 3ML9A 1JRUA 4OVUA 3PSEB 4W9GA 3PLVA 4ANVA 3EHVA 3ZTDA 4TKNA 3VTVA 3AXCA 5AZGA 4GSWA 3WAPA 3MJWA 3DCGA 2LI5A 3UGBB 3ZLZA 5LLIA 2DZKA 4HXDA 3M95A 3MTNB 3V60A 2DZMA 2GBKA 2J0MA 4AP4C 3AU4A 1SE9A 2WDTB 3RD2A 4URKA 5J2RA 1E7VA 1WJ6A 3DVNV 3IHPC 3VHTC 2REXA 2MX2A 1WR1A 4PYZA 4W9FA 4K7WA 2N9PC 2Z59B 4LCDE 4NJ6A 5JH5C 1WXSA 4ZYNA 3Q3JA 5IAAC 1ZW7A 3TCAA 4FULA 1YD8U 2BF8B 2MW5A 2LVPA 4LJOB 2GOWA 2ZPNA 4XC2A 2D07B 3H9DA 4NAWA 3JVZX 2MSED 2RD0A 2KN5A 2QHOA 2G4SA 3L54A 2C7MB 3R7RA 2ZPYA 4CO7A 2K25A 3L17A 5E6OA 3ZVVA 2HD5B 4EEWA 2ZNVC 5AZHA 3ZTCA 3PLUA 1WJUA 3PGEA 4G50A 4NQKE 5DPTA 2N4FA 4W9HA 3WAMA 1VCBA 3PZDA 2CU1A 3P2BA 2DYBA 2KC1A 5J18A 3WAOA 2LRUA 4M8NA 1KLVA 3N30A 4W9LA 5D94A 2V3SA 1LFDA 2IYDB 3T9LA 1WJNA 2KTFA 2MBBB 4IM3A 4CYEA 1WY8A 2IO0B 2IO1B 4EKUA 1OEYJ 3RUIB 2ZJDA 3HIZA 4ZDVA 5D7GA 2CHWA 2MLBA 5C1ZA 4N9F4 2MP2A 2JRIB 4ZRKA 1Z5SB 2L0TA 3N3KB 2JF5A 5GMVA 2L05A 1R4NI 3IFWB 3QJZA 1SGHA 4KV2A 4KVGB 2D3GA 3V62A 3I3TB 2O2VA 1D3ZA 3ZRFA 4FHJA 1V9JA 2VRRB 4DHJD 3TL5A 2KDFB 4E74A 3W1SA 3OJ4B 4MEMA 1T0YA 2KD0A 3TJPA 3A9JA 3JYUA 1J0GA 4K81A 4MSMB 2KTRB 2LGXA 4I6PA 2KZRA 1UBIA 3ZKJC 3ZUNA 2JVCA 3CF6E 3H7SA 1WF9A 3NOBA 3SD5A 1V5OA 2BKFA 2J0KA 2LUEA 1YX5B 4IC7B 2JZ3B 4P7IA 4EOYA 2GBNA 1GJZA 2L3ZA 3H6NA 1E5WA 4GDKA 4A3PA 4GXBA 3NHEB 4IG7B 5FR6A 4HWIB 3MHSD 4RMAA 3O65B 4M0WB 2LASA 5CHVC 1S3SG 3B0AA 2BWFA 3B1LX 3VFKA 2KJHB 4MGIE 5D6JB 4GU2A 1UGMA 1Z2MA 2K8BA 4GB9A 4KZCA 4LDTD 4NPNA 5DPSA 2L7RA 5LXIB 1WMHA 3DVGX 4B9KA 1MG8A 3DOWA 3LJ3A 2DYMA 1J8CA 3V6EB 2ZCBA 4FBJB 1I35A 4I6NB 3OLMD 2IBIB 2EMSA 3PHWB 2LGYA 4IM0A 4PS7A 4XX5A 2HJ8A 1OEYA 4WWPA 1WGYA 4KSKC 4II3B 4PS8A 4W9DA 4BVUC 2GBMA 4CHKA 4PYUA 4JL9A 3QQ8B 1LQBA 4A3OA 2C9WB 1P98A 2CKHB 2KX3A 2NBVB 2J7QB 1L2NA 1BT0A 2BWES 4HDOA 2K1FA 4EZLA 1WIAA 2G4DB 3SU8X 4HK2A 1P9DU 2LD9A 3L13A 3PREA 3L16A 2MBOA 4DDID 2KWCA 2XK5A 3VUXA 2AL3A 3DQVA 4B6WA 2PE6B 4NAWB 2DENB 3ZO5B 3QK0A 1I42A 2ZVNA 3PPAA 2KMAA 4BKGA
chains in the Genus database with same CATH superfamily
4LNOA 4XDDA 2WP9B 3S2AA 5IN7A 4BKSD 4RGMA 4K7SA 2FIDA 4BBNC 1TS3A 5TSSA 5KHQA 4IW0A 1Q0WB 4X57B 4WJNA 1XXGA 4DHZB 4KGTA 1NENB 2BYFA 4N58A 3ZJUA 2IDYA 4HJKA 1L5PA 1YQ4B 2M1MA 2KMMA 4ZRJA 3UI3A 3K9OB 2NCNA 1V1PA 2NBUA 2NMQA 1WFYA 2NBWB 3NVWA 1CK1A 1RRBA 1ROEA 3HM3A 4HPMB 2ZNVB 4W9KA 1E90A 1TBEA 1RFKA 1UD7A 2O6VD 3QCAA 3MP9A 2NVUI 3ZNZB 2C7HA 3HVDA 3GZNI 3W5UB 3IVFA 1FCCC 4TMAB 5BMGA 1IGDA 3RN9C 1XO3A 4C7YA 2N7EA 3RULA 3AU5A 4DBGA 4ASWC 2QDFA 3PRMB 1NDDA 1K51A 2ONQA 1WGRA 3DBRI 1AYFA 3PZ8A 3TEYA 3PRZA 1KOTA 4WWNA 3A1QA 1TJEA 3AE6B 1QOGA 4PK1A 1GNUA 1JALA 3DPDA 1GPXA 3APDA 3VVWB 2DZJA 1V2YA 4FHKA 3ZIMA 2G9HD 1PGXA 2Q5WD 3ONSA 2FCMA 3ZNHB 3OWEB 3UIOB 1F2RC 3QA8A 1SJHD 2PEAA 2ASQA 1VZ7A 4JLCA 1NBFC 3PZ7A 3GOEA 3A9JB 3RNAC 1UBQA 2AYOB 1R4MB 1F52A 3U2SC 3BK2A 1B1ZA 1WE7A 4DXGA 2KK8A 2HE7A 2V1YA 3AE5B 1KLGD 4F1SA 2LMCA 2UYZB 3Q3NC 1SB3C 4C4VA 3BY4B 3R8BA 1T5XD 1UUPA 2ON8A 2NPTB 4HEA1 5EE9A 2XK5B 3FILB 1PGBA 1XLPA 3DVGY 1I7HA 3KH0A 2N9XA 2MA9B 3KYCD 4CQNA 1ET6A 1FNUA 2KO3A 2M56B 2PW9A 1PYWD 2ZW1A 1FRRA 4HCPB 1R4MI 2A5UA 2SEBD 2IY0B 3V6CB 4YTMB 2IO2B 1HXYD 1TY2A 4C00A 3RI7C 3GE3C 2AEHA 1FMAD 4US9A 1GC7A 1OTRB 4DQOC 2BQQA 2M4NA 1WX8A 2C60A 1CZPA 3AE4B 3IXSA 3IG3A 3QIJA 3DBLB 1E10A 3PVLA 1P3QU 1SBBB 4RNAA 4MJSA 2N7DA 3A4SC 1V86A 2D10A 1KRHA 4HROA 2J4XA 2I1JA 2K9XA 4JIOU 1K8RB 1ACCA 1SIFA 3LB8C 4RFBA 5EDSA 2L76A 4EZKA 4MH8A 3Q8FA 3X23A 5AUKA 2KVRA 2B3AA 2H89B 5H8YE 2BS3B 2WGSA 3CSFA 4YSZB 4TQ1A 4WJPA 1K50A 1WGDA 2DX5B 3IBEA 4W9CA 3OAWA 5G5HA 2JU6X 3VTWA 1AW7A 2FE8A 5L83A 3IAM1 1F9JA 1EWCA 3I9V1 4FJZA 4YWGG 2V0GA 2YLMA 3I5JC 3KW5B 4OHJA 2L8JA 4WH4A 5E6JA 2BYTA 2L00B 2KOXA 3DHHC 4LLGM 3ZNGC 2FCQA 3B2FA 4JQWC 1YQ3B 3VXWA 5G2NA 3RNFC 1T3QA 3U4EG 1OGWA 3ZW3A 3QC8B 2O6VB 3VUWA 1VR9A 2IY1B 2QC8A 1WX9A 3MC0B 1L7YA 3PLVA 3EHVA 3VTVA 3DCGA 2LI5A 4C56C 2N9LA 4YSYB 4XDCA 2INPE 2J0MA 3LYYA 1L0XB 1SE9A 4IKGA 2REXA 4M0WA 3GS2A 4ZYSA 2FBWB 2LUMA 3B2GA 1WXSA 1V97A 3TCAA 2LHDA 2MW5A 2LVPA 4XC2A 3ZYYX 1QF6A 2MSED 2QHOA 3L54A 2ZPYA 4N6EB 4WWMA 3PO0A 3AECB 3WAMA 2N4FA 1VCBA 3PZDA 1FRDA 2CU1A 2DYBA 2PVOD 2ZW0A 3WAOA 3NUHB 1KLVA 2WU5B 3V05A 3N30A 2BT6A 4W9LA 2V3SA 1LFDA 2IYDB 2G1EA 1V8CA 5IKCM 4HKZE 2IO1B 1SE3A 2W54A 5C1ZA 4YTNB 4M00A 3N3KB 3MHZA 3IFWB 2PIAA 2DBYA 3T3NA 1IGCA 1D3ZA 4FHJA 2RPVA 1I4HA 3W1SA 2KD0A 1J0GA 1P7EA 2LGXA 4I6PA 3VR9B 4RF0A 2PTLA 1ZUD2 3ZUNA 3H7SA 1LO5D 1ZDXA 4A55A 2WDVB 3SD5A 1V5OA 2J0KA 1ET9A 2JZ3B 2BS4B 3ZXRA 3RNGC 1PUTA 4AQ7A 4XE0A 1QKZA 4IG7B 5FR6A 4LNNA 1I4RA 2BWFA 2WU2B 4GU2A 1JWUD 4M01A 4ZRPA 2RMMA 3ZJTA 3SFDB 4B9KA 1MG8A 1QLBB 3AEAB 3V6EB 1I35A 1KH0A 4IM0A 4PS7A 2LGYA 4KSKC 3AH7A 1GB1A 4JL9A 3U52E 3QQ8B 2L1AA 2C9WB 2KX3A 2J7QB 4HDOA 1HTQA 1P9DU 3AEFB 2BTEA 4NAMA 4DDID 2KWCA 2LGSA 2PE6B 2KVZA 4BKGA 2RR9A 4NY0A 2R61A 4A6QA 3NY5A 5HHDG 2GRIA 4BKSA 4BOZB 4YSXB 1FD6A 3LDZE 1C9FA 3C0RB 4P6VF 2KYWA 2WHIA 3EGRA 2BW2A 5G55A 5BMHA 3RZFA 4L23A 1JCKB 1YJ1A 3NVYA 1YX6B 2NS5A 4DK5A 1XCTL 1BMLC 4YXDB 4US8A 2J52A 1N63A 2QILA 5AZFA 4RM8A 1L6VA 3HK0A 1ISNA 2M8SA 1PFDA 4EUTA 2RDHA 3VRAB 2YVCA 1ENFA 2YEPB 2J0JA 1TKYA 5JHAA 1Q1OA 3B08A 2N1VA 2LVOA 3SEBA 1UZXB 1V6EA 4KKJA 1VD2A 1WMHB 4GOCA 1N61A 2MH7A 3NVZA 4P1BC 1C78A 3A9KA 3MC8A 2DAJA 2O2VB 4JGHB 4ZHPA 3UQAA 3JSVB 2B76B 4ANUA 3AI5A 1WM3A 2GBJA 4HDQA 4C7ZA 4M02A 4RGTA 2WXMA 2ZEQA 3APCA 5IA7A 3ZDMC 3KUZA 4XZ4A 2JX5A 4TUUA 1STEA 3UF8A 4LDTB 3HRDD 2LHEA 3EFCA 2QCZA 1A5RA 4MJSB 1WGHA 3ECIA 3U8ZA 1WR6E 2BKRB 4YL8A 1MG4A 2MQJA 2D2QA 3R7QA 3H7PB 3W5VB 2NTSA 3Q6BA 2JRHA 1VJKA 4IWQA 4PS3A 1AN8A 3W2DA 1R4NB 4FA6A 1IPGA 1P0RA 3ZQ4A 3P63A 4GIVA 4GDLB 1KFYB 2NTTA 3QAQA 1WXQA 3BVMA 4KDIC 1E8WA 4HJGE 1UF0A 1HE8A 2PLPA 2CS4A 1QILA 3U30A 2KQSA 4ZRQA 1N60A 1V5TA 1WRIA 2KXJA 3AV8A 2BB5A 1E0ZA 1UGJA 1IP9A 4A9AA 3FAHA 1BUIC 1NI2A 2N7JA 2AWTA 1M94A 3VAWA 2JZZA 5EE3A 2YEPF 4K1RB 2MBEA 4AJYB 4FXCA 5IP4D 3L0WB 1D4BA 4F7ZA 2M17A 2LJIA 3ML8A 2A4ZA 2BYVE 1KTKA 3RCZA 4ANXA 1S1QB 4FADA 2KWVB 4JPSA 3JW0X 3AE9B 1I4PA 3RNCC 2WQYB 1XLQA 3L08A 2CR5A 2IO3B 1E9MA 2RDGA 2KJRA 4ANWA 1IUEA 4P1CC 3H1UA 4IWOA 3R2IA 4GDLA 1UELA 3VQIA 2CU3A 3NZSA 2WXLA 3SR6A 3SDLC 1WSPA 3EC8A 4WQOB 3Q8BA 2ACZB 3OG5A 2WXKA 2JSVX 3RYTA 3PTFC 4M8MA 1D5MC 2ZCCA 4KZ0A 2V3NA 5JZEB 2WXRA 3L10B 3HM6X 2RPQA 1GC6A 1JROA 2LXCA 2V3PA 3ZJVA 1TKEA 3KQ4A 3N9YC 4AS1A 3EECA 1D6EC 1EO6A 5CHFA 5D3IB 5EE0A 2PE9A 3X0WA 3A9KB 2G3QB 2W9NA 4P16A 4MSQB 2FCSA 4KGRA 3VR8B 1WYGA 4NJCA 4OZCA 1RYJA 2D3BA 2G45B 2L0FA 4K3BA 5C3JB 4MGYE 2OJRA 1JRUA 4TKNA 2KWDA 2EKIA 3J9CA 4GSWA 3MJWA 4ARCA 3T3OA 2DZKA 3M95A 5AUIA 1E6EB 2GBKA 3N1YC 2KACA 4RGOS 5EE1A 3ZGZA 2WDTB 