3DDCB

Crystal structure of nore1a in complex with ras
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
133
Chain Sequence
PPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPSFYLPLDAIKQMHISSTTTVSEVIQGLLDKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTPase HRas
publication title Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/apoptosis
total genus 28
structure length 133
sequence length 158
ec nomenclature
pdb deposition date 2008-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ddcB00
1H8CA 1YIWA 2A4ZA 2B3AA 1Q0WB 3DVGX 2FUHB 2GBRA 3W1SA 3QA8A 4MJSB 1T0YA 3K9PB 4MSQB 1WGGA 1Z2MA 2EKEC 1V81A 2R2OA 3QCAA 4GDKA 4B95A 3RYTA 1UBQA 1EO6A 3PGEA 4DWFA 1WXVA 1OEYJ 2CHWA 3U30A 2L3ZA 4EUTA 3UF8A 3JSVB 4JL9A 2ZPNA 5D2MB 4K81A 5KHOA 5J17A 1TBEA 2ZVNA 4JIOU 1E7VA 3PLVA 2FCSA 5E6PA 4HDOA 2NPTB 3CMMB 4IUMB 2BGFA 4W9DA 1GC6A 3KYCD 2KD0A 4J6IA 3APFA 3DVGY 2OJRA 3EFUA 1C1YB 4K1RB 3U8ZA 2LUEA 4MELA 5D6JB 2KHWB 2PEAA 2XK5A 2WYQA 5D94A 4HCPB 2FCMA 2J0JA 2DYMA 1P98A 4TQ1A 4W9LA 2KXJA 2GBNA 3NOBA 1E7UA 2FNJB 4IM3A 5D7GA 1NBFC 3R7QA 4URKA 4G50A 4FHJA 2KMCA 4II2B 3D32A 2NBUA 2BKRB 2JZZA 2GBMA 5LXHA 3ENEA 1QZEA 4W9KA 3RD2A 4KZ0A 5DCNA 2PE6B 3WIMA 1WXMA 4LJPB 2IBIB 4A20A 4KDLB 4AUQC 4DHJB 2GBJA 2KZRA 3QHTA 2GOWA 3IBEA 3TL5A 2AEHA 3HK0A 2OOBB 2L05A 3L13A 3APDA 2PJHA 3IFWB 3L10B 2NS5A 2LGXA 4IWOA 2Y5BB 2LGYA 2KOXA 3M95A 4IW0A 3VTVA 3DBHI 2XK5B 2JXXA 2N7EA 3SD5A 2KJRA 4KDIC 5FR6A 3H6NA 2ASQA 2XBBC 4IWPA 2M8SA 2MBOA 3QIJA 3V62A 4GGQA 3ZKJC 4BBNC 1WX7A 2BWES 3SHQA 4TQ0A 3A9JA 1M94A 2KJHB 3ML8A 2HTHA 4EEWA 3PREA 4M0WB 3IVFA 2CU1A 2I1KA 1UGMA 2K6QA 2EMSA 2L76A 4XX5A 4DDID 1WGDA 4JQWC 2M0XA 4B9KA 2KFKA 2UYZB 1UELA 3H7PA 2C60A 2EMTA 1KM7A 1WX9A 3TIXA 4ZRIA 2CR5A 4I6LB 4XC2A 3W1YA 2NBWB 3VH4B 3EECA 3ZLZA 2IY0B 2LXAA 3OJ3A 1LXDA 2V4LA 3M3JA 4GB9A 4WJNA 3VQIA 1U4AA 4CO7A 4WJOA 4BKTA 4DXAB 1WMHA 1GNUA 3JVZX 2MSED 2CHXA 3H1UA 3HHMA 4MGIE 4LDTB 3B08A 4YL8A 4NQLB 2L0FA 3HIZA 2LRUA 2J0KA 2K6DB 3OAWA 4MJSA 2JPHA 2K8HA 2KVRA 3PHWB 1WXSA 3PTFC 1JRUA 2JVCA 3VXWA 3KUZA 1WYWB 2N9XA 1OTRB 2KFJA 4W9GA 4MDKE 2BYVE 2KK8A 5G2NA 2KFKB 1YQBA 3BINA 1WZ0A 5G55A 1WXAA 2V3SA 3QARA 4FBJB 2Z0EB 3Q3JA 4HWIB 1KOTA 4MGZE 4NJ7A 1SE9A 2KX0A 2NCNA 3VTUA 3ZDTA 3A33B 1WF9A 4WAAA 1V49A 2O2VB 4II3B 2W9NA 1V80A 3NS8A 5TR5A 4WWNA 2C9WB 2BF8B 2G4DB 3PPAA 3V61A 2FCQA 2C5LC 2MW5A 3KVFB 1KJTA 4EZKA 1ZW7A 2KO3A 4KV2A 3PZDA 3PVLA 4F8CB 1WX8A 5CTRC 4DBGA 2WX1A 2ZEQA 4AOFA 2MP2A 4DK5A 4A3OA 4GXBA 2DAFA 3L0WB 1RFAA 3WAPA 1ISNA 4IM2A 2JRIB 4I6NB 1H4RA 3DBSA 1RLFA 4EZLA 1L2NA 1D3ZA 4NNJB 3JYUA 4K7WA 3K9OB 2GBKA 2KDEB 4M8NA 3RUIB 1EF5A 2N7DA 4BOSC 3B0AA 4MH0E 1J0GA 2KDBA 3A9KA 4P7IA 2LGDA 3SDLC 2I1JA 4CYEA 4OVVA 2K8CA 4AWJA 5J2RA 2MCNB 2DZJA 4BBNF 1F9JA 2BWFA 3QX1A 3RZFA 3A4SC 4G0NB 2IO3B 2V1YA 1P0RA 1WE7A 2KNBA 2MRPA 2WDTB 3TJPA 2KKCA 2DENB 3S2AA 2ZZPB 1TGZB 3ZRFA 2K39A 2ZPYA 4TV3A 4BKSA 3DPDA 2KTRA 5JHAA 2MP2B 2DYOA 2G4SA 3O65B 2IY1B 2N1WA 4GU2A 1ZGUB 2WWZA 1P9DU 3LJ3A 1E8XA 3NZSA 3WA0A 3MTNB 1G6JA 3MJWA 2KTFA 2MBBB 3ECIA 1VD2A 3M62B 5GMVA 1P1AA 4N9F4 2JF5A 1WJ4A 1CMXB 2L7RA 3RT3B 1OQYA 3ONSA 5IAAC 1XQQA 1WI0A 3VH3B 3RCZA 3PHXB 2M1MA 5AEKB 1WH3A 3OLMD 4FA6A 3A9KB 3KH0A 3B1LX 3PS6A 4KZCA 3ZIMA 2KANA 2LD9A 3SU8X 4ASWC 4MGYE 1FXTB 3V6CB 3L16A 4KIKB 3VVWB 5L83A 3ZTDA 3KUDB 2RD0A 3ZUNA 3UGBB 1BT0A 2KN5A 4ZRKA 3ZNHB 4F1SA 5L95C 3UQBA 4NAWB 1HE8A 2KTRB 3RULA 1J8CA 4PS3A 4RM9A 1RAXA 1ZKHA 5JHBA 2KDFB 1R4MI 1E90A 1V2YA 3ZDMC 2O6VB 3R7RA 2HD5B 2NBVB 2PPHA 2R2QA 4A3PA 2DX5B 2K1FA 2MBHA 4HCNB 5BO4B 3QK0A 3CF6E 3DBRI 1C3TA 2MWSB 1K8RB 5LLIA 4WWPA 2FIFA 4B6WA 3EHVA 3AI5A 4DHJD 4GMVA 4HPMB 4NQKE 2AL3A 4EKUA 2UWQA 3V60A 3ZW3A 3APCA 3VAWA 4BFRA 3N32A 1MG8A 4GSWA 4JGHB 2O2VA 2XEWA 5CHWA 1XD3B 2D3GA 4GDLB 1WJ6A 1GUAB 2PE9A 4BOZB 4HVBA 4AP4C 2KWUB 1LFDA 2BKFA 3A1QB 4FULA 2WX0A 2YLMA 3H7SA 1IYFA 2LZ6A 2MLBA 3DCGA 5E6NA 1NI2A 1WM3A 4NY0A 4WJPA 5JH5C 1RRBA 3N3KB 2D07B 5E6OA 1S3SG 4ZDVA 1A5RA 3TCAA 5J18A 1UZXB 4K7UA 3CSFA 2FCNA 4W9IA 1SGHA 1YD8U 4IM0A 1UD7A 4CHKA 2MBQA 2YVCA 4W9FA 3ZRCA 2DYBA 3NHEB 3U7DA 2MX2A 4WQOB 3DOWA 4KVGB 2G45B 4HDQA 3P2BA 4MSMB 2CS4A 4NJ6A 2MQJA 1X1MA 2A5UA 1WGYA 2LVPA 3OJ4B 4W9HA 2D11A 2MA9B 3X23A 3AU4A 2DAJA 2VRRB 3KUCB 1E5WA 2NR2A 1AARA 3DVNV 2JZ3B 3AXCA 3BY4B 4MGKE 4FLHA 2KLGA 1WY8A 4ANVA 2JT4B 4DHZB 2LJ5A 5CHVC 3VUWA 3KYDD 5C1ZA 2CHZA 3GZNI 4LDTD 5DPTA 3ALBA 4HPLB 5CX3A 2IYDB 2BPSA 5KHQA 1XT9B 4PS8A 3ZNGC 3PRPB 3DVNU 3CSTA 4KSKC 4E71A 1YX5B 2FAZA 2KLCA 1YJ1A 1WE6A 4K7SA 2K25A 2LVQA 2M17A 2ZCCA 3PRMB 4ANXA 2ZNVC 3VTWA 5HKHA 2KWVB 3DDCB 1I35A 3HM3A 2DZIA 4FJZA 4LCDE 3ZNZB 1E8YA 2BYEA 1GG3A 5AZFA 3PV1A 3A4RA 1WIAA 1IP9A 2KJ6A 2QHOA 3L08A 4KIKA 3R66C 4OVUA 1LM8B 1V5TA 3IHPC 4RM8A 2LASA 2KQSA 3QAQA 3UIOB 3IG3A 1J19A 4NAWA 1Y8RC 4DDGD 4EZJA 4GIVA 2LRWA 2L8JA 2O6VA 1SIFA 3NY5A 4M8MA 2LVOA 2RR9A 2KDIA 1KLVA 4FHKA 2D10A 1V9JA 1V6EA 4IG7B 4WWOA 3WANA 2Z59B 4LJOB 1WGRA 4MEMA 1WJUA 1WFYA 3L17A 1TTNA 5DPRA 4RMAA 5LXIB 1EUVB 5CHFA 3V6EB 3WALA 2ZVOA 4EFOA 2J0MA 3KW5B 4GDLA 2C7HA 4FADA 3PT2B 2ZJDA 3MHSD 4GDKB 1WRDB 2JY6A 2L0TA 3A1QA 1GJZA 3W1SC 3EC8A 4ZYNA 3Q3FA 3JW0X 3PLUA 2N1VA 1EF1A 1WZ3A 1L7YA 2LXCA 1OGWA 2Z0DB 4ANWA 1WR6E 4ANUA 2HE7A 3LDZE 1P3QU 1E8WA 2IO1B 4TUUA 3PSEB 1Z5SB 3VFKA 3NZUA 3WAMA 1NDDA 4E3CA 3WAOA 1E8ZA 3VDZA 3DQVA 4HK2A 3TMPB 2IO2B 1S1QB 2HJ8A 2JWZA 1WR1A 4BKGA 2MBEA 2K8BA 2N9EB 3DBLI 1GC7A 4I6PA 2FIDA 5DPWA 3QQ8B 2KMAA 2NVUI 4E74A 2IO0B 3AU5A 5EDSA 2AYOB 4PYZA 4HJKA 3UINB 3ZVVA 4HLEA 2LI5A 4ICVA 2KQ7A 3UIPB 4G3XB 2C7MB 4BKSD 1WGHA 2JUOA 2IZVB 4PYUA 4EOYA 4DHZE 1WJNA 4MM3A 3ML9A 5AZHA 1V5OA 3R3MA 1LQBA 2GMIC 5JZEB 2O6VD 4IC7B 3ZTCA 4X57B 3QJZA 4XZ4A 3M63B 1Q5WB 4W9CA 2J7QB 2CKHB 2M4NA 3ZNID 3VUXA 4WJQA 2RSUA 3PRZA 3ZO5B 5IA7A 4ZRJA 1Q1OA 2KC1A 1UH6A 4JLCA 1V86A 2DHZA 5C23A 4TKNA 2LWPA 5DPSA 1WM2A 2AWTA 4W9JA 3QWZB 1YX6B 3QC8B 4HXDA 3N30A 4AJYB 2ZCBA 3VHTC 1IPGA 2REXA 4FJYA 3T8MA 3A9JB 3H9DA 3T9LA 1OEYA 4KSLC 3GOEA 2KC2A 3C0RB 2AL6A 3VUYA 4FN2A 3JSVA 4GOCA 3AULA 3H7PB 4FJVB 3RZWC 3HM6X 2ZNVB 2C7NB 2N4FA 4GN1A 2L00B 2G3QB 3TBLD 1I42A 2KWCA 4IWQA 1VCBA 2DZKA 3L54A 2DZMA 2NPTA 5AZGA 4PS7A 2JRHA 1TZ1A 4BVUC 2BYFA 4ICUA 4W9EA 3UQAA 1PQSA 4G11A 4AJWA 1R4NI 3X0WA 2N9PC 1WMHB 2KX3A 2RGFA 2D2QA 4NPNA 3I3TB 2RPQA 4F7ZA 1UBIA
chains in the Genus database with same CATH superfamily
