3DDCB

Crystal structure of nore1a in complex with ras
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
133
Chain Sequence
PPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPSFYLPLDAIKQMHISSTTTVSEVIQGLLDKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTPase HRas
publication title Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/apoptosis
total genus 28
structure length 133
sequence length 158
ec nomenclature
pdb deposition date 2008-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ddcB00
3NOBA 1IYFA 4F7ZA 2NBWB 1LXDA 1YX6B 4GDLB 3LJ3A 3AU5A 4NNJB 5LXHA 3R7QA 1ZKHA 2KWVB 3MTNB 4I6LB 1J0GA 1RFAA 2ZEQA 3RT3B 3QCAA 1R4MI 3QX1A 3RZFA 3VQIA 3U7DA 4TQ1A 4MGYE 4KVGB 1WFYA 2NPTB 1KJTA 2K8CA 2KTRB 3L54A 5E6PA 1MG8A 3V62A 5J17A 2KZRA 3V60A 1RLFA 5C23A 3UQAA 3PRZA 3UINB 2J0KA 3PT2B 2LASA 4IC7B 3SHQA 2KWCA 4A3OA 4OVUA 3L08A 2LVQA 4HWIB 2KDFB 3ONSA 1TGZB 3RCZA 2DAFA 3VH3B 4JGHB 3ZKJC 3EC8A 1UBQA 3PHXB 4ANXA 5EDSA 4HXDA 3WALA 3ZW3A 3AXCA 5HKHA 2LI5A 3VUYA 2AEHA 2A5UA 2D10A 1WXMA 3JSVA 2ASQA 2D07B 1L7YA 3KUDB 2J0MA 4II3B 2XBBC 2N4FA 3W1YA 2WX0A 3R66C 4MGZE 2MWSB 4IM2A 4K81A 3QARA 4GDKB 3WAMA 1KM7A 3ML9A 1WH3A 1WZ3A 1GC6A 2Y5BB 1WX9A 1YD8U 2C60A 4NAWA 4ZRIA 2KQSA 2DAJA 3QWZB 2KHWB 2ZZPB 1K8RB 1P3QU 3MJWA 1X1MA 3A1QA 1T0YA 2IO1B 4BBNC 2KNBA 1WMHB 4B9KA 1OQYA 1SGHA 1WGDA 4FLHA 1D3ZA 2FCNA 2LVPA 3DCGA 4MDKE 4ANVA 4LJPB 3SU8X 4FBJB 4WWNA 3R3MA 3N32A 3DVNU 3DPDA 4KDLB 3AULA 5LLIA 3RD2A 4K7SA 5KHOA 2MBBB 4IWQA 2G45B 2MSED 1NDDA 2KX0A 5DPTA 1J19A 1V81A 2KD0A 5CHWA 2N9EB 1ZW7A 3HM3A 4XZ4A 4JQWC 4AP4C 3A9JA 2G3QB 2HJ8A 2KVRA 3PGEA 4ICUA 3H9DA 2NBUA 1E8YA 3N30A 2ZCCA 2K6DB 3QK0A 4HCNB 4EEWA 3PV1A 3B0AA 2N7EA 3KH0A 3S2AA 4M0WB 3VAWA 2LRUA 3B1LX 1WJNA 1LM8B 2KFKB 2KK8A 4A20A 1P9DU 2XEWA 5JZEB 3LDZE 1NI2A 3VUWA 2LJ5A 3TJPA 4W9JA 2BWFA 2KJRA 4K7WA 3A4RA 4ZRJA 4GDLA 2UYZB 2ZPNA 2L76A 4FN2A 1J8CA 1Q5WB 2JF5A 2Z0EB 4ZRKA 2BPSA 1UD7A 3CMMB 3ECIA 3U8ZA 3ZRFA 3L16A 3QJZA 4NQLB 3JYUA 2NPTA 1VCBA 2LD9A 3ZNGC 4DWFA 2KTRA 4WWPA 2DENB 2IY0B 3ZNZB 1LQBA 2CHXA 3RUIB 3PLVA 1EO6A 4IWPA 2MCNB 3HK0A 1IPGA 3ZTCA 4I6NB 3KUZA 3W1SA 3P2BA 4FJZA 4AJWA 1EF1A 4A3PA 4FULA 4EKUA 2N9PC 4PS7A 2C7MB 2ZPYA 4FJVB 2XK5B 4RM9A 1OEYA 3PREA 1V5TA 3H7SA 3N3KB 3ZDTA 4XX5A 4BKSD 4IG7B 3EECA 2JWZA 2C7HA 3PHWB 2KLGA 4KV2A 4I6PA 4JL9A 2AL6A 4W9IA 2V1YA 4GIVA 4NPNA 4DDID 4BKSA 3MHSD 3GZNI 3T8MA 4CYEA 2GBKA 4W9CA 3OJ4B 4TQ0A 3NHEB 2VRRB 2KTFA 3ZDMC 4GB9A 4DBGA 2MBEA 2KXJA 3DBHI 2MQJA 2LUEA 5J2RA 4FHKA 1WI0A 4RMAA 4IM0A 4GDKA 4F8CB 1V2YA 4IUMB 2AWTA 2MX2A 1A5RA 3UF8A 2BYEA 4MGKE 2KMCA 3IVFA 4EZJA 1KLVA 3D32A 2LZ6A 2JZ3B 1V80A 4BVUC 4WJNA 3DVGY 4NQKE 4K7UA 2CKHB 1WMHA 3A9KB 2ZVOA 