4URKA 2MHJA 3GE8C 3BVGA 1OFFA 1WJ6A 2X38A 2WXJA 4PYZA 4W9FA 2N9PC 3W9CB 4QAYA 4MT5A 1ZW7A 1YD8U 2BF8B 2K22A 2D07B 3H9DA 4NAWA 1YN5A 2VH1A 3SFEB 2RD0A 2KN5A 1MFWA 3R7RA 3L17A 1QOBA 1VDVA 3ZVVA 2HD5B 4EEWA 2ZNVC 3ZTCA 1L0VB 4HRSA 3PGEA 4G50A 3RPFC 2LRUA 3Q8AA 1QOAA 3KLSX 1WJNA 2WXHA 2IO0B 1RWSA 4EKUA 2ZJDA 5D7GA 2MLBA 4N9F4 2JRIB 1YJJA 3EA6A 2L0TA 5GXGB 1HEZE 5GMVA 2JF5A 4KV2A 4C80A 3RFZB 4KVGB 1BXTA 3I3TB 3NVVA 4E74A 1C79A 4MEMA 3L4PA 3JYUA 4K81A 1D5ZC 1MJDA 1UBIA 2WDQB 1V1PB 1WF9A 2BKFA 1PDXA 2LUEA 4P7IA 2M19A 2GBNA 4PT5A 1E5WA 1FPYA 3NHEB 1JWAD 2QSDA 4HKQA 3N1XC 3V3XA 4EE2A 2LASA 5CHVC 3VFKA 1GOZA 5D6JB 4KZCA 3AEDB 5BYQA 1DOYA 3IT6B 3DOWA 2DYMA 1J8CA 4FBJB 1OEYA 2CJOA 3BK1A 4WWPA 1ZXIA 4RGNA 4II3B 4BVUC 4CHKA 5FKAC 1EWYC 1P98A 3MJ5A 2K1FA 4IDIA 1LGRA 2LD9A 4C4VB 1YN3A 1JMLA 1QQRA 3DQVA 3QK0A 1I42A 2KMAA 3WALA 1Y56A 1C3TA 4LNKA 1ZXHA 3D32A 4MACA 4W9JA 2OOBB 5C2TB 1P1AA 2Z8LA 4USAA 1JW9D 1HZ5A 2CHZA 2W55A 1XT9B 1XQQA 3Q3OC 4GN1A 2WLBA 3AEGB 1N6ZA 3KUDB 5HKHA 4E71A 4IM2A 4FLHA 2DNFA 3NJTA 2VZKD 2KFJA 3PV1A 2Y5PA 2L32A 4GLSC 3K9PB 3ABVB 3RZWC 1WGGA 2MEKA 2CJNA 2IJ0A 1FNVA 2KNBA 1EF5A 3AE3B 1RFAA 3DBSA 1KF6B 4B0MA 4ICVA 1OQYA 1WXMA 3CSTA 3AEBB 3AE7B 1Q5WB 3OJ3A 3QWZB 4WAFA 2K39A 5CX3A 3NZUA 2INNE 1I4GA 4DHZE 2PKOA 2KDEB 2WXPA 1NI3A 5C23A 4IWPA 2DZIA 3GB1A 5T8IA 3MFGA 2LWPA 1YIWA 3VH4B 2KQ4X 4XWTA 3Q69A 3Q3MC 3UIPB 1WH3A 1ZP0B 3NRZA 4TSSA 2IGDA 4D2KA 3FC4A 4BBNF 5IO9A 2JPHA 3N1ZC 3VTUA 4NQLB 4BKTA 1V81A 1UH6A 5AEKB 1LM8B 1T0SC 3AE2B 1E8ZA 4ICUA 3A1QB 2J53A 2DAFA 5MPOA 1ESFA 2R2QA 3BWUD 3U7DA 4MELA 2LEKA 4WWOA 4W9IA 2WNMA 3URYA 4RH6A 1FM0D 3V61A 3ALBA 5BO4B 4II2B 4DDGD 5J17A 3QX1A 3DBHI 3W1SC 2OHFA 3WA0A 5CHWA 1CJEA 1T0QC 3AE8B 2SAKA 4HVBA 4REZA 2I38A 1C4AA 3ZRCA 1F77A 4Q2JA 1KJTA 2EMTA 2KDBA 1N5WA 1EM7A 2XNAC 1VZ8A 4XYCA 3TBLD 4BOSC 1GG3A 3KUCB 4WJOA 1A70A 1WJ4A 1N5XA 4IOIE 5D3DA 3VDZA 2Z0EB 2HJ1A 1TZ1A 4LNFA 2IGGA 3ZNID 2I1KA 4K3CA 3DVNU 4LNIA 3AE1B 3P4PB 2C5LC 1FXIA 1L4DB 2KJ6A 4O1NA 2FCNA 1LXDA 3KWVA 1AWDA 1QOFA 2ZVOA 1P7FA 1RAXA 4DXAB 2KFKA 2JWUA 1WI0A 3BYTB 2DWQA 3E9SA 1MI0A 2FNJB 2X8XX 2XBBC 1J7CA 1WZ3A 4N59A 1YJIA 3BVZA 4MM3B 2KQ7A 1FNWA 4G3XB 1IYFA 2MP2B 1IBXB 2KLGA 1FXTB 5DPWA 3M63B 2JUOA 4RCOA 3DHGC 4ZRIA 4A8XC 2INCC 3PT2B 4J6IA 1V1OA 2Z0DB 4KSLC 5DPRA 2EKEC 2IZVB 1AARA 1DYQA 1MHXA 2IGHA 1VZ6A 4XGAB 4W9EA 2DYOA 2N9KA 3APFA 3A33B 2PMVA 1VLBA 2KX0A 4HCNB 1TT5B 2HTHA 3P4QB 3T8MA 2WXNA 3DBLI 2DHZA 3TSSA 2K8CA 2GMIC 5TR5A 3R66C 3ZDTA 1GB4A 2ICIA 1H4RA 1HQRD 1ZPSA 5BMIA 3R3MA 1E8XA 1UNSA 5HFYA 3FKYA 2K6QA 1I4XA 4YTPB 3U7ZA 3TIXA 3C19A 2KFKB 2H88B 4H2AA 4MM3A 2K6DB 2FAZA 3NS8A 2RGFA 2C7NB 1XD3B 3NZ3A 2WXGA 4MGKE 3KYDD 2MWSB 1TKGA 3PRPB 5E6NA 4FN2A 2JT4B 1SIJA 2WX1A 2M0XA 3QARA 2HTME 3O13A 1ZKHA 1CMXB 3N32A 3QHTA 1WZ0A 2UU7A 1JWMD 1QZEA 2UWQA 4G0NB 3Q3FA 3AULA 2O6VA 3ML9A 4S17A 4ANVA 3AXCA 5AZGA 3ZLZA 1UWXA 5LLIA 2K5PA 2IPKD 4HXDA 4YT0B 1F2RI 3V60A 1C4CA 2DZMA 1JWSD 3AU4A 3RD2A 1E7VA 3DVNV 3VHTC 3R2TA 4K7WA 2Z59B 4LCDE 3GP7A 4FULA 2GOWA 1SE2A 3JVZX 2LFIA 3P42A 2G4SA 2C7MB 4CO7A 2K25A 5E6OA 3NS1A 1OQRA 2BVCA 3PLUA 1WJUA 4J3OD 4NQKE 4W9HA 1ZOYB 3AEEB 4OZAA 4OVZA 1SJED 3P2BA 3DWMA 4M8NA 2WXOA 5FR3A 5D94A 2OEDA 3ETRA 1XLNA 2MBBB 3RUIB 2JYTA 4ZRKA 1MVKA 1SGHA 2O2VA 3ZRFA 1V9JA 3TL5A 3OJ4B 1T0YA 3TJPA 2JVCA 3NOBA 3AN1A 4ACFA 4IC7B 1GJZA 4ITKA 1FCLA 4GDKA 3DBRB 3TUOA 4HWIB 1NYRA 2QIEB 3B1LX 2D5GA 4LDTD 5DPSA 2L7RA 5LXIB 4ZOHC 1WMHA 4JX1C 1XF5L 3DVGX 3BYYB 1SXTA 2WDRB 2EMSA 3PHWB 4XX5A 2HJ8A 2VH2A 2AX5A 1RM6C 1C76A 4PS8A 4W9DA 2GBMA 1JWBD 5BYSA 4PYUA 1QT9A 2AQ2B 1LQBA 3DHIC 4A3OA 2CKHB 2NBVB 1L2NA 2BWES 1F1HA 4EZLA 2G4DB 2RDBC 4HK2A 5JXVA 3L13A 2GI9A 4R3DA 3L16A 3I63C 2OJWA 2VZKB 2MBOA 1TS4A 2XK5A 3FILA 3VUXA 4B6WA 1L4ZB 2DENB 1TGZB 2QJLA 1R7SA 4WIPA 1G6JA 1JRPA 2JWZA 2BPSA 4TQ0A 4KX6B 2W3RA 3LXFA 5DCNA 1L6UA 3TEWA 2FUHB 2WWZA 4UDUC 4LK0M 3DWGC 2V4IB 2ZZPB 5KHOA 2RSUA 2D3AA 4E3CA 2FUG1 1H8CA 1E7UA 3TEXA 1ZE3D 1WYWB 1XEEA 4NZLB 2LZ6A 1NYQA 2GB1A 2PPHA 2LXAA 3IAS1 1C1YB 1MHHE 2BBCA 3N20C 2N0SB 3KVFB 1C4PA 2Y5BB 2JYEA 1RLFA 1ZGUB 2EELA 2K0PA 2L83A 1OQQA 2MJDA 3HHMA 1WWTA 4L2YA 4AJWA 3VUYA 3HUIA 4G11A 1EF1A 1FO4A 2KMCA 4JWUC 3A4RA 3BIID 4DHJB 4B0EA 2R2OA 4EFOA 2NR2A 4DWFA 2KAJA 5HG2A 1K53A 2CHXA 4MDKE 1J19A 5BYRA 3BZDB 4HPLB 1EU4A 3Q8EA 1ZDVA 2INDC 3C8YA 5JHBA 4HPPA 2V4LA 3B9JA 3CMMB 2JZPA 4GMVA 1UWMA 1FIQA 1GUAB 1EU3A 2HDEA 2N9EB 4RM9A 4MGZE 4NNJB 5CTRC 2KDIA 4WAAA 4KIKA 2WYQA 2MCNB 2N1WA 1FFVA 2KLCA 4WJQA 4NJ7A 2MBQA 2JY6A 1X1MA 4OW0A 1NVID 2XEWA 3H7PA 1N62A 4GGQA 4F8CB 2BGFA 2AQ3B 3DDCB 4BZAA 3E56A 4EZJA 4I6LB 3AM9A 2WS3B 2LJ5A 1J7BA 2L52A 4GDKB 3PHXB 2BB6A 1K52A 2GLSA 2KT7A 4FJYA 2WX0A 1TY0A 2JQRB 1V49A 1Q10A 1B9RA 1YMHE 2LGIA 3I57A 2D11A 4IUMB 4ZHOA 1JQ4A 1Y8RC 3VH3B 1V80A 5HI1A 4MH0E 2FIFA 4OVVA 2GBRA 3UINB 1TIFA 3SHQA 1TTNA 2BYEA 5IOIA 5L95C 1PQSA 1YQBA 4AUQC 2TSSA 2PVGC 3BINA 2QMTA 2K8HA 3P1MA 2AL6A 3AMZA 4KIKB 2KHWB 4A20A 4LJPB 3P4RB 4A90A 1WM2A 3WCQA 3EUB2 2MRPA 2LVQA 4JWSC 3RT3B 1DOXA 1WX7A 2KC2A 1L0YB 5D2MB 3WIMA 3EFUA 2KANA 1KM7A 1YNTE 3RNBC 3M3JA 1TZOA 2PJHA 3H8HA 1XLOA 5E6PA 3WANA 3ENEA 1TYGB 4ARIA 3M62B 3KWLA 4KDLB 3DBHB 1WXAA 5G5GA 1DGJA 1D5XC 2KWUB 2LGDA 1TS2A 2JXXA 2J42A 4WQMA 2NPTA 4AWJA 4TV3A 4B95A 3PS6A 1VRAB 1HZ6A 5LXHA 1HTOA 2MJEA 1WXVA 2MBHA 4BAXA 1CQVA 2V9HA 1E7PB 3NG0A 3JSVA 4FJVB 4S0RA 3TMPB 1YN4A 2LRWA 4AOFA 1SSNA 3VRBB 4K7UA 1U4AA 1FFUA 4BFRA 5LNK1 1WRDB 4OZBA 1WE6A 3UQBA 2JXTA 2KKCA 3W1YA 4HLEA 4DHJD 1E8YA 1EUVB 2KTRA 4W9GA 4OVUA 2BS2B 3PSEB 3ZTDA 3Q8CA 2WXFA 3WAPA 3UGBB 1C77A 1SE4A 1KLUD 2M0AA 3RNEC 1F0ZA 3MTNB 2Y3AA 3Q14C 4AP4C 5I4DA 5J2RA 2MJ3A 3IHPC 1FXAA 2MX2A 1WR1A 2KDMA 4NJ6A 5JH5C 4ZYNA 3Q3JA 5IAAC 4LJOB 2ZPNA 3TEZA 5AZHA 1PGAA 2E6XA 1GAQB 5DPTA 4DXFA 2KC1A 5J18A 3MC9A 3T9LA 3IT4B 2KTFA 2D3CA 4IM3A 4CYEA 1WY8A 1T6BX 1OEYJ 3HVZA 3HIZA 4ZDVA 1J7AA 1XCQL 2CHWA 2QEJC 2MP2A 3AB5A 1IBXA 2W3SA 1Z5SB 2XN9C 2KN4A 4L1BA 2L05A 1R4NI 3CWIA 3QJZA 1YOVB 4WURA 2D3GA 3V62A 1SF0A 2VRRB 3ZXVA 1HA5A 2KDFB 3A9JA 1M4VA 4MSMB 1SEBD 2KTRB 2KZRA 3ZKJC 3CF6E 1NEKB 3Q2AC 5H92C 4LTUA 1YX5B 2WXQA 4KKIA 4EOYA 2L3ZA 1T0RC 3H6NA 4A3PA 1FEHA 4GXBA 2AQ1B 2I2YA 3MHSD 4RMAA 3O65B 4M0WB 1S3SG 3B0AA 2KJHB 4MGIE 1UGMA 1Z2MA 2K8BA 4GB9A 2WXIA 4KGSA 4NPNA 4JE3B 1MPEA 3GZNB 3P4SB 3LJ3A 2ZCBA 4I6NB 3OLMD 2IBIB 2DLBA 2K3UA 1WGYA 4RF1A 1TS5A 2Y5CA 3CIRB 1BT0A 1WIAA 3SU8X 5FK9C 1I4QA 3PREA 2W82A 1WGKA 2AL3A 4NAWB 4XWWA 3ZO5B 2ZVNA 2E3TA 3PPAA 1DOIA 3RMKC
chains in the Genus database with same CATH topology
