3DDCB

Crystal structure of nore1a in complex with ras
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
133
Chain Sequence
PPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPSFYLPLDAIKQMHISSTTTVSEVIQGLLDKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/apoptosis
molecule keywords GTPase HRas
total genus 28
structure length 133
sequence length 158
ec nomenclature
pdb deposition date 2008-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ddcB00
4I6NB 2DHZA 3WIMA 1AARA 2K39A 5IAAC 2RPQA 4KDIC 3VAWA 2BKFA 3A9JA 2UYZB 2RD0A 4WQOB 1G6JA 1P1AA 5BO4B 2MBQA 5KHOA 3T9LA 2EMSA 4ZRIA 5JHBA 3PT2B 2PE6B 1UD7A 3PGEA 4OVUA 1KOTA 4J6IA 2KMAA 2KN5A 2XK5B 4WWNA 2LZ6A 2GBRA 3DVGX 2N1WA 1LXDA 1E8XA 1U4AA 5G2NA 3T8MA 2N7EA 3PHXB 5AZGA 1V2YA 3NS8A 4KIKA 3HK0A 2IO1B 1L2NA 1RFAA 4FLHA 1WFYA 2KMCA 2CHWA 1YX6B 1WZ0A 3AI5A 1EF5A 1WH3A 3M62B 2JF5A 3A1QB 3D32A 3UINB 1ZW7A 4NAWA 2HD5B 2MBOA 2NBUA 2G4DB 1LFDA 1Q5WB 2RSUA 5TR5A 4FJVB 3S2AA 3WAMA 3UQAA 2HTHA 4NQKE 2LGXA 3KUDB 2L76A 1WX8A 3PZDA 2ASQA 2KTFA 4TKNA 2KWVB 4G0NB 4CO7A 2N9PC 2FIFA 4GDKB 2K1FA 3L08A 1GNUA 4LDTB 2D10A 2FNJB 3CSFA 5G55A 4JLCA 4ZDVA 3EHVA 3HM3A 3EECA 3ZDTA 1UZXB 1SIFA 3B0AA 2QHOA 1P9DU 4G3XB 2KC2A 4HPLB 4MGIE 2MA9B 2IY1B 2LVQA 4MM3A 4WWOA 2EMTA 1WMHB 4GDKA 4GGQA 2NBVB 2ZNVB 4E71A 1KM7A 1P98A 4W9DA 3VUXA 2ZPNA 1WX9A 2AL6A 3B08A 4FBJB 3BY4B 4IM2A 3UQBA 3N3KB 3QX1A 3UIPB 3RZFA 3W1SA 3ZNID 2ZZPB 4W9EA 4PYZA 4WJNA 2O2VB 3WALA 5L83A 2KWCA 2KTRA 3PLVA 2MCNB 5EDSA 1LM8B 2L8JA 1J19A 4G50A 4FHJA 3NOBA 4K81A 4BBNF 4MSQB 2G3QB 4IC7B 2KHWB 2WWZA 3O65B 2BF8B 2LWPA 2PPHA 1ZKHA 1IPGA 2CS4A 2M1MA 1UGMA 2NS5A 3CMMB 4KZ0A 2Z59B 4XZ4A 4FULA 4EFOA 2BYVE 2PE9A 1NDDA 2N7DA 2BYEA 4HDQA 2DYOA 3X0WA 2BYFA 1EO6A 1E8YA 4IWOA 1RAXA 2G4SA 1VCBA 1YIWA 3IVFA 5E6NA 5C23A 3IBEA 2AYOB 2BKRB 4HCPB 1TZ1A 2LXAA 4ZRJA 4IWQA 2L0FA 1K8RB 4JQWC 4MGKE 2AWTA 3ZDMC 4TQ1A 1A5RA 3DVNV 3DCGA 4II2B 1GUAB 2K6DB 4EZKA 3SU8X 1V5OA 3ZTDA 1S1QB 2JPHA 3DDCB 2KDBA 2JZZA 2J0KA 2V1YA 3VFKA 2IO3B 3VQIA 5JZEB 2NVUI 2KQ7A 4BBNC 3UGBB 4BKSD 4W9JA 3Q3FA 4EZLA 2B3AA 3ZNHB 5CHWA 2NBWB 2C7HA 2MRPA 1TTNA 3JVZX 1WY8A 3NZUA 3OAWA 4MGZE 4DHZB 1WXVA 3KUZA 4ICVA 1YJ1A 2LASA 1WJNA 1JRUA 5CTRC 1WJ6A 4FJZA 4K7SA 1WRDB 2KDEB 2K25A 4P7IA 2K8BA 1M94A 1P3QU 2MWSB 4FADA 1WF9A 5FR6A 1IYFA 2WYQA 3A4SC 4I6LB 2WDTB 4AJYB 3AU4A 1KLVA 3N30A 2CKHB 3HM6X 4GIVA 3DBHI 5J17A 2KK8A 4KZCA 3RD2A 3AU5A 3V6CB 2R2QA 3JSVA 2MLBA 3RULA 1T0YA 2KFJA 4W9CA 3M3JA 1WM3A 3GZNI 2JZ3B 3PHWB 3K9OB 2ZVNA 4DXAB 2GMIC 1WXAA 4ICUA 1J8CA 4EUTA 2DENB 5DPSA 1ISNA 3PTFC 4IM3A 4AWJA 2KQSA 3VTUA 2DAJA 2ZCBA 3L10B 4GDLA 1V49A 1MG8A 2G45B 3DBSA 3HIZA 1UELA 4HK2A 4YL8A 5KHQA 1OGWA 2FCMA 3L0WB 3VVWB 3OJ3A 1XT9B 4IG7B 2M4NA 1EUVB 4II3B 4BOSC 1WGHA 5LXHA 3QQ8B 2OJRA 4W9FA 3ZTCA 4GOCA 2GBKA 2FCQA 4RM9A 3R66C 2LXCA 4MJSA 1OQYA 2MBBB 2NCNA 3K9PB 3DOWA 2NPTA 2A5UA 4DWFA 2FIDA 3QK0A 1WR6E 2JRIB 4DK5A 4A20A 4B6WA 1Z5SB 4GB9A 2REXA 1RRBA 1EF1A 3ECIA 1WE6A 3I3TB 3KYCD 3VH4B 4HLEA 1E7VA 4HPMB 2MP2A 4WJOA 4GN1A 3L17A 1WGDA 4B9KA 3PV1A 1Y8RC 2C7MB 2JXXA 2L3ZA 3V62A 2C7NB 3X23A 2A4ZA 2C5LC 2M0XA 3PSEB 1WGRA 3KW5B 2N4FA 3KH0A 5LLIA 2GBNA 2LVPA 3APFA 4HVBA 5CX3A 3JYUA 2KLCA 3WAOA 2PEAA 1V6EA 1WZ3A 3W1SC 4MELA 3DPDA 3VTVA 1FXTB 1YQBA 2K6QA 2MSED 2WX0A 4TV3A 1RLFA 2I1KA 1Q0WB 3RUIB 1V86A 1E8WA 4KSKC 4GMVA 1OTRB 3U7DA 4BVUC 4PYUA 2C60A 4MH0E 2FCNA 1VD2A 3A1QA 1CMXB 2O6VD 5D7GA 5AZHA 2C9WB 2KX3A 4JGHB 2DYMA 4HXDA 2ZNVC 2IBIB 1GG3A 2JVCA 3HHMA 3QCAA 4G11A 3IHPC 2CHZA 2JRHA 3Q3JA 2IO2B 3ENEA 1XD3B 3CF6E 4MEMA 1WJUA 2LUEA 1GJZA 4FN2A 1WM2A 2DAFA 1WXMA 4CHKA 4RM8A 4EZJA 2D2QA 3L13A 3PS6A 2GOWA 3TBLD 2KLGA 2LI5A 3CSTA 1WGYA 2CU1A 4LJPB 2RR9A 5E6OA 5HKHA 3L54A 3AULA 5DPTA 3PPAA 4MSMB 4W9LA 2MBHA 4GSWA 4HCNB 5IA7A 4WWPA 3L16A 2PJHA 3QHTA 3A4RA 2ZEQA 2M8SA 3IFWB 1WJ4A 4JIOU 2J0MA 1C3TA 1SGHA 2DX5B 3RYTA 3TMPB 4BKSA 4NJ6A 4DHJB 5DPWA 4PS3A 3DVNU 4GXBA 4FA6A 3DQVA 2DYBA 2YLMA 1WMHA 2JUOA 3QAQA 2VRRB 2CHXA 1QZEA 4M8NA 1YX5B 4MJSB 2BGFA 2R2OA 2DZIA 2L05A 3OJ4B 2KWUB 2HJ8A 3WANA 4M0WB 4NY0A 2IZVB 3DVGY 4NPNA 4DDID 5D6JB 5CHFA 3ZUNA 1WR1A 3ZIMA 1C1YB 3H9DA 3H6NA 3KYDD 4A3PA 2HE7A 2MP2B 2LD9A 3MJWA 3R7RA 3VH3B 3QC8B 3RZWC 3UF8A 1WX7A 4OVVA 4XX5A 3OLMD 4LJOB 1NI2A 1WI0A 3AXCA 1R4MI 4IUMB 1E7UA 2AL3A 2LGYA 2BWES 4HDOA 5AZFA 2Z0DB 3QJZA 2JWZA 3ALBA 3ZNGC 2D3GA 2KVRA 2W9NA 1E5WA 3PRPB 2L7RA 4IM0A 3EFUA 3LJ3A 3ONSA 1LQBA 2GBJA 2KANA 2LRUA 4WJQA 5AEKB 4EKUA 3P2BA 2LGDA 2NR2A 1TBEA 2L0TA 4XC2A 3ZKJC 3ZRFA 1Z2MA 4FHKA 1I42A 3A9KB 2UWQA 1UBQA 3ZW3A 4BKGA 4EEWA 5D2MB 2CR5A 3MTNB 3ML8A 3A33B 3DBRI 3H7PB 4AUQC 4PS8A 4ZRKA 5C1ZA 5DPRA 4ANWA 3V6EB 4X57B 4K1RB 2V4LA 2KDFB 4CYEA 4I6PA 3VHTC 1UH6A 4DHJD 4BKTA 3QIJA 3U30A 2FUHB 2KJ6A 3A9KA 5GMVA 4KV2A 1Q1OA 4F1SA 1I35A 4LCDE 2OOBB 2YVCA 3IG3A 3UIOB 2N9EB 2KXJA 4F7ZA 1XQQA 2DZJA 2WX1A 3RCZA 1ZGUB 4WJPA 1H8CA 3A9JB 2D11A 3WAPA 2N1VA 5JH5C 2ZPYA 2KC1A 3JSVB 4IW0A 2IO0B 4NJ7A 3GOEA 1J0GA 4W9HA 4RMAA 2KX0A 2XBBC 4PS7A 3APCA 2XK5A 3PRZA 2ZJDA 4AJWA 5L95C 5J18A 4EOYA 4K7WA 4KDLB 4K7UA 2KO3A 3APDA 3VDZA 3QWZB 4AP4C 2J0JA 4KIKB 4W9KA 2Y5BB 1KJTA 2O6VA 3W1YA 2DZMA 2JY6A 3NZSA 3V61A 4ANXA 1HE8A 2D07B 5DCNA 2KZRA 1OEYA 2L00B 3BINA 3JW0X 3VXWA 2I1JA 3M95A 3V60A 4FJYA 2KNBA 5J2RA 2DZKA 2V3SA 2KDIA 4MGYE 3ZVVA 3VUYA 4ANUA 4N9F4 3TL5A 5D94A 1X1MA 4LDTD 1WYWB 2MQJA 2J7QB 2NPTB 4TUUA 2MBEA 4NQLB 4KVGB 4AOFA 1YD8U 2ZCCA 4ZYNA 4ASWC 2LVOA 2MW5A 4BFRA 4JL9A 2EKEC 3U8ZA 1V9JA 3RT3B 4F8CB 3VUWA 1PQSA 1V80A 3PLUA 4A3OA 3KVFB 3M63B 2M17A 3WA0A 5CHVC 2FCSA 1TGZB 3PRMB 3ZO5B 3ZRCA 3TIXA 2KD0A 2IY0B 4URKA 2N9XA 4DHZE 4HJKA 3EC8A 4W9IA 1SE9A 3DBLI 3ML9A 3H7PA 1L7YA 3NHEB 4GU2A 4W9GA 1E8ZA 4ANVA 2ZVOA 1UBIA 3NY5A 2KKCA 4IWPA 4NAWB 2K8CA 2KOXA 3KUCB 2FAZA 2KJRA 2Z0EB 4NNJB 3ZNZB 1R4NI 2BPSA 1WGGA 3QA8A 3SDLC 2IYDB 2KFKB 3TJPA 3H1UA 3R3MA 3TCAA 1E90A 2KJHB 4B95A 4BOZB 1D3ZA 2BWFA 4GDLB 1IP9A 5E6PA 4HWIB 4E3CA 3MHSD 1BT0A 1OEYJ 1WE7A 2LRWA 3PVLA 3ZLZA 1P0RA 2AEHA 3B1LX 3LDZE 3R7QA 1S3SG 3H7SA 1V81A 4TQ0A 1NBFC 4DBGA 3SHQA 4WAAA 4E74A 1GC7A 4KSLC 5LXIB 2JT4B 3VTWA 3C0RB 4MDKE 2KFKA 3PREA 1V5TA 2LJ5A 1F9JA 1WIAA 4DDGD 1WXSA 1GC6A 3N32A 2K8HA 5JHAA 2GBMA 4M8MA 2RGFA 2MX2A 2O6VB 3SD5A 2XEWA 2KTRB 1H4RA 2O2VA 3QARA
chains in the Genus database with same CATH superfamily