3W1SA 3QA8A 4HKZE 1WGGA 2EKEC 1V81A 1LGRA 2R2OA 4GDKA 4B95A 1ROEA 1WXVA 2L3ZA 4EUTA 5E6JA 3UF8A 5J17A 4JIOU 2KN4A 1E7VA 5E6PA 3AE7B 3U4EG 2LMCA 3KYCD 1PFDA 4J6IA 3APFA 2N9LA 2IPKD 4P6VF 1C1YB 4K1RB 2LUEA 2KHWB 2XK5A 2IDYA 2DYMA 4TQ1A 1XLOA 5TSSA 1E7UA 2FNJB 4IM3A 2JZPA 2QDFA 2WXJA 3VRBB 4II2B 2NBUA 1FCCC 1QZEA 5DCNA 4LJPB 4AUQC 2GBJA 2AEHA 5EE3A 2XN9C 2OOBB 1TS2A 3APDA 3IFWB 3L10B 2Y5BB 2LGYA 2KOXA 3M95A 4IW0A 2JXXA 2KJRA 3H6NA 3FKYA 4GGQA 3ZKJC 1E6EB 3IT4B 1C4PA 1XEEA 3A9JA 1JWUD 1HEZE 5C3JB 2HTHA 3BK2A 3BYTB 3IVFA 2CU1A 3ABVB 2L76A 4P16A 4JQWC 2KWDA 2KFKA 2UYZB 1K51A 2MJEA 2CR5A 4XC2A 3FILB 1KRHA 2IY0B 3OJ3A 1LXDA 2V4LA 4NZLB 3B2GA 4DXAB 3H1UA 3HHMA 4RGMA 4NQLB 4C56C 3Q2AC 1J7BA 2JPHA 1T6BX 1WXSA 4RH6A 1WYWB 2N9XA 4REZA 4W9GA 2BYVE 3VR8B 3NVYA 4XDCA 1N61A 2Z0EB 3Q3JA 4HWIB 4MGZE 2J53A 3T3NA 1P7FA 3VTUA 1ZOYB 1D4BA 4WAAA 1V49A 4II3B 4WWNA 4K3BA 3PPAA 2FCQA 2MW5A 2SAKA 1ZW7A 3O13A 1WX8A 4RGOS 5CTRC 4AOFA 2MP2A 1E10A 1CZPA 3DBRB 2ON8A 4LK0M 1ISNA 3P63A 4IM2A 4WQMA 3MC8A 3DBSA 4EZLA 4N59A 1L2NA 4NNJB 3MHZA 4KGSA 2GBKA 4BOSC 1EF5A 4QAYA 1AW7A 1FXIA 2KAJA 3EA6A 2MCNB 3V05A 3A4SC 4YTNB 2IO3B 3S2AA 2DENB 3NZ3A 2HJ1A 1EU4A 1DOXA 2K39A 2ZPYA 3DPDA 2KTRA 4A6QA 2DYOA 3P4PB 1EWCA 1UWXA 2WDQB 1RYJA 2BS3B 1E8XA 1G6JA 2KTFA 3ECIA 1VD2A 3J9CA 5GMVA 1WJ4A 1CMXB 2V9HA 3PHXB 1SE3A 4FA6A 2K5PA 3A9KB 3PS6A 1YMHE 3SU8X 4ASWC 1FXTB 2WXRA 3KUDB 2RD0A 3SR6A 3UGBB 3ZNHB 1EWYC 1KLGD 3BIID 1ZPSA 4A90A 4PS3A 1R4MI 4XWTA 3ZDMC 2O6VB 2HD5B 2LGSA 1OQRA 4A3PA 3CF6E 4R3DA 4B6WA 1MFWA 2V3PA 4ZRQA 4GMVA 1HXYD 2EKIA 3APCA 4BFRA 4JGHB 1TKGA 3ZQ4A 3I5JC 2WXPA 1SF0A 1GUAB 4HVBA 2K0PA 3Q6BA 2E3TA 2WX0A 1ZXIA 2MLBA 4BAXA 5E6NA 4NY0A 4WJPA 2J4XA 2B76B 1FMAD 1S3SG 3TCAA 4W9IA 1SGHA 1UD7A 4KKJA 2UU7A 3U7DA 2JYTA 3P2BA 1X1MA 1WGYA 2RPVA 2D11A 1MG4A 2DAJA 2BTEA 1YOVB 1E5WA 2NR2A 2WXIA 3DVNV 4MGKE 3TUOA 4ANVA 4DHZB 1D5MC 5C1ZA 2V3NA 4J3OD 3V3XA 1QT9A 4LDTD 2N9KA 3BWUD 4O1NA 1TS5A 3DVNU 3CSTA 2V4IB 2QIEB 1NENB 4K7SA 1V1PB 2LVQA 2M17A 2ZCCA 4ANXA 4XWWA 3VTWA 2I2YA 1F1HA 1IGCA 3DDCB 1ACCA 3HM3A 3ZNZB 2Y3AA 3PV1A 2BQQA 4XGAB 1IP9A 2M0AA 3L08A 2WDVB 1V5TA 3RNGC 1N6ZA 1VDVA 2O6VA 1NYRA 2LVOA 1T0QC 1V97A 2MEKA 1VJKA 4DXGA 2AQ3B 3WCQA 2H89B 4WWOA 3WANA 1WJUA 3L17A 4RMAA 2DWQA 1VLBA 4EFOA 2J0MA 3Q8BA 1E0ZA 3LB8C 2VZKD 2MHJA 2L0TA 2JY6A 2WXHA 3P4RB 1EU3A 2INDC 2MJDA 5GXGB 2LXCA 1L7YA 1WR6E 2HE7A 4CQNA 1P3QU 1J7CA 5IN7A 5T8IA 3VDZA 2N9EB 2K8BA 3DBLI 2WS3B 1ET6A 1GC7A 4I6PA 3T3OA 5DPWA 3AE3B 4WH4A 2WU2B 1KH0A 3AEGB 1SJED 3AU5A 4JWUC 2X38A 4HEA1 4BKSD 2IZVB 4DHZE 3KQ4A 3ZTCA 3QJZA 2WXFA 1HZ6A 3ZNID 2LFIA 2HDEA 3PRZA 1CK1A 1V1PA 1UH6A 4KGTA 1SE2A 4TKNA 3MFGA 2AWTA 4W9JA 1YX6B 2RMMA 3VHTC 5IP4D 1SSNA 3T9LA 4KKIA 4KSLC 3GOEA 2BS2B 2KC2A 3C0RB 2AL6A 4FN2A 3SFDB 3AULA 2BW2A 3H7PB 3IXSA 2C7NB 2IGHA 2L00B 2KWCA 3N1ZC 4IWQA 1FCLA 5HG2A 1VCBA 1TZOA 2JRHA 3RNFC 4OZBA 3GE3C 3FAHA 3UQAA 4AJWA 1R4NI 3HVDA 1UBIA 1HA5A 1H8CA 2A4ZA 2B3AA 1Q0WB 1FD6A 2GBRA 4MJSB 1T0YA 3K9PB 1Z2MA 2NTSA 3QCAA 1EO6A 2CHWA 3U30A 2INPE 3JSVB 1YQ3B 4JL9A 3BYYB 5KHOA 3RI7C 1TBEA 3Q8EA 1DYQA 2GRIA 4HDOA 2NPTB 1GC6A 3DVGY 3U8ZA 5D94A 1FRDA 2GB1A 1TY0A 2KXJA 1STEA 1FFVA 3R7QA 1NBFC 4URKA 2DNFA 3IT6B 1C76A 2BKRB 5LXHA 1RWSA 4KZ0A 4AS1A 3TSSA 2FBWB 3WIMA 4PK1A 2IBIB 2WXKA 4KDLB 3IBEA 5HHDG 3N20C 4KGRA 1MPEA 1TY2A 2NS5A 1JWMD 2L83A 2XK5B 2N7EA 3SD5A 1UNSA 3GE8C 2ASQA 3V62A 5HI1A 1M94A 2KJHB 3ML8A 4EEWA 4LNKA 4DDID 1WGDA 1ZUD2 3H7PA 2C60A 2EMTA 3MJ5A 4ZRIA 2KVZA 4ZHOA 3ZLZA 3NVVA 4GB9A 1ZDVA 4WJNA 2OJWA 1D6EC 5AUKA 5BMHA 1D5ZC 1SBBB 3JVZX 4HPPA 1R7SA 2D3BA 2N0SB 3HIZA 2MJ3A 4MJSA 1FIQA 3PZ8A 1IGDA 1JRUA 3KUZA 2PVOD 1OTRB 2KFJA 2DBYA 2KK8A 3OG5A 2KFKB 1YQBA 3BINA 2V3SA 4FBJB 3U52E 4YTPB 3RN9C 2KX0A 2NCNA 1JCKB 3ZDTA 3A33B 1WF9A 4L1BA 5BYQA 2L1AA 3PZDA 3PVLA 4F8CB 2YEPB 4DBGA 4DK5A 2JX5A 4A3OA 3L0WB 2GLSA 1RLFA 4M8NA 3B0AA 1XCTL 4AWJA 2DZJA 4BBNF 1F9JA 3RZFA 4G0NB 2KKCA 2ZZPB 2MH7A 2KQ4X 2MP2B 3O65B 1DOIA 2N1WA 4IDIA 1ZGUB 1ZP0B 3P1MA 3M62B 1P1AA 2L7RA 1OQYA 3VH3B 3RCZA 2M1MA 5AEKB 3B1LX 4KZCA 3ZIMA 1V1OA 4MGYE 1TKEA 5JXVA 3ETRA 5L95C 3UQBA 1DOYA 1DGJA 1HE8A 2KTRB 1J8CA 4RM9A 4H2AA 5JHBA 2M19A 1VZ6A 5IO9A 1TS3A 2R2QA 2K1FA 2MBHA 4L2YA 3W5UB 4JPSA 1C3TA 1K8RB 5LLIA 3AB5A 3AI5A 1MHHE 3PO0A 4HPMB 4EKUA 1QOBA 4EE2A 1MG8A 1F2RI 5CHWA 3KLSX 2NTTA 3AECB 4AP4C 3HRDD 3H7SA 1I4GA 2BT6A 2YLMA 4IOIE 3AEDB 1NI2A 5H92C 5J18A 4IM0A 4CHKA 2DYBA 2MX2A 2ICIA 4HDQA 3ZYYX 4NJ6A 2LVPA 3OJ4B 4OW0A 3X23A 2VRRB 3KUCB 2G9HD 1MI0A 1AARA 3BY4B 5H8YE 5CHVC 1L4DB 4LLGM 1GB1A 4HPLB 2IYDB 3AEEB 1XT9B 1BMLC 2FAZA 2KLCA 1N5WA 3GP7A 2IGGA 3P4SB 3ZXRA 2KDMA 2RDGA 1YN5A 1JWSD 4PT5A 3BZDB 1JQ4A 1FPYA 4OVUA 2AQ2B 4RM8A 2KQSA 1FNVA 3QAQA 1J19A 1L6UA 1UUPA 2AX5A 4DDGD 4GIVA 3GB1A 1SIFA 1L5PA 4M8MA 3P42A 2KDIA 4FHKA 2D10A 2TSSA 1WGRA 1OFFA 4ARCA 5DPRA 1C9FA 5BMGA 5LXIB 1EUVB 2ZVOA 3NG0A 2C7HA 1I4HA 2ZJDA 3MHSD 1GJZA 2PLPA 3EC8A 3Q3FA 3JW0X 3PLUA 4YT0B 1WZ3A 1OGWA 3LDZE 2IO1B 4TUUA 4WWMA 3W9CB 3WAMA 4E3CA 1TIFA 3WAOA 1ESFA 4LTUA 1YNTE 3Q3OC 2JWZA 2QJLA 5AUIA 2LHEA 2FIDA 2KMAA 3MC9A 4E74A 4PYZA 4HLEA 4HJKA 3UINB 1GOZA 4GLSC 2JUOA 4EOYA 3ML9A 5AZHA 1LQBA 2O6VD 4IC7B 1B9RA 4K3CA 4OZAA 2JXTA 3M63B 4W9CA 3VUXA 4WJQA 2CU3A 1ET9A 4OVZA 5C23A 3PZ7A 4MACA 3QC8B 4HXDA 2REXA 3H9DA 1ZDXA 1VRAB 4ARIA 3VUYA 3RZWC 3HM6X 4A9AA 4GN1A 3TBLD 1MHXA 1PGBA 1I42A 2DZMA 2OHFA 5AZGA 4PS7A 1RM6C 1TZ1A 1TYGB 4M02A 4ICUA 4W9EA 1AYFA 4RNAA 2PW9A 4MT5A 2N9PC 1K52A 1FXAA 2RGFA 4NPNA 2PMVA 3I3TB 2RPQA 1YIWA 1PGAA 3DVGX 4M00A 4RF1A 1QILA 4TSSA 1QLBB 1WXQA 1QOAA 3ZGZA 1UBQA 4DWFA 1GAQB 2ZVNA 3PLVA 2K3UA 3DHGC 5BMIA 2K9XA 4B0MA 4W9DA 2FUG1 2KD0A 3RNEC 4MELA 1L0XB 4HCPB 2FCMA 2J0JA 3TEYA 1YQ4B 1TT5B 3NOBA 1HQRD 1N60A 5D7GA 3DHIC 4FHJA 2KMCA 3CIRB 2BVCA 3B9JA 2JZZA 4BZAA 2M56B 2GBMA 2VH2A 1HTOA 4W9KA 3RD2A 2PE6B 5D3IB 1WXMA 4A20A 4LNNA 2WNMA 4DHJB 4Q2JA 3TL5A 2WLBA 2L05A 2JWUA 3E56A 2LGXA 3VRAB 4KDIC 2XBBC 4IWPA 2M8SA 2MBOA 4US9A 1OQQA 1WX7A 2G1EA 3SHQA 4TQ0A 5C2TB 4M0WB 2I1KA 2KT7A 1UGMA 2K6QA 2EMSA 2M0XA 2FE8A 3CWIA 4B9KA 1SB3C 1KM7A 4I6LB 4P1CC 3W1YA 2LXAA 3E9SA 3M3JA 2PIAA 4CO7A 5BYRA 1MVKA 1I4PA 2W3SA 2CHXA 4MGIE 3TEXA 4YTMB 3R2IA 3B08A 4N6EB 2LRUA 1XCQL 2J0KA 3OAWA 2BYTA 3PHWB 3EUB2 4MDKE 2WXNA 1AN8A 3QARA 4NJ7A 2LUMA 3AE6B 5LNK1 2W9NA 2G4DB 2C5LC 1KJTA 4EZKA 2KO3A 2WHIA 1L4ZB 2WX1A 2ZEQA 1Y56A 2GI9A 2DAFA 1TS4A 4ZRPA 2W54A 2JRIB 4I6NB 1H4RA 1D3ZA 3JYUA 4C7ZA 3K9OB 2J42A 1I4XA 2KDEB 1IUEA 4MH0E 3SDLC 3R2TA 1XLQA 1F2RC 4OVVA 1P0RA 1WE7A 4TV3A 4BKSA 4WURA 2G4SA 4GU2A 1YJIA 1P9DU 3LJ3A 1IBXA 3NZSA 3WA0A 2EELA 3EGRA 4M0WA 4N9F4 2JF5A 3ONSA 5IAAC 1WI0A 2JYEA 1WH3A 3OLMD 1GB4A 3KH0A 1J7AA 2KANA 2LD9A 1XF5L 3SEBA 3L16A 4KIKB 5L83A 1FNWA 3ZUNA 4C80A 1BT0A 4ZRKA 4NAWB 1L0VB 1FRRA 1E90A 2LJIA 4D2KA 1PYWD 5IOIA 2PPHA 1QOGA 2VH1A 5BO4B 2MWSB 4US8A 2IJ0A 4NQKE 2AL3A 2UWQA 1SIJA 3V60A 3ZW3A 3N32A 1Q10A 2XEWA 3EFCA 1E9MA 1WJ6A 5MPOA 1K53A 2PE9A 1I7HA 2KWUB 3A1QB 4FULA 1IYFA 1I4RA 2LZ6A 1I4QA 2HTME 3P4QB 3KWVA 2KACA 1ENFA 1RRBA 1SE4A 2D07B 5E6OA 1JALA 3GS2A 4ZDVA 1A5RA 2J52A 1UZXB 3CSFA 2FCNA 1YD8U 3DWMA 2MBQA 2YVCA 2W82A 2G45B 2CS4A 3IAS1 3IAM1 2MA9B 2QCZA 3AU4A 4ZHPA 2I38A 1R4MB 3AXCA 3AH7A 2XNAC 3DHHC 2ZW0A 2CHZA 2WXQA 3GZNI 5DPTA 1B1ZA 5CX3A 5KHQA 4PS8A 1VZ7A 3H8HA 3PRPB 4KSKC 4E71A 1HTQA 1WE6A 2KMMA 2K25A 4USAA 3PRMB 2ZNVC 3KWLA 3B2FA 5HKHA 1F0ZA 4FJZA 1E8YA 1GG3A 4RCOA 1WIAA 4KIKA 2WXOA 3IHPC 2LASA 4ZOHC 4NAWA 1WGKA 2BB6A 2L32A 2LRWA 2L8JA 1JWAD 3MC0B 1V8CA 2OEDA 2PVGC 4KX6B 3RMKC 2RR9A 4S0RA 1JWBD 3BVZA 1KLVA 1V6EA 4IG7B 1PDXA 2Z59B 3URYA 4LJOB 2D5GA 3L4PA 4WAFA 1WFYA 3C19A 5FR3A 4JX1C 2AQ1B 5CHFA 3V6EB 4FADA 3PT2B 1WRDB 3A1QA 3AEAB 1EF1A 4ANWA 2Z0DB 4ANUA 1D5XC 4LNIA 3TEZA 4JWSC 2D3AA 3PSEB 3VFKA 1YJJA 4M01A 4HK2A 3HUIA 2HJ8A 4BKGA 4NAMA 3LYYA 3QQ8B 1C4AA 2NVUI 3ZVVA 4G3XB 2C7MB 1WGHA 2WXMA 2V0GA 1GPXA 1JMLA 1WJNA 3NRZA 4MM3A 2GMIC 5EE9A 5JZEB 4XZ4A 2CJNA 3Q8AA 2J7QB 2CKHB 2M4NA 2RSUA 3ZO5B 5IA7A 4RF0A 4JLCA 1E7PB 2DHZA 