4KIKB 2FCQA 2LXAA 5D7GA 3QQ8B 3H6NA 1I35A 4LDTB 5C1ZA 4PYUA 4KSLC 2FIDA 4P7IA 2KJ6A 4MSQB 3M3JA 2DZJA 2J0JA 2C9WB 2MW5A 2KO3A 3H1UA 1WGGA 1WGHA 1Z5SB 4MM3A 4NY0A 5TR5A 4ANWA 1UH6A 2ZVNA 4GMVA 2L00B 4DXAB 1KOTA 1E5WA 4NJ6A 3HM6X 1UBIA 4KZ0A 1WRDB 4JLCA 2DHZA 3L17A 2CU1A 3WAPA 1SIFA 1TTNA 4W9GA 4WWOA 2GBRA 2L05A 3PS6A 3ALBA 2G4SA 2O2VB 2JUOA 3H7PB 4B95A 2KDIA 4MGIE 4BOZB 4DHJB 3UQBA 5IA7A 2DYMA 1WXSA 1V49A 4X57B 2K39A 2RGFA 2GBJA 3JW0X 5FR6A 3VXWA 2MLBA 2KFKA 1WX8A 1Y8RC 2LGDA 2D11A 3DBSA 4GXBA 1Z2MA 2GBNA 1OTRB 3HHMA 1V6EA 3GOEA 4EOYA 1Q0WB 3QA8A 2ZNVC 4BBNF 1I42A 3L0WB 2BKFA 3B08A 1XQQA 1S1QB 1YQBA 2M1MA 3ENEA 2V3SA 3KW5B 1AARA 1GUAB 4RM8A 2N9XA 3ZNHB 2BYFA 2RD0A 1WR6E 1TBEA 2DZIA 2I1JA 4PS8A 5D6JB 2L0TA 1XT9B 2KLCA 3ZUNA 4FHJA 1WXVA 2JXXA 1G6JA 4GGQA 2HTHA 4WJOA 3QC8B 3TMPB 2BWES 1WZ0A 3CSFA 3CSTA 2JZZA 3ZLZA 4II2B 1CMXB 2XK5A 2WWZA 3KUCB 4G0NB 4GOCA 1YIWA 2PE6B 5AEKB 1EUVB 1WGRA 1WY8A 2PJHA 3L13A 2N1WA 3DBLI 5KHQA 2AYOB 2HE7A 2M0XA 2GMIC 2NBVB 4IWOA 4WJQA 3W1SC 3X23A 2M17A 3PVLA 3WANA 1WE6A 2LGYA 3DVNV 4GU2A 1ZGUB 2BF8B 2IBIB 2PE9A 4ANUA 2MA9B 4EZKA 1WYWB 2EKEC 1E8WA 3WIMA 2RPQA 3APFA 2FAZA 2M4NA 2OOBB 5LXIB 3VVWB 1P98A 5IAAC 1GG3A 2DYOA 4W9KA 4IM3A 4K1RB 2LXCA 4HLEA 2KJHB 2K6QA 3OJ3A 3TL5A 1GJZA 2ZCBA 2YVCA 2UWQA 2R2QA 5CHFA 5AZHA 3DBRI 2FCMA 2EMTA 4TV3A 4MH0E 2DYBA 5CX3A 2KC2A 3VTWA 2MP2B 2J7QB 2K25A 2WX1A 4LDTD 2LRWA 4G11A 2MRPA 1VD2A 4W9LA 3VTVA 3RYTA 4MJSB 3A9KA 3A33B 4KIKA 4AWJA 3TCAA 2JVCA 1IP9A 2FUHB 5CTRC 4ASWC 1S3SG 2KQ7A 2MBHA 2L8JA 2CHWA 3NS8A 3V6EB 4WJPA 4HJKA 3NZUA 4EUTA 1TZ1A 1E8XA 3RZWC 2O6VD 2W9NA 2ZJDA 3M95A 3I3TB 3BINA 4WAAA 3OLMD 3PRPB 3QHTA 4HPLB 4YL8A 1L2NA 1WF9A 1V9JA 2D2QA 2JPHA 5DCNA 2KDEB 1E7UA 1OGWA 2CS4A 2IO2B 2KMAA 3TBLD 4DHJD 2JY6A 3K9PB 3KYCD 2MBOA 2PPHA 1P0RA 4URKA 1RRBA 2NR2A 2DX5B 1UZXB 2O2VA 4MEMA 3H7PA 3AI5A 4BKTA 1QZEA 2C5LC 3DOWA 4NJ7A 1YJ1A 2KDBA 2N1VA 3O65B 2KKCA 4ZDVA 4E71A 2A4ZA 3DQVA 3VUXA 4W9FA 4AOFA 3NZSA 2OJRA 5DPWA 5D94A 1V86A 2KFJA 2KX3A 3PPAA 2M8SA 1ISNA 1BT0A 2HD5B 4E74A 2D3GA 3EFUA 2L0FA 3SD5A 3DDCB 3VH4B 3IFWB 2GOWA 3BY4B 2LGXA 3V61A 4B6WA 3VFKA 2N7DA 3QAQA 2WYQA 1GNUA 2O6VB 1WJ6A 4MSMB 1SE9A 3K9OB 4G3XB 4OVVA 4PS3A 1WM2A 1YX5B 1WJ4A 4FJYA 4DK5A 2JRIB 1E7VA 5G2NA 4W9EA 2Z59B 3ZTDA 2B3AA 2YLMA 3APCA 4W9HA 5BO4B 1XD3B 1PQSA 3UIOB 4LJOB 4BFRA 2RSUA 2DZMA 2CHZA 2NS5A 4EFOA 1WJUA 4DHZB 2BKRB 2IYDB 3APDA 4DDGD 1C1YB 3L10B 5CHVC 4BKGA 1RAXA 2IY1B 4ZYNA 5JH5C 2KC1A 5L95C 4XC2A 1Q1OA 4HDOA 1M94A 2LVOA 2GBMA 2REXA 4AJYB 3EHVA 2G4DB 5D2MB 4GSWA 4W9DA 3ZVVA 4CO7A 1WR1A 2JRHA 2KOXA 3DVGX 4LCDE 3A4SC 1WIAA 3IBEA 2EMSA 2C7NB 1WGYA 2FCSA 5DPSA 1NBFC 4F1SA 4TKNA 2KANA 3UIPB 1E90A 3UGBB 1WM3A 