2DHZA 3WIMA 1JWMD 2BKFA 4MH8A 4WQOB 1ZDVA 3FILB 4LTUA 4OVUA 2WHIA 2KN5A 2XK5B 1N60A 2N7EA 2D3AA 1V2YA 3NS8A 3GE3C 3HK0A 4N6EB 2IO1B 4RF1A 1L2NA 3BWUD 1YX6B 3AI5A 5G5HA 1EF5A 2AQ1B 3AE8B 4ACFA 1OFFA 4NAWA 4L23A 2G4DB 1Q5WB 3VRAB 4YSXB 3GS2A 2KWVB 2N0SB 2N9PC 3L08A 1ACCA 1SXTA 2EKIA 5G55A 4ZDVA 3HM3A 1TY0A 3B0AA 3AE6B 4YT0B 1CQVA 4G3XB 3OWEB 2X8XX 1WMHB 2X38A 4E71A 4P6VF 2L52A 2WU5B 2AL6A 3UQBA 3N3KB 1CK1A 3RZFA 3KWVA 3WALA 2KWCA 2KTRA 5EE0A 5EDSA 2BVCA 1J19A 4K81A 2INDC 4IC7B 1HZ6A 1GB4A 2TSSA 4OHJA 1NDDA 4HKZE 2BYEA 2DYOA 1EO6A 2ONQA 1E8YA 2G4SA 3NZ3A 2LGSA 2Y3AA 1T0QC 2AYOB 4HCPB 4ZRJA 3AEBB 4JQWC 4MGKE 2AWTA 1A5RA 1GUAB 2SEBD 2J0KA 2V1YA 1EM7A 4BBNC 1BXTA 4BKSD 4W9JA 2N9KA 3Q3FA 4A6QA 2PLPA 2MRPA 1TTNA 3OAWA 4MGZE 4BAXA 4YSZB 4M00A 1JRUA 2K25A 2WXKA 1P3QU 5JXVA 4AJYB 5IOIA 1V1PA 2CKHB 3BK2A 3DBHI 3RD2A 3V6CB 1I4GA 3RULA 1T0YA 2KFJA 1WM3A 4EUTA 3ZJTA 1JMLA 2KDMA 3WCQA 1C78A 1ISNA 2ZCBA 1V49A 3HIZA 4OW0A 4HK2A 4YL8A 2BBCA 3VVWB 3NVYA 2LGIA 1N6ZA 2WU2B 4BOSC 1RM6C 3QQ8B 2OJRA 4W9FA 2FCQA 4RM9A 2HJ1A 4HPPA 2W82A 3QK0A 2JRIB 4DK5A 1Z5SB 3N1ZC 1EF1A 2MJ3A 1J7BA 1E7VA 4MACA 2MP2A 4GN1A 3P4QB 2V3PA 4B9KA 3V62A 2C7NB 3RN9C 2OJWA 3KW5B 1GOZA 2KACA 2N4FA 2RDHA 2WXOA 2GBNA 4HVBA 4WQMA 5MPOA 5CX3A 3JYUA 3WAOA 2PEAA 5EE3A 1KFYB 3W1SC 3DPDA 2K6QA 2IJ0A 1Q0WB 1KLGD 1V86A 4KSKC 2QJLA 1OTRB 1VLBA 2C60A 1VD2A 1CMXB 3BYTB 1PFDA 3KQ4A 5D7GA 4JGHB 2INNE 1GG3A 3LB8C 3QCAA 3IHPC 2JRHA 3Q3JA 1XD3B 2WXJA 1R7SA 1SE2A 4NAMA 1T5XD 3AEDB 4LJPB 2LI5A 1WGYA 2CU1A 2RR9A 5E6OA 5HKHA 3L54A 4R3DA 5DPTA 1JWBD 2BT6A 1PGBA 4JIOU 2DX5B 3RYTA 1D5MC 3OG5A 3DVNU 2L83A 1XLPA 2R61A 2VRRB 1KF6B 1SSNA 1YX5B 4WH4A 2R2OA 2L05A 2HJ8A 1DOYA 2WXNA 1C4PA 3I9V1 3H6NA 4A3PA 1Y56A 2HE7A 2LD9A 3R7RA 3VH3B 3L4PA 2LJIA 3HVZA 1WI0A 1XCTL 3TEZA 2WXGA 1E7UA 4HDOA 3QJZA 2JWZA 1QKZA 5BYQA 5IP4D 1B1ZA 1LQBA 3HRDD 3AH7A 1TBEA 2L0TA 3ZKJC 2GLSA 5EE9A 3A9KB 3IAS1 1UBQA 3ZW3A 2CR5A 2BB5A 4PT5A 1YQ4B 4WURA 4AUQC 4ZRKA 3V6EB 4X57B 4I6PA 4DHJD 4B0EA 3U30A 1OQRA 3A9KA 5GMVA 1Q1OA 1I35A 2MJEA 4C80A 3RMKC 2DZJA 1ZPSA 1VRAB 1TS3A 2D11A 1ET9A 2J53A 1YJIA 3ZXVA 2KC1A 3JSVB 2WXMA 4W9HA 2QSDA 2KX0A 5E6JA 3PRZA 2XK5A 4AJWA 4AQ7A 5J18A 4K7UA 1P7FA 1SE3A 2KWDA 4YSYB 4C4VB 2O6VA 2DZMA 4ANXA 1HE8A 5DCNA 2DLBA 1GB1A 3BINA 1DOIA 4FJYA 2KNBA 2N7JA 2KAJA 4N9F4 3MC0B 2IGDA 2WXRA 4LDTD 3DWGC 1WYWB 1TY2A 2NPTB 2MBEA 4NQLB 2FUG1 1GPXA 1BMLC 1XF5L 4JL9A 1TYGB 4M02A 1TJEA 1TKYA 3ZO5B 3ZRCA 2AQ2B 5HI1A 3KLSX 1IGCA 1TKGA 4ANVA 1D5ZC 2KOXA 2Z0EB 2LHEA 5H8YE 2NTSA 1FD6A 2WS3B 3TJPA 1IP9A 4GDLB 4HWIB 3MC9A 3MHSD 1OEYJ 2AEHA 3R7QA 4TQ0A 1EWCA 4DBGA 4E74A 4KSLC 3C0RB 3PREA 1V5TA 1F9JA 4EE2A 4DDGD 1GC6A 2WXLA 3AMZA 2GBMA 2RGFA 1H4RA 2O2VA 4HEA1 1OQQA 1IUEA 5IAAC 3TEXA 2UYZB 1CZPA 1G6JA 1P1AA 5KHOA 3HUIA 5JHBA 3PT2B 3PGEA 3SR6A 4J6IA 2LZ6A 2GBRA 3DVGX 2N1WA 4Q2JA 1L4DB 5AZGA 2L1AA 1RFAA 2J42A 1TT5B 3P4SB 1RYJA 2W55A 2D5GA 1ZXHA 2JF5A 3A1QB 3D32A 3W2DA 1I4PA 1WSPA 4US8A 2QIEB 1ZW7A 1C9FA 2HD5B 2RSUA 3UQAA 3Q6BA 2L76A 4TKNA 1V97A 2FIFA 1GNUA 3RNGC 4LDTB 2FNJB 3CSFA 4JLCA 3EECA 4TMAB 3ZDTA 1SIFA 2ACZB 4AS1A 2KC2A 4HPLB 4MM3A 4WWOA 3PZ7A 3ZGZA 2NBVB 1P98A 4W9DA 3VUXA 3ZNID 3FC4A 2M56B 1EWYC 4HROA 2O2VB 4K3CA 1MHXA 2MCNB 1YN5A 4FHJA 3NOBA 4BBNF 1YN3A 2G3QB 4KX6B 2KHWB 2WWZA 2QCZA 1FM0D 2LWPA 1RFKA 2PPHA 2M1MA 2NS5A 3CMMB 2PIAA 3T3OA 4KZ0A 3P4PB 1HXYD 3NRZA 4EFOA 2JWUA 2INPE 4S17A 2BYVE 2PE9A 4WWMA 1ZUD2 2WQYB 3IAM1 4KGTA 3X0WA 1T0RC 3P63A 1JRPA 3IVFA 4US9A 1R4MB 1TZ1A 3DWMA 1K8RB 3ZDMC 1KRHA 1HEZE 3DVNV 1C4AA 2WP9B 3DCGA 2SAKA 3SU8X 5C2TB 1S1QB 2JPHA 3AE7B 2B76B 2IO3B 4TSSA 3E56A 5CHWA 2NBWB 3W9CB 4A90A 1WY8A 3NZUA 1WXVA 3KUZA 2INCC 4LNFA 1N61A 1NYRA 3NS1A 4FJZA 4K7SA 5FR3A 1M94A 3P4RB 4M01A 2LMCA 2MH7A 4M0WA 5J17A 4KZCA 2GB1A 1I4RA 1FRDA 3GZNI 2JZ3B 4ZHOA 2GMIC 4ICUA 2DENB 1AYFA 3PTFC 4IM3A 2KQSA 3L10B 4GDLA 2G45B 1UELA 3Q3MC 1UWMA 3AE1B 1Q10A 1XT9B 1EUVB 5H92C 3AV8A 5LXHA 2AQ3B 1L5PA 3ZTCA 4GOCA 1QF6A 4MJSA 2OHFA 1OQYA 2M19A 2NCNA 3K9PB 2A5UA 1L0XB 4IOIE 4GB9A 2REXA 4N58A 3I3TB 3KYCD 4HPMB 4WJOA 1WGDA 4MT5A 1K52A 2JXXA 1I4QA 1FXAA 1HTOA 2A4ZA 2C5LC 2M0XA 4RGTA 3KH0A 5LLIA 2FBWB 4ITKA 3NUHB 3R2TA 2AX5A 1K50A 1WZ3A 1ZDXA 1D4BA 3ABVB 3VTVA 3N20C 4TV3A 1RLFA 2VZKD 2I1KA 1K51A 1E8WA 4GMVA 3N1YC 3U7DA 4BVUC 4PYUA 4RGMA 2FCNA 1XCQL 2KMMA 5AZHA 2IGHA 4HXDA 2ZNVC 2IBIB 3IT6B 3HHMA 4XE0A 2CHZA 2JX5A 3ENEA 3CF6E 1WJUA 2LUEA 4FN2A 3Q8BA 2DAFA 3NVVA 3TBLD 3CSTA 3AULA 3I57A 1E6EB 3PPAA 4MSMB 2MBHA 5IA7A 2M8SA 3VRBB 1C4CA 2J0MA 2ON8A 1C3TA 1YQ3B 3TMPB 4DHJB 5HHDG 4C56C 4FXCA 2JUOA 1TKEA 1QZEA 4JWSC 4MJSB 2BGFA 2ZW0A 3OJ4B 3DVGY 5D6JB 3ZIMA 1AWDA 2XNAC 3RZWC 1MJDA 1WX7A 2BYTA 1FCCC 3FKYA 3OLMD 1NI2A 2AL3A 2BWES 2W54A 4ZYSA 2Y5CA 2Z0DB 3ALBA 4C7YA 2D3GA 2W9NA 2L7RA 2G9HD 3ONSA 2KANA 2GBJA 2LRUA 2RPVA 2WXFA 1I42A 4ZOHC 1JW9D 3ETRA 3NVZA 5D2MB 3ML8A 2K9XA 1YJJA 3DBRI 3H7PB 4PS8A 2VH2A 5C1ZA 4ANWA 4CYEA 3ZJVA 1C76A 4BKTA 4A8XC 5AUIA 2MJDA 1WWTA 4F1SA 2OOBB 2D3BA 2N9EB 4DXGA 1N62A 2WX1A 3U7ZA 1ZGUB 5AUKA 1YMHE 3Q8FA 1KLUD 2IO0B 5D3IB 1VDVA 1MI0A 2XBBC 4PS7A 1VZ6A 2K5PA 4EOYA 2KO3A 3VDZA 3QWZB 4AP4C 3N1XC 4L2YA 2Y5BB 1K53A 5IN7A 3AM9A 1VZ8A 1I7HA 2WXIA 4RGOS 4NZLB 2D07B 2L00B 3B2FA 3JW0X 3CIRB 2I1JA 3Q2AC 2YEPB 4WIPA 2V3SA 4MGYE 3ZVVA 2PVGC 2WXQA 4P1CC 1JWSD 2MQJA 2K22A 1AW7A 1ESFA 3RNFC 1HTQA 1GAQB 2ZCCA 3BYYB 1L0VB 3LYYA 4ASWC 2MW5A 2YEPF 4BFRA 1F0ZA 3RT3B 4DXFA 4NJCA 3B2GA 3VUWA 3PLUA 3KVFB 2M17A 3WA0A 3VR8B 1TGZB 2NTTA 3EC8A 1YNTE 4W9IA 5C3JB 5BYSA 4W9GA 3DHIC 3TUOA 3NY5A 2JQRB 3KUCB 4K3BA 1R4NI 2BPSA 1WGGA 3QA8A 3TCAA 1E90A 2KJHB 4B95A 1D3ZA 4E3CA 1FFUA 1WE7A 3PVLA 1P0RA 1S3SG 1NBFC 5LXIB 1MPEA 3VTWA 1V1PB 2LJ5A 1WXSA 2CU3A 5JHAA 4M8MA 1VJKA 3SD5A 2XEWA 2KTRB 3QARA 4I6NB 3VAWA 2H88B 5BO4B 2MBQA 2QDFA 1C77A 2PE6B 1E9MA 2H89B 1KOTA 2KMAA 4WWNA 2RMMA 4OZCA 2JYEA 1E10A 1L0YB 1U4AA 3T8MA 4LLGM 2D3CA 3U2SC 4FLHA 5EE1A 1WH3A 3M62B 5GXGB 3UINB 2NBUA 3S2AA 1LFDA 2HTHA 1FO4A 1I4XA 4B0MA 2QILA 2LGXA 1WX8A 3PZDA 2KTFA 1VZ7A 4G0NB 2MEKA 4CO7A 1FCLA 2K1FA 1QOAA 1L6VA 2IDYA 1UZXB 2Z8LA 3Q3OC 4MGIE 2IY1B 1EU4A 3H8HA 2I38A 4GDKA 1UWXA 4GGQA 2ZNVB 1KM7A 1WX9A 1WXQA 3Q8AA 3BY4B 4IM2A 3RNBC 4W9EA 2RDBC 5L83A 3DHHC 4YXDB 1KTKA 1LM8B 3U4EG 2XN9C 2BF8B 1JCKB 1IPGA 4JPSA 4C00A 2Z59B 3R2IA 2L32A 4KKJA 3IXSA 4HDQA 2BYFA 4IWOA 1RAXA 4LNIA 1VCBA 1YIWA 2DWQA 5BYRA 1DOXA 5C23A 3IBEA 3Q69A 2BQQA 4KGRA 4II2B 4EZKA 1ET6A 3DDCB 2KDBA 3J9CA 3VFKA 3VQIA 5JZEB 1XEEA 2NVUI 2KQ7A 3UGBB 5FKAC 3ZNHB 3ZXRA 3JVZX 4ICVA 1YJ1A 2LASA 1WJNA 2KVZA 1WJ6A 1WRDB 3GE8C 4P7IA 1HZ5A 2PKOA 2K8BA 2MWSB 4FADA 1IYFA 2WYQA 4XYCA 3AE5B 3AU4A 3HM6X 2KK8A 3AU5A 2R2QA 3JSVA 4P1BC 4W9CA 3UI3A 3M3JA 4LNNA 3K9OB 2ZVNA 1WXAA 4LNKA 1LO5D 2I2YA 4CQNA 2DAJA 4C4VA 3DBSA 2CJNA 4O1NA 5KHQA 1OGWA 4YTMB 2GI9A 3LXFA 1EU3A 1NVID 4IG7B 1WGHA 1SEBD 2GBKA 2LXCA 4GLSC 2MBBB 1FNUA 4ARCA 3DOWA 2NPTA 4DWFA 2FIDA 1WR6E 4A20A 3DBHB 1WGKA 4HKQA 1WE6A 3VH4B 3DBRB 5G5GA 3PV1A 1Y8RC 3TEWA 3AECB 3PSEB 3MP9A 3CWIA 2JSVX 2KLCA 4ZHPA 1V6EA 4MELA 2JZPA 1YQBA 3RNEC 1JWAD 1F52A 1SIJA 1ZE3D 4MH0E 2WDVB 3A1QA 2O6VD 2C9WB 2KX3A 1DGJA 1M4VA 3AE4B 4G11A 3RNAC 3URYA 2IO2B 1GJZA 1P7EA 1R4NB 1SF0A 1NENB 4CHKA 4RM8A 2Q5WD 3L13A 2ZW1A 4W9LA 3BVGA 4GSWA 4HCNB 4YTNB 3QHTA 2PJHA 3W5UB 3IFWB 3RPFC 4BKSA 5DPWA 3DQVA 2YLMA 1NYQA 3AE9B 3V3XA 2CHXA 3SEBA 4M8NA 4ZRQA 1FPYA 1TS5A 3EUB2 1UUPA 4M0WB 4DDID 2IZVB 1MG4A 3ZUNA 1WR1A 1C1YB 3KYDD 2BS4B 3QC8B 1IGDA 3UF8A 3GB1A 4OVVA 4XX5A 3AXCA 3W5VB 5AZFA 1FIQA 1E0ZA 1E5WA 3PRPB 4IM0A 3EFUA 3LJ3A 1FXIA 3MFGA 1FMAD 4EKUA 3P2BA 1WRIA 1T3QA 4J3OD 4FHKA 4REZA 2W3SA 2DBYA 3EFCA 3MTNB 1TS2A 3A33B 3AEEB 5DPRA 3EA6A 5T8IA 4K1RB 1XO3A 1YN4A 2FUHB 2KJ6A 2V3NA 2WXPA 5BMGA 2YVCA 3IG3A 3P1MA 4LK0M 3UIOB 4F7ZA 3RCZA 4RFBA 3A9JB 4HRSA 4MM3B 3WAPA 3Q8EA 4RH6A 1J0GA 3R8BA 2ZJDA 4K7WA 4KDLB 4D2KA 1UNSA 2J0JA 4IKGA 4W9KA 1F2RC 3EGRA 4JWUC 4LNOA 3W1YA 2KZRA 1OEYA 1SE4A 1VR9A 3M95A 1QT9A 5J2RA 2KDIA 3N9YC 4ANUA 3TL5A 2J7QB 4TUUA 4AOFA 1PGAA 4ZYNA 2LVOA 2W3RA 2EKEC 3U8ZA 1V9JA 1PQSA 