3FC4A 3AN1A 2ZW1A 4AQ7A 1P7EA 1IPGA 4FJYA 4HROA 1C79A 3Q8FA 4S17A 2H88B 3AEFB 2W3RA 4FJVB 2N4FA 3BVMA 1YN3A 1KLUD 3Q3MC 4YSXB 3DBLB 2DZKA 3MP9A 3N9YC 2BYFA 1PQSA 4G11A 4ACFA 3X0WA 2L52A 1WMHB 2KX3A 1KTKA 4F7ZA 4OHJA 1N63A 5G5GA 2FUHB 3SFEB 4MSQB 2NMQA 3RYTA 3PGEA 3ZJVA 3DWGC 4DQOC 1OEYJ 1MJDA 2ZPNA 5D2MB 4K81A 3RFZB 2FCSA 1PGXA 1XLPA 1TKYA 4WIPA 3CMMB 4IUMB 1A70A 2BGFA 5BYSA 1HZ5A 2OJRA 1C4CA 3EFUA 5D6JB 2PEAA 2WYQA 2WQYB 1P98A 1BXTA 1T0SC 4W9LA 2GBNA 3RNBC 1WWTA 2WXLA 2QEJC 5G5HA 1SXTA 4G50A 3D32A 3ENEA 2BBCA 1TJEA 1NVID 4TMAB 2KZRA 3QHTA 2GOWA 1R4NB 3AV8A 3FILA 3HK0A 3L13A 2RDHA 2PJHA 2BB5A 4IWOA 1UWMA 3VTVA 3DBHI 5FR6A 1T5XD 3QIJA 4BBNC 2BWES 1KFYB 2PTLA 1JROA 3PREA 2WGSA 1NEKB 4A55A 4XX5A 3U7ZA 1UELA 3Q8CA 1WX9A 3TIXA 2KYWA 2Q5WD 2NBWB 3VH4B 3EECA 4L23A 2X8XX 5FK9C 3VQIA 1U4AA 4WJOA 4BKTA 1CJEA 3BK1A 1WMHA 4LNOA 1GNUA 3BVGA 2MSED 3AE4B 3NS1A 4LDTB 4JE3B 5FKAC 4YL8A 2L0FA 2K6DB 1SJHD 2K8HA 2KVRA 3I63C 3PTFC 2JVCA 3VXWA 4IKGA 2K22A 5G2NA 3ZXVA 1WZ0A 5G55A 1VZ8A 1WXAA 1K50A 1KOTA 1FM0D 1SE9A 2O2VB 3NS8A 1V80A 5TR5A 2C9WB 2BF8B 2DLBA 3V61A 3KVFB 1FO4A 4KV2A 2INNE 4GXBA 1JRPA 5IKCM 1RFAA 2ACZB 3C8YA 3WAPA 4K7WA 3RUIB 2N7DA 1L6VA 1J0GA 2KDBA 3A9KA 1FFUA 4P7IA 2LGDA 2I1JA 4CYEA 2K8CA 5J2RA 2BWFA 3QX1A 1M4VA 2V1YA 2KNBA 2MRPA 2WDTB 3TJPA 3UI3A 3AE2B 2Z8LA 2PKOA 4ITKA 1TGZB 3ZRFA 2JSVX 5JHAA 2VZKB 3I9V1 2IY1B 5I4DA 2WWZA 1AWDA 4YWGG 2E6XA 4LNFA 3MTNB 3MJWA 2MBBB 3RT3B 3RNCC 1N62A 1XQQA 3OWEB 4XE0A 3AE5B 3GZNB 3V6CB 3AMZA 3VVWB 3ZTDA 3AEBB 2KN5A 4F1SA 4YSZB 4MH8A 3RULA 1RAXA 1ZKHA 4RGTA 2KDFB 1QKZA 2WXGA 1IBXB 1V2YA 3R7RA 2NBVB 2R61A 2W55A 2WDRB 2DX5B 4HCNB 3QK0A 3DBRI 3U2SC 4NJCA 3NVWA 4WWPA 2FIFA 3NVZA 1BUIC 1WRIA 3EHVA 4DHJD 4XDDA 3VAWA 4GSWA 2O2VA 4C4VB 3I57A 1XD3B 2D3GA 4GDLB 4XYCA 2YEPF 4BOZB 1LFDA 2BKFA 1UF0A 3DCGA 1WM3A 3ZJUA 5JH5C 3N3KB 1N5XA 4K7UA 3Q69A 4DXFA 1L0YB 1F77A 4W9FA 3ZRCA 4RGNA 1XXGA 3NHEB 4WQOB 3DOWA 4KVGB 4MSMB 4OZCA 1T3QA 4B0EA 2MQJA 2A5UA 4W9HA 3LXFA 5HFYA 1F52A 1EM7A 1VR9A 4HRSA 1FEHA 1NYQA 2JZ3B 4FLHA 2KLGA 1WY8A 2JT4B 2LJ5A 1T0RC 2N7JA 3VUWA 3KYDD 1NI3A 3ALBA 2BPSA 2LHDA 2QMTA 3ZNGC 3NUHB 1YN4A 1YX5B 3TEWA 2LEKA 1YJ1A 2KWVB 3ZJTA 1I35A 2DZIA 1UGJA 4LCDE 2BYEA 2QSDA 5AZFA 4HKQA 3A4RA 3VR9B 2KJ6A 2QHOA 3R66C 1QOFA 4YXDB 1LM8B 3AE9B 3UIOB 3IG3A 2QC8A 3Q3NC 1Y8RC 4EZJA 3NY5A 1RFKA 2BS4B 2D3CA 1ZE3D 4YSYB 3W2DA 1V9JA 4C00A 2Y5PA 2LGIA 4MEMA 1TTNA 4C4VA 3WALA 3RNAC 3KW5B 4GDLA 4GDKB 2JU6X 2Y5CA 2RDBC 1QQRA 3W1SC 1XLNA 4ZYNA 2N1VA 2IGDA 1E8WA 1Z5SB 5EE1A 3NZUA 3AE8B 1NDDA 1E8ZA 3DQVA 1ZXHA 3TMPB 2IO2B 1S1QB 2JQRB 3N1YC 3RPFC 1WR1A 2MBEA 2IO0B 3N1XC 1WYGA 5EDSA 2AYOB 2LI5A 4ICVA 2KQ7A 3UIPB 2INCC 2SEBD 4PYUA 1C77A 1V5OA 3R3MA 1WSPA 4X57B 3Q14C 1JW9D 1C78A 1Q5WB 2WU5B 4ZRJA 1Q1OA 2KC1A 1V86A 2QILA 4FXCA 2LWPA 5DPSA 1WM2A 3QWZB 1QF6A 1CQVA 3N30A 5EE0A 4AJYB 4ZYSA 2ZCBA 3AE1B 4C7YA 3T8MA 3W5VB 3A9JB 1XO3A 1OEYA 4N58A 4MM3B 4UDUC 3JSVA 4GOCA 2ZNVB 5D3DA 4P1BC 2G3QB 1KF6B 3DBHB 3AM9A 2WP9B 1FNUA 1PUTA 3L54A 2NPTA 4HJGE 1SEBD 3HVZA 4A8XC 4BVUC 2CJOA 2ONQA 4RFBA 3R8BA 2D2QA 1LO5D 3NJTA
chains in the Genus database with same CATH topology
1H8CA 1YIWA 2A4ZA 2B3AA 1Q0WB 3DVGX 2FUHB 2GBRA 3W1SA 3QA8A 4MJSB 1T0YA 3K9PB 4MSQB 1WGGA 1Z2MA 2EKEC 1V81A 2R2OA 3QCAA 4GDKA 4B95A 3RYTA 1UBQA 1EO6A 3PGEA 4DWFA 1WXVA 1OEYJ 2CHWA 3U30A 2L3ZA 4EUTA 3UF8A 3JSVB 4JL9A 2ZPNA 5D2MB 4K81A 5KHOA 5J17A 1TBEA 2ZVNA 4JIOU 1E7VA 3PLVA 2FCSA 5E6PA 4HDOA 2NPTB 3CMMB 4IUMB 2BGFA 4W9DA 1GC6A 3KYCD 2KD0A 4J6IA 3APFA 3DVGY 2OJRA 3EFUA 1C1YB 4K1RB 3U8ZA 2LUEA 4MELA 5D6JB 2KHWB 2PEAA 2XK5A 2WYQA 5D94A 4HCPB 2FCMA 2J0JA 2DYMA 1P98A 4TQ1A 4W9LA 2KXJA 2GBNA 3NOBA 1E7UA 2FNJB 4IM3A 5D7GA 1NBFC 3R7QA 4URKA 4G50A 4FHJA 2KMCA 4II2B 3D32A 2NBUA 2BKRB 2JZZA 2GBMA 5LXHA 3ENEA 1QZEA 4W9KA 3RD2A 4KZ0A 5DCNA 2PE6B 3WIMA 1WXMA 4LJPB 2IBIB 4A20A 4KDLB 4AUQC 4DHJB 2GBJA 2KZRA 3QHTA 2GOWA 3IBEA 3TL5A 2AEHA 3HK0A 2OOBB 2L05A 3L13A 3APDA 2PJHA 3IFWB 3L10B 2NS5A 2LGXA 4IWOA 2Y5BB 2LGYA 2KOXA 3M95A 4IW0A 3VTVA 3DBHI 2XK5B 2JXXA 2N7EA 3SD5A 2KJRA 4KDIC 5FR6A 3H6NA 2ASQA 2XBBC 4IWPA 2M8SA 2MBOA 3QIJA 3V62A 4GGQA 3ZKJC 4BBNC 1WX7A 2BWES 3SHQA 4TQ0A 3A9JA 1M94A 2KJHB 3ML8A 2HTHA 4EEWA 3PREA 4M0WB 3IVFA 2CU1A 2I1KA 1UGMA 2K6QA 2EMSA 2L76A 4XX5A 4DDID 1WGDA 4JQWC 2M0XA 4B9KA 2KFKA 2UYZB 1UELA 3H7PA 2C60A 2EMTA 1KM7A 1WX9A 3TIXA 4ZRIA 2CR5A 4I6LB 4XC2A 3W1YA 2NBWB 3VH4B 3EECA 3ZLZA 2IY0B 2LXAA 3OJ3A 1LXDA 2V4LA 3M3JA 4GB9A 4WJNA 3VQIA 1U4AA 4CO7A 4WJOA 4BKTA 4DXAB 1WMHA 1GNUA 3JVZX 2MSED 2CHXA 3H1UA 3HHMA 4MGIE 4LDTB 3B08A 4YL8A 4NQLB 2L0FA 3HIZA 2LRUA 2J0KA 2K6DB 3OAWA 4MJSA 2JPHA 2K8HA 2KVRA 3PHWB 1WXSA 3PTFC 1JRUA 2JVCA 3VXWA 3KUZA 1WYWB 2N9XA 1OTRB 2KFJA 4W9GA 4MDKE 2BYVE 2KK8A 5G2NA 2KFKB 1YQBA 3BINA 1WZ0A 5G55A 1WXAA 2V3SA 3QARA 4FBJB 2Z0EB 3Q3JA 4HWIB 1KOTA 4MGZE 4NJ7A 1SE9A 2KX0A 2NCNA 3VTUA 3ZDTA 3A33B 1WF9A 4WAAA 1V49A 2O2VB 4II3B 2W9NA 1V80A 3NS8A 5TR5A 4WWNA 2C9WB 2BF8B 2G4DB 3PPAA 3V61A 2FCQA 2C5LC 2MW5A 3KVFB 1KJTA 4EZKA 1ZW7A 2KO3A 4KV2A 3PZDA 3PVLA 4F8CB 1WX8A 5CTRC 4DBGA 2WX1A 2ZEQA 4AOFA 2MP2A 4DK5A 4A3OA 4GXBA 2DAFA 3L0WB 1RFAA 3WAPA 1ISNA 4IM2A 2JRIB 4I6NB 1H4RA 3DBSA 1RLFA 4EZLA 1L2NA 1D3ZA 4NNJB 3JYUA 4K7WA 3K9OB 2GBKA 2KDEB 4M8NA 3RUIB 1EF5A 2N7DA 4BOSC 3B0AA 4MH0E 1J0GA 2KDBA 3A9KA 4P7IA 2LGDA 3SDLC 2I1JA 4CYEA 4OVVA 2K8CA 4AWJA 5J2RA 2MCNB 2DZJA 4BBNF 1F9JA 2BWFA 3QX1A 3RZFA 3A4SC 4G0NB 2IO3B 2V1YA 1P0RA 1WE7A 2KNBA 2MRPA 2WDTB 3TJPA 2KKCA 2DENB 3S2AA 2ZZPB 1TGZB 3ZRFA 2K39A 2ZPYA 4TV3A 4BKSA 3DPDA 2KTRA 5JHAA 2MP2B 2DYOA 2G4SA 3O65B 2IY1B 2N1WA 4GU2A 1ZGUB 2WWZA 1P9DU 3LJ3A 1E8XA 3NZSA 3WA0A 3MTNB 1G6JA 3MJWA 2KTFA 2MBBB 3ECIA 1VD2A 3M62B 5GMVA 1P1AA 4N9F4 2JF5A 1WJ4A 1CMXB 2L7RA 3RT3B 1OQYA 3ONSA 5IAAC 1XQQA 1WI0A 3VH3B 3RCZA 3PHXB 2M1MA 5AEKB 1WH3A 3OLMD 4FA6A 3A9KB 3KH0A 3B1LX 3PS6A 4KZCA 3ZIMA 2KANA 2LD9A 3SU8X 4ASWC 4MGYE 1FXTB 3V6CB 3L16A 4KIKB 3VVWB 5L83A 3ZTDA 3KUDB 2RD0A 3ZUNA 3UGBB 1BT0A 2KN5A 4ZRKA 3ZNHB 4F1SA 5L95C 3UQBA 4NAWB 1HE8A 2KTRB 3RULA 1J8CA 4PS3A 4RM9A 1RAXA 1ZKHA 5JHBA 2KDFB 1R4MI 1E90A 1V2YA 3ZDMC 2O6VB 3R7RA 2HD5B 2NBVB 2PPHA 2R2QA 4A3PA 2DX5B 2K1FA 2MBHA 4HCNB 5BO4B 3QK0A 3CF6E 3DBRI 1C3TA 2MWSB 1K8RB 5LLIA 4WWPA 2FIFA 4B6WA 3EHVA 3AI5A 4DHJD 4GMVA 4HPMB 4NQKE 2AL3A 4EKUA 2UWQA 3V60A 3ZW3A 3APCA 3VAWA 4BFRA 3N32A 1MG8A 4GSWA 4JGHB 2O2VA 2XEWA 5CHWA 1XD3B 2D3GA 4GDLB 1WJ6A 1GUAB 2PE9A 4BOZB 4HVBA 4AP4C 2KWUB 1LFDA 2BKFA 3A1QB 4FULA 2WX0A 2YLMA 3H7SA 1IYFA 2LZ6A 2MLBA 3DCGA 5E6NA 1NI2A 1WM3A 4NY0A 4WJPA 5JH5C 1RRBA 3N3KB 2D07B 5E6OA 1S3SG 4ZDVA 1A5RA 3TCAA 5J18A 1UZXB 4K7UA 3CSFA 2FCNA 4W9IA 1SGHA 1YD8U 4IM0A 1UD7A 4CHKA 2MBQA 2YVCA 4W9FA 3ZRCA 2DYBA 3NHEB 3U7DA 2MX2A 4WQOB 3DOWA 4KVGB 2G45B 4HDQA 3P2BA 4MSMB 2CS4A 4NJ6A 2MQJA 1X1MA 2A5UA 1WGYA 2LVPA 3OJ4B 4W9HA 2D11A 2MA9B 3X23A 3AU4A 2DAJA 2VRRB 3KUCB 1E5WA 2NR2A 1AARA 3DVNV 2JZ3B 3AXCA 3BY4B 4MGKE 4FLHA 2KLGA 1WY8A 4ANVA 2JT4B 4DHZB 2LJ5A 5CHVC 3VUWA 3KYDD 5C1ZA 2CHZA 3GZNI 4LDTD 5DPTA 3ALBA 4HPLB 5CX3A 2IYDB 2BPSA 5KHQA 1XT9B 4PS8A 3ZNGC 3PRPB 3DVNU 3CSTA 4KSKC 4E71A 1YX5B 2FAZA 2KLCA 1YJ1A 1WE6A 4K7SA 2K25A 2LVQA 2M17A 2ZCCA 3PRMB 