2BYVE 2CR5A 4M8NA 4EZLA 3CF6E 3PRMB 1C3TA 3R7RA 3VHTC 2JT4B 3ZRCA 3JSVB 3M62B 1P1AA 2K8BA 3M63B 5J18A 2K1FA 2NVUI 3IG3A 3ML8A 2MP2A 1JRUA 2FNJB 3QIJA 3ZIMA 3TIXA 1WX7A 4MJSA 4FA6A 4KDIC 2IO3B 1E8ZA 4HPMB 3IHPC 1WXAA 3C0RB 4NAWB 1V5OA 2PEAA 1OEYJ 3OAWA 4PYZA 3T9LA 4MELA 4GN1A 3A1QB 2KWUB 2AL3A 2NCNA 5AZGA 1GC7A 2I1KA 4JIOU 2DZKA 3RULA 4FADA 2L3ZA 5E6NA 3WA0A 3KVFB 5JHAA 3KYDD 4DHZE 1EF5A 3NY5A 4HCPB 3X0WA 5L83A 1R4NI 2QHOA 4KZCA 5DPRA 2K8HA 1WE7A 3PLUA 1UELA 4AUQC 2R2OA 2LWPA 4HK2A 4J6IA 3Q3JA 1HE8A 3VDZA 2RR9A 4N9F4 1FXTB 4KSKC 1H8CA 3U30A 2KN5A 3PSEB 5JHBA 1H4RA 4IW0A 5G55A 3SDLC 3Q3FA 3A9JB 3VTUA 4CHKA 2Z0DB 2IZVB 3WAOA 3ZNID 3ZO5B 4G50A 4TUUA 1U4AA 4E3CA 2MBQA 2WDTB 1LFDA 1F9JA 3JVZX 2FIFA 2L7RA 3PZDA 5GMVA 4ICVA 2V4LA 2ZNVB 2IO0B 5AZFA 5E6OA 2BGFA 3HIZA 3PTFC 4M8MA 4HVBA 4BOSC 1UGMA 4HDQA 3AU4A 4WQOB 3V6CB 2O6VA
chains in the Genus database with same CATH superfamily
2MEKA 1LXDA 4GDLB 4KGRA 3AH7A 3I63C 1JALA 2WGSA 3RT3B 2N7JA 2OEDA 1T0QC 4MGYE 3VR8B 1F2RI 2K8CA 3KWLA 3B9JA 3ZXRA 1MG8A 1RLFA 2QDFA 2WXOA 3GS2A 2J0KA 1IBXA 4IC7B 1RWSA 1SJED 1VR9A 3L08A 3RCZA 3ZKJC 3LB8C 1TS2A 3VUYA 2AEHA 3BVGA 3KLSX 2D07B 1L7YA 2NTTA 1QOGA 3WAMA 4GDKB 1XF5L 2Y5BB 3MC8A 1BMLC 1WX9A 2C60A 2KQSA 4C00A 2ZZPB 2IGHA 1K8RB 1VZ6A 1VDVA 3MJWA 1T0YA 3KQ4A 2KNBA 4B9KA 1OQYA 2LVPA 1EM7A 4LJPB 4WWNA 2V4IB 5LLIA 2AQ2B 1V97A 4IWQA 1J19A 2V3PA 1MJDA 2HJ8A 2KVRA 1FRRA 2NBUA 1EU3A 1CZPA 1E8YA 3N30A 3Q2AC 3FAHA 2N7EA 3BK1A 4MT5A 1R4MB 3B1LX 4DQOC 1NYRA 4A20A 5JZEB 3TJPA 3BK2A 4YSYB 3W5VB 2L76A 1Q5WB 3DHIC 4DXGA 3MP9A 1UD7A 2XN9C 1TY0A 3L16A 3JYUA 1VCBA 2LD9A 2IY0B 4C7ZA 4HPPA 2GLSA 3Q8CA 4IWPA 3ZTCA 1IPGA 3ZJUA 1T3QA 1EF1A 4RGNA 4A3PA 4EKUA 4ZHOA 1IGCA 1HXYD 1V5TA 3H7SA 3N3KB 3ZDTA 1P7FA 4IG7B 3R8BA 4KV2A 3V3XA 4BKSA 2V3NA 3T8MA 4CYEA 1IGDA 1ENFA 2LJIA 3OJ4B 2MBEA 2KXJA 2LUEA 4JE3B 1SE3A 2MX2A 1B1ZA 1A5RA 2KMCA 3IVFA 2LZ6A 4J3OD 4NQKE 2UU7A 1WMHA 1TZOA 1I35A 1SJHD 3MJ5A 5C1ZA 1N62A 2J0JA 2W54A 1KLGD 1WGGA 3GB1A 1UH6A 3SFEB 4GMVA 3HM6X 4JLCA 3L17A 4A90A 4YT0B 2GBRA 3PS6A 2G4SA 3H7PB 5AUIA 1YQ4B 2KDIA 3IAS1 1AW7A 4B95A 3GE3C 4M0WA 5IA7A 1V49A 4X57B 2K39A 2RGFA 1RYJA 5FR6A 3VXWA 2MLBA 3RNCC 1PGAA 2KFKA 4GXBA 1JMLA 2BYTA 4EOYA 3ENEA 2M1MA 5EE0A 1VZ7A 2N9XA 3DBRB 2VZKB 2BYFA 1WR6E 4ZRPA 2WDQB 4N59A 4C7YA 1D5XC 3ZUNA 4FHJA 2WXNA 1WXVA 2ACZB 1TJEA 3QC8B 2LGSA 1WZ0A 2K9XA 2LFIA 1KTKA 1CMXB 2XK5A 2WWZA 3KUCB 1YIWA 1WY8A 3DBLI 4WJQA 4IWOA 3W1SC 1WYGA 2WDRB 1SF0A 3DVNV 2CU3A 1T0RC 2MA9B 2ONQA 3APFA 2BVCA 5IAAC 3HVDA 4W9KA 2LXCA 2KJHB 3OJ3A 1GJZA 2UWQA 3DBRI 2K0PA 2EMTA 2KC2A 1E7PB 2K25A 5FKAC 2LRWA 1MVKA 2MH7A 3A33B 4AWJA 3TCAA 3ZGZA 3V6EB 1MFWA 1F52A 3NZUA 1TZ1A 3RZWC 4N58A 