1D6EC 4A3OA 1PGXA 3PRMB 4URKA 3Q14C 2N9XA 4DHZE 4HJKA 1SE9A 3DBLI 4DQOC 2KYWA 1UBIA 1N5XA 2FAZA 1ROEA 1XLQA 4RGNA 4YWGG 2E3TA 1FRRA 3R3MA 4BOZB 1NI3A 1FNWA 5E6PA 2LRWA 3ZLZA 3B1LX 2LFIA 3LDZE 3SHQA 1GC7A 2JT4B 3NJTA 4XWTA 3FILA 1WIAA 3N32A 2K8HA 2MX2A 2O6VB 3PZ8A 2LHDA 1T6BX 4WAFA 1PYWD 1AARA 4XDCA 2K39A 3P42A 2RPQA 4KDIC 3A9JA 2RD0A 3O13A 3T9LA 2EMSA 4ZRIA 1UD7A 2KN4A 4IDIA 1LXDA 1L4ZB 1E8XA 5G2NA 3PHXB 2PMVA 4KIKA 4H2AA 4ZRPA 5BMHA 5FK9C 1WFYA 2KMCA 2CHWA 1WZ0A 1LGRA 4C7ZA 2MBOA 3KWLA 5TR5A 3WAMA 4FJVB 1PUTA 4JX1C 2LUMA 4NQKE 3KUDB 3VR9B 2ASQA 2Y5PA 4GDKB 3RFZB 3ZJUA 2D10A 3EHVA 2E6XA 1J7AA 4A55A 2QHOA 1P9DU 1SBBB 2MA9B 2LVQA 2EMTA 1D5XC 3Q8CA 3BK1A 2ZPNA 2CJOA 3B08A 2DNFA 4FBJB 3QX1A 3UIPB 3W1SA 2PVOD 1FEHA 2ZZPB 4PYZA 2BB6A 4WJNA 3PLVA 2L8JA 4G50A 4MSQB 3O65B 1ZKHA 2CS4A 1UF0A 1UGMA 4XZ4A 4FULA 2N7DA 1V8CA 3V05A 2UU7A 5E6NA 3PO0A 2KT7A 4RNAA 2BKRB 1ENFA 2LXAA 3I5JC 4IWQA 2L0FA 4TQ1A 1SB3C 2K6DB 1V5OA 3ZTDA 2JZZA 1QOGA 4EZLA 2B3AA 2HDEA 2WXHA 1A70A 2C7HA 1XXGA 4DHZB 3E9SA 1ZP0B 3ZYYX 5CTRC 3AEAB 2KDEB 3I63C 1WF9A 5FR6A 3A4SC 4I6LB 1N5WA 2WDTB 1IBXA 5BMIA 1KLVA 3N30A 4GIVA 2MLBA 4USAA 2M0AA 1SJHD 4DXAB 3PHWB 1J8CA 1T0SC 1DYQA 3C19A 5DPSA 4AWJA 3VTUA 1MG8A 1QILA 3AB5A 1XLOA 2FCMA 1HQRD 3L0WB 3SFDB 3OJ3A 2WDRB 2JXTA 2MHJA 2M4NA 4II3B 1SJED 1TS4A 3R66C 3BVZA 1V1OA 5I4DA 4RCOA 1QQRA 1YOVB 3GP7A 4B6WA 2N9LA 3U52E 1RRBA 3ECIA 4N59A 2OEDA 4HLEA 3L17A 2C7MB 2L3ZA 3X23A 2QC8A 2WNMA 1WGRA 2LVPA 3APFA 3AE2B 2G1EA 3AE3B 1FXTB 2MSED 2WX0A 3C8YA 1L6UA 5D3DA 3RUIB 3MC8A 2PTLA 2NMQA 1MHHE 2DYMA 2KQ4X 2K0PA 2JVCA 4ARIA 3T3NA 4MEMA 1WM2A 1ZXIA 1WXMA 2WGSA 4EZJA 4KKIA 2D2QA 3PS6A 2GOWA 3FAHA 2KLGA 1PDXA 4WWPA 3L16A 2RDGA 3A4RA 4PK1A 2ZEQA 4QAYA 1WJ4A 2BW2A 1SGHA 1JROA 4S0RA 4NJ6A 1C79A 4PS3A 1F1HA 4GXBA 4FA6A 2DYBA 1WMHA 3QAQA 1N63A 3NG0A 2DZIA 1AN8A 2KWUB 3WANA 4NY0A 1QOBA 3IT4B 4NPNA 1WYGA 2QEJC 5CHFA 3SFEB 1XLNA 3BZDB 3H9DA 4RF0A 2MP2B 3MJWA 3BVMA 1QOFA 4LJOB 4L1BA 1R4MI 4IUMB 2HTME 2LGYA 3RNCC 1ZOYB 3TSSA 3ZNGC 2V0GA 2KVRA 2FE8A 2WDQB 4XDDA 5AEKB 4WJQA 2K3UA 2LGDA 2NR2A 4XC2A 3ZRFA 1Z2MA 1MVKA 2UWQA 4BKGA 3DBLB 5TSSA 5IO9A 4EEWA 3AEGB 1JQ4A 2VH1A 4KGSA 2QMTA 5HG2A 4XGAB 2V4LA 4BZAA 2KDFB 4YTPB 3VHTC 1UH6A 3QIJA 4KV2A 4LCDE 2KXJA 1XQQA 1I4HA 4WJPA 1H8CA 2N1VA 2EELA 5JH5C 2ZPYA 4IW0A 4OVZA 1HA5A 4A9AA 1JWUD 4NJ7A 3GOEA 3DHGC 4RMAA 3APCA 3B9JA 5L95C 2ICIA 3AN1A 3ZQ4A 1UGJA 3APDA 4KIKB 2IPKD 1QLBB 1KJTA 2JY6A 1JALA 1F77A 3NZSA 3V61A 5HFYA 3MJ5A 1TIFA 3NVWA 3BIID 3VXWA 3V60A 2DZKA 2LEKA 3VUYA 5D94A 1X1MA 1RWSA 2GRIA 1STEA 4KVGB 1MFWA 1YD8U 4XWWA 2WLBA 3AEFB 1TZOA 3GZNB 1FFVA 4F8CB 1V80A 1KH0A 2BS2B 3M63B 5LNK1 5CHVC 2FCSA 3TIXA 2KD0A 2IY0B 3ML9A 1FNVA 3H7PA 1L7YA 3NHEB 4GU2A 1E8ZA 2ZVOA 1E7PB 4OZBA 4IWPA 4NAWB 2KKCA 2J52A 3TEYA 2K8CA 1J7CA 1CJEA 2KJRA 4HJGE 4NNJB 4JE3B 3ZNZB 1IBXB 2JU6X 3SDLC 2IYDB 4OZAA 2KFKB 3H1UA 1NEKB 3Q3NC 2BWFA 4P16A 2JYTA 1BT0A 3H7SA 1V81A 4WAAA 2BS3B 4UDUC 2VZKB 2PW9A 5IKCM 4MDKE 2KFKA 3MHZA 2J4XA 1B9RA 3RI7C 2BTEA 2V4IB 2V9HA 3HVDA 2IGGA 1BUIC 1F2RI
chains in the Genus database with same CATH topology
4I6NB 2DHZA 3WIMA 1AARA 2K39A 5IAAC 2RPQA 4KDIC 3VAWA 2BKFA 3A9JA 2UYZB 2RD0A 4WQOB 1G6JA 1P1AA 5BO4B 2MBQA 5KHOA 3T9LA 2EMSA 4ZRIA 5JHBA 3PT2B 2PE6B 1UD7A 3PGEA 4OVUA 1KOTA 4J6IA 2KMAA 2KN5A 2XK5B 4WWNA 2LZ6A 2GBRA 3DVGX 2N1WA 1LXDA 1E8XA 1U4AA 5G2NA 3T8MA 2N7EA 3PHXB 5AZGA 1V2YA 3NS8A 4KIKA 3HK0A 2IO1B 1L2NA 1RFAA 4FLHA 1WFYA 2KMCA 2CHWA 1YX6B 1WZ0A 3AI5A 1EF5A 1WH3A 3M62B 2JF5A 3A1QB 3D32A 3UINB 1ZW7A 4NAWA 2HD5B 2MBOA 2NBUA 2G4DB 1LFDA 1Q5WB 2RSUA 5TR5A 4FJVB 3S2AA 3WAMA 3UQAA 2HTHA 4NQKE 2LGXA 3KUDB 2L76A 1WX8A 3PZDA 2ASQA 2KTFA 4TKNA 2KWVB 4G0NB 4CO7A 2N9PC 2FIFA 4GDKB 2K1FA 3L08A 1GNUA 4LDTB 2D10A 2FNJB 3CSFA 5G55A 4JLCA 4ZDVA 3EHVA 3HM3A 3EECA 3ZDTA 1UZXB 1SIFA 3B0AA 2QHOA 1P9DU 4G3XB 2KC2A 4HPLB 4MGIE 2MA9B 2IY1B 2LVQA 4MM3A 4WWOA 2EMTA 1WMHB 4GDKA 4GGQA 2NBVB 2ZNVB 4E71A 1KM7A 1P98A 4W9DA 3VUXA 2ZPNA 1WX9A 2AL6A 3B08A 4FBJB 3BY4B 4IM2A 3UQBA 3N3KB 3QX1A 3UIPB 3RZFA 3W1SA 3ZNID 2ZZPB 4W9EA 4PYZA 4WJNA 2O2VB 3WALA 5L83A 2KWCA 2KTRA 3PLVA 2MCNB 5EDSA 1LM8B 2L8JA 1J19A 4G50A 4FHJA 3NOBA 4K81A 4BBNF 4MSQB 2G3QB 4IC7B 2KHWB 2WWZA 3O65B 2BF8B 2LWPA 2PPHA 1ZKHA 1IPGA 2CS4A 2M1MA 1UGMA 2NS5A 3CMMB 4KZ0A 2Z59B 4XZ4A 4FULA 4EFOA 2BYVE 2PE9A 1NDDA 2N7DA 2BYEA 4HDQA 2DYOA 3X0WA 2BYFA 1EO6A 1E8YA 4IWOA 1RAXA 2G4SA 1VCBA 1YIWA 3IVFA 5E6NA 5C23A 3IBEA 2AYOB 2BKRB 4HCPB 1TZ1A 2LXAA 4ZRJA 4IWQA 2L0FA 1K8RB 4JQWC 4MGKE 2AWTA 3ZDMC 4TQ1A 1A5RA 3DVNV 3DCGA 4II2B 1GUAB 2K6DB 4EZKA 3SU8X 1V5OA 3ZTDA 1S1QB 2JPHA 3DDCB 2KDBA 2JZZA 2J0KA 2V1YA 3VFKA 2IO3B 3VQIA 5JZEB 2NVUI 2KQ7A 4BBNC 3UGBB 4BKSD 4W9JA 3Q3FA 4EZLA 2B3AA 3ZNHB 5CHWA 2NBWB 2C7HA 2MRPA 1TTNA 3JVZX 1WY8A 3NZUA 3OAWA 4MGZE 4DHZB 1WXVA 3KUZA 4ICVA 1YJ1A 2LASA 1WJNA 1JRUA 5CTRC 1WJ6A 4FJZA 4K7SA 1WRDB 2KDEB 2K25A 4P7IA 2K8BA 1M94A 1P3QU 2MWSB 4FADA 1WF9A 5FR6A 1IYFA 2WYQA 3A4SC 4I6LB 2WDTB 4AJYB 3AU4A 1KLVA 3N30A 2CKHB 3HM6X 4GIVA 3DBHI 5J17A 2KK8A 4KZCA 3RD2A 3AU5A 3V6CB 2R2QA 3JSVA 2MLBA 3RULA 1T0YA 2KFJA 4W9CA 3M3JA 1WM3A 3GZNI 2JZ3B 3PHWB 3K9OB 2ZVNA 4DXAB 2GMIC 1WXAA 4ICUA 1J8CA 4EUTA 2DENB 5DPSA 1ISNA 3PTFC 4IM3A 4AWJA 2KQSA 3VTUA 2DAJA 2ZCBA 3L10B 4GDLA 1V49A 1MG8A 2G45B 3DBSA 3HIZA 1UELA 4HK2A 4YL8A 5KHQA 1OGWA 2FCMA 3L0WB 3VVWB 3OJ3A 1XT9B 4IG7B 2M4NA 1EUVB 4II3B 4BOSC 1WGHA 5LXHA 3QQ8B 2OJRA 4W9FA 3ZTCA 4GOCA 2GBKA 2FCQA 4RM9A 3R66C 2LXCA 4MJSA 1OQYA 2MBBB 2NCNA 3K9PB 3DOWA 2NPTA 2A5UA 4DWFA 2FIDA 3QK0A 1WR6E 2JRIB 4DK5A 4A20A 4B6WA 1Z5SB 4GB9A 2REXA 1RRBA 1EF1A 3ECIA 1WE6A 3I3TB 3KYCD 3VH4B 4HLEA 1E7VA 4HPMB 2MP2A 4WJOA 4GN1A 3L17A 1WGDA 4B9KA 3PV1A 1Y8RC 2C7MB 2JXXA 2L3ZA 3V62A 2C7NB 3X23A 2A4ZA 2C5LC 2M0XA 3PSEB 1WGRA 3KW5B 2N4FA 3KH0A 5LLIA 2GBNA 2LVPA 3APFA 4HVBA 5CX3A 3JYUA 2KLCA 3WAOA 2PEAA 1V6EA 1WZ3A 3W1SC 4MELA 3DPDA 3VTVA 1FXTB 1YQBA 2K6QA 2MSED 2WX0A 4TV3A 1RLFA 2I1KA 1Q0WB 3RUIB 1V86A 1E8WA 4KSKC 4GMVA 1OTRB 3U7DA 4BVUC 4PYUA 2C60A 4MH0E 2FCNA 1VD2A 3A1QA 1CMXB 2O6VD 5D7GA 5AZHA 2C9WB 2KX3A 4JGHB 2DYMA 4HXDA 2ZNVC 2IBIB 1GG3A 2JVCA 3HHMA 3QCAA 4G11A 3IHPC 2CHZA 2JRHA 3Q3JA 2IO2B 3ENEA 1XD3B 3CF6E 4MEMA 1WJUA 2LUEA 1GJZA 4FN2A 1WM2A 2DAFA 1WXMA 4CHKA 4RM8A 4EZJA 2D2QA 3L13A 3PS6A 2GOWA 3TBLD 2KLGA 2LI5A 3CSTA 1WGYA 2CU1A 4LJPB 2RR9A 5E6OA 5HKHA 3L54A 3AULA 5DPTA 3PPAA 4MSMB 4W9LA 2MBHA 4GSWA 4HCNB 5IA7A 4WWPA 3L16A 2PJHA 3QHTA 3A4RA 2ZEQA 2M8SA 3IFWB 1WJ4A 4JIOU 2J0MA 1C3TA 1SGHA 2DX5B 3RYTA 3TMPB 4BKSA 4NJ6A 4DHJB 5DPWA 4PS3A 3DVNU 4GXBA 4FA6A 3DQVA 2DYBA 2YLMA 1WMHA 2JUOA 3QAQA 2VRRB 2CHXA 1QZEA 4M8NA 1YX5B 4MJSB 2BGFA 2R2OA 2DZIA 2L05A 3OJ4B 2KWUB 2HJ8A 3WANA 4M0WB 4NY0A 2IZVB 3DVGY 4NPNA 4DDID 5D6JB 5CHFA 3ZUNA 1WR1A 3ZIMA 1C1YB 3H9DA 3H6NA 3KYDD 4A3PA 2HE7A 2MP2B 2LD9A 3MJWA 3R7RA 3VH3B 3QC8B 3RZWC 3UF8A 1WX7A 4OVVA 4XX5A 3OLMD 4LJOB 1NI2A 1WI0A 3AXCA 1R4MI 4IUMB 1E7UA 2AL3A 2LGYA 2BWES 4HDOA 5AZFA 2Z0DB 3QJZA 2JWZA 3ALBA 3ZNGC 2D3GA 2KVRA 2W9NA 1E5WA 3PRPB 2L7RA 4IM0A 3EFUA 3LJ3A 3ONSA 1LQBA 2GBJA 2KANA 2LRUA 4WJQA 5AEKB 4EKUA 3P2BA 2LGDA 2NR2A 1TBEA 2L0TA 4XC2A 3ZKJC 3ZRFA 1Z2MA 4FHKA 1I42A 3A9KB 