4ANXA 2ZNVC 3VTWA 5HKHA 2KWVB 3DDCB 1I35A 3HM3A 2DZIA 4FJZA 4LCDE 3ZNZB 1E8YA 2BYEA 1GG3A 5AZFA 3PV1A 3A4RA 1WIAA 1IP9A 2KJ6A 2QHOA 3L08A 4KIKA 3R66C 4OVUA 1LM8B 1V5TA 3IHPC 4RM8A 2LASA 2KQSA 3QAQA 3UIOB 3IG3A 1J19A 4NAWA 1Y8RC 4DDGD 4EZJA 4GIVA 2LRWA 2L8JA 2O6VA 1SIFA 3NY5A 4M8MA 2LVOA 2RR9A 2KDIA 1KLVA 4FHKA 2D10A 1V9JA 1V6EA 4IG7B 4WWOA 3WANA 2Z59B 4LJOB 1WGRA 4MEMA 1WJUA 1WFYA 3L17A 1TTNA 5DPRA 4RMAA 5LXIB 1EUVB 5CHFA 3V6EB 3WALA 2ZVOA 4EFOA 2J0MA 3KW5B 4GDLA 2C7HA 4FADA 3PT2B 2ZJDA 3MHSD 4GDKB 1WRDB 2JY6A 2L0TA 3A1QA 1GJZA 3W1SC 3EC8A 4ZYNA 3Q3FA 3JW0X 3PLUA 2N1VA 1EF1A 1WZ3A 1L7YA 2LXCA 1OGWA 2Z0DB 4ANWA 1WR6E 4ANUA 2HE7A 3LDZE 1P3QU 1E8WA 2IO1B 4TUUA 3PSEB 1Z5SB 3VFKA 3NZUA 3WAMA 1NDDA 4E3CA 3WAOA 1E8ZA 3VDZA 3DQVA 4HK2A 3TMPB 2IO2B 1S1QB 2HJ8A 2JWZA 1WR1A 4BKGA 2MBEA 2K8BA 2N9EB 3DBLI 1GC7A 4I6PA 2FIDA 5DPWA 3QQ8B 2KMAA 2NVUI 4E74A 2IO0B 3AU5A 5EDSA 2AYOB 4PYZA 4HJKA 3UINB 3ZVVA 4HLEA 2LI5A 4ICVA 2KQ7A 3UIPB 4G3XB 2C7MB 4BKSD 1WGHA 2JUOA 2IZVB 4PYUA 4EOYA 4DHZE 1WJNA 4MM3A 3ML9A 5AZHA 1V5OA 3R3MA 1LQBA 2GMIC 5JZEB 2O6VD 4IC7B 3ZTCA 4X57B 3QJZA 4XZ4A 3M63B 1Q5WB 4W9CA 2J7QB 2CKHB 2M4NA 3ZNID 3VUXA 4WJQA 2RSUA 3PRZA 3ZO5B 5IA7A 4ZRJA 1Q1OA 2KC1A 1UH6A 4JLCA 1V86A 2DHZA 5C23A 4TKNA 2LWPA 5DPSA 1WM2A 2AWTA 4W9JA 3QWZB 1YX6B 3QC8B 4HXDA 3N30A 4AJYB 2ZCBA 3VHTC 1IPGA 2REXA 4FJYA 3T8MA 3A9JB 3H9DA 3T9LA 1OEYA 4KSLC 3GOEA 2KC2A 3C0RB 2AL6A 3VUYA 4FN2A 3JSVA 4GOCA 3AULA 3H7PB 4FJVB 3RZWC 3HM6X 2ZNVB 2C7NB 2N4FA 4GN1A 2L00B 2G3QB 3TBLD 1I42A 2KWCA 4IWQA 1VCBA 2DZKA 3L54A 2DZMA 2NPTA 5AZGA 4PS7A 2JRHA 1TZ1A 4BVUC 2BYFA 4ICUA 4W9EA 3UQAA 1PQSA 4G11A 4AJWA 1R4NI 3X0WA 2N9PC 1WMHB 2KX3A 2RGFA 2D2QA 4NPNA 3I3TB 2RPQA 4F7ZA 1UBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8C A;  1YIW A;  2A4Z A;  2B3A A;  1Q0W B;  3DVG X;  2FUH B;  2GBR A;  3W1S A;  3QA8 A;  4MJS B;  1T0Y A;  3K9P B;  4MSQ B;  1WGG A;  1Z2M A;  2EKE C;  1V81 A;  2R2O A;  3QCA A;  4GDK A;  4B95 A;  3RYT A;  1UBQ A;  1EO6 A;  3PGE A;  4DWF A;  1WXV A;  1OEY J;  2CHW A;  3U30 A;  2L3Z A;  4EUT A;  3UF8 A;  3JSV B;  4JL9 A;  2ZPN A;  5D2M B;  4K81 A;  5KHO A;  5J17 A;  1TBE A;  2ZVN A;  4JIO U;  1E7V A;  3PLV A;  2FCS A;  5E6P A;  4HDO A;  2NPT B;  3CMM B;  4IUM B;  2BGF A;  4W9D A;  1GC6 A;  3KYC D;  2KD0 A;  4J6I A;  3APF A;  3DVG Y;  2OJR A;  3EFU A;  1C1Y B;  4K1R B;  3U8Z A;  2LUE A;  4MEL A;  5D6J B;  2KHW B;  2PEA A;  2XK5 A;  2WYQ A;  5D94 A;  4HCP B;  2FCM A;  2J0J A;  2DYM A;  1P98 A;  4TQ1 A;  4W9L A;  2KXJ A;  2GBN A;  3NOB A;  1E7U A;  2FNJ B;  4IM3 A;  5D7G A;  1NBF C;  3R7Q A;  4URK A;  4G50 A;  4FHJ A;  2KMC A;  4II2 B;  3D32 A;  2NBU A;  2BKR B;  2JZZ A;  2GBM A;  5LXH A;  3ENE A;  1QZE A;  4W9K A;  3RD2 A;  4KZ0 A;  5DCN A;  2PE6 B;  3WIM A;  1WXM A;  4LJP B;  2IBI B;  4A20 A;  4KDL B;  4AUQ C;  4DHJ B;  2GBJ A;  2KZR A;  3QHT A;  2GOW A;  3IBE A;  3TL5 A;  2AEH A;  3HK0 A;  2OOB B;  2L05 A;  3L13 A;  3APD A;  2PJH A;  3IFW B;  3L10 B;  2NS5 A;  2LGX A;  4IWO A;  2Y5B B;  2LGY A;  2KOX A;  3M95 A;  4IW0 A;  3VTV A;  3DBH I;  2XK5 B;  2JXX A;  2N7E A;  3SD5 A;  2KJR A;  4KDI C;  5FR6 A;  3H6N A;  2ASQ A;  2XBB C;  4IWP A;  2M8S A;  2MBO A;  3QIJ A;  3V62 A;  4GGQ A;  3ZKJ C;  4BBN C;  1WX7 A;  2BWE S;  3SHQ A;  4TQ0 A;  3A9J A;  1M94 A;  2KJH B;  3ML8 A;  2HTH A;  4EEW A;  3PRE A;  4M0W B;  3IVF A;  2CU1 A;  2I1K A;  1UGM A;  2K6Q A;  2EMS A;  2L76 A;  4XX5 A;  4DDI D;  1WGD A;  4JQW C;  2M0X A;  4B9K A;  2KFK A;  2UYZ B;  1UEL A;  3H7P A;  2C60 A;  2EMT A;  1KM7 A;  1WX9 A;  3TIX A;  4ZRI A;  2CR5 A;  4I6L B;  4XC2 A;  3W1Y A;  2NBW B;  3VH4 B;  3EEC A;  3ZLZ A;  2IY0 B;  2LXA A;  3OJ3 A;  1LXD A;  2V4L A;  3M3J A;  4GB9 A;  4WJN A;  3VQI A;  1U4A A;  4CO7 A;  4WJO A;  4BKT A;  4DXA B;  1WMH A;  1GNU A;  3JVZ X;  2MSE D;  2CHX A;  3H1U A;  3HHM A;  4MGI E;  4LDT B;  3B08 A;  4YL8 A;  4NQL B;  2L0F A;  3HIZ A;  2LRU A;  2J0K A;  2K6D B;  3OAW A;  4MJS A;  2JPH A;  2K8H A;  2KVR A;  3PHW B;  1WXS A;  3PTF C;  1JRU A;  2JVC A;  3VXW A;  3KUZ A;  1WYW B;  2N9X A;  1OTR B;  2KFJ A;  4W9G A;  4MDK E;  2BYV E;  2KK8 A;  5G2N A;  2KFK B;  1YQB A;  3BIN A;  1WZ0 A;  5G55 A;  1WXA A;  2V3S A;  3QAR A;  4FBJ B;  2Z0E B;  3Q3J A;  4HWI B;  1KOT A;  4MGZ E;  4NJ7 A;  1SE9 A;  2KX0 A;  2NCN A;  3VTU A;  3ZDT A;  3A33 B;  1WF9 A;  4WAA A;  1V49 A;  2O2V B;  4II3 B;  2W9N A;  1V80 A;  3NS8 A;  5TR5 A;  4WWN A;  2C9W B;  2BF8 B;  2G4D B;  3PPA A;  3V61 A;  2FCQ A;  2C5L C;  2MW5 A;  3KVF B;  1KJT A;  4EZK A;  1ZW7 A;  2KO3 A;  4KV2 A;  3PZD A;  3PVL A;  4F8C B;  1WX8 A;  5CTR C;  4DBG A;  2WX1 A;  2ZEQ A;  4AOF A;  2MP2 A;  4DK5 A;  4A3O A;  4GXB A;  2DAF A;  3L0W B;  1RFA A;  3WAP A;  1ISN A;  4IM2 A;  2JRI B;  4I6N B;  1H4R A;  3DBS A;  1RLF A;  4EZL A;  1L2N A;  1D3Z A;  4NNJ B;  3JYU A;  4K7W A;  3K9O B;  2GBK A;  2KDE B;  4M8N A;  3RUI B;  1EF5 A;  2N7D A;  4BOS C;  3B0A A;  4MH0 E;  1J0G A;  2KDB A;  3A9K A;  4P7I A;  2LGD A;  3SDL C;  2I1J A;  4CYE A;  4OVV A;  2K8C A;  4AWJ A;  5J2R A;  2MCN B;  2DZJ A;  4BBN F;  1F9J A;  2BWF A;  3QX1 A;  3RZF A;  3A4S C;  4G0N B;  2IO3 B;  2V1Y A;  1P0R A;  1WE7 A;  2KNB A;  2MRP A;  2WDT B;  3TJP A;  2KKC A;  2DEN B;  3S2A A;  2ZZP B;  1TGZ B;  3ZRF A;  2K39 A;  2ZPY A;  4TV3 A;  4BKS A;  3DPD A;  2KTR A;  5JHA A;  2MP2 B;  2DYO A;  2G4S A;  3O65 B;  2IY1 B;  2N1W A;  4GU2 A;  1ZGU B;  2WWZ A;  1P9D U;  3LJ3 A;  1E8X A;  3NZS A;  3WA0 A;  3MTN B;  1G6J A;  3MJW A;  2KTF A;  2MBB B;  3ECI A;  1VD2 A;  3M62 B;  5GMV A;  1P1A A;  4N9F 4;  2JF5 A;  1WJ4 A;  1CMX B;  2L7R A;  3RT3 B;  1OQY A;  3ONS A;  5IAA C;  1XQQ A;  1WI0 A;  3VH3 B;  3RCZ A;  3PHX B;  2M1M A;  5AEK B;  1WH3 A;  3OLM D;  4FA6 A;  3A9K B;  3KH0 A;  3B1L X;  3PS6 A;  4KZC A;  3ZIM A;  2KAN A;  2LD9 A;  3SU8 X;  4ASW C;  4MGY E;  1FXT B;  3V6C B;  3L16 A;  4KIK B;  3VVW B;  5L83 A;  3ZTD A;  3KUD B;  2RD0 A;  3ZUN A;  3UGB B;  1BT0 A;  2KN5 A;  4ZRK A;  3ZNH B;  4F1S A;  5L95 C;  3UQB A;  4NAW B;  1HE8 A;  2KTR B;  3RUL A;  1J8C A;  4PS3 A;  4RM9 A;  1RAX A;  1ZKH A;  5JHB A;  2KDF B;  1R4M I;  1E90 A;  1V2Y A;  3ZDM C;  2O6V B;  3R7R A;  2HD5 B;  2NBV B;  2PPH A;  2R2Q A;  4A3P A;  2DX5 B;  2K1F A;  2MBH A;  4HCN B;  5BO4 B;  3QK0 A;  3CF6 E;  3DBR I;  1C3T A;  2MWS B;  1K8R B;  5LLI A;  4WWP A;  2FIF A;  4B6W A;  3EHV A;  3AI5 A;  4DHJ D;  4GMV A;  4HPM B;  4NQK E;  2AL3 A;  4EKU A;  2UWQ A;  3V60 A;  3ZW3 A;  3APC A;  3VAW A;  4BFR A;  3N32 A;  1MG8 A;  4GSW A;  4JGH B;  2O2V A;  2XEW A;  5CHW A;  1XD3 B;  2D3G A;  4GDL B;  1WJ6 A;  1GUA B;  2PE9 A;  4BOZ B;  4HVB A;  4AP4 C;  2KWU B;  1LFD A;  2BKF A;  3A1Q B;  4FUL A;  2WX0 A;  2YLM A;  3H7S A;  1IYF A;  2LZ6 A;  2MLB A;  3DCG A;  5E6N A;  1NI2 A;  1WM3 A;  4NY0 A;  4WJP A;  5JH5 C;  1RRB A;  3N3K B;  2D07 B;  5E6O A;  1S3S G;  4ZDV A;  1A5R A;  3TCA A;  5J18 A;  1UZX B;  4K7U A;  3CSF A;  2FCN A;  4W9I A;  1SGH A;  1YD8 U;  4IM0 A;  1UD7 A;  4CHK A;  2MBQ A;  2YVC A;  4W9F A;  3ZRC A;  2DYB A;  3NHE B;  3U7D A;  2MX2 A;  4WQO B;  3DOW A;  4KVG B;  