2VH1A 3BINA 3QHTA 3PRPB 4WIPA 4P16A 4TMAB 2B76B 3TBLD 3NVZA 4A8XC 1SXTA 4XDCA 1C78A 1OFFA 2MBOA 2EELA 4URKA 1JRPA 4LNFA 2O2VA 4WURA 4MEMA 2JQRB 4BKTA 4M00A 2KDBA 2KKCA 3NZSA 2OJRA 4R3DA 2D3GA 2M56B 2Q5WD 2VZKD 1SIJA 3KWVA 3IFWB 3BY4B 4YTMB 3B2GA 4IDIA 4MSMB 1STEA 4WQMA 1ZDVA 1VZ8A 4OVVA 1F77A 5FR3A 2LHEA 3ZTDA 3APCA 4W9HA 5BO4B 1PQSA 4LJOB 3TEWA 4P6VF 2BKRB 1KH0A 3APDA 4DDGD 1C1YB 1YQ3B 5CHVC 3ETRA 1MPEA 1IBXB 1FNWA 1T0SC 3EGRA 4NJCA 2REXA 2KACA 3EHVA 5D2MB 4C56C 2Y5CA 2JRHA 4XGAB 1GOZA 2BB6A 1JWMD 4H2AA 3IBEA 2I38A 3R2IA 3CF6E 3R7RA 3VHTC 3M63B 3M62B 2K8BA 5J18A 4KKJA 1C77A 2BTEA 2MP2A 1JRUA 3NZ3A 2FNJB 3T3OA 4MJSA 4YXDB 3AE9B 3AM9A 4KDIC 4RFBA 1XLPA 3C0RB 3N1YC 3AMZA 4MELA 4REZA 4JIOU 3RULA 3WA0A 4DHZE 1EF5A 4UDUC 2QHOA 1WE7A 5H8YE 2LWPA 3Q3JA 4OZCA 3PSEB 1H4RA 3FILA 3SDLC 3SR6A 3WAOA 4A9AA 4TUUA 4E3CA 2WDTB 3JVZX 3AE6B 3MFGA 2V4LA 2IO0B 2L32A 3N1XC 2JX5A 2AX5A 4HDQA 1UWMA 1IYFA 3MHZA 2NBWB 1FFVA 1ZKHA 2KWVB 1J0GA 2W55A 2X38A 2G9HD 3ABVB 4NAMA 3AEGB 2PVGC 2WXMA 3U7DA 4KVGB 1WFYA 2LEKA 5E6PA 2LHDA 5J17A 3U7ZA 3PRZA 3PT2B 2LASA 1DYQA 4OVUA 4S17A 3HUIA 2KDFB 3ONSA 1TGZB 2DAFA 2FE8A 1UBQA 3PHXB 4LNIA 1HZ5A 3ZW3A 2R61A 2A5UA 1WXMA 4GLSC 2ASQA 1QKZA 3KUDB 3NUHB 3DHGC 1L0XB 2PMVA 3AN1A 3W1YA 3R2TA 1TS5A 1WH3A 1WZ3A 1GC6A 3AE8B 4NAWA 4ARIA 3IAM1 1P3QU 1X1MA 1BXTA 1P7EA 4RF1A 1ZP0B 1WMHB 3N1ZC 4FLHA 3U4EG 1D3ZA 2FCNA 3DCGA 4MDKE 2QILA 2JXTA 3N32A 3DVNU 3TEYA 3RD2A 1JWBD 1OQQA 1XXGA 2G45B 1NDDA 3AE4B 5DPTA 1V81A 2KWDA 3HM3A 4JQWC 3A9JA 2BS3B 3PGEA 2BQQA 2ICIA 2KDMA 4BZAA 2CJNA 4M0WB 3VAWA 1N60A 1LM8B 4JWUC 2KFKB 3IXSA 2SEBD 3LDZE 4LNKA 3A4RA 1TT5B 1D6EC 2PW9A 1UF0A 4P1BC 4FN2A 2BPSA 3CMMB 3ZRFA 1AYFA 1N63A 2KTRA 3PLVA 1EO6A 3HK0A 3KUZA 3P2BA 2IDYA 5IP4D 4PS7A 1YOVB 2XK5B 1OEYA 4BKSD 1QF6A 2KLGA 3Q8EA 4I6PA 4GIVA 3GZNI 1UGJA 4W9CA 3NHEB 2VRRB 1QQRA 3DBHI 2WXQA 3BIID 1WI0A 1DOYA 4IUMB 1L0YB 3UF8A 2BYEA 1K53A 4HKZE 4EZJA 1KLVA 5IN7A 4BVUC 1V80A 4WJNA 1PFDA 2RDBC 2CKHB 2ZVOA 2LXAA 4LTUA 3QQ8B 2Y3AA 4RH6A 2KJ6A 4MSQB 2MW5A 2KO3A 3MC9A 3RPFC 2WQYB 1WXQA 3E9SA 1UBIA 1ACCA 2WXHA 2RPVA 1TTNA 2O2VB 2JUOA 4BOZB 2DYMA 1NVID 4RGTA 3JW0X 1E0ZA 1WX8A 1FCCC 1Y8RC 2GBNA 3HHMA 2V9HA 4BBNF 5C3JB 3B08A 5HFYA 1XQQA 2H89B 4XDDA 2RD0A 2I1JA 4PS8A 1T5XD 2L0TA 2QC8A 1XT9B 2JXXA 1V8CA 1E6EB 5G5HA 4M02A 3TMPB 1KFYB 3CSFA 3PZ8A 4AS1A 2JZZA 3ZLZA 5AEKB 1WGRA 1PGXA 5E6JA 1M4VA 2N1WA 5KHQA 2AYOB 2K5PA 3DHHC 1XCQL 2GMIC 1C79A 3WANA 4IOIE 2LGYA 1ZGUB 1SBBB 3L4PA 2EKEC 3WIMA 2M4NA 1EWYC 5LXIB 3VVWB 3BZDB 2W3RA 2WP9B 2PIAA 1GG3A 2DYOA 4ITKA 2R2QA 2J52A 1YJIA 4KKIA 1QOAA 2FCMA 4MH0E 1I4HA 2MP2B 2J7QB 1I4PA 1SB3C 2MRPA 3RYTA 4MJSB 2INDC 3A9KA 2JVCA 5BYSA 4JX1C 5BMHA 1L5PA 