2UWQA 1UBQA 3ZW3A 4BKGA 4EEWA 5D2MB 2CR5A 3MTNB 3ML8A 3A33B 3DBRI 3H7PB 4AUQC 4PS8A 4ZRKA 5C1ZA 5DPRA 4ANWA 3V6EB 4X57B 4K1RB 2V4LA 2KDFB 4CYEA 4I6PA 3VHTC 1UH6A 4DHJD 4BKTA 3QIJA 3U30A 2FUHB 2KJ6A 3A9KA 5GMVA 4KV2A 1Q1OA 4F1SA 1I35A 4LCDE 2OOBB 2YVCA 3IG3A 3UIOB 2N9EB 2KXJA 4F7ZA 1XQQA 2DZJA 2WX1A 3RCZA 1ZGUB 4WJPA 1H8CA 3A9JB 2D11A 3WAPA 2N1VA 5JH5C 2ZPYA 2KC1A 3JSVB 4IW0A 2IO0B 4NJ7A 3GOEA 1J0GA 4W9HA 4RMAA 2KX0A 2XBBC 4PS7A 3APCA 2XK5A 3PRZA 2ZJDA 4AJWA 5L95C 5J18A 4EOYA 4K7WA 4KDLB 4K7UA 2KO3A 3APDA 3VDZA 3QWZB 4AP4C 2J0JA 4KIKB 4W9KA 2Y5BB 1KJTA 2O6VA 3W1YA 2DZMA 2JY6A 3NZSA 3V61A 4ANXA 1HE8A 2D07B 5DCNA 2KZRA 1OEYA 2L00B 3BINA 3JW0X 3VXWA 2I1JA 3M95A 3V60A 4FJYA 2KNBA 5J2RA 2DZKA 2V3SA 2KDIA 4MGYE 3ZVVA 3VUYA 4ANUA 4N9F4 3TL5A 5D94A 1X1MA 4LDTD 1WYWB 2MQJA 2J7QB 2NPTB 4TUUA 2MBEA 4NQLB 4KVGB 4AOFA 1YD8U 2ZCCA 4ZYNA 4ASWC 2LVOA 2MW5A 4BFRA 4JL9A 2EKEC 3U8ZA 1V9JA 3RT3B 4F8CB 3VUWA 1PQSA 1V80A 3PLUA 4A3OA 3KVFB 3M63B 2M17A 3WA0A 5CHVC 2FCSA 1TGZB 3PRMB 3ZO5B 3ZRCA 3TIXA 2KD0A 2IY0B 4URKA 2N9XA 4DHZE 4HJKA 3EC8A 4W9IA 1SE9A 3DBLI 3ML9A 3H7PA 1L7YA 3NHEB 4GU2A 4W9GA 1E8ZA 4ANVA 2ZVOA 1UBIA 3NY5A 2KKCA 4IWPA 4NAWB 2K8CA 2KOXA 3KUCB 2FAZA 2KJRA 2Z0EB 4NNJB 3ZNZB 1R4NI 2BPSA 1WGGA 3QA8A 3SDLC 2IYDB 2KFKB 3TJPA 3H1UA 3R3MA 3TCAA 1E90A 2KJHB 4B95A 4BOZB 1D3ZA 2BWFA 4GDLB 1IP9A 5E6PA 4HWIB 4E3CA 3MHSD 1BT0A 1OEYJ 1WE7A 2LRWA 3PVLA 3ZLZA 1P0RA 2AEHA 3B1LX 3LDZE 3R7QA 1S3SG 3H7SA 1V81A 4TQ0A 1NBFC 4DBGA 3SHQA 4WAAA 4E74A 1GC7A 4KSLC 5LXIB 2JT4B 3VTWA 3C0RB 4MDKE 2KFKA 3PREA 1V5TA 2LJ5A 1F9JA 1WIAA 4DDGD 1WXSA 1GC6A 3N32A 2K8HA 5JHAA 2GBMA 4M8MA 2RGFA 2MX2A 2O6VB 3SD5A 2XEWA 2KTRB 1H4RA 2O2VA 3QARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N B;  2DHZ A;  3WIM A;  1AAR A;  2K39 A;  5IAA C;  2RPQ A;  4KDI C;  3VAW A;  2BKF A;  3A9J A;  2UYZ B;  2RD0 A;  4WQO B;  1G6J A;  1P1A A;  5BO4 B;  2MBQ A;  5KHO A;  3T9L A;  2EMS A;  4ZRI A;  5JHB A;  3PT2 B;  2PE6 B;  1UD7 A;  3PGE A;  4OVU A;  1KOT A;  4J6I A;  2KMA A;  2KN5 A;  2XK5 B;  4WWN A;  2LZ6 A;  2GBR A;  3DVG X;  2N1W A;  1LXD A;  1E8X A;  1U4A A;  5G2N A;  3T8M A;  2N7E A;  3PHX B;  5AZG A;  1V2Y A;  3NS8 A;  4KIK A;  3HK0 A;  2IO1 B;  1L2N A;  1RFA A;  4FLH A;  1WFY A;  2KMC A;  2CHW A;  1YX6 B;  1WZ0 A;  3AI5 A;  1EF5 A;  1WH3 A;  3M62 B;  2JF5 A;  3A1Q B;  3D32 A;  3UIN B;  1ZW7 A;  4NAW A;  2HD5 B;  2MBO A;  2NBU A;  2G4D B;  1LFD A;  1Q5W B;  2RSU A;  5TR5 A;  4FJV B;  3S2A A;  3WAM A;  3UQA A;  2HTH A;  4NQK E;  2LGX A;  3KUD B;  2L76 A;  1WX8 A;  3PZD A;  2ASQ A;  2KTF A;  4TKN A;  2KWV B;  4G0N B;  4CO7 A;  2N9P C;  2FIF A;  4GDK B;  2K1F A;  3L08 A;  1GNU A;  4LDT B;  2D10 A;  2FNJ B;  3CSF A;  5G55 A;  4JLC A;  4ZDV A;  3EHV A;  3HM3 A;  3EEC A;  3ZDT A;  1UZX B;  1SIF A;  3B0A A;  2QHO A;  1P9D U;  4G3X B;  2KC2 A;  4HPL B;  4MGI E;  2MA9 B;  2IY1 B;  2LVQ A;  4MM3 A;  4WWO A;  2EMT A;  1WMH B;  4GDK A;  4GGQ A;  2NBV B;  2ZNV B;  4E71 A;  1KM7 A;  1P98 A;  4W9D A;  3VUX A;  2ZPN A;  1WX9 A;  2AL6 A;  3B08 A;  4FBJ B;  3BY4 B;  4IM2 A;  3UQB A;  3N3K B;  3QX1 A;  3UIP B;  3RZF A;  3W1S A;  3ZNI D;  2ZZP B;  4W9E A;  4PYZ A;  4WJN A;  2O2V B;  3WAL A;  5L83 A;  2KWC A;  2KTR A;  3PLV A;  2MCN B;  5EDS A;  1LM8 B;  2L8J A;  1J19 A;  4G50 A;  4FHJ A;  3NOB A;  4K81 A;  4BBN F;  4MSQ B;  2G3Q B;  4IC7 B;  2KHW B;  2WWZ A;  3O65 B;  2BF8 B;  2LWP A;  2PPH A;  1ZKH A;  1IPG A;  2CS4 A;  2M1M A;  1UGM A;  2NS5 A;  3CMM B;  4KZ0 A;  2Z59 B;  4XZ4 A;  4FUL A;  4EFO A;  2BYV E;  2PE9 A;  1NDD A;  2N7D A;  2BYE A;  4HDQ A;  2DYO A;  3X0W A;  2BYF A;  1EO6 A;  1E8Y A;  4IWO A;  1RAX A;  2G4S A;  1VCB A;  1YIW A;  3IVF A;  5E6N A;  5C23 A;  3IBE A;  2AYO B;  2BKR B;  4HCP B;  1TZ1 A;  2LXA A;  4ZRJ A;  4IWQ A;  2L0F A;  1K8R B;  4JQW C;  4MGK E;  2AWT A;  3ZDM C;  4TQ1 A;  1A5R A;  3DVN V;  3DCG A;  4II2 B;  1GUA B;  2K6D B;  4EZK A;  3SU8 X;  1V5O A;  3ZTD A;  1S1Q B;  2JPH A;  3DDC B;  2KDB A;  2JZZ A;  2J0K A;  2V1Y A;  3VFK A;  2IO3 B;  3VQI A;  5JZE B;  2NVU I;  2KQ7 A;  4BBN C;  3UGB B;  4BKS D;  4W9J A;  3Q3F A;  4EZL A;  2B3A A;  3ZNH B;  5CHW A;  2NBW B;  2C7H A;  2MRP A;  1TTN A;  3JVZ X;  1WY8 A;  3NZU A;  3OAW A;  4MGZ E;  4DHZ B;  1WXV A;  3KUZ A;  4ICV A;  1YJ1 A;  2LAS A;  1WJN A;  1JRU A;  5CTR C;  1WJ6 A;  4FJZ A;  4K7S A;  1WRD B;  2KDE B;  2K25 A;  4P7I A;  2K8B A;  1M94 A;  1P3Q U;  2MWS B;  4FAD A;  1WF9 A;  5FR6 A;  1IYF A;  2WYQ A;  3A4S C;  4I6L B;  2WDT B;  4AJY B;  3AU4 A;  1KLV A;  3N30 A;  2CKH B;  3HM6 X;  4GIV A;  3DBH I;  5J17 A;  2KK8 A;  4KZC A;  3RD2 A;  3AU5 A;  3V6C B;  2R2Q A;  3JSV A;  2MLB A;  3RUL A;  1T0Y A;  2KFJ A;  4W9C A;  3M3J A;  1WM3 A;  3GZN I;  2JZ3 B;  3PHW B;  3K9O B;  2ZVN A;  4DXA B;  2GMI C;  1WXA A;  4ICU A;  1J8C A;  4EUT A;  2DEN B;  5DPS A;  1ISN A;  3PTF C;  4IM3 A;  4AWJ A;  2KQS A;  3VTU A;  2DAJ A;  2ZCB A;  3L10 B;  4GDL A;  1V49 A;  1MG8 A;  2G45 B;  3DBS A;  3HIZ A;  1UEL A;  4HK2 A;  4YL8 A;  5KHQ A;  1OGW A;  2FCM A;  3L0W B;  3VVW B;  3OJ3 A;  1XT9 B;  4IG7 B;  2M4N A;  1EUV B;  4II3 B;  4BOS C;  1WGH A;  5LXH A;  3QQ8 B;  2OJR A;  4W9F A;  3ZTC A;  4GOC A;  2GBK A;  2FCQ A;  4RM9 A;  3R66 C;  2LXC A;  4MJS A;  1OQY A;  2MBB B;  2NCN A;  3K9P B;  3DOW A;  2NPT A;  2A5U A;  4DWF A;  2FID A;  3QK0 A;  1WR6 E;  2JRI B;  4DK5 A;  4A20 A;  4B6W A;  1Z5S B;  4GB9 A;  2REX A;  1RRB A;  1EF1 A;  3ECI A;  1WE6 A;  3I3T B;  3KYC D;  3VH4 B;  4HLE A;  1E7V A;  4HPM B;  2MP2 A;  4WJO A;  4GN1 A;  3L17 A;  1WGD A;  4B9K A;  3PV1 A;  1Y8R C;  2C7M B;  2JXX A;  2L3Z A;  3V62 A;  2C7N B;  3X23 A;  2A4Z A;  2C5L C;  2M0X A;  3PSE B;  1WGR A;  3KW5 B;  2N4F A;  3KH0 A;  5LLI A;  2GBN A;  2LVP A;  3APF A;  4HVB A;  5CX3 A;  3JYU A;  2KLC A;  3WAO A;  2PEA A;  1V6E A;  1WZ3 A;  3W1S C;  4MEL A;  3DPD A;  3VTV A;  1FXT B;  1YQB A;  2K6Q A;  2MSE D;  2WX0 A;  4TV3 A;  1RLF A;  2I1K A;  1Q0W B;  3RUI B;  1V86 A;  1E8W A;  4KSK C;  4GMV A;  1OTR B;  3U7D A;  4BVU C;  4PYU A;  2C60 A;  4MH0 E;  2FCN A;  1VD2 A;  3A1Q A;  1CMX B;  2O6V D;  5D7G A;  5AZH A;  2C9W B;  2KX3 A;  4JGH B;  2DYM A;  4HXD A;  2ZNV C;  2IBI B;  1GG3 A;  2JVC A;  3HHM A;  3QCA A;  4G11 A;  3IHP C;  2CHZ A;  2JRH A;  3Q3J A;  2IO2 B;  3ENE A;  1XD3 B;  3CF6 E;  4MEM A;  1WJU A;  2LUE A;  1GJZ A;  4FN2 A;  1WM2 A;  2DAF A;  1WXM A;  4CHK A;  4RM8 A;  4EZJ A;  2D2Q A;  3L13 A;  3PS6 A;  2GOW A;  3TBL D;  2KLG A;  2LI5 A;  3CST A;  1WGY A;  2CU1 A;  4LJP B;  2RR9 A;  5E6O A;  5HKH A;  3L54 A;  3AUL A;  5DPT A;  3PPA A;  4MSM B;  4W9L A;  2MBH A;  4GSW A;  4HCN B;  5IA7 A;  4WWP A;  3L16 A;  2PJH A;  3QHT A;  3A4R A;  2ZEQ A;  2M8S A;  3IFW B;  1WJ4 A;  4JIO U;  2J0M A;  1C3T A;  1SGH A;  2DX5 B;  3RYT A;  3TMP B;  4BKS A;  4NJ6 A;  4DHJ B;  5DPW A;  4PS3 A;  3DVN U;  4GXB A;  4FA6 A;  3DQV A;  2DYB A;  2YLM A;  1WMH A;  2JUO A;  3QAQ A;  2VRR B;  2CHX A;  1QZE A;  4M8N A;  1YX5 B;  4MJS B;  2BGF A;  2R2O A;  2DZI A;  2L05 A;  3OJ4 B;  2KWU B;  2HJ8 A;  3WAN A;  4M0W B;  4NY0 A;  2IZV B;  3DVG Y;  4NPN A;  