2RR9A 4NY0A 3WALA 3NY5A 3S2AA 1C3TA 1G6JA 2JWZA 2BPSA 4BKSA 4BOZB 3D32A 4TQ0A 4W9JA 2OOBB 4BKSD 3LDZE 1P1AA 4K7SA 5DCNA 2FIDA 3C0RB 2FUHB 4BBNC 2WWZA 5G55A 5KHQA 2CHZA 4IW0A 3RZFA 1XT9B 2ZZPB 1XQQA 4GN1A 1YJ1A 5KHOA 1Q0WB 2RSUA 4E3CA 4X57B 4WJNA 3KUDB 1YX6B 1H8CA 1E7UA 5HKHA 2NS5A 1WYWB 4DHZB 4E71A 4DK5A 2BYFA 4IM2A 2LZ6A 1TGZB 4HJKA 4FLHA 2KFJA 3PV1A 2PPHA 2LXAA 1C1YB 2M1MA 3K9PB 3RZWC 3KVFB 1WGGA 2Y5BB 4ZRJA 1RLFA 5AZFA 2KNBA 1EF5A 1ZGUB 1RFAA 3K9OB 2NCNA 3DBSA 4RM8A 4ICVA 1OQYA 2NBUA 1WFYA 2NBWB 3HK0A 3HHMA 1RRBA 1WXMA 1ISNA 2M8SA 4EUTA 3CSTA 3HM3A 4HPMB 2YVCA 4AJWA 2ZNVB 3VUYA 4W9KA 4G11A 1EF1A 1E90A 2KMCA 1Q5WB 3OJ3A 3QWZB 2J0JA 5JHAA 1Q1OA 1TBEA 2K39A 2N1VA 3B08A 3NZUA 1UD7A 5CX3A 3A4RA 4DHZE 2LVOA 2O6VD 3QCAA 4DHJB 2KDEB 2NVUI 3ZNZB 2R2OA 1UZXB 2C7HA 4EFOA 5C23A 3GZNI 4IWPA 2DZIA 2NR2A 4DWFA 1V6EA 3IVFA 2LWPA 1VD2A 1WMHB 4GOCA 1YIWA 3VH4B 2N7EA 3UIPB 3RULA 3AU5A 4DBGA 1WH3A 3A9KA 2CHXA 4ASWC 4MDKE 1J19A 4BBNF 2JPHA 3VTUA 3PRMB 1NDDA 2DAJA 2O2VB 1WGRA 3DBRI 4NQLB 4JGHB 3PRZA 4HPLB 3W1YA 4BKTA 1KOTA 3UQAA 1V81A 1UH6A 4WWNA 5AEKB 1LM8B 3A1QA 3JSVB 4ANUA 1GNUA 5JHBA 3AI5A 1E8ZA 1WM3A 2GBJA 4HDQA 4ICUA 3DPDA 2V4LA 3CMMB 3A1QB 2DAFA 4GMVA 2ZEQA 3APCA 2R2QA 3APDA 1GUAB 3VVWB 3U7DA 2DZJA 4MELA 1V2YA 4FHKA 5IA7A 3ZDMC 3ZIMA 3KUZA 2N9EB 4WWOA 4W9IA 4RM9A 4XZ4A 4MGZE 3ONSA 4NNJB 5CTRC 2FCMA 2KDIA 3ALBA 4TUUA 3V61A 4WAAA 5BO4B 3ZNHB 4II2B 4DDGD 4KIKA 3UIOB 3UF8A 2WYQA 4LDTB 5J17A 3QA8A 3QX1A 3DBHI 3W1SC 2PEAA 2MCNB 3WA0A 2ASQA 2N1WA 5CHWA 2KLCA 4WJQA 4NJ7A 1A5RA 4HVBA 2MBQA 2JY6A 1NBFC 4JLCA 4MJSB 1X1MA 1WGHA 3ZRCA 3GOEA 1KJTA 3A9JB 3ECIA 3U8ZA 2EMTA 1UBQA 1WR6E 2BKRB 2AYOB 4YL8A 2KDBA 2XEWA 3H7PA 4GGQA 2MQJA 1WE7A 2D2QA 2BGFA 3TBLD 4BOSC 1GG3A 3DDCB 3R7QA 3KUCB 3H7PB 2KK8A 4WJOA 2JRHA 2HE7A 2V1YA 4EZJA 4I6LB 4IWQA 2LJ5A 4PS3A 4GDKB 3PHXB 4F1SA 2UYZB 1WJ4A 4FA6A 3BY4B 4FJYA 3VDZA 2Z0EB 1IPGA 2WX0A 1P0RA 1TZ1A 2NPTB 3ZNID 1V49A 4GIVA 2I1KA 4GDLB 3DVNU 3QAQA 2XK5B 3DVGY 4KDIC 2C5LC 2KJ6A 2D11A 1E8WA 4IUMB 1Y8RC 1HE8A 2CS4A 3KH0A 3VH3B 1V80A 2N9XA 2FCNA 2MA9B 1LXDA 3KYCD 4MH0E 2KQSA 3U30A 2FIFA 4OVVA 1V5TA 2GBRA 2KO3A 3UINB 2KXJA 3SHQA 1TTNA 2ZVOA 4HCPB 2BYEA 1RAXA 5L95C 4DXAB 1R4MI 1PQSA 2A5UA 2KFKA 1IP9A 2IY0B 1YQBA 3V6CB 1NI2A 1WI0A 2IO2B 4AUQC 2AWTA 2FNJB 1M94A 2XBBC 3VAWA 2JZZA 3BINA 2K8HA 1WZ3A 2AEHA 2AL6A 4K1RB 4KIKB 2KHWB 1GC7A 2KQ7A 1OTRB 4A20A 4G3XB 4LJPB 2MBEA 1IYFA 2MP2B 2KLGA 4AJYB 2M4NA 1WM2A 3L0WB 1FXTB 1WX8A 2MRPA 3M63B 5DPWA 4F7ZA 2C60A 2JUOA 2LVQA 3RT3B 2M17A 3IG3A 3ML8A 2A4ZA 3QIJA 1WX7A 2KC2A 4ZRIA 2BYVE 5D2MB 3PT2B 3PVLA 3RCZA 1P3QU 3WIMA 4ANXA 4J6IA 1S1QB 4FADA 4MJSA 2KWVB 2Z0DB 2N7DA 2KANA 3EFUA 3A4SC 4KSLC 1KM7A 1V86A 3JW0X 2D10A 5DPRA 2EKEC 2IZVB 3M3JA 1AARA 3L08A 2I1JA 4JIOU 2PJHA 5E6PA 3WANA 1K8RB 1SIFA 3ENEA 5EDSA 2L76A 4EZKA 3M62B 2CR5A 4KDLB 4W9EA 2DYOA 2IO3B 3X23A 3APFA 2KVRA 2B3AA 1WXAA 2KJRA 4F8CB 3A33B 4ANWA 3H1UA 2KWUB 4IWOA 3CSFA 4GDLA 2KX0A 1UELA 4HCNB 2LGDA 2JXXA 2NPTA 2HTHA 4AWJA 4TQ1A 4WJPA 4TV3A 3VQIA 4B95A 3NZSA 3PS6A 3T8MA 3DBLI 3SDLC 3EC8A 2DHZA 4WQOB 1WGDA 2K8CA 5LXHA 2GMIC 2DX5B 5TR5A 3R66C 3ZDTA 1WXVA 2MBHA 3IBEA 1H4RA 4W9CA 3OAWA 3PTFC 3RYTA 4M8MA 2ZCCA 3R3MA 1E8XA 4KZ0A 5JZEB 3JSVA 4FJVB 3L10B 3VTWA 3TMPB 2K6QA 3HM6X 4HLEA 5L83A 2RPQA 2LRWA 1GC6A 4AOFA 2LXCA 1F9JA 3TIXA 4FJZA 4K7UA 2KFKB 4MM3A 2K6DB 2FAZA 1U4AA 3NS8A 2YLMA 3KW5B 2RGFA 2L8JA 3EECA 2C7NB 4BFRA 1EO6A 5CHFA 1XD3B 2L00B 1WRDB 2PE9A 2KOXA 3ZNGC 4MGKE 3KYDD 3A9KB 3X0WA 2MWSB 3PRPB 1WE6A 2G3QB 5E6NA 2FCQA 4FN2A 2W9NA 2JT4B 4MSQB 3UQBA 4JQWC 3VXWA 2FCSA 2WX1A 2KKCA 2M0XA 3QARA 5G2NA 1ZKHA 1CMXB 1OGWA 1WZ0A 3N32A 3QHTA 3QC8B 2O6VB 1QZEA 1E8YA 3VUWA 3ZW3A 1EUVB 2G45B 2KTRA 2IY1B 2L0FA 2UWQA 4G0NB 1WX9A 3Q3FA 1L7YA 4MGYE 2OJRA 3AULA 2O6VA 3ML9A 1JRUA 4OVUA 3PSEB 4W9GA 3PLVA 4ANVA 3EHVA 3ZTDA 4TKNA 3VTVA 3AXCA 5AZGA 4GSWA 3WAPA 3MJWA 3DCGA 2LI5A 3UGBB 3ZLZA 5LLIA 2DZKA 4HXDA 3M95A 3MTNB 3V60A 2DZMA 2GBKA 2J0MA 4AP4C 3AU4A 1SE9A 2WDTB 3RD2A 4URKA 5J2RA 1E7VA 1WJ6A 3DVNV 3IHPC 3VHTC 2REXA 2MX2A 1WR1A 4PYZA 4W9FA 4K7WA 2N9PC 2Z59B 4LCDE 4NJ6A 5JH5C 1WXSA 4ZYNA 3Q3JA 5IAAC 1ZW7A 3TCAA 4FULA 1YD8U 2BF8B 2MW5A 2LVPA 4LJOB 2GOWA 2ZPNA 4XC2A 2D07B 3H9DA 4NAWA 3JVZX 2MSED 2RD0A 2KN5A 2QHOA 2G4SA 3L54A 2C7MB 3R7RA 2ZPYA 4CO7A 2K25A 3L17A 5E6OA 3ZVVA 2HD5B 4EEWA 2ZNVC 5AZHA 3ZTCA 3PLUA 1WJUA 3PGEA 4G50A 4NQKE 5DPTA 2N4FA 4W9HA 3WAMA 1VCBA 3PZDA 2CU1A 3P2BA 2DYBA 2KC1A 5J18A 3WAOA 2LRUA 4M8NA 1KLVA 3N30A 4W9LA 5D94A 2V3SA 1LFDA 2IYDB 3T9LA 1WJNA 2KTFA 2MBBB 4IM3A 4CYEA 1WY8A 2IO0B 2IO1B 4EKUA 1OEYJ 3RUIB 2ZJDA 3HIZA 4ZDVA 5D7GA 2CHWA 2MLBA 5C1ZA 4N9F4 2MP2A 2JRIB 4ZRKA 1Z5SB 2L0TA 3N3KB 2JF5A 5GMVA 2L05A 1R4NI 3IFWB 3QJZA 1SGHA 4KV2A 4KVGB 2D3GA 3V62A 3I3TB 2O2VA 1D3ZA 3ZRFA 4FHJA 1V9JA 2VRRB 4DHJD 3TL5A 2KDFB 4E74A 3W1SA 3OJ4B 4MEMA 1T0YA 2KD0A 3TJPA 3A9JA 3JYUA 1J0GA 4K81A 4MSMB 2KTRB 2LGXA 4I6PA 2KZRA 1UBIA 3ZKJC 3ZUNA 2JVCA 3CF6E 3H7SA 1WF9A 3NOBA 3SD5A 1V5OA 2BKFA 2J0KA 2LUEA 1YX5B 4IC7B 2JZ3B 4P7IA 4EOYA 2GBNA 1GJZA 2L3ZA 3H6NA 1E5WA 4GDKA 4A3PA 4GXBA 3NHEB 4IG7B 5FR6A 4HWIB 3MHSD 4RMAA 3O65B 4M0WB 2LASA 5CHVC 1S3SG 3B0AA 2BWFA 3B1LX 3VFKA 2KJHB 4MGIE 5D6JB 4GU2A 1UGMA 1Z2MA 2K8BA 4GB9A 4KZCA 4LDTD 4NPNA 5DPSA 2L7RA 5LXIB 1WMHA 3DVGX 4B9KA 1MG8A 3DOWA 3LJ3A 2DYMA 1J8CA 3V6EB 2ZCBA 4FBJB 1I35A 4I6NB 3OLMD 2IBIB 2EMSA 3PHWB 2LGYA 4IM0A 4PS7A 4XX5A 2HJ8A 1OEYA 4WWPA 1WGYA 4KSKC 4II3B 4PS8A 4W9DA 4BVUC 2GBMA 4CHKA 4PYUA 4JL9A 3QQ8B 1LQBA 4A3OA 2C9WB 1P98A 2CKHB 2KX3A 2NBVB 2J7QB 1L2NA 1BT0A 2BWES 4HDOA 2K1FA 4EZLA 1WIAA 2G4DB 3SU8X 4HK2A 1P9DU 2LD9A 3L13A 3PREA 3L16A 2MBOA 4DDID 2KWCA 2XK5A 3VUXA 2AL3A 3DQVA 4B6WA 2PE6B 4NAWB 2DENB 3ZO5B 3QK0A 1I42A 2ZVNA 3PPAA 2KMAA 4BKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR9 A;  4NY0 A;  3WAL A;  3NY5 A;  3S2A A;  1C3T A;  1G6J A;  2JWZ A;  2BPS A;  4BKS A;  4BOZ B;  3D32 A;  4TQ0 A;  4W9J A;  2OOB B;  4BKS D;  3LDZ E;  1P1A A;  4K7S A;  5DCN A;  2FID A;  3C0R B;  2FUH B;  4BBN C;  2WWZ A;  5G55 A;  5KHQ A;  2CHZ A;  4IW0 A;  3RZF A;  1XT9 B;  2ZZP B;  1XQQ A;  4GN1 A;  1YJ1 A;  5KHO A;  1Q0W B;  2RSU A;  4E3C A;  4X57 B;  4WJN A;  3KUD B;  1YX6 B;  1H8C A;  1E7U A;  5HKH A;  2NS5 A;  1WYW B;  4DHZ B;  4E71 A;  4DK5 A;  2BYF A;  4IM2 A;  2LZ6 A;  1TGZ B;  4HJK A;  4FLH A;  2KFJ A;  3PV1 A;  2PPH A;  2LXA A;  1C1Y B;  2M1M A;  3K9P B;  3RZW C;  3KVF B;  1WGG A;  2Y5B B;  4ZRJ A;  1RLF A;  5AZF A;  2KNB A;  1EF5 A;  1ZGU B;  1RFA A;  3K9O B;  2NCN A;  3DBS A;  4RM8 A;  4ICV A;  1OQY A;  2NBU A;  1WFY A;  2NBW B;  3HK0 A;  3HHM A;  1RRB A;  1WXM A;  1ISN A;  2M8S A;  4EUT A;  3CST A;  3HM3 A;  4HPM B;  2YVC A;  4AJW A;  2ZNV