4WJPA 3GE8C 1XLOA 1E8XA 2O6VD 2ZJDA 4YSXB 4WAAA 3Q3MC 3Q8FA 4HPLB 4YL8A 2ON8A 1WF9A 1E7UA 1OGWA 2IO2B 3K9PB 2JZPA 3NJTA 1P0RA 1RRBA 1QLBB 1FD6A 3DOWA 1FMAD 2N1VA 5AUKA 4E71A 3DQVA 5D94A 1V86A 4TSSA 2M8SA 1ISNA 2HD5B 4E74A 3RMKC 1XO3A 3EFUA 1UUPA 2FBWB 3SD5A 2WU2B 4M01A 2GOWA 2LGXA 2SAKA 2WYQA 3K9OB 3HVZA 3BYTB 1WM2A 1FXIA 3DBLB 4MACA 4BFRA 3C8YA 1D5MC 3FC4A 2CHZA 4OZBA 4DHZB 2IYDB 1WRIA 4QAYA 3L10B 3BVZA 4BKGA 1RAXA 3CWIA 2KC1A 3ZXVA 2IJ0A 4AJYB 2RDHA 1WR1A 3DVGX 1FXAA 2JSVX 2NTSA 2C7NB 1WGYA 1YN4A 1ZXIA 1NBFC 5DPSA 4F1SA 4TKNA 2KANA 1E90A 2BYVE 3AB5A 2CR5A 3MC0B 1UWXA 3PRMB 3ZRCA 2JT4B 1UNSA 1QOBA 4OHJA 2PVOD 3IG3A 3ML8A 1GAQB 2BS4B 3SFDB 1E8ZA 3AE5B 1FCLA 2JU6X 1WXAA 4NAWB 1HA5A 1V5OA 2PEAA 1N61A 3OAWA 2KYWA 1XEEA 3T9LA 4N6EB 4B0MA 2KWUB 2I1KA 1I4QA 3NY5A 4HCPB 1R4NI 4ZOHC 1ET9A 2R2OA 1RM6C 4YTPB 1FXTB 1TIFA 2K22A 5G55A 4IW0A 1E10A 3A9JB 3VTUA 1AN8A 3ZO5B 1U4AA 2J53A 2WU5B 4ICVA 2ZNVB 5E6OA 2BGFA 1TKEA 4M8MA 4HVBA 3AU4A 3V6CB 2O6VA 2AQ1B 2LMCA 3NOBA 4RGOS 1YX6B 3HRDD 4NNJB 3AU5A 3R7QA 3VR9B 3BVMA 1C4AA 2INNE 4I6LB 3NVWA 1RFAA 3RNGC 2QJLA 3I5JC 3QCAA 3VQIA 3QX1A 1L4ZB 4PK1A 1ZPSA 2KTRB 1SEBD 1Q10A 4KGSA 2D3BA 3UQAA 2OJWA 3UINB 4S0RA 1YN5A 3U52E 1WWTA 3O13A 2KWCA 2LVQA 2DLBA 3EC8A 3IT6B 4ANXA 4HXDA 3ZYYX 3AXCA 3ZQ4A 2WXGA 2D10A 3Q3OC 4II3B 1XCTL 3VRAB 1FEHA 2JWUA 1KM7A 3ML9A 1SE2A 1YD8U 3P4PB 2W82A 4WAFA 4ZRIA 2FUG1 3QWZB 1EWCA 4RGMA 4BBNC 1FIQA 1SGHA 1WGDA 1D5ZC 1PDXA 2EKIA 3AULA 1FFUA 4K7SA 3SEBA 2DBYA 2MSED 2PKOA 2KD0A 2N9EB 1ZW7A 2RMMA 3U2SC 2ZW1A 2G3QB 2HDEA 4YTNB 4ICUA 2TSSA 3H9DA 2ZCCA 4EEWA 3QK0A 3URYA 3PV1A 3GP7A 4C80A 3I57A 2KK8A 1P9DU 2XEWA 1NI2A 3VUWA 2BWFA 2KJRA 4K7WA 1J7AA 2ZPNA 3ZJTA 4ZRKA 1TYGB 3QJZA 1ZUD2 2NPTA 3ZNGC 4DWFA 4WWPA 3P63A 4FXCA 2CHXA 3RUIB 2WXLA 2MCNB 3W1SA 4FJZA 3W5UB 4FULA 1ZXHA 2N9PC 2C7MB 2ZPYA 4LLGM 4FJVB 3PREA 4XX5A 3EECA 3V05A 2ZW0A 3E56A 2C7HA 1K50A 4JL9A 2AL6A 4DDID 3OWEB 4HJGE 3MHSD 4XWWA 2INPE 1PGBA 2KTFA 3ZDMC 4DBGA 1CK1A 2GI9A 2MQJA 2L52A 4IM0A 1YN3A 5G5GA 4O1NA 3D32A 2JZ3B 4C4VA 3DVGY 4K7UA 3VRBB 1B9RA 3A9KB 3W9CB 2FCQA 3H6NA 4KSLC 2FIDA 4P7IA 3M3JA 2C9WB 4MM3A 4NY0A 5TR5A 2ZVNA 4NJ6A 3ZJVA 3NVYA 2OHFA 1WRDB 2DHZA 3WAPA 1SIFA 4WWOA 2L05A 1V1OA 3UQBA 2AQ3B 1GB1A 2GBJA 3DBSA 1Z2MA 1OTRB 2MJEA 1QILA 1FO4A 1GPXA 3QA8A 3RFZB 3L0WB 2BKFA 2V3SA 3RI7C 3ZNHB 5BYQA 1TBEA 2DZIA 5D6JB 4OVZA 1R7SA 1G6JA 1N5XA 2HTHA 3GZNB 4II2B 4K3CA 4GOCA 5BMIA 2J4XA 1EUVB 3OG5A 2HE7A 3DBHB 2M0XA 2M17A 1WE6A 2BF8B 1IUEA 4EZKA 2K3UA 1E8WA 3FKYA 2FAZA 2OOBB 3RN9C 4P1CC 4WWMA 1XLQA 4IM3A 4ARCA 1ZE3D 5CHFA 1I4XA 5AZHA 5LNK1 4TV3A 2DYBA 5CX3A 1JWUD 2WX1A 1VD2A 3VTVA 4KIKA 3CIRB 1F1HA 3NG0A 2D3CA 1S3SG 2MBHA 3NS8A 2Z8LA 