4DDI D;  5D6J B;  5CHF A;  3ZUN A;  1WR1 A;  3ZIM A;  1C1Y B;  3H9D A;  3H6N A;  3KYD D;  4A3P A;  2HE7 A;  2MP2 B;  2LD9 A;  3MJW A;  3R7R A;  3VH3 B;  3QC8 B;  3RZW C;  3UF8 A;  1WX7 A;  4OVV A;  4XX5 A;  3OLM D;  4LJO B;  1NI2 A;  1WI0 A;  3AXC A;  1R4M I;  4IUM B;  1E7U A;  2AL3 A;  2LGY A;  2BWE S;  4HDO A;  5AZF A;  2Z0D B;  3QJZ A;  2JWZ A;  3ALB A;  3ZNG C;  2D3G A;  2KVR A;  2W9N A;  1E5W A;  3PRP B;  2L7R A;  4IM0 A;  3EFU A;  3LJ3 A;  3ONS A;  1LQB A;  2GBJ A;  2KAN A;  2LRU A;  4WJQ A;  5AEK B;  4EKU A;  3P2B A;  2LGD A;  2NR2 A;  1TBE A;  2L0T A;  4XC2 A;  3ZKJ C;  3ZRF A;  1Z2M A;  4FHK A;  1I42 A;  3A9K B;  2UWQ A;  1UBQ A;  3ZW3 A;  4BKG A;  4EEW A;  5D2M B;  2CR5 A;  3MTN B;  3ML8 A;  3A33 B;  3DBR I;  3H7P B;  4AUQ C;  4PS8 A;  4ZRK A;  5C1Z A;  5DPR A;  4ANW A;  3V6E B;  4X57 B;  4K1R B;  2V4L A;  2KDF B;  4CYE A;  4I6P A;  3VHT C;  1UH6 A;  4DHJ D;  4BKT A;  3QIJ A;  3U30 A;  2FUH B;  2KJ6 A;  3A9K A;  5GMV A;  4KV2 A;  1Q1O A;  4F1S A;  1I35 A;  4LCD E;  2OOB B;  2YVC A;  3IG3 A;  3UIO B;  2N9E B;  2KXJ A;  4F7Z A;  1XQQ A;  2DZJ A;  2WX1 A;  3RCZ A;  1ZGU B;  4WJP A;  1H8C A;  3A9J B;  2D11 A;  3WAP A;  2N1V A;  5JH5 C;  2ZPY A;  2KC1 A;  3JSV B;  4IW0 A;  2IO0 B;  4NJ7 A;  3GOE A;  1J0G A;  4W9H A;  4RMA A;  2KX0 A;  2XBB C;  4PS7 A;  3APC A;  2XK5 A;  3PRZ A;  2ZJD A;  4AJW A;  5L95 C;  5J18 A;  4EOY A;  4K7W A;  4KDL B;  4K7U A;  2KO3 A;  3APD A;  3VDZ A;  3QWZ B;  4AP4 C;  2J0J A;  4KIK B;  4W9K A;  2Y5B B;  1KJT A;  2O6V A;  3W1Y A;  2DZM A;  2JY6 A;  3NZS A;  3V61 A;  4ANX A;  1HE8 A;  2D07 B;  5DCN A;  2KZR A;  1OEY A;  2L00 B;  3BIN A;  3JW0 X;  3VXW A;  2I1J A;  3M95 A;  3V60 A;  4FJY A;  2KNB A;  5J2R A;  2DZK A;  2V3S A;  2KDI A;  4MGY E;  3ZVV A;  3VUY A;  4ANU A;  4N9F 4;  3TL5 A;  5D94 A;  1X1M A;  4LDT D;  1WYW B;  2MQJ A;  2J7Q B;  2NPT B;  4TUU A;  2MBE A;  4NQL B;  4KVG B;  4AOF A;  1YD8 U;  2ZCC A;  4ZYN A;  4ASW C;  2LVO A;  2MW5 A;  4BFR A;  4JL9 A;  2EKE C;  3U8Z A;  1V9J A;  3RT3 B;  4F8C B;  3VUW A;  1PQS A;  1V80 A;  3PLU A;  4A3O A;  3KVF B;  3M63 B;  2M17 A;  3WA0 A;  5CHV C;  2FCS A;  1TGZ B;  3PRM B;  3ZO5 B;  3ZRC A;  3TIX A;  2KD0 A;  2IY0 B;  4URK A;  2N9X A;  4DHZ E;  4HJK A;  3EC8 A;  4W9I A;  1SE9 A;  3DBL I;  3ML9 A;  3H7P A;  1L7Y A;  3NHE B;  4GU2 A;  4W9G A;  1E8Z A;  4ANV A;  2ZVO A;  1UBI A;  3NY5 A;  2KKC A;  4IWP A;  4NAW B;  2K8C A;  2KOX A;  3KUC B;  2FAZ A;  2KJR A;  2Z0E B;  4NNJ B;  3ZNZ B;  1R4N I;  2BPS A;  1WGG A;  3QA8 A;  3SDL C;  2IYD B;  2KFK B;  3TJP A;  3H1U A;  3R3M A;  3TCA A;  1E90 A;  2KJH B;  4B95 A;  4BOZ B;  1D3Z A;  2BWF A;  4GDL B;  1IP9 A;  5E6P A;  4HWI B;  4E3C A;  3MHS D;  1BT0 A;  1OEY J;  1WE7 A;  2LRW A;  3PVL A;  3ZLZ A;  1P0R A;  2AEH A;  3B1L X;  3LDZ E;  3R7Q A;  1S3S G;  3H7S A;  1V81 A;  4TQ0 A;  1NBF C;  4DBG A;  3SHQ A;  4WAA A;  4E74 A;  1GC7 A;  4KSL C;  5LXI B;  2JT4 B;  3VTW A;  3C0R B;  4MDK E;  2KFK A;  3PRE A;  1V5T A;  2LJ5 A;  1F9J A;  1WIA A;  4DDG D;  1WXS A;  1GC6 A;  3N32 A;  2K8H A;  5JHA A;  2GBM A;  4M8M A;  2RGF A;  2MX2 A;  2O6V B;  3SD5 A;  2XEW A;  2KTR B;  1H4R A;  2O2V A;  3QAR A; 
#chains in the Genus database with same CATH topology
 2DHZ A;  3WIM A;  1JWM D;  2BKF A;  4MH8 A;  4WQO B;  1ZDV A;  3FIL B;  4LTU A;  4OVU A;  2WHI A;  2KN5 A;  2XK5 B;  1N60 A;  2N7E A;  2D3A A;  1V2Y A;  3NS8 A;  3GE3 C;  3HK0 A;  4N6E B;  2IO1 B;  4RF1 A;  1L2N A;  3BWU D;  1YX6 B;  3AI5 A;  5G5H A;  1EF5 A;  2AQ1 B;  3AE8 B;  4ACF A;  1OFF A;  4NAW A;  4L23 A;  2G4D B;  1Q5W B;  3VRA B;  4YSX B;  3GS2 A;  2KWV B;  2N0S B;  2N9P C;  3L08 A;  1ACC A;  1SXT A;  2EKI A;  5G55 A;  4ZDV A;  3HM3 A;  1TY0 A;  3B0A A;  3AE6 B;  4YT0 B;  1CQV A;  4G3X B;  3OWE B;  2X8X X;  1WMH B;  2X38 A;  4E71 A;  4P6V F;  2L52 A;  2WU5 B;  2AL6 A;  3UQB A;  3N3K B;  1CK1 A;  3RZF A;  3KWV A;  3WAL A;  2KWC A;  2KTR A;  5EE0 A;  5EDS A;  2BVC A;  1J19 A;  4K81 A;  2IND C;  4IC7 B;  1HZ6 A;  1GB4 A;  2TSS A;  4OHJ A;  1NDD A;  4HKZ E;  2BYE A;  2DYO A;  1EO6 A;  2ONQ A;  1E8Y A;  2G4S A;  3NZ3 A;  2LGS A;  2Y3A A;  1T0Q C;  2AYO B;  4HCP B;  4ZRJ A;  3AEB B;  4JQW C;  4MGK E;  2AWT A;  1A5R A;  1GUA B;  2SEB D;  2J0K A;  2V1Y A;  1EM7 A;  4BBN C;  1BXT A;  4BKS D;  4W9J A;  2N9K A;  3Q3F A;  4A6Q A;  2PLP A;  2MRP A;  1TTN A;  3OAW A;  4MGZ E;  4BAX A;  4YSZ B;  4M00 A;  1JRU A;  2K25 A;  2WXK A;  1P3Q U;  5JXV A;  4AJY B;  5IOI A;  1V1P A;  2CKH B;  3BK2 A;  3DBH I;  3RD2 A;  3V6C B;  1I4G A;  3RUL A;  1T0Y A;  2KFJ A;  1WM3 A;  4EUT A;  3ZJT A;  1JML A;  2KDM A;  3WCQ A;  1C78 A;  1ISN A;  2ZCB A;  1V49 A;  3HIZ A;  4OW0 A;  4HK2 A;  4YL8 A;  2BBC A;  3VVW B;  3NVY A;  2LGI A;  1N6Z A;  2WU2 B;  4BOS C;  1RM6 C;  3QQ8 B;  2OJR A;  4W9F A;  2FCQ A;  4RM9 A;  2HJ1 A;  4HPP A;  2W82 A;  3QK0 A;  2JRI B;  4DK5 A;  1Z5S B;  3N1Z C;  1EF1 A;  2MJ3 A;  1J7B A;  1E7V A;  4MAC A;  2MP2 A;  4GN1 A;  3P4Q B;  2V3P A;  4B9K A;  3V62 A;  2C7N B;  3RN9 C;  2OJW A;  3KW5 B;  1GOZ A;  2KAC A;  2N4F A;  2RDH A;  2WXO A;  2GBN A;  4HVB A;  4WQM A;  5MPO A;  5CX3 A;  3JYU A;  3WAO A;  2PEA A;  5EE3 A;  1KFY B;  3W1S C;  3DPD A;  2K6Q A;  2IJ0 A;  1Q0W B;  1KLG D;  1V86 A;  4KSK C;  2QJL A;  1OTR B;  1VLB A;  2C60 A;  1VD2 A;  1CMX B;  3BYT B;  1PFD A;  3KQ4 A;  5D7G A;  4JGH B;  2INN E;  1GG3 A;  3LB8 C;  3QCA A;  3IHP C;  2JRH A;  3Q3J A;  1XD3 B;  2WXJ A;  1R7S A;  1SE2 A;  4NAM A;  1T5X D;  3AED B;  4LJP B;  2LI5 A;  1WGY A;  2CU1 A;  2RR9 A;  5E6O A;  5HKH A;  3L54 A;  4R3D A;  5DPT A;  1JWB D;  2BT6 A;  1PGB A;  4JIO U;  2DX5 B;  3RYT A;  1D5M C;  3OG5 A;  3DVN U;  2L83 A;  1XLP A;  2R61 A;  2VRR B;  1KF6 B;  1SSN A;  1YX5 B;  4WH4 A;  2R2O A;  2L05 A;  2HJ8 A;  1DOY A;  2WXN A;  1C4P A;  3I9V 1;  3H6N A;  4A3P A;  1Y56 A;  2HE7 A;  2LD9 A;  3R7R A;  3VH3 B;  3L4P A;  2LJI A;  3HVZ A;  1WI0 A;  1XCT L;  3TEZ A;  2WXG A;  1E7U A;  4HDO A;  3QJZ A;  2JWZ A;  1QKZ A;  5BYQ A;  5IP4 D;  1B1Z A;  1LQB A;  3HRD D;  3AH7 A;  1TBE A;  2L0T A;  3ZKJ C;  2GLS A;  5EE9 A;  3A9K B;  3IAS 1;  1UBQ A;  3ZW3 A;  2CR5 A;  2BB5 A;  4PT5 A;  1YQ4 B;  4WUR A;  4AUQ C;  4ZRK A;  3V6E B;  4X57 B;  4I6P A;  4DHJ D;  4B0E A;  3U30 A;  1OQR A;  3A9K A;  5GMV A;  1Q1O A;  1I35 A;  2MJE A;  4C80 A;  3RMK C;  2DZJ A;  1ZPS A;  1VRA B;  1TS3 A;  2D11 A;  1ET9 A;  2J53 A;  1YJI A;  3ZXV A;  2KC1 A;  3JSV B;  2WXM A;  4W9H A;  2QSD A;  2KX0 A;  5E6J A;  3PRZ A;  2XK5 A;  4AJW A;  4AQ7 A;  5J18 A;  4K7U A;  1P7F A;  1SE3 A;  2KWD A;  4YSY B;  4C4V B;  2O6V A;  2DZM A;  4ANX A;  1HE8 A;  5DCN A;  2DLB A;  1GB1 A;  3BIN A;  1DOI A;  4FJY A;  2KNB A;  2N7J A;  2KAJ A;  4N9F 4;  3MC0 B;  2IGD A;  2WXR A;  4LDT D;  3DWG C;  1WYW B;  1TY2 A;  2NPT B;  2MBE A;  4NQL B;  2FUG 1;  1GPX A;  1BML C;  1XF5 L;  4JL9 A;  1TYG B;  4M02 A;  1TJE A;  1TKY A;  3ZO5 B;  3ZRC A;  2AQ2 B;  5HI1 A;  3KLS X;  1IGC A;  1TKG A;  4ANV A;  1D5Z C;  2KOX A;  2Z0E B;  2LHE A;  5H8Y E;  2NTS A;  1FD6 A;  2WS3 B;  3TJP A;  1IP9 A;  4GDL B;  4HWI B;  3MC9 A;  3MHS