B;  3VUY A;  4W9K A;  4G11 A;  1EF1 A;  1E90 A;  2KMC A;  1Q5W B;  3OJ3 A;  3QWZ B;  2J0J A;  5JHA A;  1Q1O A;  1TBE A;  2K39 A;  2N1V A;  3B08 A;  3NZU A;  1UD7 A;  5CX3 A;  3A4R A;  4DHZ E;  2LVO A;  2O6V D;  3QCA A;  4DHJ B;  2KDE B;  2NVU I;  3ZNZ B;  2R2O A;  1UZX B;  2C7H A;  4EFO A;  5C23 A;  3GZN I;  4IWP A;  2DZI A;  2NR2 A;  4DWF A;  1V6E A;  3IVF A;  2LWP A;  1VD2 A;  1WMH B;  4GOC A;  1YIW A;  3VH4 B;  2N7E A;  3UIP B;  3RUL A;  3AU5 A;  4DBG A;  1WH3 A;  3A9K A;  2CHX A;  4ASW C;  4MDK E;  1J19 A;  4BBN F;  2JPH A;  3VTU A;  3PRM B;  1NDD A;  2DAJ A;  2O2V B;  1WGR A;  3DBR I;  4NQL B;  4JGH B;  3PRZ A;  4HPL B;  3W1Y A;  4BKT A;  1KOT A;  3UQA A;  1V81 A;  1UH6 A;  4WWN A;  5AEK B;  1LM8 B;  3A1Q A;  3JSV B;  4ANU A;  1GNU A;  5JHB A;  3AI5 A;  1E8Z A;  1WM3 A;  2GBJ A;  4HDQ A;  4ICU A;  3DPD A;  2V4L A;  3CMM B;  3A1Q B;  2DAF A;  4GMV A;  2ZEQ A;  3APC A;  2R2Q A;  3APD A;  1GUA B;  3VVW B;  3U7D A;  2DZJ A;  4MEL A;  1V2Y A;  4FHK A;  5IA7 A;  3ZDM C;  3ZIM A;  3KUZ A;  2N9E B;  4WWO A;  4W9I A;  4RM9 A;  4XZ4 A;  4MGZ E;  3ONS A;  4NNJ B;  5CTR C;  2FCM A;  2KDI A;  3ALB A;  4TUU A;  3V61 A;  4WAA A;  5BO4 B;  3ZNH B;  4II2 B;  4DDG D;  4KIK A;  3UIO B;  3UF8 A;  2WYQ A;  4LDT B;  5J17 A;  3QA8 A;  3QX1 A;  3DBH I;  3W1S C;  2PEA A;  2MCN B;  3WA0 A;  2ASQ A;  2N1W A;  5CHW A;  2KLC A;  4WJQ A;  4NJ7 A;  1A5R A;  4HVB A;  2MBQ A;  2JY6 A;  1NBF C;  4JLC A;  4MJS B;  1X1M A;  1WGH A;  3ZRC A;  3GOE A;  1KJT A;  3A9J B;  3ECI A;  3U8Z A;  2EMT A;  1UBQ A;  1WR6 E;  2BKR B;  2AYO B;  4YL8 A;  2KDB A;  2XEW A;  3H7P A;  4GGQ A;  2MQJ A;  1WE7 A;  2D2Q A;  2BGF A;  3TBL D;  4BOS C;  1GG3 A;  3DDC B;  3R7Q A;  3KUC B;  3H7P B;  2KK8 A;  4WJO A;  2JRH A;  2HE7 A;  2V1Y A;  4EZJ A;  4I6L B;  4IWQ A;  2LJ5 A;  4PS3 A;  4GDK B;  3PHX B;  4F1S A;  2UYZ B;  1WJ4 A;  4FA6 A;  3BY4 B;  4FJY A;  3VDZ A;  2Z0E B;  1IPG A;  2WX0 A;  1P0R A;  1TZ1 A;  2NPT B;  3ZNI D;  1V49 A;  4GIV A;  2I1K A;  4GDL B;  3DVN U;  3QAQ A;  2XK5 B;  3DVG Y;  4KDI C;  2C5L C;  2KJ6 A;  2D11 A;  1E8W A;  4IUM B;  1Y8R C;  1HE8 A;  2CS4 A;  3KH0 A;  3VH3 B;  1V80 A;  2N9X A;  2FCN A;  2MA9 B;  1LXD A;  3KYC D;  4MH0 E;  2KQS A;  3U30 A;  2FIF A;  4OVV A;  1V5T A;  2GBR A;  2KO3 A;  3UIN B;  2KXJ A;  3SHQ A;  1TTN A;  2ZVO A;  4HCP B;  2BYE A;  1RAX A;  5L95 C;  4DXA B;  1R4M I;  1PQS A;  2A5U A;  2KFK A;  1IP9 A;  2IY0 B;  1YQB A;  3V6C B;  1NI2 A;  1WI0 A;  2IO2 B;  4AUQ C;  2AWT A;  2FNJ B;  1M94 A;  2XBB C;  3VAW A;  2JZZ A;  3BIN A;  2K8H A;  1WZ3 A;  2AEH A;  2AL6 A;  4K1R B;  4KIK B;  2KHW B;  1GC7 A;  2KQ7 A;  1OTR B;  4A20 A;  4G3X B;  4LJP B;  2MBE A;  1IYF A;  2MP2 B;  2KLG A;  4AJY B;  2M4N A;  1WM2 A;  3L0W B;  1FXT B;  1WX8 A;  2MRP A;  3M63 B;  5DPW A;  4F7Z A;  2C60 A;  2JUO A;  2LVQ A;  3RT3 B;  2M17 A;  3IG3 A;  3ML8 A;  2A4Z A;  3QIJ A;  1WX7 A;  2KC2 A;  4ZRI A;  2BYV E;  5D2M B;  3PT2 B;  3PVL A;  3RCZ A;  1P3Q U;  3WIM A;  4ANX A;  4J6I A;  1S1Q B;  4FAD A;  4MJS A;  2KWV B;  2Z0D B;  2N7D A;  2KAN A;  3EFU A;  3A4S C;  4KSL C;  1KM7 A;  1V86 A;  3JW0 X;  2D10 A;  5DPR A;  2EKE C;  2IZV B;  3M3J A;  1AAR A;  3L08 A;  2I1J A;  4JIO U;  2PJH A;  5E6P A;  3WAN A;  1K8R B;  1SIF A;  3ENE A;  5EDS A;  2L76 A;  4EZK A;  3M62 B;  2CR5 A;  4KDL B;  4W9E A;  2DYO A;  2IO3 B;  3X23 A;  3APF A;  2KVR A;  2B3A A;  1WXA A;  2KJR A;  4F8C B;  3A33 B;  4ANW A;  3H1U A;  2KWU B;  4IWO A;  3CSF A;  4GDL A;  2KX0 A;  1UEL A;  4HCN B;  2LGD A;  2JXX A;  2NPT A;  2HTH A;  4AWJ A;  4TQ1 A;  4WJP A;  4TV3 A;  3VQI A;  4B95 A;  3NZS A;  3PS6 A;  3T8M A;  3DBL I;  3SDL C;  3EC8 A;  2DHZ A;  4WQO B;  1WGD A;  2K8C A;  5LXH A;  2GMI C;  2DX5 B;  5TR5 A;  3R66 C;  3ZDT A;  1WXV A;  2MBH A;  3IBE A;  1H4R A;  4W9C A;  3OAW A;  3PTF C;  3RYT A;  4M8M A;  2ZCC A;  3R3M A;  1E8X A;  4KZ0 A;  5JZE B;  3JSV A;  4FJV B;  3L10 B;  3VTW A;  3TMP B;  2K6Q A;  3HM6 X;  4HLE A;  5L83 A;  2RPQ A;  2LRW A;  1GC6 A;  4AOF A;  2LXC A;  1F9J A;  3TIX A;  4FJZ A;  4K7U A;  2KFK B;  4MM3 A;  2K6D B;  2FAZ A;  1U4A A;  3NS8 A;  2YLM A;  3KW5 B;  2RGF A;  2L8J A;  3EEC A;  2C7N B;  4BFR A;  1EO6 A;  5CHF A;  1XD3 B;  2L00 B;  1WRD B;  2PE9 A;  2KOX A;  3ZNG C;  4MGK E;  3KYD D;  3A9K B;  3X0W A;  2MWS B;  3PRP B;  1WE6 A;  2G3Q B;  5E6N A;  2FCQ A;  4FN2 A;  2W9N A;  2JT4 B;  4MSQ B;  3UQB A;  4JQW C;  3VXW A;  2FCS A;  2WX1 A;  2KKC A;  2M0X A;  3QAR A;  5G2N A;  1ZKH A;  1CMX B;  1OGW A;  1WZ0 A;  3N32 A;  3QHT A;  3QC8 B;  2O6V B;  1QZE A;  1E8Y A;  3VUW A;  3ZW3 A;  1EUV B;  2G45 B;  2KTR A;  2IY1 B;  2L0F A;  2UWQ A;  4G0N B;  1WX9 A;  3Q3F A;  1L7Y A;  4MGY E;  2OJR A;  3AUL A;  2O6V A;  3ML9 A;  1JRU A;  4OVU A;  3PSE B;  4W9G A;  3PLV A;  4ANV A;  3EHV A;  3ZTD A;  4TKN A;  3VTV A;  3AXC A;  5AZG A;  4GSW A;  3WAP A;  3MJW A;  3DCG A;  2LI5 A;  3UGB B;  3ZLZ A;  5LLI A;  2DZK A;  4HXD A;  3M95 A;  3MTN B;  3V60 A;  2DZM A;  2GBK A;  2J0M A;  4AP4 C;  3AU4 A;  1SE9 A;  2WDT B;  3RD2 A;  4URK A;  5J2R A;  1E7V A;  1WJ6 A;  3DVN V;  3IHP C;  3VHT C;  2REX A;  2MX2 A;  1WR1 A;  4PYZ A;  4W9F A;  4K7W A;  2N9P C;  2Z59 B;  4LCD E;  4NJ6 A;  5JH5 C;  1WXS A;  4ZYN A;  3Q3J A;  5IAA C;  1ZW7 A;  3TCA A;  4FUL A;  1YD8 U;  2BF8 B;  2MW5 A;  2LVP A;  4LJO B;  2GOW A;  2ZPN A;  4XC2 A;  2D07 B;  3H9D A;  4NAW A;  3JVZ X;  2MSE D;  2RD0 A;  2KN5 A;  2QHO A;  2G4S A;  3L54 A;  2C7M B;  3R7R A;  2ZPY A;  4CO7 A;  2K25 A;  3L17 A;  5E6O A;  3ZVV A;  2HD5 B;  4EEW A;  2ZNV C;  5AZH A;  3ZTC A;  3PLU A;  1WJU A;  3PGE A;  4G50 A;  4NQK E;  5DPT A;  2N4F A;  4W9H A;  3WAM A;  1VCB A;  3PZD A;  2CU1 A;  3P2B A;  2DYB A;  2KC1 A;  5J18 A;  3WAO A;  2LRU A;  4M8N A;  1KLV A;  3N30 A;  4W9L A;  5D94 A;  2V3S A;  1LFD A;  2IYD B;  3T9L A;  1WJN A;  2KTF A;  2MBB B;  4IM3 A;  4CYE A;  1WY8 A;  2IO0 B;  2IO1 B;  4EKU A;  1OEY J;  3RUI B;  2ZJD A;  3HIZ A;  4ZDV A;  5D7G A;  2CHW A;  2MLB A;  5C1Z A;  4N9F 4;  2MP2 A;  2JRI B;  4ZRK A;  1Z5S B;  2L0T A;  3N3K B;  2JF5 A;  5GMV A;  2L05 A;  1R4N I;  3IFW B;  3QJZ A;  1SGH A;  4KV2 A;  4KVG B;  2D3G A;  3V62 A;  3I3T B;  2O2V A;  1D3Z A;  3ZRF A;  4FHJ A;  1V9J A;  2VRR B;  4DHJ D;  3TL5 A;  2KDF B;  4E74 A;  3W1S A;  3OJ4 B;  4MEM A;  1T0Y A;  2KD0 A;  3TJP A;  3A9J A;  3JYU A;  1J0G A;  4K81 A;  4MSM B;  2KTR B;  2LGX A;  4I6P A;  2KZR A;  1UBI A;  3ZKJ C;  3ZUN A;  2JVC A;  3CF6 E;  3H7S A;  1WF9 A;  3NOB A;  3SD5 A;  1V5O A;  2BKF A;  2J0K A;  2LUE A;  1YX5 B;  4IC7 B;  2JZ3 B;  4P7I