2W9NA 2WXKA 4DXFA 1L2NA 5TSSA 4ZHPA 2JPHA 2KDEB 4US8A 2CS4A 2JY6A 2E6XA 2N9LA 2NR2A 1MI0A 2DX5B 1I7HA 5GXGB 3AI5A 1QZEA 1JWSD 4NJ7A 3O65B 4D2KA 2A4ZA 3PO0A 2KX3A 1CQVA 2H88B 1V1PA 2L0FA 3VH4B 1L6VA 4B6WA 3AEFB 3VFKA 3QAQA 2N0SB 1DOIA 1GNUA 2O6VB 1F2RC 4PS3A 4A6QA 5IO9A 2N9KA 1L6UA 1YX5B 4FJYA 1FM0D 1E7VA 2Z59B 2YLMA 2GB1A 4HROA 5T8IA 2RSUA 2DZMA 2NS5A 3DWGC 2LGIA 2IY1B 5JH5C 3PZ7A 3Q8BA 5L95C 3AEEB 2WLBA 4XC2A 1Q1OA 3C19A 3RNEC 1NEKB 3Q3NC 4GSWA 4W9DA 3ZVVA 4CO7A 4JPSA 5EE3A 4LCDE 2EMSA 2FCSA 2IGGA 3AE2B 2LUMA 3H8HA 1K51A 2QEJC 1C3TA 1ROEA 1T6BX 2NVUI 4CQNA 5JXVA 3QIJA 5EE9A 3TIXA 1WX7A 1I4RA 2IO3B 4L1BA 4HPMB 3IHPC 4B0EA 4Q2JA 3EFCA 4PYZA 2NMQA 2NCNA 4JWSC 1F0ZA 2DZKA 4FADA 3KVFB 4KGTA 3EUB2 5DPRA 2WS3B 1PYWD 3VDZA 4N9F4 4KSKC 3LYYA 1MHHE 2Z0DB 2IZVB 1C9FA 4G50A 4XWTA 2MBQA 1LFDA 1F9JA 1YJJA 4RNAA 3PZDA 5GMVA 5AZFA 4XYCA 4YSZB 2MHJA 3HIZA 1K52A 2Y5PA 3PTFC 3Q6BA 1NI3A 3NS1A 4F7ZA 2BT6A 5LXHA 3LJ3A 2BB5A 3MTNB 1NYQA 2ZEQA 2QMTA 3AE7B 1R4MI 3RZFA 4TQ1A 2NPTB 3FILB 1KJTA 3L54A 4US9A 3V62A 2KZRA 3V60A 2HTME 5C23A 2G1EA 1Y56A 3SHQA 1DOXA 4A3OA 4AQ7A 4HWIB 4WH4A 3VH3B 4JGHB 5EDSA 4XE0A 4MH8A 3WALA 5HKHA 1YMHE 2D3AA 2LI5A 2QCZA 2WDVB 3RNAC 4HRSA 2QIEB 3JSVA 2J0MA 2XBBC 4ACFA 1JQ4A 2N4FA 2W3SA 2WX0A 3R66C 4MGZE 2MWSB 4IM2A 4K81A 3QARA 2KQ4X 4L23A 2J42A 1R4NB 2M19A 2DAJA 2KHWB 4LK0M 2WHIA 4C4VB 3A1QA 2IO1B 2MJ3A 1HQRD 4LNOA 1I4GA 4ANVA 5BYRA 1L4DB 3SU8X 4FBJB 1TKGA 3R3MA 4EE2A 3DPDA 4KDLB 5KHOA 2MBBB 5HHDG 3Q69A 4MM3B 2KX0A 5CHWA 4XZ4A 4AP4C 1KLUD 1JROA 2DNFA 3B2FA 1J7CA 1QOFA 4HCNB 2K6DB 3AEAB 5IOIA 3B0AA 3S2AA 3KH0A 3TSSA 2LRUA 3P1MA 1WJNA 2LJ5A 4W9JA 1TY2A 1FRDA 4ZRJA 2JYEA 4GDLA 2UYZB 4OZAA 1A70A 5D3IB 1J8CA 2JF5A 2Z0EB 3ECIA 3U8ZA 5HI1A 2E3TA 4NQLB 1HTQA 2DENB 1FPYA 1XLNA 3ZNZB 1LQBA 2WXIA 1VJKA 1E9MA 4I6NB 2RDGA 4AJWA 3TEXA 1LO5D 4RM9A 3AEBB 5H92C 2JWZA 1TKYA 3PHWB 4BAXA 4W9IA 2V1YA 4NPNA 1N5WA 4USAA 1DGJA 2JYTA 3T3NA 2V0GA 2BW2A 2GBKA 3P4RB 1J7BA 4TQ0A 4GB9A 1KF6B 3DWMA 5J2RA 4FHKA 4RMAA 4F8CB 4GDKA 1V2YA 3TEZA 5MPOA 2YEPF 2AWTA 3J9CA 1BUIC 1WSPA 4MGKE 5D3DA 1HTOA 4KIKB 5D7GA 2VH2A 1MG4A 1L0VB 4LDTB 4PYUA 2BS2B 2DZJA 3H1UA 1WGHA 1Z5SB 2QSDA 4ANWA 3BWUD 1C4PA 1LGRA 2L00B 4DXAB 4ZYSA 1KOTA 1E5WA 5I4DA 4KZ0A 2WXFA 4OW0A 2CU1A 4W9GA 1FNUA 3ALBA 1HZ6A 4DHJB 3P4QB 4MGIE 1WXSA 1MHXA 2PLPA 3UI3A 1D4BA 2LGDA 2D11A 4IKGA 3Q8AA 1V6EA 2WXPA 1V1PB 3GOEA 1Q0WB 1TS3A 2ZNVC 1I42A 2PTLA 2KMMA 5FK9C 1S1QB 1YQBA 3KW5B 1AARA 1GUAB 4RM8A 2D5GA 1QT9A 2KN4A 2KLCA 5C2TB 4GGQA 1AWDA 4WJOA 2BWES 3CSTA 3P4SB 5EE1A 2KT7A 4G0NB 2PE6B 1C4CA 1KRHA 2PJHA 3L13A 4RF0A 3P42A 1C76A 3N20C 3AE3B 2NBVB 3X23A 3IT4B 3PVLA 4GU2A 3NRZA 2IBIB 3N9YC 2PE9A 4ANUA 1WYWB 2RPQA 