D;  1OEY J;  2AEH A;  3R7Q A;  4TQ0 A;  1EWC A;  4DBG A;  4E74 A;  4KSL C;  3C0R B;  3PRE A;  1V5T A;  1F9J A;  4EE2 A;  4DDG D;  1GC6 A;  2WXL A;  3AMZ A;  2GBM A;  2RGF A;  1H4R A;  2O2V A;  4HEA 1;  1OQQ A;  1IUE A;  5IAA C;  3TEX A;  2UYZ B;  1CZP A;  1G6J A;  1P1A A;  5KHO A;  3HUI A;  5JHB A;  3PT2 B;  3PGE A;  3SR6 A;  4J6I A;  2LZ6 A;  2GBR A;  3DVG X;  2N1W A;  4Q2J A;  1L4D B;  5AZG A;  2L1A A;  1RFA A;  2J42 A;  1TT5 B;  3P4S B;  1RYJ A;  2W55 A;  2D5G A;  1ZXH A;  2JF5 A;  3A1Q B;  3D32 A;  3W2D A;  1I4P A;  1WSP A;  4US8 A;  2QIE B;  1ZW7 A;  1C9F A;  2HD5 B;  2RSU A;  3UQA A;  3Q6B A;  2L76 A;  4TKN A;  1V97 A;  2FIF A;  1GNU A;  3RNG C;  4LDT B;  2FNJ B;  3CSF A;  4JLC A;  3EEC A;  4TMA B;  3ZDT A;  1SIF A;  2ACZ B;  4AS1 A;  2KC2 A;  4HPL B;  4MM3 A;  4WWO A;  3PZ7 A;  3ZGZ A;  2NBV B;  1P98 A;  4W9D A;  3VUX A;  3ZNI D;  3FC4 A;  2M56 B;  1EWY C;  4HRO A;  2O2V B;  4K3C A;  1MHX A;  2MCN B;  1YN5 A;  4FHJ A;  3NOB A;  4BBN F;  1YN3 A;  2G3Q B;  4KX6 B;  2KHW B;  2WWZ A;  2QCZ A;  1FM0 D;  2LWP A;  1RFK A;  2PPH A;  2M1M A;  2NS5 A;  3CMM B;  2PIA A;  3T3O A;  4KZ0 A;  3P4P B;  1HXY D;  3NRZ A;  4EFO A;  2JWU A;  2INP E;  4S17 A;  2BYV E;  2PE9 A;  4WWM A;  1ZUD 2;  2WQY B;  3IAM 1;  4KGT A;  3X0W A;  1T0R C;  3P63 A;  1JRP A;  3IVF A;  4US9 A;  1R4M B;  1TZ1 A;  3DWM A;  1K8R B;  3ZDM C;  1KRH A;  1HEZ E;  3DVN V;  1C4A A;  2WP9 B;  3DCG A;  2SAK A;  3SU8 X;  5C2T B;  1S1Q B;  2JPH A;  3AE7 B;  2B76 B;  2IO3 B;  4TSS A;  3E56 A;  5CHW A;  2NBW B;  3W9C B;  4A90 A;  1WY8 A;  3NZU A;  1WXV A;  3KUZ A;  2INC C;  4LNF A;  1N61 A;  1NYR A;  3NS1 A;  4FJZ A;  4K7S A;  5FR3 A;  1M94 A;  3P4R B;  4M01 A;  2LMC A;  2MH7 A;  4M0W A;  5J17 A;  4KZC A;  2GB1 A;  1I4R A;  1FRD A;  3GZN I;  2JZ3 B;  4ZHO A;  2GMI C;  4ICU A;  2DEN B;  1AYF A;  3PTF C;  4IM3 A;  2KQS A;  3L10 B;  4GDL A;  2G45 B;  1UEL A;  3Q3M C;  1UWM A;  3AE1 B;  1Q10 A;  1XT9 B;  1EUV B;  5H92 C;  3AV8 A;  5LXH A;  2AQ3 B;  1L5P A;  3ZTC A;  4GOC A;  1QF6 A;  4MJS A;  2OHF A;  1OQY A;  2M19 A;  2NCN A;  3K9P B;  2A5U A;  1L0X B;  4IOI E;  4GB9 A;  2REX A;  4N58 A;  3I3T B;  3KYC D;  4HPM B;  4WJO A;  1WGD A;  4MT5 A;  1K52 A;  2JXX A;  1I4Q A;  1FXA A;  1HTO A;  2A4Z A;  2C5L C;  2M0X A;  4RGT A;  3KH0 A;  5LLI A;  2FBW B;  4ITK A;  3NUH B;  3R2T A;  2AX5 A;  1K50 A;  1WZ3 A;  1ZDX A;  1D4B A;  3ABV B;  3VTV A;  3N20 C;  4TV3 A;  1RLF A;  2VZK D;  2I1K A;  1K51 A;  1E8W A;  4GMV A;  3N1Y C;  3U7D A;  4BVU C;  4PYU A;  4RGM A;  2FCN A;  1XCQ L;  2KMM A;  5AZH A;  2IGH A;  4HXD A;  2ZNV C;  2IBI B;  3IT6 B;  3HHM A;  4XE0 A;  2CHZ A;  2JX5 A;  3ENE A;  3CF6 E;  1WJU A;  2LUE A;  4FN2 A;  3Q8B A;  2DAF A;  3NVV A;  3TBL D;  3CST A;  3AUL A;  3I57 A;  1E6E B;  3PPA A;  4MSM B;  2MBH A;  5IA7 A;  2M8S A;  3VRB B;  1C4C A;  2J0M A;  2ON8 A;  1C3T A;  1YQ3 B;  3TMP B;  4DHJ B;  5HHD G;  4C56 C;  4FXC A;  2JUO A;  1TKE A;  1QZE A;  4JWS C;  4MJS B;  2BGF A;  2ZW0 A;  3OJ4 B;  3DVG Y;  5D6J B;  3ZIM A;  1AWD A;  2XNA C;  3RZW C;  1MJD A;  1WX7 A;  2BYT A;  1FCC C;  3FKY A;  3OLM D;  1NI2 A;  2AL3 A;  2BWE S;  2W54 A;  4ZYS A;  2Y5C A;  2Z0D B;  3ALB A;  4C7Y A;  2D3G A;  2W9N A;  2L7R A;  2G9H D;  3ONS A;  2KAN A;  2GBJ A;  2LRU A;  2RPV A;  2WXF A;  1I42 A;  4ZOH C;  1JW9 D;  3ETR A;  3NVZ A;  5D2M B;  3ML8 A;  2K9X A;  1YJJ A;  3DBR I;  3H7P B;  4PS8 A;  2VH2 A;  5C1Z A;  4ANW A;  4CYE A;  3ZJV A;  1C76 A;  4BKT A;  4A8X C;  5AUI A;  2MJD A;  1WWT A;  4F1S A;  2OOB B;  2D3B A;  2N9E B;  4DXG A;  1N62 A;  2WX1 A;  3U7Z A;  1ZGU B;  5AUK A;  1YMH E;  3Q8F A;  1KLU D;  2IO0 B;  5D3I B;  1VDV A;  1MI0 A;  2XBB C;  4PS7 A;  1VZ6 A;  2K5P A;  4EOY A;  2KO3 A;  3VDZ A;  3QWZ B;  4AP4 C;  3N1X C;  4L2Y A;  2Y5B B;  1K53 A;  5IN7 A;  3AM9 A;  1VZ8 A;  1I7H A;  2WXI A;  4RGO S;  4NZL B;  2D07 B;  2L00 B;  3B2F A;  3JW0 X;  3CIR B;  2I1J A;  3Q2A C;  2YEP B;  4WIP A;  2V3S A;  4MGY E;  3ZVV A;  2PVG C;  2WXQ A;  4P1C C;  1JWS D;  2MQJ A;  2K22 A;  1AW7 A;  1ESF A;  3RNF C;  1HTQ A;  1GAQ B;  2ZCC A;  3BYY B;  1L0V B;  3LYY A;  4ASW C;  2MW5 A;  2YEP F;  4BFR A;  1F0Z A;  3RT3 B;  4DXF A;  4NJC A;  3B2G A;  3VUW A;  3PLU A;  3KVF B;  2M17 A;  3WA0 A;  3VR8 B;  1TGZ B;  2NTT A;  3EC8 A;  1YNT E;  4W9I A;  5C3J B;  5BYS A;  4W9G A;  3DHI C;  3TUO A;  3NY5 A;  2JQR B;  3KUC B;  4K3B A;  1R4N I;  2BPS A;  1WGG A;  3QA8 A;  3TCA A;  1E90 A;  2KJH B;  4B95 A;  1D3Z A;  4E3C A;  1FFU A;  1WE7 A;  3PVL A;  1P0R A;  1S3S G;  1NBF C;  5LXI B;  1MPE A;  3VTW A;  1V1P B;  2LJ5 A;  1WXS A;  2CU3 A;  5JHA A;  4M8M A;  1VJK A;  3SD5 A;  2XEW A;  2KTR B;  3QAR A;  4I6N B;  3VAW A;  2H88 B;  5BO4 B;  2MBQ A;  2QDF A;  1C77 A;  2PE6 B;  1E9M A;  2H89 B;  1KOT A;  2KMA A;  4WWN A;  2RMM A;  4OZC A;  2JYE A;  1E10 A;  1L0Y B;  1U4A A;  3T8M A;  4LLG M;  2D3C A;  3U2S C;  4FLH A;  5EE1 A;  1WH3 A;  3M62 B;  5GXG B;  3UIN B;  2NBU A;  3S2A A;  1LFD A;  2HTH A;  1FO4 A;  1I4X A;  4B0M A;  2QIL A;  2LGX A;  1WX8 A;  3PZD A;  2KTF A;  1VZ7 A;  4G0N B;  2MEK A;  4CO7 A;  1FCL A;  2K1F A;  1QOA A;  1L6V A;  2IDY A;  1UZX B;  2Z8L A;  3Q3O C;  4MGI E;  2IY1 B;  1EU4 A;  3H8H A;  2I38 A;  4GDK A;  1UWX A;  4GGQ A;  2ZNV B;  1KM7 A;  1WX9 A;  1WXQ A;  3Q8A A;  3BY4 B;  4IM2 A;  3RNB C;  4W9E A;  2RDB C;  5L83 A;  3DHH C;  4YXD B;  1KTK A;  1LM8 B;  3U4E G;  2XN9 C;  2BF8 B;  1JCK B;  1IPG A;  4JPS A;  4C00 A;  2Z59 B;  3R2I A;  2L32 A;  4KKJ A;  3IXS A;  4HDQ A;  2BYF A;  4IWO A;  1RAX A;  4LNI A;  1VCB A;  1YIW A;  2DWQ A;  5BYR A;  1DOX A;  5C23 A;  3IBE A;  3Q69 A;  2BQQ A;  4KGR A;  4II2 B;  4EZK A;  1ET6 A;  3DDC B;  2KDB A;  3J9C A;  3VFK A;  3VQI A;  5JZE B;  1XEE A;  2NVU I;  2KQ7 A;  3UGB B;  5FKA C;  3ZNH B;  3ZXR A;  3JVZ X;  4ICV A;  1YJ1 A;  2LAS A;  1WJN A;  2KVZ A;  1WJ6 A;  1WRD B;  3GE8 C;  4P7I A;  1HZ5 A;  2PKO A;  2K8B A;  2MWS B;  4FAD A;  1IYF A;  2WYQ A;  4XYC A;  3AE5 B;  3AU4 A;  3HM6 X;  2KK8 A;  3AU5 A;  2R2Q A;  3JSV A;  4P1B C;  4W9C A;  3UI3 A;  3M3J A;  4LNN A;  3K9O B;  2ZVN A;  1WXA A;  4LNK A;  1LO5 D;  2I2Y A;  4CQN A;  2DAJ A;  4C4V A;  3DBS A;  2CJN A;  4O1N A;  5KHQ A;  1OGW A;  4YTM B;  2GI9 A;  3LXF A;  1EU3 A;  1NVI D;  4IG7 B;  1WGH A;  1SEB D;  2GBK A;  2LXC A;  4GLS C;  2MBB B;  1FNU A;  4ARC A;  3DOW A;  2NPT A;  4DWF A;  2FID A;  1WR6 E;  4A20 A;  3DBH B;  1WGK A;  4HKQ A;  1WE6 A;  3VH4 B;  3DBR B;  5G5G A;  3PV1 A;  1Y8R C;  3TEW A;  3AEC B;  3PSE B;  3MP9 A;  3CWI A;  2JSV X;  2KLC A;  4ZHP A;  1V6E A;  4MEL A;  2JZP A;  1YQB A;  3RNE C;  1JWA D;  1F52 A;  1SIJ A;  1ZE3 D;  4MH0 E;  2WDV B;  3A1Q A;  2O6V D;  2C9W B;  2KX3 A;  1DGJ A;  1M4V A;  3AE4 B;  4G11 A;  3RNA C;  3URY A;  2IO2 B;  1GJZ A;  1P7E A;  1R4N B;  1SF0 A;  1NEN B;  4CHK A;  4RM8 A;  2Q5W D;  3L13 A;  2ZW1 A;  4W9L A;  3BVG A;  4GSW A;  4HCN B;  4YTN B;  3QHT A;  2PJH A;  3W5U B;  3IFW B;  3RPF C;  4BKS A;  5DPW A;  3DQV A;  2YLM A;  1NYQ A;  3AE9 B;  3V3X A;  2CHX A;  3SEB A;  4M8N A;  4ZRQ A;  1FPY A;  1TS5 A;  3EUB 2;  1UUP