A;  4EOY A;  2GBN A;  1GJZ A;  2L3Z A;  3H6N A;  1E5W A;  4GDK A;  4A3P A;  4GXB A;  3NHE B;  4IG7 B;  5FR6 A;  4HWI B;  3MHS D;  4RMA A;  3O65 B;  4M0W B;  2LAS A;  5CHV C;  1S3S G;  3B0A A;  2BWF A;  3B1L X;  3VFK A;  2KJH B;  4MGI E;  5D6J B;  4GU2 A;  1UGM A;  1Z2M A;  2K8B A;  4GB9 A;  4KZC A;  4LDT D;  4NPN A;  5DPS A;  2L7R A;  5LXI B;  1WMH A;  3DVG X;  4B9K A;  1MG8 A;  3DOW A;  3LJ3 A;  2DYM A;  1J8C A;  3V6E B;  2ZCB A;  4FBJ B;  1I35 A;  4I6N B;  3OLM D;  2IBI B;  2EMS A;  3PHW B;  2LGY A;  4IM0 A;  4PS7 A;  4XX5 A;  2HJ8 A;  1OEY A;  4WWP A;  1WGY A;  4KSK C;  4II3 B;  4PS8 A;  4W9D A;  4BVU C;  2GBM A;  4CHK A;  4PYU A;  4JL9 A;  3QQ8 B;  1LQB A;  4A3O A;  2C9W B;  1P98 A;  2CKH B;  2KX3 A;  2NBV B;  2J7Q B;  1L2N A;  1BT0 A;  2BWE S;  4HDO A;  2K1F A;  4EZL A;  1WIA A;  2G4D B;  3SU8 X;  4HK2 A;  1P9D U;  2LD9 A;  3L13 A;  3PRE A;  3L16 A;  2MBO A;  4DDI D;  2KWC A;  2XK5 A;  3VUX A;  2AL3 A;  3DQV A;  4B6W A;  2PE6 B;  4NAW B;  2DEN B;  3ZO5 B;  3QK0 A;  1I42 A;  2ZVN A;  3PPA A;  2KMA A;  4BKG A; 
#chains in the Genus database with same CATH topology
 4LNO A;  4XDD A;  2WP9 B;  3S2A A;  5IN7 A;  4BKS D;  4RGM A;  4K7S A;  2FID A;  4BBN C;  1TS3 A;  5TSS A;  5KHQ A;  4IW0 A;  1Q0W B;  4X57 B;  4WJN A;  1XXG A;  4DHZ B;  4KGT A;  1NEN B;  2BYF A;  4N58 A;  3ZJU A;  2IDY A;  4HJK A;  1L5P A;  1YQ4 B;  2M1M A;  2KMM A;  4ZRJ A;  3UI3 A;  3K9O B;  2NCN A;  1V1P A;  2NBU A;  2NMQ A;  1WFY A;  2NBW B;  3NVW A;  1CK1 A;  1RRB A;  1ROE A;  3HM3 A;  4HPM B;  2ZNV B;  4W9K A;  1E90 A;  1TBE A;  1RFK A;  1UD7 A;  2O6V D;  3QCA A;  3MP9 A;  2NVU I;  3ZNZ B;  2C7H A;  3HVD A;  3GZN I;  3W5U B;  3IVF A;  1FCC C;  4TMA B;  5BMG A;  1IGD A;  3RN9 C;  1XO3 A;  4C7Y A;  2N7E A;  3RUL A;  3AU5 A;  4DBG A;  4ASW C;  2QDF A;  3PRM B;  1NDD A;  1K51 A;  2ONQ A;  1WGR A;  3DBR I;  1AYF A;  3PZ8 A;  3TEY A;  3PRZ A;  1KOT A;  4WWN A;  3A1Q A;  1TJE A;  3AE6 B;  1QOG A;  4PK1 A;  1GNU A;  1JAL A;  3DPD A;  1GPX A;  3APD A;  3VVW B;  2DZJ A;  1V2Y A;  4FHK A;  3ZIM A;  2G9H D;  1PGX A;  2Q5W D;  3ONS A;  2FCM A;  3ZNH B;  3OWE B;  3UIO B;  1F2R C;  3QA8 A;  1SJH D;  2PEA A;  2ASQ A;  1VZ7 A;  4JLC A;  1NBF C;  3PZ7 A;  3GOE A;  3A9J B;  3RNA C;  1UBQ A;  2AYO B;  1R4M B;  1F52 A;  3U2S C;  3BK2 A;  1B1Z A;  1WE7 A;  4DXG A;  2KK8 A;  2HE7 A;  2V1Y A;  3AE5 B;  1KLG D;  4F1S A;  2LMC A;  2UYZ B;  3Q3N C;  1SB3 C;  4C4V A;  3BY4 B;  3R8B A;  1T5X D;  1UUP A;  2ON8 A;  2NPT B;  4HEA 1;  5EE9 A;  2XK5 B;  3FIL B;  1PGB A;  1XLP A;  3DVG Y;  1I7H A;  3KH0 A;  2N9X A;  2MA9 B;  3KYC D;  4CQN A;  1ET6 A;  1FNU A;  2KO3 A;  2M56 B;  2PW9 A;  1PYW D;  2ZW1 A;  1FRR A;  4HCP B;  1R4M I;  2A5U A;  2SEB D;  2IY0 B;  3V6C B;  4YTM B;  2IO2 B;  1HXY D;  1TY2 A;  4C00 A;  3RI7 C;  3GE3 C;  2AEH A;  1FMA D;  4US9 A;  1GC7 A;  1OTR B;  4DQO C;  2BQQ A;  2M4N A;  1WX8 A;  2C60 A;  1CZP A;  3AE4 B;  3IXS A;  3IG3 A;  3QIJ A;  3DBL B;  1E10 A;  3PVL A;  1P3Q U;  1SBB B;  4RNA A;  4MJS A;  2N7D A;  3A4S C;  1V86 A;  2D10 A;  1KRH A;  4HRO A;  2J4X A;  2I1J A;  2K9X A;  4JIO U;  1K8R B;  1ACC A;  1SIF A;  3LB8 C;  4RFB A;  5EDS A;  2L76 A;  4EZK A;  4MH8 A;  3Q8F A;  3X23 A;  5AUK A;  2KVR A;  2B3A A;  2H89 B;  5H8Y E;  2BS3 B;  2WGS A;  3CSF A;  4YSZ B;  4TQ1 A;  4WJP A;  1K50 A;  1WGD A;  2DX5 B;  3IBE A;  4W9C A;  3OAW A;  5G5H A;  2JU6 X;  3VTW A;  1AW7 A;  2FE8 A;  5L83 A;  3IAM 1;  1F9J A;  1EWC A;  3I9V 1;  4FJZ A;  4YWG G;  2V0G A;  2YLM A;  3I5J C;  3KW5 B;  4OHJ A;  2L8J A;  4WH4 A;  5E6J A;  2BYT A;  2L00 B;  2KOX A;  3DHH C;  4LLG M;  3ZNG C;  2FCQ A;  3B2F A;  4JQW C;  1YQ3 B;  3VXW A;  5G2N A;  3RNF C;  1T3Q A;  3U4E G;  1OGW A;  3ZW3 A;  3QC8 B;  2O6V B;  3VUW A;  1VR9 A;  2IY1 B;  2QC8 A;  1WX9 A;  3MC0 B;  1L7Y A;  3PLV A;  3EHV A;  3VTV A;  3DCG A;  2LI5 A;  4C56 C;  2N9L A;  4YSY B;  4XDC A;  2INP E;  2J0M A;  3LYY A;  1L0X B;  1SE9 A;  4IKG A;  2REX A;  4M0W A;  3GS2 A;  4ZYS A;  2FBW B;  2LUM A;  3B2G A;  1WXS A;  1V97 A;  3TCA A;  2LHD A;  2MW5 A;  2LVP A;  4XC2 A;  3ZYY X;  1QF6 A;  2MSE D;  2QHO A;  3L54 A;  2ZPY A;  4N6E B;  4WWM A;  3PO0 A;  3AEC B;  3WAM A;  2N4F A;  1VCB A;  3PZD A;  1FRD A;  2CU1 A;  2DYB A;  2PVO D;  2ZW0 A;  3WAO A;  3NUH B;  1KLV A;  2WU5 B;  3V05 A;  3N30 A;  2BT6 A;  4W9L A;  2V3S A;  1LFD A;  2IYD B;  2G1E A;  1V8C A;  5IKC M;  4HKZ E;  2IO1 B;  1SE3 A;  2W54 A;  5C1Z A;  4YTN B;  4M00 A;  3N3K B;  3MHZ A;  3IFW B;  2PIA A;  2DBY A;  3T3N A;  1IGC A;  1D3Z A;  4FHJ A;  2RPV A;  1I4H A;  3W1S A;  2KD0 A;  1J0G A;  1P7E A;  2LGX A;  4I6P A;  3VR9 B;  4RF0 A;  2PTL A;  1ZUD 2;  3ZUN A;  3H7S A;  1LO5 D;  1ZDX A;  4A55 A;  2WDV B;  3SD5 A;  1V5O A;  2J0K A;  1ET9 A;  2JZ3 B;  2BS4 B;  3ZXR A;  3RNG C;  1PUT A;  4AQ7 A;  4XE0 A;  1QKZ A;  4IG7 B;  5FR6 A;  4LNN A;  1I4R A;  2BWF A;  2WU2 B;  4GU2 A;  1JWU D;  4M01 A;  4ZRP A;  2RMM A;  3ZJT A;  3SFD B;  4B9K A;  1MG8 A;  1QLB B;  3AEA B;  3V6E B;  1I35 A;  1KH0 A;  4IM0 A;  4PS7 A;  2LGY A;  4KSK C;  3AH7 A;  1GB1 A;  4JL9 A;  3U52 E;  3QQ8 B;  2L1A A;  2C9W B;  2KX3 A;  2J7Q B;  4HDO A;  1HTQ A;  1P9D U;  3AEF B;  2BTE A;  4NAM A;  4DDI D;  2KWC A;  2LGS A;  2PE6 B;  2KVZ A;  4BKG A;  2RR9 A;  4NY0 A;  2R61 A;  4A6Q A;  3NY5 A;  5HHD G;  2GRI A;  4BKS A;  4BOZ B;  4YSX B;  1FD6 A;  3LDZ E;  1C9F A;  3C0R B;  4P6V F;  2KYW A;  2WHI A;  3EGR A;  2BW2 A;  5G55 A;  5BMH A;  3RZF A;  4L23 A;  1JCK B;  1YJ1 A;  3NVY A;  1YX6 B;  2NS5 A;  4DK5 A;  1XCT L;  1BML C;  4YXD B;  4US8 A;  2J52 A;  1N63 A;  2QIL A;  5AZF A;  4RM8 A;  1L6V A;  3HK0 A;  1ISN A;  2M8S A;  1PFD A;  4EUT A;  2RDH A;  3VRA B;  2YVC A;  1ENF A;  2YEP B;  2J0J A;  1TKY A;  5JHA A;  1Q1O A;  3B08 A;  2N1V A;  2LVO A;  3SEB A;  1UZX B;  1V6E A;  4KKJ A;  1VD2 A;  1WMH B;  4GOC A;  1N61 A;  2MH7 A;  3NVZ A;  4P1B C;  1C78 A;  3A9K A;  3MC8 A;  2DAJ A;  2O2V B;  4JGH B;  4ZHP A;  3UQA A;  3JSV B;  2B76 B;  4ANU A;  3AI5 A;  1WM3 A;  2GBJ A;  4HDQ A;  4C7Z A;  4M02 A;  4RGT A;  2WXM A;  2ZEQ A;  3APC A;  5IA7 A;  3ZDM C;  3KUZ A;  4XZ4 A;  2JX5 A;  4TUU A;  1STE A;  3UF8 A;  4LDT B;  3HRD D;  2LHE A;  3EFC A;  2QCZ A;  1A5R A;  4MJS B;  1WGH A;  3ECI A;  3U8Z A;  1WR6 E;  2BKR B;  4YL8 A;  1MG4 A;  2MQJ A;  2D2Q A;  3R7Q A;  3H7P B;  3W5V B;  2NTS A;  3Q6B A;  2JRH A;  1VJK A;  4IWQ A;  4PS3 A;  1AN8 A;  3W2D A;  1R4N B;  4FA6 A;  1IPG A;  1P0R A;  3ZQ4 A;  3P63 A;  4GIV A;  4GDL B;  1KFY B;  2NTT A;  3QAQ A;  1WXQ A;  3BVM A;  4KDI C;  1E8W A;  4HJG