1P98A 4K1RB 4HLEA 3NVVA 3TL5A 2K6QA 2ZCBA 2YVCA 1ZDXA 3LXFA 3VTWA 4LDTD 4G11A 4W9LA 1IP9A 2FUHB 5CTRC 4ASWC 2KQ7A 2L8JA 2CHWA 2L1AA 4HJKA 4EUTA 1SSNA 3M95A 3I3TB 2WXRA 3OLMD 1JCKB 1V9JA 2D2QA 5DCNA 2KMAA 4DHJD 3I9V1 3KYCD 2PPHA 2WXJA 1UZXB 3H7PA 2C5LC 1ESFA 1YJ1A 2GRIA 4ZDVA 4PT5A 3VUXA 3AE1B 4W9FA 4AOFA 3AV8A 5DPWA 2KFJA 1PUTA 3PPAA 1BT0A 1VRAB 3DDCB 3V61A 2X8XX 1OQRA 2N7DA 1JWAD 2DWQA 1WJ6A 2I2YA 1SE9A 4G3XB 2XNAC 1WJ4A 1NENB 1ZOYB 4DK5A 2JRIB 5G2NA 4YWGG 4W9EA 2B3AA 1XD3B 3UIOB 4EFOA 1WJUA 4ZYNA 3RNFC 1TS4A 1EU4A 1RFKA 3AEDB 4HKQA 4HDOA 2CJOA 1M94A 2LVOA 5BMGA 2GBMA 2YEPB 3W2DA 3EA6A 2G4DB 1WGKA 2KOXA 3Q14C 4A55A 3A4SC 1WIAA 2IPKD 3UIPB 3UGBB 1WM3A 4M8NA 2KVZA 4EZLA 2L83A 2MJDA 3JSVB 1N6ZA 1P1AA 4RCOA 2K1FA 4HEA1 1HEZE 2WNMA 1JW9D 2IGDA 1FNVA 3BYYB 3ZIMA 1GB4A 3RNBC 4ZRQA 4FA6A 2BBCA 3WCQA 1OEYJ 4L2YA 4GN1A 3A1QB 2AL3A 5AZGA 2INCC 1GC7A 2L3ZA 5E6NA 5JHAA 3KYDD 5HG2A 5L83A 3X0WA 2M0AA 4KZCA 2K8HA 3PLUA 1UELA 4AUQC 4HK2A 4J6IA 1HE8A 2RR9A 4KX6B 1H8CA 3U30A 2KN5A 1SE4A 5JHBA 1YNTE 3Q3FA 4NZLB 4CHKA 1ET6A 2KAJA 3ZNID 2HJ1A 5IKCM 4K3BA 2FIFA 2L7RA 1VLBA 4LNNA 4BOSC 3TUOA 1UGMA 3AECB 1CJEA 4WQOB
chains in the Genus database with same CATH topology
3NOBA 1IYFA 4F7ZA 2NBWB 1LXDA 1YX6B 4GDLB 3LJ3A 3AU5A 4NNJB 5LXHA 3R7QA 1ZKHA 2KWVB 3MTNB 4I6LB 1J0GA 1RFAA 2ZEQA 3RT3B 3QCAA 1R4MI 3QX1A 3RZFA 3VQIA 3U7DA 4TQ1A 4MGYE 4KVGB 1WFYA 2NPTB 1KJTA 2K8CA 2KTRB 3L54A 5E6PA 1MG8A 3V62A 5J17A 2KZRA 3V60A 1RLFA 5C23A 3UQAA 3PRZA 3UINB 2J0KA 3PT2B 2LASA 4IC7B 3SHQA 2KWCA 4A3OA 4OVUA 3L08A 2LVQA 4HWIB 2KDFB 3ONSA 1TGZB 3RCZA 2DAFA 3VH3B 4JGHB 3ZKJC 3EC8A 1UBQA 3PHXB 4ANXA 5EDSA 4HXDA 3WALA 3ZW3A 3AXCA 5HKHA 2LI5A 3VUYA 2AEHA 2A5UA 2D10A 1WXMA 3JSVA 2ASQA 2D07B 1L7YA 3KUDB 2J0MA 4II3B 2XBBC 2N4FA 3W1YA 2WX0A 3R66C 4MGZE 2MWSB 4IM2A 4K81A 3QARA 4GDKB 3WAMA 1KM7A 3ML9A 1WH3A 1WZ3A 1GC6A 2Y5BB 1WX9A 1YD8U 2C60A 4NAWA 4ZRIA 2KQSA 2DAJA 3QWZB 2KHWB 2ZZPB 1K8RB 1P3QU 3MJWA 1X1MA 3A1QA 1T0YA 2IO1B 4BBNC 2KNBA 1WMHB 4B9KA 1OQYA 1SGHA 1WGDA 4FLHA 1D3ZA 2FCNA 2LVPA 3DCGA 4MDKE 4ANVA 4LJPB 3SU8X 4FBJB 4WWNA 3R3MA 3N32A 3DVNU 3DPDA 4KDLB 3AULA 5LLIA 3RD2A 4K7SA 5KHOA 2MBBB 4IWQA 2G45B 2MSED 1NDDA 2KX0A 5DPTA 1J19A 1V81A 2KD0A 5CHWA 2N9EB 1ZW7A 3HM3A 4XZ4A 4JQWC 4AP4C 3A9JA 2G3QB 2HJ8A 2KVRA 3PGEA 4ICUA 3H9DA 2NBUA 1E8YA 3N30A 2ZCCA 2K6DB 3QK0A 4HCNB 4EEWA 3PV1A 3B0AA 2N7EA 3KH0A 3S2AA 4M0WB 3VAWA 2LRUA 3B1LX 1WJNA 1LM8B 2KFKB 2KK8A 4A20A 1P9DU 2XEWA 5JZEB 3LDZE 1NI2A 3VUWA 2LJ5A 3TJPA 4W9JA 2BWFA 2KJRA 4K7WA 3A4RA 4ZRJA 4GDLA 2UYZB 2ZPNA 2L76A 4FN2A 1J8CA 1Q5WB 2JF5A 2Z0EB 4ZRKA 2BPSA 1UD7A 3CMMB 3ECIA 3U8ZA 3ZRFA 3L16A 3QJZA 4NQLB 3JYUA 2NPTA 1VCBA 2LD9A 3ZNGC 4DWFA 