A;  4M0W B;  4DDI D;  2IZV B;  1MG4 A;  3ZUN A;  1WR1 A;  1C1Y B;  3KYD D;  2BS4 B;  3QC8 B;  1IGD A;  3UF8 A;  3GB1 A;  4OVV A;  4XX5 A;  3AXC A;  3W5V B;  5AZF A;  1FIQ A;  1E0Z A;  1E5W A;  3PRP B;  4IM0 A;  3EFU A;  3LJ3 A;  1FXI A;  3MFG A;  1FMA D;  4EKU A;  3P2B A;  1WRI A;  1T3Q A;  4J3O D;  4FHK A;  4REZ A;  2W3S A;  2DBY A;  3EFC A;  3MTN B;  1TS2 A;  3A33 B;  3AEE B;  5DPR A;  3EA6 A;  5T8I A;  4K1R B;  1XO3 A;  1YN4 A;  2FUH B;  2KJ6 A;  2V3N A;  2WXP A;  5BMG A;  2YVC A;  3IG3 A;  3P1M A;  4LK0 M;  3UIO B;  4F7Z A;  3RCZ A;  4RFB A;  3A9J B;  4HRS A;  4MM3 B;  3WAP A;  3Q8E A;  4RH6 A;  1J0G A;  3R8B A;  2ZJD A;  4K7W A;  4KDL B;  4D2K A;  1UNS A;  2J0J A;  4IKG A;  4W9K A;  1F2R C;  3EGR A;  4JWU C;  4LNO A;  3W1Y A;  2KZR A;  1OEY A;  1SE4 A;  1VR9 A;  3M95 A;  1QT9 A;  5J2R A;  2KDI A;  3N9Y C;  4ANU A;  3TL5 A;  2J7Q B;  4TUU A;  4AOF A;  1PGA A;  4ZYN A;  2LVO A;  2W3R A;  2EKE C;  3U8Z A;  1V9J A;  1PQS A;  1D6E C;  4A3O A;  1PGX A;  3PRM B;  4URK A;  3Q14 C;  2N9X A;  4DHZ E;  4HJK A;  1SE9 A;  3DBL I;  4DQO C;  2KYW A;  1UBI A;  1N5X A;  2FAZ A;  1ROE A;  1XLQ A;  4RGN A;  4YWG G;  2E3T A;  1FRR A;  3R3M A;  4BOZ B;  1NI3 A;  1FNW A;  5E6P A;  2LRW A;  3ZLZ A;  3B1L X;  2LFI A;  3LDZ E;  3SHQ A;  1GC7 A;  2JT4 B;  3NJT A;  4XWT A;  3FIL A;  1WIA A;  3N32 A;  2K8H A;  2MX2 A;  2O6V B;  3PZ8 A;  2LHD A;  1T6B X;  4WAF A;  1PYW D;  1AAR A;  4XDC A;  2K39 A;  3P42 A;  2RPQ A;  4KDI C;  3A9J A;  2RD0 A;  3O13 A;  3T9L A;  2EMS A;  4ZRI A;  1UD7 A;  2KN4 A;  4IDI A;  1LXD A;  1L4Z B;  1E8X A;  5G2N A;  3PHX B;  2PMV A;  4KIK A;  4H2A A;  4ZRP A;  5BMH A;  5FK9 C;  1WFY A;  2KMC A;  2CHW A;  1WZ0 A;  1LGR A;  4C7Z A;  2MBO A;  3KWL A;  5TR5 A;  3WAM A;  4FJV B;  1PUT A;  4JX1 C;  2LUM A;  4NQK E;  3KUD B;  3VR9 B;  2ASQ A;  2Y5P A;  4GDK B;  3RFZ B;  3ZJU A;  2D10 A;  3EHV A;  2E6X A;  1J7A A;  4A55 A;  2QHO A;  1P9D U;  1SBB B;  2MA9 B;  2LVQ A;  2EMT A;  1D5X C;  3Q8C A;  3BK1 A;  2ZPN A;  2CJO A;  3B08 A;  2DNF A;  4FBJ B;  3QX1 A;  3UIP B;  3W1S A;  2PVO D;  1FEH A;  2ZZP B;  4PYZ A;  2BB6 A;  4WJN A;  3PLV A;  2L8J A;  4G50 A;  4MSQ B;  3O65 B;  1ZKH A;  2CS4 A;  1UF0 A;  1UGM A;  4XZ4 A;  4FUL A;  2N7D A;  1V8C A;  3V05 A;  2UU7 A;  5E6N A;  3PO0 A;  2KT7 A;  4RNA A;  2BKR B;  1ENF A;  2LXA A;  3I5J C;  4IWQ A;  2L0F A;  4TQ1 A;  1SB3 C;  2K6D B;  1V5O A;  3ZTD A;  2JZZ A;  1QOG A;  4EZL A;  2B3A A;  2HDE A;  2WXH A;  1A70 A;  2C7H A;  1XXG A;  4DHZ B;  3E9S A;  1ZP0 B;  3ZYY X;  5CTR C;  3AEA B;  2KDE B;  3I63 C;  1WF9 A;  5FR6 A;  3A4S C;  4I6L B;  1N5W A;  2WDT B;  1IBX A;  5BMI A;  1KLV A;  3N30 A;  4GIV A;  2MLB A;  4USA A;  2M0A A;  1SJH D;  4DXA B;  3PHW B;  1J8C A;  1T0S C;  1DYQ A;  3C19 A;  5DPS A;  4AWJ A;  3VTU A;  1MG8 A;  1QIL A;  3AB5 A;  1XLO A;  2FCM A;  1HQR D;  3L0W B;  3SFD B;  3OJ3 A;  2WDR B;  2JXT A;  2MHJ A;  2M4N A;  4II3 B;  1SJE D;  1TS4 A;  3R66 C;  3BVZ A;  1V1O A;  5I4D A;  4RCO A;  1QQR A;  1YOV B;  3GP7 A;  4B6W A;  2N9L A;  3U52 E;  1RRB A;  3ECI A;  4N59 A;  2OED A;  4HLE A;  3L17 A;  2C7M B;  2L3Z A;  3X23 A;  2QC8 A;  2WNM A;  1WGR A;  2LVP A;  3APF A;  3AE2 B;  2G1E A;  3AE3 B;  1FXT B;  2MSE D;  2WX0 A;  3C8Y A;  1L6U A;  5D3D A;  3RUI B;  3MC8 A;  2PTL A;  2NMQ A;  1MHH E;  2DYM A;  2KQ4 X;  2K0P A;  2JVC A;  4ARI A;  3T3N A;  4MEM A;  1WM2 A;  1ZXI A;  1WXM A;  2WGS A;  4EZJ A;  4KKI A;  2D2Q A;  3PS6 A;  2GOW A;  3FAH A;  2KLG A;  1PDX A;  4WWP A;  3L16 A;  2RDG A;  3A4R A;  4PK1 A;  2ZEQ A;  4QAY A;  1WJ4 A;  2BW2 A;  1SGH A;  1JRO A;  4S0R A;  4NJ6 A;  1C79 A;  4PS3 A;  1F1H A;  4GXB A;  4FA6 A;  2DYB A;  1WMH A;  3QAQ A;  1N63 A;  3NG0 A;  2DZI A;  1AN8 A;  2KWU B;  3WAN A;  4NY0 A;  1QOB A;  3IT4 B;  4NPN A;  1WYG A;  2QEJ C;  5CHF A;  3SFE B;  1XLN A;  3BZD B;  3H9D A;  4RF0 A;  2MP2 B;  3MJW A;  3BVM A;  1QOF A;  4LJO B;  4L1B A;  1R4M I;  4IUM B;  2HTM E;  2LGY A;  3RNC C;  1ZOY B;  3TSS A;  3ZNG C;  2V0G A;  2KVR A;  2FE8 A;  2WDQ B;  4XDD A;  5AEK B;  4WJQ A;  2K3U A;  2LGD A;  2NR2 A;  4XC2 A;  3ZRF A;  1Z2M A;  1MVK A;  2UWQ A;  4BKG A;  3DBL B;  5TSS A;  5IO9 A;  4EEW A;  3AEG B;  1JQ4 A;  2VH1 A;  4KGS A;  2QMT A;  5HG2 A;  4XGA B;  2V4L A;  4BZA A;  2KDF B;  4YTP B;  3VHT C;  1UH6 A;  3QIJ A;  4KV2 A;  4LCD E;  2KXJ A;  1XQQ A;  1I4H A;  4WJP A;  1H8C A;  2N1V A;  2EEL A;  5JH5 C;  2ZPY A;  4IW0 A;  4OVZ A;  1HA5 A;  4A9A A;  1JWU D;  4NJ7 A;  3GOE A;  3DHG C;  4RMA A;  3APC A;  3B9J A;  5L95 C;  2ICI A;  3AN1 A;  3ZQ4 A;  1UGJ A;  3APD A;  4KIK B;  2IPK D;  1QLB B;  1KJT A;  2JY6 A;  1JAL A;  1F77 A;  3NZS A;  3V61 A;  5HFY A;  3MJ5 A;  1TIF A;  3NVW A;  3BII D;  3VXW A;  3V60 A;  2DZK A;  2LEK A;  3VUY A;  5D94 A;  1X1M A;  1RWS A;  2GRI A;  1STE A;  4KVG B;  1MFW A;  1YD8 U;  4XWW A;  2WLB A;  3AEF B;  1TZO A;  3GZN B;  1FFV A;  4F8C B;  1V80 A;  1KH0 A;  2BS2 B;  3M63 B;  5LNK 1;  5CHV C;  2FCS A;  3TIX A;  2KD0 A;  2IY0 B;  3ML9 A;  1FNV A;  3H7P A;  1L7Y A;  3NHE B;  4GU2 A;  1E8Z A;  2ZVO A;  1E7P B;  4OZB A;  4IWP A;  4NAW B;  2KKC A;  2J52 A;  3TEY A;  2K8C A;  1J7C A;  1CJE A;  2KJR A;  4HJG E;  4NNJ B;  4JE3 B;  3ZNZ B;  1IBX B;  2JU6 X;  3SDL C;  2IYD B;  4OZA A;  2KFK B;  3H1U A;  1NEK B;  3Q3N C;  2BWF A;  4P16 A;  2JYT A;  1BT0 A;  3H7S A;  1V81 A;  4WAA A;  2BS3 B;  4UDU C;  2VZK B;  2PW9 A;  5IKC M;  4MDK E;  2KFK A;  3MHZ A;  2J4X A;  1B9R A;  3RI7 C;  2BTE A;  2V4I B;  2V9H A;  3HVD A;  2IGG A;  1BUI C;  1F2R I; 
#chains in the Genus database with same CATH homology
 4I6N B;  2DHZ A;  3WIM A;  1AAR A;  2K39 A;  5IAA C;  2RPQ A;  4KDI C;  3VAW A;  2BKF A;  3A9J A;  2UYZ B;  2RD0 A;  4WQO B;  1G6J A;  1P1A A;  5BO4 B;  2MBQ A;  5KHO A;  3T9L A;  2EMS A;  4ZRI A;  5JHB A;  3PT2 B;  2PE6 B;  1UD7 A;  3PGE A;  4OVU A;  1KOT A;  4J6I A;  2KMA A;  2KN5 A;  2XK5 B;  4WWN A;  2LZ6 A;  2GBR A;  3DVG X;  2N1W A;  1LXD A;  1E8X A;  1U4A A;  5G2N A;  3T8M A;  2N7E A;  3PHX B;  5AZG A;  1V2Y A;  3NS8 A;  4KIK A;  3HK0 A;  2IO1 B;  1L2N A;  1RFA A;  4FLH A;  1WFY A;  2KMC A;  2CHW A;  1YX6 B;  1WZ0 A;  3AI5 A;  1EF5 A;  1WH3 A;  3M62 B;  2JF5 A;  3A1Q B;  3D32 A;  3UIN B;  1ZW7 A;  4NAW A;  2HD5 B;  2MBO A;  2NBU A;  2G4D B;  1LFD A;  1Q5W B;  2RSU A;  5TR5 A;  4FJV B;  3S2A A;  3WAM A;  3UQA A;  2HTH A;  4NQK E;  2LGX A;  3KUD B;  2L76 A;  1WX8 A;  3PZD A;  2ASQ A;  2KTF A;  4TKN A;  2KWV B;  4G0N B;  4CO7 A;  2N9P C;  2FIF A;  4GDK B;  2K1F A;  3L08 A;  1GNU A;  4LDT B;  2D10 A;  2FNJ B;  3CSF A;  5G55 A;  4JLC A;  4ZDV A;  3EHV A;  3HM3 A;  3EEC A;  3ZDT A;  1UZX B;  1SIF A;  3B0A A;  2QHO A;  1P9D U;  4G3X B;  2KC2 A;  4HPL B;  4MGI E;  2MA9 B;  2IY1 B;  2LVQ A;  4MM3 A;  4WWO A;  2EMT A;  1WMH B;  4GDK A;  4GGQ A;  2NBV B;  2ZNV B;  4E71 A;  1KM7 A;  1P98 A;  4W9D A;  3VUX A;  2ZPN A;  1WX9 A;  2AL6 A;  3B08 A;  4FBJ B;  3BY4 B;  4IM2 A;  3UQB A;  3N3K B;  3QX1 A;  3UIP B;  3RZF A;  3W1S A;  3ZNI D;  2ZZP B;  4W9E A;  4PYZ A;  4WJN A;  2O2V B;  3WAL A;  5L83 A;  2KWC A;  2KTR A;  3PLV A;  