E;  1UF0 A;  1HE8 A;  2PLP A;  2CS4 A;  1QIL A;  3U30 A;  2KQS A;  4ZRQ A;  1N60 A;  1V5T A;  1WRI A;  2KXJ A;  3AV8 A;  2BB5 A;  1E0Z A;  1UGJ A;  1IP9 A;  4A9A A;  3FAH A;  1BUI C;  1NI2 A;  2N7J A;  2AWT A;  1M94 A;  3VAW A;  2JZZ A;  5EE3 A;  2YEP F;  4K1R B;  2MBE A;  4AJY B;  4FXC A;  5IP4 D;  3L0W B;  1D4B A;  4F7Z A;  2M17 A;  2LJI A;  3ML8 A;  2A4Z A;  2BYV E;  1KTK A;  3RCZ A;  4ANX A;  1S1Q B;  4FAD A;  2KWV B;  4JPS A;  3JW0 X;  3AE9 B;  1I4P A;  3RNC C;  2WQY B;  1XLQ A;  3L08 A;  2CR5 A;  2IO3 B;  1E9M A;  2RDG A;  2KJR A;  4ANW A;  1IUE A;  4P1C C;  3H1U A;  4IWO A;  3R2I A;  4GDL A;  1UEL A;  3VQI A;  2CU3 A;  3NZS A;  2WXL A;  3SR6 A;  3SDL C;  1WSP A;  3EC8 A;  4WQO B;  3Q8B A;  2ACZ B;  3OG5 A;  2WXK A;  2JSV X;  3RYT A;  3PTF C;  4M8M A;  1D5M C;  2ZCC A;  4KZ0 A;  2V3N A;  5JZE B;  2WXR A;  3L10 B;  3HM6 X;  2RPQ A;  1GC6 A;  1JRO A;  2LXC A;  2V3P A;  3ZJV A;  1TKE A;  3KQ4 A;  3N9Y C;  4AS1 A;  3EEC A;  1D6E C;  1EO6 A;  5CHF A;  5D3I B;  5EE0 A;  2PE9 A;  3X0W A;  3A9K B;  2G3Q B;  2W9N A;  4P16 A;  4MSQ B;  2FCS A;  4KGR A;  3VR8 B;  1WYG A;  4NJC A;  4OZC A;  1RYJ A;  2D3B A;  2G45 B;  2L0F A;  4K3B A;  5C3J B;  4MGY E;  2OJR A;  1JRU A;  4TKN A;  2KWD A;  2EKI A;  3J9C A;  4GSW A;  3MJW A;  4ARC A;  3T3O A;  2DZK A;  3M95 A;  5AUI A;  1E6E B;  2GBK A;  3N1Y C;  2KAC A;  4RGO S;  5EE1 A;  3ZGZ A;  2WDT B;  4URK A;  2MHJ A;  3GE8 C;  3BVG A;  1OFF A;  1WJ6 A;  2X38 A;  2WXJ A;  4PYZ A;  4W9F A;  2N9P C;  3W9C B;  4QAY A;  4MT5 A;  1ZW7 A;  1YD8 U;  2BF8 B;  2K22 A;  2D07 B;  3H9D A;  4NAW A;  1YN5 A;  2VH1 A;  3SFE B;  2RD0 A;  2KN5 A;  1MFW A;  3R7R A;  3L17 A;  1QOB A;  1VDV A;  3ZVV A;  2HD5 B;  4EEW A;  2ZNV C;  3ZTC A;  1L0V B;  4HRS A;  3PGE A;  4G50 A;  3RPF C;  2LRU A;  3Q8A A;  1QOA A;  3KLS X;  1WJN A;  2WXH A;  2IO0 B;  1RWS A;  4EKU A;  2ZJD A;  5D7G A;  2MLB A;  4N9F 4;  2JRI B;  1YJJ A;  3EA6 A;  2L0T A;  5GXG B;  1HEZ E;  5GMV A;  2JF5 A;  4KV2 A;  4C80 A;  3RFZ B;  4KVG B;  1BXT A;  3I3T B;  3NVV A;  4E74 A;  1C79 A;  4MEM A;  3L4P A;  3JYU A;  4K81 A;  1D5Z C;  1MJD A;  1UBI A;  2WDQ B;  1V1P B;  1WF9 A;  2BKF A;  1PDX A;  2LUE A;  4P7I A;  2M19 A;  2GBN A;  4PT5 A;  1E5W A;  1FPY A;  3NHE B;  1JWA D;  2QSD A;  4HKQ A;  3N1X C;  3V3X A;  4EE2 A;  2LAS A;  5CHV C;  3VFK A;  1GOZ A;  5D6J B;  4KZC A;  3AED B;  5BYQ A;  1DOY A;  3IT6 B;  3DOW A;  2DYM A;  1J8C A;  4FBJ B;  1OEY A;  2CJO A;  3BK1 A;  4WWP A;  1ZXI A;  4RGN A;  4II3 B;  4BVU C;  4CHK A;  5FKA C;  1EWY C;  1P98 A;  3MJ5 A;  2K1F A;  4IDI A;  1LGR A;  2LD9 A;  4C4V B;  1YN3 A;  1JML A;  1QQR A;  3DQV A;  3QK0 A;  1I42 A;  2KMA A;  3WAL A;  1Y56 A;  1C3T A;  4LNK A;  1ZXH A;  3D32 A;  4MAC A;  4W9J A;  2OOB B;  5C2T B;  1P1A A;  2Z8L A;  4USA A;  1JW9 D;  1HZ5 A;  2CHZ A;  2W55 A;  1XT9 B;  1XQQ A;  3Q3O C;  4GN1 A;  2WLB A;  3AEG B;  1N6Z A;  3KUD B;  5HKH A;  4E71 A;  4IM2 A;  4FLH A;  2DNF A;  3NJT A;  2VZK D;  2KFJ A;  3PV1 A;  2Y5P A;  2L32 A;  4GLS C;  3K9P B;  3ABV B;  3RZW C;  1WGG A;  2MEK A;  2CJN A;  2IJ0 A;  1FNV A;  2KNB A;  1EF5 A;  3AE3 B;  1RFA A;  3DBS A;  1KF6 B;  4B0M A;  4ICV A;  1OQY A;  1WXM A;  3CST A;  3AEB B;  3AE7 B;  1Q5W B;  3OJ3 A;  3QWZ B;  4WAF A;  2K39 A;  5CX3 A;  3NZU A;  2INN E;  1I4G A;  4DHZ E;  2PKO A;  2KDE B;  2WXP A;  1NI3 A;  5C23 A;  4IWP A;  2DZI A;  3GB1 A;  5T8I A;  3MFG A;  2LWP A;  1YIW A;  3VH4 B;  2KQ4 X;  4XWT A;  3Q69 A;  3Q3M C;  3UIP B;  1WH3 A;  1ZP0 B;  3NRZ A;  4TSS A;  2IGD A;  4D2K A;  3FC4 A;  4BBN F;  5IO9 A;  2JPH A;  3N1Z C;  3VTU A;  4NQL B;  4BKT A;  1V81 A;  1UH6 A;  5AEK B;  1LM8 B;  1T0S C;  3AE2 B;  1E8Z A;  4ICU A;  3A1Q B;  2J53 A;  2DAF A;  5MPO A;  1ESF A;  2R2Q A;  3BWU D;  3U7D A;  4MEL A;  2LEK A;  4WWO A;  4W9I A;  2WNM A;  3URY A;  4RH6 A;  1FM0 D;  3V61 A;  3ALB A;  5BO4 B;  4II2 B;  4DDG D;  5J17 A;  3QX1 A;  3DBH I;  3W1S C;  2OHF A;  3WA0 A;  5CHW A;  1CJE A;  1T0Q C;  3AE8 B;  2SAK A;  4HVB A;  4REZ A;  2I38 A;  1C4A A;  3ZRC A;  1F77 A;  4Q2J A;  1KJT A;  2EMT A;  2KDB A;  1N5W A;  1EM7 A;  2XNA C;  1VZ8 A;  4XYC A;  3TBL D;  4BOS C;  1GG3 A;  3KUC B;  4WJO A;  1A70 A;  1WJ4 A;  1N5X A;  4IOI E;  5D3D A;  3VDZ A;  2Z0E B;  2HJ1 A;  1TZ1 A;  4LNF A;  2IGG A;  3ZNI D;  2I1K A;  4K3C A;  3DVN U;  4LNI A;  3AE1 B;  3P4P B;  2C5L C;  1FXI A;  1L4D B;  2KJ6 A;  4O1N A;  2FCN A;  1LXD A;  3KWV A;  1AWD A;  1QOF A;  2ZVO A;  1P7F A;  1RAX A;  4DXA B;  2KFK A;  2JWU A;  1WI0 A;  3BYT B;  2DWQ A;  3E9S A;  1MI0 A;  2FNJ B;  2X8X X;  2XBB C;  1J7C A;  1WZ3 A;  4N59 A;  1YJI A;  3BVZ A;  4MM3 B;  2KQ7 A;  1FNW A;  4G3X B;  1IYF A;  2MP2 B;  1IBX B;  2KLG A;  1FXT B;  5DPW A;  3M63 B;  2JUO A;  4RCO A;  3DHG C;  4ZRI A;  4A8X C;  2INC C;  3PT2 B;  4J6I A;  1V1O A;  2Z0D B;  4KSL C;  5DPR A;  2EKE C;  2IZV B;  1AAR A;  1DYQ A;  1MHX A;  2IGH A;  1VZ6 A;  4XGA B;  4W9E A;  2DYO A;  2N9K A;  3APF A;  3A33 B;  2PMV A;  1VLB A;  2KX0 A;  4HCN B;  1TT5 B;  2HTH A;  3P4Q B;  3T8M A;  2WXN A;  3DBL I;  2DHZ A;  3TSS A;  2K8C A;  2GMI C;  5TR5 A;  3R66 C;  3ZDT A;  1GB4 A;  2ICI A;  1H4R A;  1HQR D;  1ZPS A;  5BMI A;  3R3M A;  1E8X A;  1UNS A;  5HFY A;  3FKY A;  2K6Q A;  1I4X A;  4YTP B;  3U7Z A;  3TIX A;  3C19 A;  2KFK B;  2H88 B;  4H2A A;  4MM3 A;  2K6D B;  2FAZ A;  3NS8 A;  2RGF A;  2C7N B;  1XD3 B;  3NZ3 A;  2WXG A;  4MGK E;  3KYD D;  2MWS B;  1TKG A;  3PRP B;  5E6N A;  4FN2 A;  2JT4 B;  1SIJ A;  2WX1 A;  2M0X A;  3QAR A;  2HTM E;  3O13 A;  1ZKH A;  1CMX B;  3N32 A;  3QHT A;  1WZ0 A;  2UU7 A;  1JWM D;  1QZE A;  2UWQ A;  4G0N B;  3Q3F A;  3AUL A;  2O6V A;  3ML9 A;  4S17 A;  4ANV A;  3AXC A;  5AZG A;  3ZLZ A;  1UWX A;  5LLI A;  2K5P A;  2IPK D;  4HXD A;  4YT0 B;  1F2R I;  3V60 A;  1C4C A;  2DZM A;  1JWS D;  3AU4 A;  3RD2 A;  1E7V A;  3DVN V;  3VHT C;  3R2T A;  4K7W A;  2Z59 B;  4LCD E;  3GP7 A;  4FUL A;  2GOW A;  1SE2 A;  3JVZ X;  2LFI A;  3P42 A;  2G4S A;  2C7M B;  4CO7 A;  2K25 A;  5E6O A;  3NS1 A;  1OQR A;  2BVC A;  3PLU A;  1WJU A;  4J3O D;  4NQK E;  4W9H A;  1ZOY B;  3AEE B;  4OZA A;  4OVZ A;  1SJE D;  3P2B A;  3DWM A;  4M8N A;  2WXO A;  5FR3 A;  5D94 A;  2OED A;  3ETR A;  1XLN A;  2MBB B;  3RUI B;  2JYT A;  4ZRK A;  1MVK A;  1SGH A;  2O2V A;  3ZRF A;  1V9J A;  3TL5 A;  3OJ4 B;  1T0Y A;  3TJP A;  2JVC A;  3NOB A;  3AN1 A;  4ACF A;  4IC7 B;  1GJZ A;  4ITK A;  1FCL A;  4GDK A;  3DBR B;  3TUO A;  4HWI B;  1NYR A;  2QIE B;  3B1L X;  2D5G A;  4LDT D;  5DPS A;  2L7R A;  5LXI B;  4ZOH C;  1WMH A;  4JX1 C;  1XF5 