2G45 B;  4HDQ A;  3P2B A;  4MSM B;  2CS4 A;  4NJ6 A;  2MQJ A;  1X1M A;  2A5U A;  1WGY A;  2LVP A;  3OJ4 B;  4W9H A;  2D11 A;  2MA9 B;  3X23 A;  3AU4 A;  2DAJ A;  2VRR B;  3KUC B;  1E5W A;  2NR2 A;  1AAR A;  3DVN V;  2JZ3 B;  3AXC A;  3BY4 B;  4MGK E;  4FLH A;  2KLG A;  1WY8 A;  4ANV A;  2JT4 B;  4DHZ B;  2LJ5 A;  5CHV C;  3VUW A;  3KYD D;  5C1Z A;  2CHZ A;  3GZN I;  4LDT D;  5DPT A;  3ALB A;  4HPL B;  5CX3 A;  2IYD B;  2BPS A;  5KHQ A;  1XT9 B;  4PS8 A;  3ZNG C;  3PRP B;  3DVN U;  3CST A;  4KSK C;  4E71 A;  1YX5 B;  2FAZ A;  2KLC A;  1YJ1 A;  1WE6 A;  4K7S A;  2K25 A;  2LVQ A;  2M17 A;  2ZCC A;  3PRM B;  4ANX A;  2ZNV C;  3VTW A;  5HKH A;  2KWV B;  3DDC B;  1I35 A;  3HM3 A;  2DZI A;  4FJZ A;  4LCD E;  3ZNZ B;  1E8Y A;  2BYE A;  1GG3 A;  5AZF A;  3PV1 A;  3A4R A;  1WIA A;  1IP9 A;  2KJ6 A;  2QHO A;  3L08 A;  4KIK A;  3R66 C;  4OVU A;  1LM8 B;  1V5T A;  3IHP C;  4RM8 A;  2LAS A;  2KQS A;  3QAQ A;  3UIO B;  3IG3 A;  1J19 A;  4NAW A;  1Y8R C;  4DDG D;  4EZJ A;  4GIV A;  2LRW A;  2L8J A;  2O6V A;  1SIF A;  3NY5 A;  4M8M A;  2LVO A;  2RR9 A;  2KDI A;  1KLV A;  4FHK A;  2D10 A;  1V9J A;  1V6E A;  4IG7 B;  4WWO A;  3WAN A;  2Z59 B;  4LJO B;  1WGR A;  4MEM A;  1WJU A;  1WFY A;  3L17 A;  1TTN A;  5DPR A;  4RMA A;  5LXI B;  1EUV B;  5CHF A;  3V6E B;  3WAL A;  2ZVO A;  4EFO A;  2J0M A;  3KW5 B;  4GDL A;  2C7H A;  4FAD A;  3PT2 B;  2ZJD A;  3MHS D;  4GDK B;  1WRD B;  2JY6 A;  2L0T A;  3A1Q A;  1GJZ A;  3W1S C;  3EC8 A;  4ZYN A;  3Q3F A;  3JW0 X;  3PLU A;  2N1V A;  1EF1 A;  1WZ3 A;  1L7Y A;  2LXC A;  1OGW A;  2Z0D B;  4ANW A;  1WR6 E;  4ANU A;  2HE7 A;  3LDZ E;  1P3Q U;  1E8W A;  2IO1 B;  4TUU A;  3PSE B;  1Z5S B;  3VFK A;  3NZU A;  3WAM A;  1NDD A;  4E3C A;  3WAO A;  1E8Z A;  3VDZ A;  3DQV A;  4HK2 A;  3TMP B;  2IO2 B;  1S1Q B;  2HJ8 A;  2JWZ A;  1WR1 A;  4BKG A;  2MBE A;  2K8B A;  2N9E B;  3DBL I;  1GC7 A;  4I6P A;  2FID A;  5DPW A;  3QQ8 B;  2KMA A;  2NVU I;  4E74 A;  2IO0 B;  3AU5 A;  5EDS A;  2AYO B;  4PYZ A;  4HJK A;  3UIN B;  3ZVV A;  4HLE A;  2LI5 A;  4ICV A;  2KQ7 A;  3UIP B;  4G3X B;  2C7M B;  4BKS D;  1WGH A;  2JUO A;  2IZV B;  4PYU A;  4EOY A;  4DHZ E;  1WJN A;  4MM3 A;  3ML9 A;  5AZH A;  1V5O A;  3R3M A;  1LQB A;  2GMI C;  5JZE B;  2O6V D;  4IC7 B;  3ZTC A;  4X57 B;  3QJZ A;  4XZ4 A;  3M63 B;  1Q5W B;  4W9C A;  2J7Q B;  2CKH B;  2M4N A;  3ZNI D;  3VUX A;  4WJQ A;  2RSU A;  3PRZ A;  3ZO5 B;  5IA7 A;  4ZRJ A;  1Q1O A;  2KC1 A;  1UH6 A;  4JLC A;  1V86 A;  2DHZ A;  5C23 A;  4TKN A;  2LWP A;  5DPS A;  1WM2 A;  2AWT A;  4W9J A;  3QWZ B;  1YX6 B;  3QC8 B;  4HXD A;  3N30 A;  4AJY B;  2ZCB A;  3VHT C;  1IPG A;  2REX A;  4FJY A;  3T8M A;  3A9J B;  3H9D A;  3T9L A;  1OEY A;  4KSL C;  3GOE A;  2KC2 A;  3C0R B;  2AL6 A;  3VUY A;  4FN2 A;  3JSV A;  4GOC A;  3AUL A;  3H7P B;  4FJV B;  3RZW C;  3HM6 X;  2ZNV B;  2C7N B;  2N4F A;  4GN1 A;  2L00 B;  2G3Q B;  3TBL D;  1I42 A;  2KWC A;  4IWQ A;  1VCB A;  2DZK A;  3L54 A;  2DZM A;  2NPT A;  5AZG A;  4PS7 A;  2JRH A;  1TZ1 A;  4BVU C;  2BYF A;  4ICU A;  4W9E A;  3UQA A;  1PQS A;  4G11 A;  4AJW A;  1R4N I;  3X0W A;  2N9P C;  1WMH B;  2KX3 A;  2RGF A;  2D2Q A;  4NPN A;  3I3T B;  2RPQ A;  4F7Z A;  1UBI A; 
#chains in the Genus database with same CATH topology
 3W1S A;  3QA8 A;  4HKZ E;  1WGG A;  2EKE C;  1V81 A;  1LGR A;  2R2O A;  4GDK A;  4B95 A;  1ROE A;  1WXV A;  2L3Z A;  4EUT A;  5E6J A;  3UF8 A;  5J17 A;  4JIO U;  2KN4 A;  1E7V A;  5E6P A;  3AE7 B;  3U4E G;  2LMC A;  3KYC D;  1PFD A;  4J6I A;  3APF A;  2N9L A;  2IPK D;  4P6V F;  1C1Y B;  4K1R B;  2LUE A;  2KHW B;  2XK5 A;  2IDY A;  2DYM A;  4TQ1 A;  1XLO A;  5TSS A;  1E7U A;  2FNJ B;  4IM3 A;  2JZP A;  2QDF A;  2WXJ A;  3VRB B;  4II2 B;  2NBU A;  1FCC C;  1QZE A;  5DCN A;  4LJP B;  4AUQ C;  2GBJ A;  2AEH A;  5EE3 A;  2XN9 C;  2OOB B;  1TS2 A;  3APD A;  3IFW B;  3L10 B;  2Y5B B;  2LGY A;  2KOX A;  3M95 A;  4IW0 A;  2JXX A;  2KJR A;  3H6N A;  3FKY A;  4GGQ A;  3ZKJ C;  1E6E B;  3IT4 B;  1C4P A;  1XEE A;  3A9J A;  1JWU D;  1HEZ E;  5C3J B;  2HTH A;  3BK2 A;  3BYT B;  3IVF A;  2CU1 A;  3ABV B;  2L76 A;  4P16 A;  4JQW C;  2KWD A;  2KFK A;  2UYZ B;  1K51 A;  2MJE A;  2CR5 A;  4XC2 A;  3FIL B;  1KRH A;  2IY0 B;  3OJ3 A;  1LXD A;  2V4L A;  4NZL B;  3B2G A;  4DXA B;  3H1U A;  3HHM A;  4RGM A;  4NQL B;  4C56 C;  3Q2A C;  1J7B A;  2JPH A;  1T6B X;  1WXS A;  4RH6 A;  1WYW B;  2N9X A;  4REZ A;  4W9G A;  2BYV E;  3VR8 B;  3NVY A;  4XDC A;  1N61 A;  2Z0E B;  3Q3J A;  4HWI B;  4MGZ E;  2J53 A;  3T3N A;  1P7F A;  3VTU A;  1ZOY B;  1D4B A;  4WAA A;  1V49 A;  4II3 B;  4WWN A;  4K3B A;  3PPA A;  2FCQ A;  2MW5 A;  2SAK A;  1ZW7 A;  3O13 A;  1WX8 A;  4RGO S;  5CTR C;  4AOF A;  2MP2 A;  1E10 A;  1CZP A;  3DBR B;  2ON8 A;  4LK0 M;  1ISN A;  3P63 A;  4IM2 A;  4WQM A;  3MC8 A;  3DBS A;  4EZL A;  4N59 A;  1L2N A;  4NNJ B;  3MHZ A;  4KGS A;  2GBK A;  4BOS C;  1EF5 A;  4QAY A;  1AW7 A;  1FXI A;  2KAJ A;  3EA6 A;  2MCN B;  3V05 A;  3A4S C;  4YTN B;  2IO3 B;  3S2A A;  2DEN B;  3NZ3 A;  2HJ1 A;  1EU4 A;  1DOX A;  2K39 A;  2ZPY A;  3DPD A;  2KTR A;  4A6Q A;  2DYO A;  3P4P B;  1EWC A;  1UWX A;  2WDQ B;  1RYJ A;  2BS3 B;  1E8X A;  1G6J A;  2KTF A;  3ECI A;  1VD2 A;  3J9C A;  5GMV A;  1WJ4 A;  1CMX B;  2V9H A;  3PHX B;  1SE3 A;  4FA6 A;  2K5P A;  3A9K B;  3PS6 A;  1YMH E;  3SU8 X;  4ASW C;  1FXT B;  2WXR A;  3KUD B;  2RD0 A;  3SR6 A;  3UGB B;  3ZNH B;  1EWY C;  1KLG D;  3BII D;  1ZPS A;  4A90 A;  4PS3 A;  1R4M I;  4XWT A;  3ZDM C;  2O6V B;  2HD5 B;  2LGS A;  1OQR A;  4A3P A;  3CF6 E;  4R3D A;  4B6W A;  1MFW A;  2V3P A;  4ZRQ A;  4GMV A;  1HXY D;  2EKI A;  3APC A;  4BFR A;  4JGH B;  1TKG A;  3ZQ4 A;  3I5J C;  2WXP A;  1SF0 A;  1GUA B;  4HVB A;  2K0P A;  3Q6B A;  2E3T A;  2WX0 A;  1ZXI A;  2MLB A;  4BAX A;  5E6N A;  4NY0 A;  4WJP A;  2J4X A;  2B76 B;  1FMA D;  1S3S G;  3TCA A;  4W9I A;  1SGH A;  1UD7 A;  4KKJ A;  2UU7 A;  3U7D A;  2JYT A;  3P2B A;  1X1M A;  1WGY A;  2RPV A;  2D11 A;  1MG4 A;  2DAJ A;  2BTE A;  1YOV B;  1E5W A;  2NR2 A;  2WXI A;  3DVN V;  4MGK E;  3TUO A;  4ANV A;  4DHZ B;  1D5M C;  5C1Z A;  2V3N A;  4J3O D;  3V3X A;  1QT9 A;  4LDT D;  2N9K A;  3BWU D;  4O1N A;  1TS5 A;  3DVN U;  3CST A;  2V4I B;  2QIE B;  1NEN B;  4K7S A;  1V1P B;  2LVQ A;  2M17 A;  2ZCC A;  4ANX A;  4XWW A;  3VTW A;  2I2Y A;  1F1H A;  1IGC A;  3DDC B;  1ACC A;  3HM3 A;  3ZNZ B;  2Y3A A;  3PV1 A;  2BQQ A;  4XGA B;  1IP9 A;  2M0A A;  3L08 A;  2WDV B;  1V5T A;  3RNG C;  1N6Z A;  1VDV A;  2O6V A;  1NYR A;  2LVO A;  1T0Q C;  1V97 A;  2MEK A;  1VJK A;  4DXG A;  2AQ3 B;  3WCQ A;  2H89 B;  4WWO A;  3WAN A;  1WJU A;  3L17 A;  4RMA A;  2DWQ A;  1VLB A;  4EFO A;  2J0M A;  3Q8B A;  1E0Z A;  3LB8 C;  2VZK D;  2MHJ A;  2L0T A;  2JY6 A;  2WXH A;  3P4R B;  1EU3 A;  2IND C;  2MJD A;  5GXG B;  2LXC A;  1L7Y A;  1WR6 E;  2HE7 A;  4CQN A;  1P3Q U;  1J7C A;  5IN7 A;  5T8I A;  3VDZ A;  2N9E B;  2K8B A;  3DBL I;  2WS3 B;  1ET6 A;  1GC7 A;  4I6P A;  3T3O A;  5DPW A;  3AE3 B;  4WH4 A;  2WU2 B;  1KH0 A;  3AEG B;  1SJE D;  3AU5 A;  4JWU C;  2X38 A;  4HEA 1;  4BKS D;  2IZV B;  