2MCN B;  5EDS A;  1LM8 B;  2L8J A;  1J19 A;  4G50 A;  4FHJ A;  3NOB A;  4K81 A;  4BBN F;  4MSQ B;  2G3Q B;  4IC7 B;  2KHW B;  2WWZ A;  3O65 B;  2BF8 B;  2LWP A;  2PPH A;  1ZKH A;  1IPG A;  2CS4 A;  2M1M A;  1UGM A;  2NS5 A;  3CMM B;  4KZ0 A;  2Z59 B;  4XZ4 A;  4FUL A;  4EFO A;  2BYV E;  2PE9 A;  1NDD A;  2N7D A;  2BYE A;  4HDQ A;  2DYO A;  3X0W A;  2BYF A;  1EO6 A;  1E8Y A;  4IWO A;  1RAX A;  2G4S A;  1VCB A;  1YIW A;  3IVF A;  5E6N A;  5C23 A;  3IBE A;  2AYO B;  2BKR B;  4HCP B;  1TZ1 A;  2LXA A;  4ZRJ A;  4IWQ A;  2L0F A;  1K8R B;  4JQW C;  4MGK E;  2AWT A;  3ZDM C;  4TQ1 A;  1A5R A;  3DVN V;  3DCG A;  4II2 B;  1GUA B;  2K6D B;  4EZK A;  3SU8 X;  1V5O A;  3ZTD A;  1S1Q B;  2JPH A;  3DDC B;  2KDB A;  2JZZ A;  2J0K A;  2V1Y A;  3VFK A;  2IO3 B;  3VQI A;  5JZE B;  2NVU I;  2KQ7 A;  4BBN C;  3UGB B;  4BKS D;  4W9J A;  3Q3F A;  4EZL A;  2B3A A;  3ZNH B;  5CHW A;  2NBW B;  2C7H A;  2MRP A;  1TTN A;  3JVZ X;  1WY8 A;  3NZU A;  3OAW A;  4MGZ E;  4DHZ B;  1WXV A;  3KUZ A;  4ICV A;  1YJ1 A;  2LAS A;  1WJN A;  1JRU A;  5CTR C;  1WJ6 A;  4FJZ A;  4K7S A;  1WRD B;  2KDE B;  2K25 A;  4P7I A;  2K8B A;  1M94 A;  1P3Q U;  2MWS B;  4FAD A;  1WF9 A;  5FR6 A;  1IYF A;  2WYQ A;  3A4S C;  4I6L B;  2WDT B;  4AJY B;  3AU4 A;  1KLV A;  3N30 A;  2CKH B;  3HM6 X;  4GIV A;  3DBH I;  5J17 A;  2KK8 A;  4KZC A;  3RD2 A;  3AU5 A;  3V6C B;  2R2Q A;  3JSV A;  2MLB A;  3RUL A;  1T0Y A;  2KFJ A;  4W9C A;  3M3J A;  1WM3 A;  3GZN I;  2JZ3 B;  3PHW B;  3K9O B;  2ZVN A;  4DXA B;  2GMI C;  1WXA A;  4ICU A;  1J8C A;  4EUT A;  2DEN B;  5DPS A;  1ISN A;  3PTF C;  4IM3 A;  4AWJ A;  2KQS A;  3VTU A;  2DAJ A;  2ZCB A;  3L10 B;  4GDL A;  1V49 A;  1MG8 A;  2G45 B;  3DBS A;  3HIZ A;  1UEL A;  4HK2 A;  4YL8 A;  5KHQ A;  1OGW A;  2FCM A;  3L0W B;  3VVW B;  3OJ3 A;  1XT9 B;  4IG7 B;  2M4N A;  1EUV B;  4II3 B;  4BOS C;  1WGH A;  5LXH A;  3QQ8 B;  2OJR A;  4W9F A;  3ZTC A;  4GOC A;  2GBK A;  2FCQ A;  4RM9 A;  3R66 C;  2LXC A;  4MJS A;  1OQY A;  2MBB B;  2NCN A;  3K9P B;  3DOW A;  2NPT A;  2A5U A;  4DWF A;  2FID A;  3QK0 A;  1WR6 E;  2JRI B;  4DK5 A;  4A20 A;  4B6W A;  1Z5S B;  4GB9 A;  2REX A;  1RRB A;  1EF1 A;  3ECI A;  1WE6 A;  3I3T B;  3KYC D;  3VH4 B;  4HLE A;  1E7V A;  4HPM B;  2MP2 A;  4WJO A;  4GN1 A;  3L17 A;  1WGD A;  4B9K A;  3PV1 A;  1Y8R C;  2C7M B;  2JXX A;  2L3Z A;  3V62 A;  2C7N B;  3X23 A;  2A4Z A;  2C5L C;  2M0X A;  3PSE B;  1WGR A;  3KW5 B;  2N4F A;  3KH0 A;  5LLI A;  2GBN A;  2LVP A;  3APF A;  4HVB A;  5CX3 A;  3JYU A;  2KLC A;  3WAO A;  2PEA A;  1V6E A;  1WZ3 A;  3W1S C;  4MEL A;  3DPD A;  3VTV A;  1FXT B;  1YQB A;  2K6Q A;  2MSE D;  2WX0 A;  4TV3 A;  1RLF A;  2I1K A;  1Q0W B;  3RUI B;  1V86 A;  1E8W A;  4KSK C;  4GMV A;  1OTR B;  3U7D A;  4BVU C;  4PYU A;  2C60 A;  4MH0 E;  2FCN A;  1VD2 A;  3A1Q A;  1CMX B;  2O6V D;  5D7G A;  5AZH A;  2C9W B;  2KX3 A;  4JGH B;  2DYM A;  4HXD A;  2ZNV C;  2IBI B;  1GG3 A;  2JVC A;  3HHM A;  3QCA A;  4G11 A;  3IHP C;  2CHZ A;  2JRH A;  3Q3J A;  2IO2 B;  3ENE A;  1XD3 B;  3CF6 E;  4MEM A;  1WJU A;  2LUE A;  1GJZ A;  4FN2 A;  1WM2 A;  2DAF A;  1WXM A;  4CHK A;  4RM8 A;  4EZJ A;  2D2Q A;  3L13 A;  3PS6 A;  2GOW A;  3TBL D;  2KLG A;  2LI5 A;  3CST A;  1WGY A;  2CU1 A;  4LJP B;  2RR9 A;  5E6O A;  5HKH A;  3L54 A;  3AUL A;  5DPT A;  3PPA A;  4MSM B;  4W9L A;  2MBH A;  4GSW A;  4HCN B;  5IA7 A;  4WWP A;  3L16 A;  2PJH A;  3QHT A;  3A4R A;  2ZEQ A;  2M8S A;  3IFW B;  1WJ4 A;  4JIO U;  2J0M A;  1C3T A;  1SGH A;  2DX5 B;  3RYT A;  3TMP B;  4BKS A;  4NJ6 A;  4DHJ B;  5DPW A;  4PS3 A;  3DVN U;  4GXB A;  4FA6 A;  3DQV A;  2DYB A;  2YLM A;  1WMH A;  2JUO A;  3QAQ A;  2VRR B;  2CHX A;  1QZE A;  4M8N A;  1YX5 B;  4MJS B;  2BGF A;  2R2O A;  2DZI A;  2L05 A;  3OJ4 B;  2KWU B;  2HJ8 A;  3WAN A;  4M0W B;  4NY0 A;  2IZV B;  3DVG Y;  4NPN A;  4DDI D;  5D6J B;  5CHF A;  3ZUN A;  1WR1 A;  3ZIM A;  1C1Y B;  3H9D A;  3H6N A;  3KYD D;  4A3P A;  2HE7 A;  2MP2 B;  2LD9 A;  3MJW A;  3R7R A;  3VH3 B;  3QC8 B;  3RZW C;  3UF8 A;  1WX7 A;  4OVV A;  4XX5 A;  3OLM D;  4LJO B;  1NI2 A;  1WI0 A;  3AXC A;  1R4M I;  4IUM B;  1E7U A;  2AL3 A;  2LGY A;  2BWE S;  4HDO A;  5AZF A;  2Z0D B;  3QJZ A;  2JWZ A;  3ALB A;  3ZNG C;  2D3G A;  2KVR A;  2W9N A;  1E5W A;  3PRP B;  2L7R A;  4IM0 A;  3EFU A;  3LJ3 A;  3ONS A;  1LQB A;  2GBJ A;  2KAN A;  2LRU A;  4WJQ A;  5AEK B;  4EKU A;  3P2B A;  2LGD A;  2NR2 A;  1TBE A;  2L0T A;  4XC2 A;  3ZKJ C;  3ZRF A;  1Z2M A;  4FHK A;  1I42 A;  3A9K B;  2UWQ A;  1UBQ A;  3ZW3 A;  4BKG A;  4EEW A;  5D2M B;  2CR5 A;  3MTN B;  3ML8 A;  3A33 B;  3DBR I;  3H7P B;  4AUQ C;  4PS8 A;  4ZRK A;  5C1Z A;  5DPR A;  4ANW A;  3V6E B;  4X57 B;  4K1R B;  2V4L A;  2KDF B;  4CYE A;  4I6P A;  3VHT C;  1UH6 A;  4DHJ D;  4BKT A;  3QIJ A;  3U30 A;  2FUH B;  2KJ6 A;  3A9K A;  5GMV A;  4KV2 A;  1Q1O A;  4F1S A;  1I35 A;  4LCD E;  2OOB B;  2YVC A;  3IG3 A;  3UIO B;  2N9E B;  2KXJ A;  4F7Z A;  1XQQ A;  2DZJ A;  2WX1 A;  3RCZ A;  1ZGU B;  4WJP A;  1H8C A;  3A9J B;  2D11 A;  3WAP A;  2N1V A;  5JH5 C;  2ZPY A;  2KC1 A;  3JSV B;  4IW0 A;  2IO0 B;  4NJ7 A;  3GOE A;  1J0G A;  4W9H A;  4RMA A;  2KX0 A;  2XBB C;  4PS7 A;  3APC A;  2XK5 A;  3PRZ A;  2ZJD A;  4AJW A;  5L95 C;  5J18 A;  4EOY A;  4K7W A;  4KDL B;  4K7U A;  2KO3 A;  3APD A;  3VDZ A;  3QWZ B;  4AP4 C;  2J0J A;  4KIK B;  4W9K A;  2Y5B B;  1KJT A;  2O6V A;  3W1Y A;  2DZM A;  2JY6 A;  3NZS A;  3V61 A;  4ANX A;  1HE8 A;  2D07 B;  5DCN A;  2KZR A;  1OEY A;  2L00 B;  3BIN A;  3JW0 X;  3VXW A;  2I1J A;  3M95 A;  3V60 A;  4FJY A;  2KNB A;  5J2R A;  2DZK A;  2V3S A;  2KDI A;  4MGY E;  3ZVV A;  3VUY A;  4ANU A;  4N9F 4;  3TL5 A;  5D94 A;  1X1M A;  4LDT D;  1WYW B;  2MQJ A;  2J7Q B;  2NPT B;  4TUU A;  2MBE A;  4NQL B;  4KVG B;  4AOF A;  1YD8 U;  2ZCC A;  4ZYN A;  4ASW C;  2LVO A;  2MW5 A;  4BFR A;  4JL9 A;  2EKE C;  3U8Z A;  1V9J A;  3RT3 B;  4F8C B;  3VUW A;  1PQS A;  1V80 A;  3PLU A;  4A3O A;  3KVF B;  3M63 B;  2M17 A;  3WA0 A;  5CHV C;  2FCS A;  1TGZ B;  3PRM B;  3ZO5 B;  3ZRC A;  3TIX A;  2KD0 A;  2IY0 B;  4URK A;  2N9X A;  4DHZ E;  4HJK A;  3EC8 A;  4W9I A;  1SE9 A;  3DBL I;  3ML9 A;  3H7P A;  1L7Y A;  3NHE B;  4GU2 A;  4W9G A;  1E8Z A;  4ANV A;  2ZVO A;  1UBI A;  3NY5 A;  2KKC A;  4IWP A;  4NAW B;  2K8C A;  2KOX A;  3KUC B;  2FAZ A;  2KJR A;  2Z0E B;  4NNJ B;  3ZNZ B;  1R4N I;  2BPS A;  1WGG A;  3QA8 A;  3SDL C;  2IYD B;  2KFK B;  3TJP A;  3H1U A;  3R3M A;  3TCA A;  1E90 A;  2KJH B;  4B95 A;  4BOZ B;  1D3Z A;  2BWF A;  4GDL B;  1IP9 A;  5E6P A;  4HWI B;  4E3C A;  3MHS D;  1BT0 A;  1OEY J;  1WE7 A;  2LRW A;  3PVL A;  3ZLZ A;  1P0R A;  2AEH A;  3B1L X;  3LDZ E;  3R7Q A;  1S3S G;  3H7S A;  1V81 A;  4TQ0 A;  1NBF C;  4DBG A;  3SHQ A;  4WAA A;  4E74 A;  1GC7 A;  4KSL C;  5LXI B;  2JT4 B;  3VTW A;  3C0R B;  4MDK E;  2KFK A;  3PRE A;  1V5T A;  2LJ5 A;  1F9J A;  1WIA A;  4DDG D;  1WXS A;  1GC6 A;  3N32 A;  2K8H A;  5JHA A;  2GBM A;  4M8M A;  2RGF A;  2MX2 A;  2O6V B;  3SD5 A;  2XEW A;  2KTR B;  1H4R A;  2O2V A;  3QAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...