L;  3DVG X;  3BYY B;  1SXT A;  2WDR B;  2EMS A;  3PHW B;  4XX5 A;  2HJ8 A;  2VH2 A;  2AX5 A;  1RM6 C;  1C76 A;  4PS8 A;  4W9D A;  2GBM A;  1JWB D;  5BYS A;  4PYU A;  1QT9 A;  2AQ2 B;  1LQB A;  3DHI C;  4A3O A;  2CKH B;  2NBV B;  1L2N A;  2BWE S;  1F1H A;  4EZL A;  2G4D B;  2RDB C;  4HK2 A;  5JXV A;  3L13 A;  2GI9 A;  4R3D A;  3L16 A;  3I63 C;  2OJW A;  2VZK B;  2MBO A;  1TS4 A;  2XK5 A;  3FIL A;  3VUX A;  4B6W A;  1L4Z B;  2DEN B;  1TGZ B;  2QJL A;  1R7S A;  4WIP A;  1G6J A;  1JRP A;  2JWZ A;  2BPS A;  4TQ0 A;  4KX6 B;  2W3R A;  3LXF A;  5DCN A;  1L6U A;  3TEW A;  2FUH B;  2WWZ A;  4UDU C;  4LK0 M;  3DWG C;  2V4I B;  2ZZP B;  5KHO A;  2RSU A;  2D3A A;  4E3C A;  2FUG 1;  1H8C A;  1E7U A;  3TEX A;  1ZE3 D;  1WYW B;  1XEE A;  4NZL B;  2LZ6 A;  1NYQ A;  2GB1 A;  2PPH A;  2LXA A;  3IAS 1;  1C1Y B;  1MHH E;  2BBC A;  3N20 C;  2N0S B;  3KVF B;  1C4P A;  2Y5B B;  2JYE A;  1RLF A;  1ZGU B;  2EEL A;  2K0P A;  2L83 A;  1OQQ A;  2MJD A;  3HHM A;  1WWT A;  4L2Y A;  4AJW A;  3VUY A;  3HUI A;  4G11 A;  1EF1 A;  1FO4 A;  2KMC A;  4JWU C;  3A4R A;  3BII D;  4DHJ B;  4B0E A;  2R2O A;  4EFO A;  2NR2 A;  4DWF A;  2KAJ A;  5HG2 A;  1K53 A;  2CHX A;  4MDK E;  1J19 A;  5BYR A;  3BZD B;  4HPL B;  1EU4 A;  3Q8E A;  1ZDV A;  2IND C;  3C8Y A;  5JHB A;  4HPP A;  2V4L A;  3B9J A;  3CMM B;  2JZP A;  4GMV A;  1UWM A;  1FIQ A;  1GUA B;  1EU3 A;  2HDE A;  2N9E B;  4RM9 A;  4MGZ E;  4NNJ B;  5CTR C;  2KDI A;  4WAA A;  4KIK A;  2WYQ A;  2MCN B;  2N1W A;  1FFV A;  2KLC A;  4WJQ A;  4NJ7 A;  2MBQ A;  2JY6 A;  1X1M A;  4OW0 A;  1NVI D;  2XEW A;  3H7P A;  1N62 A;  4GGQ A;  4F8C B;  2BGF A;  2AQ3 B;  3DDC B;  4BZA A;  3E56 A;  4EZJ A;  4I6L B;  3AM9 A;  2WS3 B;  2LJ5 A;  1J7B A;  2L52 A;  4GDK B;  3PHX B;  2BB6 A;  1K52 A;  2GLS A;  2KT7 A;  4FJY A;  2WX0 A;  1TY0 A;  2JQR B;  1V49 A;  1Q10 A;  1B9R A;  1YMH E;  2LGI A;  3I57 A;  2D11 A;  4IUM B;  4ZHO A;  1JQ4 A;  1Y8R C;  3VH3 B;  1V80 A;  5HI1 A;  4MH0 E;  2FIF A;  4OVV A;  2GBR A;  3UIN B;  1TIF A;  3SHQ A;  1TTN A;  2BYE A;  5IOI A;  5L95 C;  1PQS A;  1YQB A;  4AUQ C;  2TSS A;  2PVG C;  3BIN A;  2QMT A;  2K8H A;  3P1M A;  2AL6 A;  3AMZ A;  4KIK B;  2KHW B;  4A20 A;  4LJP B;  3P4R B;  4A90 A;  1WM2 A;  3WCQ A;  3EUB 2;  2MRP A;  2LVQ A;  4JWS C;  3RT3 B;  1DOX A;  1WX7 A;  2KC2 A;  1L0Y B;  5D2M B;  3WIM A;  3EFU A;  2KAN A;  1KM7 A;  1YNT E;  3RNB C;  3M3J A;  1TZO A;  2PJH A;  3H8H A;  1XLO A;  5E6P A;  3WAN A;  3ENE A;  1TYG B;  4ARI A;  3M62 B;  3KWL A;  4KDL B;  3DBH B;  1WXA A;  5G5G A;  1DGJ A;  1D5X C;  2KWU B;  2LGD A;  1TS2 A;  2JXX A;  2J42 A;  4WQM A;  2NPT A;  4AWJ A;  4TV3 A;  4B95 A;  3PS6 A;  1VRA B;  1HZ6 A;  5LXH A;  1HTO A;  2MJE A;  1WXV A;  2MBH A;  4BAX A;  1CQV A;  2V9H A;  1E7P B;  3NG0 A;  3JSV A;  4FJV B;  4S0R A;  3TMP B;  1YN4 A;  2LRW A;  4AOF A;  1SSN A;  3VRB B;  4K7U A;  1U4A A;  1FFU A;  4BFR A;  5LNK 1;  1WRD B;  4OZB A;  1WE6 A;  3UQB A;  2JXT A;  2KKC A;  3W1Y A;  4HLE A;  4DHJ D;  1E8Y A;  1EUV B;  2KTR A;  4W9G A;  4OVU A;  2BS2 B;  3PSE B;  3ZTD A;  3Q8C A;  2WXF A;  3WAP A;  3UGB B;  1C77 A;  1SE4 A;  1KLU D;  2M0A A;  3RNE C;  1F0Z A;  3MTN B;  2Y3A A;  3Q14 C;  4AP4 C;  5I4D A;  5J2R A;  2MJ3 A;  3IHP C;  1FXA A;  2MX2 A;  1WR1 A;  2KDM A;  4NJ6 A;  5JH5 C;  4ZYN A;  3Q3J A;  5IAA C;  4LJO B;  2ZPN A;  3TEZ A;  5AZH A;  1PGA A;  2E6X A;  1GAQ B;  5DPT A;  4DXF A;  2KC1 A;  5J18 A;  3MC9 A;  3T9L A;  3IT4 B;  2KTF A;  2D3C A;  4IM3 A;  4CYE A;  1WY8 A;  1T6B X;  1OEY J;  3HVZ A;  3HIZ A;  4ZDV A;  1J7A A;  1XCQ L;  2CHW A;  2QEJ C;  2MP2 A;  3AB5 A;  1IBX A;  2W3S A;  1Z5S B;  2XN9 C;  2KN4 A;  4L1B A;  2L05 A;  1R4N I;  3CWI A;  3QJZ A;  1YOV B;  4WUR A;  2D3G A;  3V62 A;  1SF0 A;  2VRR B;  3ZXV A;  1HA5 A;  2KDF B;  3A9J A;  1M4V A;  4MSM B;  1SEB D;  2KTR B;  2KZR A;  3ZKJ C;  3CF6 E;  1NEK B;  3Q2A C;  5H92 C;  4LTU A;  1YX5 B;  2WXQ A;  4KKI A;  4EOY A;  2L3Z A;  1T0R C;  3H6N A;  4A3P A;  1FEH A;  4GXB A;  2AQ1 B;  2I2Y A;  3MHS D;  4RMA A;  3O65 B;  4M0W B;  1S3S G;  3B0A A;  2KJH B;  4MGI E;  1UGM A;  1Z2M A;  2K8B A;  4GB9 A;  2WXI A;  4KGS A;  4NPN A;  4JE3 B;  1MPE A;  3GZN B;  3P4S B;  3LJ3 A;  2ZCB A;  4I6N B;  3OLM D;  2IBI B;  2DLB A;  2K3U A;  1WGY A;  4RF1 A;  1TS5 A;  2Y5C A;  3CIR B;  1BT0 A;  1WIA A;  3SU8 X;  5FK9 C;  1I4Q A;  3PRE A;  2W82 A;  1WGK A;  2AL3 A;  4NAW B;  4XWW A;  3ZO5 B;  2ZVN A;  2E3T A;  3PPA A;  1DOI A;  3RMK C; 
#chains in the Genus database with same CATH homology
 2RR9 A;  4NY0 A;  3WAL A;  3NY5 A;  3S2A A;  1C3T A;  1G6J A;  2JWZ A;  2BPS A;  4BKS A;  4BOZ B;  3D32 A;  4TQ0 A;  4W9J A;  2OOB B;  4BKS D;  3LDZ E;  1P1A A;  4K7S A;  5DCN A;  2FID A;  3C0R B;  2FUH B;  4BBN C;  2WWZ A;  5G55 A;  5KHQ A;  2CHZ A;  4IW0 A;  3RZF A;  1XT9 B;  2ZZP B;  1XQQ A;  4GN1 A;  1YJ1 A;  5KHO A;  1Q0W B;  2RSU A;  4E3C A;  4X57 B;  4WJN A;  3KUD B;  1YX6 B;  1H8C A;  1E7U A;  5HKH A;  2NS5 A;  1WYW B;  4DHZ B;  4E71 A;  4DK5 A;  2BYF A;  4IM2 A;  2LZ6 A;  1TGZ B;  4HJK A;  4FLH A;  2KFJ A;  3PV1 A;  2PPH A;  2LXA A;  1C1Y B;  2M1M A;  3K9P B;  3RZW C;  3KVF B;  1WGG A;  2Y5B B;  4ZRJ A;  1RLF A;  5AZF A;  2KNB A;  1EF5 A;  1ZGU B;  1RFA A;  3K9O B;  2NCN A;  3DBS A;  4RM8 A;  4ICV A;  1OQY A;  2NBU A;  1WFY A;  2NBW B;  3HK0 A;  3HHM A;  1RRB A;  1WXM A;  1ISN A;  2M8S A;  4EUT A;  3CST A;  3HM3 A;  4HPM B;  2YVC A;  4AJW A;  2ZNV B;  3VUY A;  4W9K A;  4G11 A;  1EF1 A;  1E90 A;  2KMC A;  1Q5W B;  3OJ3 A;  3QWZ B;  2J0J A;  5JHA A;  1Q1O A;  1TBE A;  2K39 A;  2N1V A;  3B08 A;  3NZU A;  1UD7 A;  5CX3 A;  3A4R A;  4DHZ E;  2LVO A;  2O6V D;  3QCA A;  4DHJ B;  2KDE B;  2NVU I;  3ZNZ B;  2R2O A;  1UZX B;  2C7H A;  4EFO A;  5C23 A;  3GZN I;  4IWP A;  2DZI A;  2NR2 A;  4DWF A;  1V6E A;  3IVF A;  2LWP A;  1VD2 A;  1WMH B;  4GOC A;  1YIW A;  3VH4 B;  2N7E A;  3UIP B;  3RUL A;  3AU5 A;  4DBG A;  1WH3 A;  3A9K A;  2CHX A;  4ASW C;  4MDK E;  1J19 A;  4BBN F;  2JPH A;  3VTU A;  3PRM B;  1NDD A;  2DAJ A;  2O2V B;  1WGR A;  3DBR I;  4NQL B;  4JGH B;  3PRZ A;  4HPL B;  3W1Y A;  4BKT A;  1KOT A;  3UQA A;  1V81 A;  1UH6 A;  4WWN A;  5AEK B;  1LM8 B;  3A1Q A;  3JSV B;  4ANU A;  1GNU A;  5JHB A;  3AI5 A;  1E8Z A;  1WM3 A;  2GBJ A;  4HDQ A;  4ICU A;  3DPD A;  2V4L A;  3CMM B;  3A1Q B;  2DAF A;  4GMV A;  2ZEQ A;  3APC A;  2R2Q A;  3APD A;  1GUA B;  3VVW B;  3U7D A;  2DZJ A;  4MEL A;  1V2Y A;  4FHK A;  5IA7 A;  3ZDM C;  3ZIM A;  3KUZ A;  2N9E B;  4WWO A;  4W9I A;  4RM9 A;  4XZ4 A;  4MGZ E;  3ONS A;  4NNJ B;  5CTR