4DHZ E;  3KQ4 A;  3ZTC A;  3QJZ A;  2WXF A;  1HZ6 A;  3ZNI D;  2LFI A;  2HDE A;  3PRZ A;  1CK1 A;  1V1P A;  1UH6 A;  4KGT A;  1SE2 A;  4TKN A;  3MFG A;  2AWT A;  4W9J A;  1YX6 B;  2RMM A;  3VHT C;  5IP4 D;  1SSN A;  3T9L A;  4KKI A;  4KSL C;  3GOE A;  2BS2 B;  2KC2 A;  3C0R B;  2AL6 A;  4FN2 A;  3SFD B;  3AUL A;  2BW2 A;  3H7P B;  3IXS A;  2C7N B;  2IGH A;  2L00 B;  2KWC A;  3N1Z C;  4IWQ A;  1FCL A;  5HG2 A;  1VCB A;  1TZO A;  2JRH A;  3RNF C;  4OZB A;  3GE3 C;  3FAH A;  3UQA A;  4AJW A;  1R4N I;  3HVD A;  1UBI A;  1HA5 A;  1H8C A;  2A4Z A;  2B3A A;  1Q0W B;  1FD6 A;  2GBR A;  4MJS B;  1T0Y A;  3K9P B;  1Z2M A;  2NTS A;  3QCA A;  1EO6 A;  2CHW A;  3U30 A;  2INP E;  3JSV B;  1YQ3 B;  4JL9 A;  3BYY B;  5KHO A;  3RI7 C;  1TBE A;  3Q8E A;  1DYQ A;  2GRI A;  4HDO A;  2NPT B;  1GC6 A;  3DVG Y;  3U8Z A;  5D94 A;  1FRD A;  2GB1 A;  1TY0 A;  2KXJ A;  1STE A;  1FFV A;  3R7Q A;  1NBF C;  4URK A;  2DNF A;  3IT6 B;  1C76 A;  2BKR B;  5LXH A;  1RWS A;  4KZ0 A;  4AS1 A;  3TSS A;  2FBW B;  3WIM A;  4PK1 A;  2IBI B;  2WXK A;  4KDL B;  3IBE A;  5HHD G;  3N20 C;  4KGR A;  1MPE A;  1TY2 A;  2NS5 A;  1JWM D;  2L83 A;  2XK5 B;  2N7E A;  3SD5 A;  1UNS A;  3GE8 C;  2ASQ A;  3V62 A;  5HI1 A;  1M94 A;  2KJH B;  3ML8 A;  4EEW A;  4LNK A;  4DDI D;  1WGD A;  1ZUD 2;  3H7P A;  2C60 A;  2EMT A;  3MJ5 A;  4ZRI A;  2KVZ A;  4ZHO A;  3ZLZ A;  3NVV A;  4GB9 A;  1ZDV A;  4WJN A;  2OJW A;  1D6E C;  5AUK A;  5BMH A;  1D5Z C;  1SBB B;  3JVZ X;  4HPP A;  1R7S A;  2D3B A;  2N0S B;  3HIZ A;  2MJ3 A;  4MJS A;  1FIQ A;  3PZ8 A;  1IGD A;  1JRU A;  3KUZ A;  2PVO D;  1OTR B;  2KFJ A;  2DBY A;  2KK8 A;  3OG5 A;  2KFK B;  1YQB A;  3BIN A;  2V3S A;  4FBJ B;  3U52 E;  4YTP B;  3RN9 C;  2KX0 A;  2NCN A;  1JCK B;  3ZDT A;  3A33 B;  1WF9 A;  4L1B A;  5BYQ A;  2L1A A;  3PZD A;  3PVL A;  4F8C B;  2YEP B;  4DBG A;  4DK5 A;  2JX5 A;  4A3O A;  3L0W B;  2GLS A;  1RLF A;  4M8N A;  3B0A A;  1XCT L;  4AWJ A;  2DZJ A;  4BBN F;  1F9J A;  3RZF A;  4G0N B;  2KKC A;  2ZZP B;  2MH7 A;  2KQ4 X;  2MP2 B;  3O65 B;  1DOI A;  2N1W A;  4IDI A;  1ZGU B;  1ZP0 B;  3P1M A;  3M62 B;  1P1A A;  2L7R A;  1OQY A;  3VH3 B;  3RCZ A;  2M1M A;  5AEK B;  3B1L X;  4KZC A;  3ZIM A;  1V1O A;  4MGY E;  1TKE A;  5JXV A;  3ETR A;  5L95 C;  3UQB A;  1DOY A;  1DGJ A;  1HE8 A;  2KTR B;  1J8C A;  4RM9 A;  4H2A A;  5JHB A;  2M19 A;  1VZ6 A;  5IO9 A;  1TS3 A;  2R2Q A;  2K1F A;  2MBH A;  4L2Y A;  3W5U B;  4JPS A;  1C3T A;  1K8R B;  5LLI A;  3AB5 A;  3AI5 A;  1MHH E;  3PO0 A;  4HPM B;  4EKU A;  1QOB A;  4EE2 A;  1MG8 A;  1F2R I;  5CHW A;  3KLS X;  2NTT A;  3AEC B;  4AP4 C;  3HRD D;  3H7S A;  1I4G A;  2BT6 A;  2YLM A;  4IOI E;  3AED B;  1NI2 A;  5H92 C;  5J18 A;  4IM0 A;  4CHK A;  2DYB A;  2MX2 A;  2ICI A;  4HDQ A;  3ZYY X;  4NJ6 A;  2LVP A;  3OJ4 B;  4OW0 A;  3X23 A;  2VRR B;  3KUC B;  2G9H D;  1MI0 A;  1AAR A;  3BY4 B;  5H8Y E;  5CHV C;  1L4D B;  4LLG M;  1GB1 A;  4HPL B;  2IYD B;  3AEE B;  1XT9 B;  1BML C;  2FAZ A;  2KLC A;  1N5W A;  3GP7 A;  2IGG A;  3P4S B;  3ZXR A;  2KDM A;  2RDG A;  1YN5 A;  1JWS D;  4PT5 A;  3BZD B;  1JQ4 A;  1FPY A;  4OVU A;  2AQ2 B;  4RM8 A;  2KQS A;  1FNV A;  3QAQ A;  1J19 A;  1L6U A;  1UUP A;  2AX5 A;  4DDG D;  4GIV A;  3GB1 A;  1SIF A;  1L5P A;  4M8M A;  3P42 A;  2KDI A;  4FHK A;  2D10 A;  2TSS A;  1WGR A;  1OFF A;  4ARC A;  5DPR A;  1C9F A;  5BMG A;  5LXI B;  1EUV B;  2ZVO A;  3NG0 A;  2C7H A;  1I4H A;  2ZJD A;  3MHS D;  1GJZ A;  2PLP A;  3EC8 A;  3Q3F A;  3JW0 X;  3PLU A;  4YT0 B;  1WZ3 A;  1OGW A;  3LDZ E;  2IO1 B;  4TUU A;  4WWM A;  3W9C B;  3WAM A;  4E3C A;  1TIF A;  3WAO A;  1ESF A;  4LTU A;  1YNT E;  3Q3O C;  2JWZ A;  2QJL A;  5AUI A;  2LHE A;  2FID A;  2KMA A;  3MC9 A;  4E74 A;  4PYZ A;  4HLE A;  4HJK A;  3UIN B;  1GOZ A;  4GLS C;  2JUO A;  4EOY A;  3ML9 A;  5AZH A;  1LQB A;  2O6V D;  4IC7 B;  1B9R A;  4K3C A;  4OZA A;  2JXT A;  3M63 B;  4W9C A;  3VUX A;  4WJQ A;  2CU3 A;  1ET9 A;  4OVZ A;  5C23 A;  3PZ7 A;  4MAC A;  3QC8 B;  4HXD A;  2REX A;  3H9D A;  1ZDX A;  1VRA B;  4ARI A;  3VUY A;  3RZW C;  3HM6 X;  4A9A A;  4GN1 A;  3TBL D;  1MHX A;  1PGB A;  1I42 A;  2DZM A;  2OHF A;  5AZG A;  4PS7 A;  1RM6 C;  1TZ1 A;  1TYG B;  4M02 A;  4ICU A;  4W9E A;  1AYF A;  4RNA A;  2PW9 A;  4MT5 A;  2N9P C;  1K52 A;  1FXA A;  2RGF A;  4NPN A;  2PMV A;  3I3T B;  2RPQ A;  1YIW A;  1PGA A;  3DVG X;  4M00 A;  4RF1 A;  1QIL A;  4TSS A;  1QLB B;  1WXQ A;  1QOA A;  3ZGZ A;  1UBQ A;  4DWF A;  1GAQ B;  2ZVN A;  3PLV A;  2K3U A;  3DHG C;  5BMI A;  2K9X A;  4B0M A;  4W9D A;  2FUG 1;  2KD0 A;  3RNE C;  4MEL A;  1L0X B;  4HCP B;  2FCM A;  2J0J A;  3TEY A;  1YQ4 B;  1TT5 B;  3NOB A;  1HQR D;  1N60 A;  5D7G A;  3DHI C;  4FHJ A;  2KMC A;  3CIR B;  2BVC A;  3B9J A;  2JZZ A;  4BZA A;  2M56 B;  2GBM A;  2VH2 A;  1HTO A;  4W9K A;  3RD2 A;  2PE6 B;  5D3I B;  1WXM A;  4A20 A;  4LNN A;  2WNM A;  4DHJ B;  4Q2J A;  3TL5 A;  2WLB A;  2L05 A;  2JWU A;  3E56 A;  2LGX A;  3VRA B;  4KDI C;  2XBB C;  4IWP A;  2M8S A;  2MBO A;  4US9 A;  1OQQ A;  1WX7 A;  2G1E A;  3SHQ A;  4TQ0 A;  5C2T B;  4M0W B;  2I1K A;  2KT7 A;  1UGM A;  2K6Q A;  2EMS A;  2M0X A;  2FE8 A;  3CWI A;  4B9K A;  1SB3 C;  1KM7 A;  4I6L B;  4P1C C;  3W1Y A;  2LXA A;  3E9S A;  3M3J A;  2PIA A;  4CO7 A;  5BYR A;  1MVK A;  1I4P A;  2W3S A;  2CHX A;  4MGI E;  3TEX A;  4YTM B;  3R2I A;  3B08 A;  4N6E B;  2LRU A;  1XCQ L;  2J0K A;  3OAW A;  2BYT A;  3PHW B;  3EUB 2;  4MDK E;  2WXN A;  1AN8 A;  3QAR A;  4NJ7 A;  2LUM A;  3AE6 B;  5LNK 1;  2W9N A;  2G4D B;  2C5L C;  1KJT A;  4EZK A;  2KO3 A;  2WHI A;  1L4Z B;  2WX1 A;  2ZEQ A;  1Y56 A;  2GI9 A;  2DAF A;  1TS4 A;  4ZRP A;  2W54 A;  2JRI B;  4I6N B;  1H4R A;  1D3Z A;  3JYU A;  4C7Z A;  3K9O B;  2J42 A;  1I4X A;  2KDE B;  1IUE A;  4MH0 E;  3SDL C;  3R2T A;  1XLQ A;  1F2R C;  4OVV A;  1P0R A;  1WE7 A;  4TV3 A;  4BKS A;  4WUR A;  2G4S A;  4GU2 A;  1YJI A;  1P9D U;  3LJ3 A;  1IBX A;  3NZS A;  3WA0 A;  2EEL A;  3EGR A;  4M0W A;  4N9F 4;  2JF5 A;  3ONS A;  5IAA C;  1WI0 A;  2JYE A;  1WH3 A;  3OLM D;  1GB4 A;  3KH0 A;  1J7A A;  2KAN A;  2LD9 A;  1XF5 L;  3SEB A;  3L16 A;  4KIK B;  5L83 A;  1FNW A;  3ZUN A;  4C80 A;  1BT0 A;  4ZRK A;  4NAW B;  1L0V B;  1FRR A;  1E90 A;  2LJI A;  4D2K A;  1PYW D;  5IOI A;  2PPH A;  1QOG A;  2VH1 A;  5BO4 B;  2MWS B;  4US8 A;  2IJ0 A;  4NQK E;  2AL3 A;  2UWQ A;  1SIJ A;  3V60 A;  3ZW3 A;  3N32 A;  1Q10 A;  2XEW A;  3EFC A;  1E9M A;  1WJ6 A;  5MPO A;  1K53 A;  2PE9 A;  1I7H A;  2KWU B;  3A1Q B;  4FUL A;  1IYF A;  1I4R A;  2LZ6 A;  1I4Q A;  2HTM E;  3P4Q B;  3KWV A;  2KAC A;  1ENF A;  1RRB A;  1SE4 A;  2D07 B;  5E6O A;  1JAL A;  3GS2 A;  4ZDV A;  1A5R A;  2J52 A;  1UZX B;  3CSF A;  2FCN A;  1YD8 U;  3DWM A;  2MBQ A;  2YVC A;  2W82 A;  2G45 B;  2CS4 A;  3IAS 1;  3IAM 1;  2MA9 B;  2QCZ A;  3AU4 A;  4ZHP A;  2I38 A;  1R4M B;  3AXC A;  3AH7 A;  2XNA C;  3DHH C;  2ZW0 A;  2CHZ A;  2WXQ A;  3GZN I;  5DPT A;  1B1Z A;  5CX3 A;  5KHQ A;  4PS8 A;  1VZ7 A;  3H8H A;  3PRP B;  4KSK C;  4E71 A;  1HTQ A;  1WE6 A;  2KMM A;  2K25 A;  4USA A;  3PRM B;  2ZNV C;  3KWL A;  3B2F A;  5HKH A;  1F0Z A;  4FJZ A;  1E8Y A;  1GG3 A;  4RCO A;  1WIA A;  4KIK A;  2WXO A;  3IHP C;  2LAS A;  4ZOH C;  4NAW A;  1WGK A;  2BB6 A;  2L32 A;  2LRW A;  2L8J A;  1JWA D;  3MC0 B;  1V8C A;  2OED A;  2PVG C;  4KX6 B;  3RMK C;  2RR9 A;  4S0R A;  1JWB D;  3BVZ A;  1KLV A;  1V6E A;  4IG7 B;  1PDX A;  2Z59 B;  3URY A;  4LJO B;  2D5G A;  3L4P A;  4WAF A;  1WFY A;  3C19 A;  5FR3 A;  4JX1 C;  2AQ1 B;  5CHF A;  3V6E B;  4FAD A;  3PT2 B;  1WRD B;  3A1Q A;  3AEA B;  1EF1 A;  4ANW A;  2Z0D B;  4ANU A;  1D5X C;  4LNI A;  3TEZ A;  4JWS C;  2D3A A;  3PSE B;  3VFK A;  1YJJ A;  4M01 A;  4HK2 A;  3HUI A;  2HJ8 A;  4BKG A;  4NAM A;  3LYY A;  3QQ8 B;  1C4A A;  2NVU I;  3ZVV A;  4G3X B;  2C7M B;  1WGH A;  2WXM A;  2V0G A;  1GPX A;  1JML A;  1WJN A;  3NRZ A;  4MM3 A;  2GMI C;  5EE9 A;  5JZE B;  4XZ4 A;  2CJN A;  3Q8A A;  2J7Q B;  2CKH B;  2M4N A;  2RSU A;  3ZO5 B;  5IA7 A;  4RF0 A;  4JLC A;  1E7P B;  2DHZ A;  3FC4 A;  3AN1 A;  2ZW1 A;  4AQ7 A;  1P7E A;  1IPG A;  4FJY A;  4HRO A;  1C79 A;  3Q8F A;  4S17 A;  2H88 B;  3AEF B;  2W3R A;  4FJV B;  2N4F A;  3BVM A;  1YN3 A;  1KLU D;  3Q3M C;  4YSX B;  3DBL B;  2DZK A;  3MP9 A;  3N9Y C;  2BYF A;  1PQS A;  4G11 A;  4ACF A;  3X0W A;  2L52 A;  1WMH B;  2KX3 A;  1KTK A;  4F7Z A;  4OHJ A;  1N63 A;  5G5G A;  2FUH B;  3SFE B;  4MSQ B;  2NMQ A;  3RYT A;  3PGE A;  3ZJV A;  3DWG C;  4DQO C;  1OEY J;  1MJD A;  2ZPN A;  5D2M B;  4K81 A;  3RFZ B;  2FCS A;  1PGX A;  1XLP A;  1TKY A;  4WIP A;  3CMM B;  4IUM B;  1A70 A;  2BGF A;  5BYS A;  1HZ5 A;  2OJR A;  1C4C A;  3EFU A;  5D6J B;  2PEA A;  2WYQ A;  2WQY B;  1P98 A;  1BXT A;  1T0S C;  4W9L A;  2GBN A;  3RNB C;  1WWT A;  2WXL A;  2QEJ C;  5G5H A;  1SXT A;  4G50 A;  3D32 A;  3ENE A;  2BBC A;  1TJE A;  1NVI D;  4TMA B;  2KZR A;  3QHT A;  2GOW A;  1R4N B;  3AV8 A;  3FIL A;  3HK0 A;  3L13 A;  2RDH A;  2PJH A;  2BB5 A;  4IWO A;  1UWM A;  3VTV A;  3DBH I;  5FR6 A;  1T5X D;  3QIJ A;  4BBN C;  2BWE S;  1KFY B;  2PTL A;  1JRO A;  3PRE A;  2WGS A;  1NEK B;  4A55 A;  4XX5 A;  3U7Z A;  1UEL A;  3Q8C A;  1WX9 A;  3TIX A;  2KYW A;  2Q5W D;  2NBW B;  3VH4 B;  3EEC A;  4L23 A;  2X8X X;  5FK9 C;  3VQI A;  1U4A A;  4WJO A;  4BKT A;  1CJE A;  3BK1 A;  1WMH A;  4LNO A;  1GNU A;  3BVG A;  2MSE D;  3AE4 B;  3NS1 A;  4LDT B;  4JE3 B;  5FKA C;  4YL8 A;  2L0F A;  2K6D B;  1SJH D;  2K8H A;  2KVR A;  3I63 C;  3PTF C;  2JVC A;  3VXW A;  4IKG A;  2K22 A;  5G2N A;  3ZXV A;  1WZ0 A;  5G55 A;  1VZ8 A;  1WXA A;  1K50 A;  1KOT A;  1FM0 D;  1SE9 A;  2O2V B;  3NS8 A;  1V80 A;  5TR5 A;  2C9W B;  2BF8 B;  2DLB A;  3V61 A;  3KVF B;  1FO4 A;  4KV2 A;  2INN E;  4GXB A;  1JRP A;  5IKC M;  1RFA A;  2ACZ B;  3C8Y A;  3WAP A;  4K7W A;  3RUI B;  2N7D A;  1L6V A;  1J0G A;  2KDB A;  3A9K A;  1FFU A;  4P7I A;  2LGD A;  2I1J A;  4CYE A;  2K8C A;  5J2R A;  2BWF A;  3QX1 A;  1M4V A;  2V1Y A;  2KNB A;  2MRP A;  2WDT B;  3TJP A;  3UI3 A;  3AE2 B;  2Z8L A;  2PKO A;  4ITK A;  1TGZ B;  3ZRF A;  2JSV X;  5JHA A;  2VZK B;  3I9V 1;  2IY1 B;  5I4D A;  2WWZ A;  1AWD A;  4YWG G;  2E6X A;  4LNF A;  3MTN B;  3MJW A;  2MBB B;  3RT3 B;  3RNC C;  1N62 A;  1XQQ A;  3OWE B;  4XE0 A;  3AE5 B;  3GZN B;  3V6C B;  3AMZ A;  3VVW B;  3ZTD A;  3AEB B;  2KN5 A;  4F1S A;  4YSZ B;  4MH8 A;  3RUL A;  1RAX A;  1ZKH A;  4RGT A;  2KDF B;  1QKZ A;  2WXG A;  1IBX B;  1V2Y A;  3R7R A;  2NBV B;  2R61 A;  2W55 A;  2WDR B;  2DX5 B;  4HCN B;  3QK0 A;  3DBR I;  3U2S C;  4NJC A;  3NVW A;  4WWP A;  2FIF A;  3NVZ A;  1BUI C;  1WRI A;  3EHV A;  4DHJ D;  4XDD A;  3VAW A;  4GSW A;  2O2V A;  4C4V B;  3I57 A;  1XD3 B;  2D3G A;  4GDL B;  4XYC A;  2YEP F;  4BOZ B;  1LFD A;  2BKF A;  1UF0 A;  3DCG A;  1WM3 A;  3ZJU A;  5JH5 C;  3N3K B;  1N5X A;  4K7U A;  3Q69 A;  4DXF A;  1L0Y B;  1F77 A;  4W9F A;  3ZRC A;  4RGN A;  1XXG A;  3NHE B;  4WQO B;  3DOW A;  4KVG B;  4MSM B;  4OZC A;  1T3Q A;  4B0E A;  2MQJ A;  2A5U A;  4W9H A;  3LXF A;  5HFY A;  1F52 A;  1EM7 A;  1VR9 A;  4HRS A;  1FEH A;  1NYQ A;  2JZ3 B;  4FLH A;  2KLG A;  1WY8 A;  2JT4 B;  2LJ5 A;  1T0R C;  2N7J A;  3VUW A;  3KYD D;  1NI3 A;  3ALB A;  2BPS A;  2LHD A;  2QMT A;  3ZNG C;  3NUH B;  1YN4 A;  1YX5 B;  3TEW A;  2LEK A;  1YJ1 A;  2KWV B;  3ZJT A;  1I35 A;  2DZI A;  1UGJ A;  4LCD E;  2BYE A;  2QSD A;  5AZF A;  4HKQ A;  3A4R A;  3VR9 B;  2KJ6 A;  2QHO A;  3R66 C;  1QOF A;  4YXD B;  1LM8 B;  3AE9 B;  3UIO B;  3IG3 A;  2QC8 A;  3Q3N C;  1Y8R C;  4EZJ A;  3NY5 A;  1RFK A;  2BS4 B;  2D3C A;  1ZE3 D;  4YSY B;  3W2D A;  1V9J A;  4C00 A;  2Y5P A;  2LGI A;  4MEM A;  1TTN A;  4C4V A;  3WAL A;  3RNA C;  3KW5 B;  4GDL A;  4GDK B;  2JU6 X;  2Y5C A;  2RDB C;  1QQR A;  3W1S C;  1XLN A;  4ZYN A;  2N1V A;  2IGD A;  1E8W A;  1Z5S B;  5EE1 A;  3NZU A;  3AE8 B;  1NDD A;  1E8Z A;  3DQV A;  1ZXH A;  3TMP B;  2IO2 B;  1S1Q B;  2JQR B;  3N1Y C;  3RPF C;  1WR1 A;  2MBE A;  2IO0 B;  3N1X C;  1WYG A;  5EDS A;  2AYO B;  2LI5 A;  4ICV A;  2KQ7 A;  3UIP B;  2INC C;  2SEB D;  4PYU A;  1C77 A;  1V5O A;  3R3M A;  1WSP A;  4X57 B;  3Q14 C;  1JW9 D;  1C78 A;  1Q5W B;  2WU5 B;  4ZRJ A;  1Q1O A;  2KC1 A;  1V86 A;  2QIL A;  4FXC A;  2LWP A;  5DPS A;  1WM2 A;  3QWZ B;  1QF6 A;  1CQV A;  3N30 A;  5EE0 A;  4AJY B;  4ZYS A;  2ZCB A;  3AE1 B;  4C7Y A;  3T8M A;  3W5V B;  3A9J B;  1XO3 A;  1OEY A;  4N58 A;  4MM3 B;  4UDU C;  3JSV A;  4GOC A;  2ZNV B;  5D3D A;  4P1B C;  2G3Q B;  1KF6 B;  3DBH B;  3AM9 A;  2WP9 B;  1FNU A;  1PUT A;  3L54 A;  2NPT A;  4HJG E;  1SEB D;  3HVZ A;  4A8X C;  4BVU C;  2CJO A;  2ONQ A;  4RFB A;  3R8B A;  2D2Q A;  1LO5 D;  3NJT A; 
#chains in the Genus database with same CATH homology
 1H8C A;  1YIW A;  2A4Z A;  2B3A A;  1Q0W B;  3DVG X;  2FUH B;  2GBR A;  3W1S A;  3QA8 A;  4MJS B;  1T0Y A;  3K9P B;  4MSQ B;  1WGG A;  1Z2M A;  2EKE C;  1V81 A;  2R2O A;  3QCA A;  4GDK A;  4B95 A;  3RYT A;  1UBQ A;  1EO6 A;  3PGE A;  4DWF A;  1WXV A;  1OEY J;  2CHW A;  3U30 A;  2L3Z A;  4EUT A;  3UF8 A;  3JSV B;  4JL9 A;  2ZPN A;  5D2M B;  4K81 A;  5KHO A;  5J17 A;  1TBE A;  2ZVN A;  4JIO U;  1E7V A;  3PLV A;  2FCS A;  5E6P A;  4HDO A;  2NPT B;  3CMM B;  4IUM B;  2BGF A;  4W9D A;  1GC6 A;  3KYC D;  2KD0 A;  4J6I A;  3APF A;  3DVG Y;  2OJR A;  3EFU A;  1C1Y B;  4K1R B;  3U8Z A;  2LUE A;  4MEL A;  5D6J B;  2KHW B;  2PEA A;  2XK5 A;  2WYQ A;  5D94 A;  4HCP B;  2FCM A;  2J0J A;  2DYM A;  1P98 A;  4TQ1 A;  4W9L A;  2KXJ A;  2GBN A;  3NOB A;  1E7U A;  2FNJ B;  4IM3 A;  5D7G A;  1NBF C;  3R7Q A;  4URK A;  4G50 A;  4FHJ A;  2KMC A;  4II2 B;  3D32 A;  2NBU A;  2BKR B;  2JZZ A;  2GBM A;  5LXH A;  3ENE A;  1QZE A;  4W9K A;  3RD2 A;  4KZ0 A;  5DCN A;  2PE6 B;  3WIM A;  1WXM A;  4LJP B;  2IBI B;  4A20 A;  4KDL B;  4AUQ C;  4DHJ B;  2GBJ A;  2KZR A;  3QHT A;  2GOW A;  3IBE A;  3TL5 A;  2AEH A;  3HK0 A;  2OOB B;  2L05 A;  3L13 A;  3APD A;  2PJH A;  3IFW B;  3L10 B;  2NS5 A;  2LGX A;  4IWO A;  2Y5B B;  2LGY A;  2KOX A;  3M95 A;  4IW0 A;  3VTV A;  3DBH I;  2XK5 B;  2JXX A;  2N7E A;  3SD5 A;  2KJR A;  4KDI C;  5FR6 A;  3H6N A;  2ASQ A;  2XBB C;  4IWP A;  2M8S A;  2MBO A;  3QIJ A;  3V62 A;  4GGQ A;  3ZKJ C;  4BBN C;  1WX7 A;  2BWE