C;  2FCM A;  2KDI A;  3ALB A;  4TUU A;  3V61 A;  4WAA A;  5BO4 B;  3ZNH B;  4II2 B;  4DDG D;  4KIK A;  3UIO B;  3UF8 A;  2WYQ A;  4LDT B;  5J17 A;  3QA8 A;  3QX1 A;  3DBH I;  3W1S C;  2PEA A;  2MCN B;  3WA0 A;  2ASQ A;  2N1W A;  5CHW A;  2KLC A;  4WJQ A;  4NJ7 A;  1A5R A;  4HVB A;  2MBQ A;  2JY6 A;  1NBF C;  4JLC A;  4MJS B;  1X1M A;  1WGH A;  3ZRC A;  3GOE A;  1KJT A;  3A9J B;  3ECI A;  3U8Z A;  2EMT A;  1UBQ A;  1WR6 E;  2BKR B;  2AYO B;  4YL8 A;  2KDB A;  2XEW A;  3H7P A;  4GGQ A;  2MQJ A;  1WE7 A;  2D2Q A;  2BGF A;  3TBL D;  4BOS C;  1GG3 A;  3DDC B;  3R7Q A;  3KUC B;  3H7P B;  2KK8 A;  4WJO A;  2JRH A;  2HE7 A;  2V1Y A;  4EZJ A;  4I6L B;  4IWQ A;  2LJ5 A;  4PS3 A;  4GDK B;  3PHX B;  4F1S A;  2UYZ B;  1WJ4 A;  4FA6 A;  3BY4 B;  4FJY A;  3VDZ A;  2Z0E B;  1IPG A;  2WX0 A;  1P0R A;  1TZ1 A;  2NPT B;  3ZNI D;  1V49 A;  4GIV A;  2I1K A;  4GDL B;  3DVN U;  3QAQ A;  2XK5 B;  3DVG Y;  4KDI C;  2C5L C;  2KJ6 A;  2D11 A;  1E8W A;  4IUM B;  1Y8R C;  1HE8 A;  2CS4 A;  3KH0 A;  3VH3 B;  1V80 A;  2N9X A;  2FCN A;  2MA9 B;  1LXD A;  3KYC D;  4MH0 E;  2KQS A;  3U30 A;  2FIF A;  4OVV A;  1V5T A;  2GBR A;  2KO3 A;  3UIN B;  2KXJ A;  3SHQ A;  1TTN A;  2ZVO A;  4HCP B;  2BYE A;  1RAX A;  5L95 C;  4DXA B;  1R4M I;  1PQS A;  2A5U A;  2KFK A;  1IP9 A;  2IY0 B;  1YQB A;  3V6C B;  1NI2 A;  1WI0 A;  2IO2 B;  4AUQ C;  2AWT A;  2FNJ B;  1M94 A;  2XBB C;  3VAW A;  2JZZ A;  3BIN A;  2K8H A;  1WZ3 A;  2AEH A;  2AL6 A;  4K1R B;  4KIK B;  2KHW B;  1GC7 A;  2KQ7 A;  1OTR B;  4A20 A;  4G3X B;  4LJP B;  2MBE A;  1IYF A;  2MP2 B;  2KLG A;  4AJY B;  2M4N A;  1WM2 A;  3L0W B;  1FXT B;  1WX8 A;  2MRP A;  3M63 B;  5DPW A;  4F7Z A;  2C60 A;  2JUO A;  2LVQ A;  3RT3 B;  2M17 A;  3IG3 A;  3ML8 A;  2A4Z A;  3QIJ A;  1WX7 A;  2KC2 A;  4ZRI A;  2BYV E;  5D2M B;  3PT2 B;  3PVL A;  3RCZ A;  1P3Q U;  3WIM A;  4ANX A;  4J6I A;  1S1Q B;  4FAD A;  4MJS A;  2KWV B;  2Z0D B;  2N7D A;  2KAN A;  3EFU A;  3A4S C;  4KSL C;  1KM7 A;  1V86 A;  3JW0 X;  2D10 A;  5DPR A;  2EKE C;  2IZV B;  3M3J A;  1AAR A;  3L08 A;  2I1J A;  4JIO U;  2PJH A;  5E6P A;  3WAN A;  1K8R B;  1SIF A;  3ENE A;  5EDS A;  2L76 A;  4EZK A;  3M62 B;  2CR5 A;  4KDL B;  4W9E A;  2DYO A;  2IO3 B;  3X23 A;  3APF A;  2KVR A;  2B3A A;  1WXA A;  2KJR A;  4F8C B;  3A33 B;  4ANW A;  3H1U A;  2KWU B;  4IWO A;  3CSF A;  4GDL A;  2KX0 A;  1UEL A;  4HCN B;  2LGD A;  2JXX A;  2NPT A;  2HTH A;  4AWJ A;  4TQ1 A;  4WJP A;  4TV3 A;  3VQI A;  4B95 A;  3NZS A;  3PS6 A;  3T8M A;  3DBL I;  3SDL C;  3EC8 A;  2DHZ A;  4WQO B;  1WGD A;  2K8C A;  5LXH A;  2GMI C;  2DX5 B;  5TR5 A;  3R66 C;  3ZDT A;  1WXV A;  2MBH A;  3IBE A;  1H4R A;  4W9C A;  3OAW A;  3PTF C;  3RYT A;  4M8M A;  2ZCC A;  3R3M A;  1E8X A;  4KZ0 A;  5JZE B;  3JSV A;  4FJV B;  3L10 B;  3VTW A;  3TMP B;  2K6Q A;  3HM6 X;  4HLE A;  5L83 A;  2RPQ A;  2LRW A;  1GC6 A;  4AOF A;  2LXC A;  1F9J A;  3TIX A;  4FJZ A;  4K7U A;  2KFK B;  4MM3 A;  2K6D B;  2FAZ A;  1U4A A;  3NS8 A;  2YLM A;  3KW5 B;  2RGF A;  2L8J A;  3EEC A;  2C7N B;  4BFR A;  1EO6 A;  5CHF A;  1XD3 B;  2L00 B;  1WRD B;  2PE9 A;  2KOX A;  3ZNG C;  4MGK E;  3KYD D;  3A9K B;  3X0W A;  2MWS B;  3PRP B;  1WE6 A;  2G3Q B;  5E6N A;  2FCQ A;  4FN2 A;  2W9N A;  2JT4 B;  4MSQ B;  3UQB A;  4JQW C;  3VXW A;  2FCS A;  2WX1 A;  2KKC A;  2M0X A;  3QAR A;  5G2N A;  1ZKH A;  1CMX B;  1OGW A;  1WZ0 A;  3N32 A;  3QHT A;  3QC8 B;  2O6V B;  1QZE A;  1E8Y A;  3VUW A;  3ZW3 A;  1EUV B;  2G45 B;  2KTR A;  2IY1 B;  2L0F A;  2UWQ A;  4G0N B;  1WX9 A;  3Q3F A;  1L7Y A;  4MGY E;  2OJR A;  3AUL A;  2O6V A;  3ML9 A;  1JRU A;  4OVU A;  3PSE B;  4W9G A;  3PLV A;  4ANV A;  3EHV A;  3ZTD A;  4TKN A;  3VTV A;  3AXC A;  5AZG A;  4GSW A;  3WAP A;  3MJW A;  3DCG A;  2LI5 A;  3UGB B;  3ZLZ A;  5LLI A;  2DZK A;  4HXD A;  3M95 A;  3MTN B;  3V60 A;  2DZM A;  2GBK A;  2J0M A;  4AP4 C;  3AU4 A;  1SE9 A;  2WDT B;  3RD2 A;  4URK A;  5J2R A;  1E7V A;  1WJ6 A;  3DVN V;  3IHP C;  3VHT C;  2REX A;  2MX2 A;  1WR1 A;  4PYZ A;  4W9F A;  4K7W A;  2N9P C;  2Z59 B;  4LCD E;  4NJ6 A;  5JH5 C;  1WXS A;  4ZYN A;  3Q3J A;  5IAA C;  1ZW7 A;  3TCA A;  4FUL A;  1YD8 U;  2BF8 B;  2MW5 A;  2LVP A;  4LJO B;  2GOW A;  2ZPN A;  4XC2 A;  2D07 B;  3H9D A;  4NAW A;  3JVZ X;  2MSE D;  2RD0 A;  2KN5 A;  2QHO A;  2G4S A;  3L54 A;  2C7M B;  3R7R A;  2ZPY A;  4CO7 A;  2K25 A;  3L17 A;  5E6O A;  3ZVV A;  2HD5 B;  4EEW A;  2ZNV C;  5AZH A;  3ZTC A;  3PLU A;  1WJU A;  3PGE A;  4G50 A;  4NQK E;  5DPT A;  2N4F A;  4W9H A;  3WAM A;  1VCB A;  3PZD A;  2CU1 A;  3P2B A;  2DYB A;  2KC1 A;  5J18 A;  3WAO A;  2LRU A;  4M8N A;  1KLV A;  3N30 A;  4W9L A;  5D94 A;  2V3S A;  1LFD A;  2IYD B;  3T9L A;  1WJN A;  2KTF A;  2MBB B;  4IM3 A;  4CYE A;  1WY8 A;  2IO0 B;  2IO1 B;  4EKU A;  1OEY J;  3RUI B;  2ZJD A;  3HIZ A;  4ZDV A;  5D7G A;  2CHW A;  2MLB A;  5C1Z A;  4N9F 4;  2MP2 A;  2JRI B;  4ZRK A;  1Z5S B;  2L0T A;  3N3K B;  2JF5 A;  5GMV A;  2L05 A;  1R4N I;  3IFW B;  3QJZ A;  1SGH A;  4KV2 A;  4KVG B;  2D3G A;  3V62 A;  3I3T B;  2O2V A;  1D3Z A;  3ZRF A;  4FHJ A;  1V9J A;  2VRR B;  4DHJ D;  3TL5 A;  2KDF B;  4E74 A;  3W1S A;  3OJ4 B;  4MEM A;  1T0Y A;  2KD0 A;  3TJP A;  3A9J A;  3JYU A;  1J0G A;  4K81 A;  4MSM B;  2KTR B;  2LGX A;  4I6P A;  2KZR A;  1UBI A;  3ZKJ C;  3ZUN A;  2JVC A;  3CF6 E;  3H7S A;  1WF9 A;  3NOB A;  3SD5 A;  1V5O A;  2BKF A;  2J0K A;  2LUE A;  1YX5 B;  4IC7 B;  2JZ3 B;  4P7I A;  4EOY A;  2GBN A;  1GJZ A;  2L3Z A;  3H6N A;  1E5W A;  4GDK A;  4A3P A;  4GXB A;  3NHE B;  4IG7 B;  5FR6 A;  4HWI B;  3MHS D;  4RMA A;  3O65 B;  4M0W B;  2LAS A;  5CHV C;  1S3S G;  3B0A A;  2BWF A;  3B1L X;  3VFK A;  2KJH B;  4MGI E;  5D6J B;  4GU2 A;  1UGM A;  1Z2M A;  2K8B A;  4GB9 A;  4KZC A;  4LDT D;  4NPN A;  5DPS A;  2L7R A;  5LXI B;  1WMH A;  3DVG X;  4B9K A;  1MG8 A;  3DOW A;  3LJ3 A;  2DYM A;  1J8C A;  3V6E B;  2ZCB A;  4FBJ B;  1I35 A;  4I6N B;  3OLM D;  2IBI B;  2EMS A;  3PHW B;  2LGY A;  4IM0 A;  4PS7 A;  4XX5 A;  2HJ8 A;  1OEY A;  4WWP A;  1WGY A;  4KSK C;  4II3 B;  4PS8 A;  4W9D A;  4BVU C;  2GBM A;  4CHK A;  4PYU A;  4JL9 A;  3QQ8 B;  1LQB A;  4A3O A;  2C9W B;  1P98 A;  2CKH B;  2KX3 A;  2NBV B;  2J7Q B;  1L2N A;  1BT0 A;  2BWE S;  4HDO A;  2K1F A;  4EZL A;  1WIA A;  2G4D B;  3SU8 X;  4HK2 A;  1P9D U;  2LD9 A;  3L13 A;  3PRE A;  3L16 A;  2MBO A;  4DDI D;  2KWC A;  2XK5 A;  3VUX A;  2AL3 A;  3DQV A;  4B6W A;  2PE6 B;  4NAW B;  2DEN B;  3ZO5 B;  3QK0 A;  1I42 A;  2ZVN A;  3PPA A;  2KMA A;  4BKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...