S;  3SHQ A;  4TQ0 A;  3A9J A;  1M94 A;  2KJH B;  3ML8 A;  2HTH A;  4EEW A;  3PRE A;  4M0W B;  3IVF A;  2CU1 A;  2I1K A;  1UGM A;  2K6Q A;  2EMS A;  2L76 A;  4XX5 A;  4DDI D;  1WGD A;  4JQW C;  2M0X A;  4B9K A;  2KFK A;  2UYZ B;  1UEL A;  3H7P A;  2C60 A;  2EMT A;  1KM7 A;  1WX9 A;  3TIX A;  4ZRI A;  2CR5 A;  4I6L B;  4XC2 A;  3W1Y A;  2NBW B;  3VH4 B;  3EEC A;  3ZLZ A;  2IY0 B;  2LXA A;  3OJ3 A;  1LXD A;  2V4L A;  3M3J A;  4GB9 A;  4WJN A;  3VQI A;  1U4A A;  4CO7 A;  4WJO A;  4BKT A;  4DXA B;  1WMH A;  1GNU A;  3JVZ X;  2MSE D;  2CHX A;  3H1U A;  3HHM A;  4MGI E;  4LDT B;  3B08 A;  4YL8 A;  4NQL B;  2L0F A;  3HIZ A;  2LRU A;  2J0K A;  2K6D B;  3OAW A;  4MJS A;  2JPH A;  2K8H A;  2KVR A;  3PHW B;  1WXS A;  3PTF C;  1JRU A;  2JVC A;  3VXW A;  3KUZ A;  1WYW B;  2N9X A;  1OTR B;  2KFJ A;  4W9G A;  4MDK E;  2BYV E;  2KK8 A;  5G2N A;  2KFK B;  1YQB A;  3BIN A;  1WZ0 A;  5G55 A;  1WXA A;  2V3S A;  3QAR A;  4FBJ B;  2Z0E B;  3Q3J A;  4HWI B;  1KOT A;  4MGZ E;  4NJ7 A;  1SE9 A;  2KX0 A;  2NCN A;  3VTU A;  3ZDT A;  3A33 B;  1WF9 A;  4WAA A;  1V49 A;  2O2V B;  4II3 B;  2W9N A;  1V80 A;  3NS8 A;  5TR5 A;  4WWN A;  2C9W B;  2BF8 B;  2G4D B;  3PPA A;  3V61 A;  2FCQ A;  2C5L C;  2MW5 A;  3KVF B;  1KJT A;  4EZK A;  1ZW7 A;  2KO3 A;  4KV2 A;  3PZD A;  3PVL A;  4F8C B;  1WX8 A;  5CTR C;  4DBG A;  2WX1 A;  2ZEQ A;  4AOF A;  2MP2 A;  4DK5 A;  4A3O A;  4GXB A;  2DAF A;  3L0W B;  1RFA A;  3WAP A;  1ISN A;  4IM2 A;  2JRI B;  4I6N B;  1H4R A;  3DBS A;  1RLF A;  4EZL A;  1L2N A;  1D3Z A;  4NNJ B;  3JYU A;  4K7W A;  3K9O B;  2GBK A;  2KDE B;  4M8N A;  3RUI B;  1EF5 A;  2N7D A;  4BOS C;  3B0A A;  4MH0 E;  1J0G A;  2KDB A;  3A9K A;  4P7I A;  2LGD A;  3SDL C;  2I1J A;  4CYE A;  4OVV A;  2K8C A;  4AWJ A;  5J2R A;  2MCN B;  2DZJ A;  4BBN F;  1F9J A;  2BWF A;  3QX1 A;  3RZF A;  3A4S C;  4G0N B;  2IO3 B;  2V1Y A;  1P0R A;  1WE7 A;  2KNB A;  2MRP A;  2WDT B;  3TJP A;  2KKC A;  2DEN B;  3S2A A;  2ZZP B;  1TGZ B;  3ZRF A;  2K39 A;  2ZPY A;  4TV3 A;  4BKS A;  3DPD A;  2KTR A;  5JHA A;  2MP2 B;  2DYO A;  2G4S A;  3O65 B;  2IY1 B;  2N1W A;  4GU2 A;  1ZGU B;  2WWZ A;  1P9D U;  3LJ3 A;  1E8X A;  3NZS A;  3WA0 A;  3MTN B;  1G6J A;  3MJW A;  2KTF A;  2MBB B;  3ECI A;  1VD2 A;  3M62 B;  5GMV A;  1P1A A;  4N9F 4;  2JF5 A;  1WJ4 A;  1CMX B;  2L7R A;  3RT3 B;  1OQY A;  3ONS A;  5IAA C;  1XQQ A;  1WI0 A;  3VH3 B;  3RCZ A;  3PHX B;  2M1M A;  5AEK B;  1WH3 A;  3OLM D;  4FA6 A;  3A9K B;  3KH0 A;  3B1L X;  3PS6 A;  4KZC A;  3ZIM A;  2KAN A;  2LD9 A;  3SU8 X;  4ASW C;  4MGY E;  1FXT B;  3V6C B;  3L16 A;  4KIK B;  3VVW B;  5L83 A;  3ZTD A;  3KUD B;  2RD0 A;  3ZUN A;  3UGB B;  1BT0 A;  2KN5 A;  4ZRK A;  3ZNH B;  4F1S A;  5L95 C;  3UQB A;  4NAW B;  1HE8 A;  2KTR B;  3RUL A;  1J8C A;  4PS3 A;  4RM9 A;  1RAX A;  1ZKH A;  5JHB A;  2KDF B;  1R4M I;  1E90 A;  1V2Y A;  3ZDM C;  2O6V B;  3R7R A;  2HD5 B;  2NBV B;  2PPH A;  2R2Q A;  4A3P A;  2DX5 B;  2K1F A;  2MBH A;  4HCN B;  5BO4 B;  3QK0 A;  3CF6 E;  3DBR I;  1C3T A;  2MWS B;  1K8R B;  5LLI A;  4WWP A;  2FIF A;  4B6W A;  3EHV A;  3AI5 A;  4DHJ D;  4GMV A;  4HPM B;  4NQK E;  2AL3 A;  4EKU A;  2UWQ A;  3V60 A;  3ZW3 A;  3APC A;  3VAW A;  4BFR A;  3N32 A;  1MG8 A;  4GSW A;  4JGH B;  2O2V A;  2XEW A;  5CHW A;  1XD3 B;  2D3G A;  4GDL B;  1WJ6 A;  1GUA B;  2PE9 A;  4BOZ B;  4HVB A;  4AP4 C;  2KWU B;  1LFD A;  2BKF A;  3A1Q B;  4FUL A;  2WX0 A;  2YLM A;  3H7S A;  1IYF A;  2LZ6 A;  2MLB A;  3DCG A;  5E6N A;  1NI2 A;  1WM3 A;  4NY0 A;  4WJP A;  5JH5 C;  1RRB A;  3N3K B;  2D07 B;  5E6O A;  1S3S G;  4ZDV A;  1A5R A;  3TCA A;  5J18 A;  1UZX B;  4K7U A;  3CSF A;  2FCN A;  4W9I A;  1SGH A;  1YD8 U;  4IM0 A;  1UD7 A;  4CHK A;  2MBQ A;  2YVC A;  4W9F A;  3ZRC A;  2DYB A;  3NHE B;  3U7D A;  2MX2 A;  4WQO B;  3DOW A;  4KVG B;  2G45 B;  4HDQ A;  3P2B A;  4MSM B;  2CS4 A;  4NJ6 A;  2MQJ A;  1X1M A;  2A5U A;  1WGY A;  2LVP A;  3OJ4 B;  4W9H A;  2D11 A;  2MA9 B;  3X23 A;  3AU4 A;  2DAJ A;  2VRR B;  3KUC B;  1E5W A;  2NR2 A;  1AAR A;  3DVN V;  2JZ3 B;  3AXC A;  3BY4 B;  4MGK E;  4FLH A;  2KLG A;  1WY8 A;  4ANV A;  2JT4 B;  4DHZ B;  2LJ5 A;  5CHV C;  3VUW A;  3KYD D;  5C1Z A;  2CHZ A;  3GZN I;  4LDT D;  5DPT A;  3ALB A;  4HPL B;  5CX3 A;  2IYD B;  2BPS A;  5KHQ A;  1XT9 B;  4PS8 A;  3ZNG C;  3PRP B;  3DVN U;  3CST A;  4KSK C;  4E71 A;  1YX5 B;  2FAZ A;  2KLC A;  1YJ1 A;  1WE6 A;  4K7S A;  2K25 A;  2LVQ A;  2M17 A;  2ZCC A;  3PRM B;  4ANX A;  2ZNV C;  3VTW A;  5HKH A;  2KWV B;  3DDC B;  1I35 A;  3HM3 A;  2DZI A;  4FJZ A;  4LCD E;  3ZNZ B;  1E8Y A;  2BYE A;  1GG3 A;  5AZF A;  3PV1 A;  3A4R A;  1WIA A;  1IP9 A;  2KJ6 A;  2QHO A;  3L08 A;  4KIK A;  3R66 C;  4OVU A;  1LM8 B;  1V5T A;  3IHP C;  4RM8 A;  2LAS A;  2KQS A;  3QAQ A;  3UIO B;  3IG3 A;  1J19 A;  4NAW A;  1Y8R C;  4DDG D;  4EZJ A;  4GIV A;  2LRW A;  2L8J A;  2O6V A;  1SIF A;  3NY5 A;  4M8M A;  2LVO A;  2RR9 A;  2KDI A;  1KLV A;  4FHK A;  2D10 A;  1V9J A;  1V6E A;  4IG7 B;  4WWO A;  3WAN A;  2Z59 B;  4LJO B;  1WGR A;  4MEM A;  1WJU A;  1WFY A;  3L17 A;  1TTN A;  5DPR A;  4RMA A;  5LXI B;  1EUV B;  5CHF A;  3V6E B;  3WAL A;  2ZVO A;  4EFO A;  2J0M A;  3KW5 B;  4GDL A;  2C7H A;  4FAD A;  3PT2 B;  2ZJD A;  3MHS D;  4GDK B;  1WRD B;  2JY6 A;  2L0T A;  3A1Q A;  1GJZ A;  3W1S C;  3EC8 A;  4ZYN A;  3Q3F A;  3JW0 X;  3PLU A;  2N1V A;  1EF1 A;  1WZ3 A;  1L7Y A;  2LXC A;  1OGW A;  2Z0D B;  4ANW A;  1WR6 E;  4ANU A;  2HE7 A;  3LDZ E;  1P3Q U;  1E8W A;  2IO1 B;  4TUU A;  3PSE B;  1Z5S B;  3VFK A;  3NZU A;  3WAM A;  1NDD A;  4E3C A;  3WAO A;  1E8Z A;  3VDZ A;  3DQV A;  4HK2 A;  3TMP B;  2IO2 B;  1S1Q B;  2HJ8 A;  2JWZ A;  1WR1 A;  4BKG A;  2MBE A;  2K8B A;  2N9E B;  3DBL I;  1GC7 A;  4I6P A;  2FID A;  5DPW A;  3QQ8 B;  2KMA A;  2NVU I;  4E74 A;  2IO0 B;  3AU5 A;  5EDS A;  2AYO B;  4PYZ A;  4HJK A;  3UIN B;  3ZVV A;  4HLE A;  2LI5 A;  4ICV A;  2KQ7 A;  3UIP B;  4G3X B;  2C7M B;  4BKS D;  1WGH A;  2JUO A;  2IZV B;  4PYU A;  4EOY A;  4DHZ E;  1WJN A;  4MM3 A;  3ML9 A;  5AZH A;  1V5O A;  3R3M A;  1LQB A;  2GMI C;  5JZE B;  2O6V D;  4IC7 B;  3ZTC A;  4X57 B;  3QJZ A;  4XZ4 A;  3M63 B;  1Q5W B;  4W9C A;  2J7Q B;  2CKH B;  2M4N A;  3ZNI D;  3VUX A;  4WJQ A;  2RSU A;  3PRZ A;  3ZO5 B;  5IA7 A;  4ZRJ A;  1Q1O A;  2KC1 A;  1UH6 A;  4JLC A;  1V86 A;  2DHZ A;  5C23 A;  4TKN A;  2LWP A;  5DPS A;  1WM2 A;  2AWT A;  4W9J A;  3QWZ B;  1YX6 B;  3QC8 B;  4HXD A;  3N30 A;  4AJY B;  2ZCB A;  3VHT C;  1IPG A;  2REX A;  4FJY A;  3T8M A;  3A9J B;  3H9D A;  3T9L A;  1OEY A;  4KSL C;  3GOE A;  2KC2 A;  3C0R B;  2AL6 A;  3VUY A;  4FN2 A;  3JSV A;  4GOC A;  3AUL A;  3H7P B;  4FJV B;  3RZW C;  3HM6 X;  2ZNV B;  2C7N B;  2N4F A;  4GN1 A;  2L00 B;  2G3Q B;  3TBL D;  1I42 A;  2KWC A;  4IWQ A;  1VCB A;  2DZK A;  3L54 A;  2DZM A;  2NPT A;  5AZG A;  4PS7 A;  2JRH A;  1TZ1 A;  4BVU C;  2BYF A;  4ICU A;  4W9E A;  3UQA A;  1PQS A;  4G11 A;  4AJW A;  1R4N I;  3X0W A;  2N9P C;  1WMH B;  2KX3 A;  2RGF A;  2D2Q A;  4NPN A;  3I3T B;  2RPQ A;  4F7Z A;  1UBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...