2KTRA 4WWPA 2DENB 2IY0B 3ZNZB 1LQBA 2CHXA 3RUIB 3PLVA 1EO6A 4IWPA 2MCNB 3HK0A 1IPGA 3ZTCA 4I6NB 3KUZA 3W1SA 3P2BA 4FJZA 4AJWA 1EF1A 4A3PA 4FULA 4EKUA 2N9PC 4PS7A 2C7MB 2ZPYA 4FJVB 2XK5B 4RM9A 1OEYA 3PREA 1V5TA 3H7SA 3N3KB 3ZDTA 4XX5A 4BKSD 4IG7B 3EECA 2JWZA 2C7HA 3PHWB 2KLGA 4KV2A 4I6PA 4JL9A 2AL6A 4W9IA 2V1YA 4GIVA 4NPNA 4DDID 4BKSA 3MHSD 3GZNI 3T8MA 4CYEA 2GBKA 4W9CA 3OJ4B 4TQ0A 3NHEB 2VRRB 2KTFA 3ZDMC 4GB9A 4DBGA 2MBEA 2KXJA 3DBHI 2MQJA 2LUEA 5J2RA 4FHKA 1WI0A 4RMAA 4IM0A 4GDKA 4F8CB 1V2YA 4IUMB 2AWTA 2MX2A 1A5RA 3UF8A 2BYEA 4MGKE 2KMCA 3IVFA 4EZJA 1KLVA 3D32A 2LZ6A 2JZ3B 1V80A 4BVUC 4WJNA 3DVGY 4NQKE 4K7UA 2CKHB 1WMHA 3A9KB 2ZVOA 4KIKB 2FCQA 2LXAA 5D7GA 3QQ8B 3H6NA 1I35A 4LDTB 5C1ZA 4PYUA 4KSLC 2FIDA 4P7IA 2KJ6A 4MSQB 3M3JA 2DZJA 2J0JA 2C9WB 2MW5A 2KO3A 3H1UA 1WGGA 1WGHA 1Z5SB 4MM3A 4NY0A 5TR5A 4ANWA 1UH6A 2ZVNA 4GMVA 2L00B 4DXAB 1KOTA 1E5WA 4NJ6A 3HM6X 1UBIA 4KZ0A 1WRDB 4JLCA 2DHZA 3L17A 2CU1A 3WAPA 1SIFA 1TTNA 4W9GA 4WWOA 2GBRA 2L05A 3PS6A 3ALBA 2G4SA 2O2VB 2JUOA 3H7PB 4B95A 2KDIA 4MGIE 4BOZB 4DHJB 3UQBA 5IA7A 2DYMA 1WXSA 1V49A 4X57B 2K39A 2RGFA 2GBJA 3JW0X 5FR6A 3VXWA 2MLBA 2KFKA 1WX8A 1Y8RC 2LGDA 2D11A 3DBSA 4GXBA 1Z2MA 2GBNA 1OTRB 3HHMA 1V6EA 3GOEA 4EOYA 1Q0WB 3QA8A 2ZNVC 4BBNF 1I42A 3L0WB 2BKFA 3B08A 1XQQA 1S1QB 1YQBA 2M1MA 3ENEA 2V3SA 3KW5B 1AARA 1GUAB 4RM8A 2N9XA 3ZNHB 2BYFA 2RD0A 1WR6E 1TBEA 2DZIA 2I1JA 4PS8A 5D6JB 2L0TA 1XT9B 2KLCA 3ZUNA 4FHJA 1WXVA 2JXXA 1G6JA 4GGQA 2HTHA 4WJOA 3QC8B 3TMPB 2BWES 1WZ0A 3CSFA 3CSTA 2JZZA 3ZLZA 4II2B 1CMXB 2XK5A 2WWZA 3KUCB 4G0NB 4GOCA 1YIWA 2PE6B 5AEKB 1EUVB 1WGRA 1WY8A 2PJHA 3L13A 2N1WA 3DBLI 5KHQA 2AYOB 2HE7A 2M0XA 2GMIC 2NBVB 4IWOA 4WJQA 3W1SC 3X23A 2M17A 3PVLA 3WANA 1WE6A 2LGYA 3DVNV 4GU2A 1ZGUB 2BF8B 2IBIB 2PE9A 4ANUA 2MA9B 4EZKA 1WYWB 2EKEC 1E8WA 3WIMA 2RPQA 3APFA 2FAZA 2M4NA 2OOBB 5LXIB 3VVWB 1P98A 5IAAC 1GG3A 2DYOA 4W9KA 4IM3A 4K1RB 2LXCA 4HLEA 2KJHB 2K6QA 3OJ3A 3TL5A 1GJZA 2ZCBA 2YVCA 2UWQA 2R2QA 5CHFA 5AZHA 3DBRI 2FCMA 2EMTA 4TV3A 4MH0E 2DYBA 5CX3A 2KC2A 3VTWA 2MP2B 2J7QB 2K25A 2WX1A 4LDTD 2LRWA 4G11A 2MRPA 1VD2A 4W9LA 3VTVA 3RYTA 4MJSB 3A9KA 3A33B 4KIKA 4AWJA 3TCAA 2JVCA 1IP9A 2FUHB 5CTRC 4ASWC 1S3SG 2KQ7A 2MBHA 2L8JA 2CHWA 3NS8A 3V6EB 4WJPA 4HJKA 3NZUA 4EUTA 1TZ1A 1E8XA 3RZWC 2O6VD 2W9NA 2ZJDA 3M95A 3I3TB 3BINA 4WAAA 3OLMD 3PRPB 3QHTA 4HPLB 4YL8A 1L2NA 1WF9A 1V9JA 2D2QA 2JPHA 5DCNA 2KDEB 1E7UA 1OGWA 2CS4A 2IO2B 2KMAA 3TBLD 4DHJD 2JY6A 3K9PB 3KYCD 2MBOA 2PPHA 1P0RA 4URKA 1RRBA 2NR2A 2DX5B 1UZXB 2O2VA 4MEMA 3H7PA 3AI5A 4BKTA 1QZEA 2C5LC 3DOWA 4NJ7A 1YJ1A 2KDBA 2N1VA 3O65B 2KKCA 4ZDVA 4E71A 2A4ZA 3DQVA 3VUXA 4W9FA 4AOFA 3NZSA 2OJRA 5DPWA 5D94A 1V86A 2KFJA 2KX3A 3PPAA 2M8SA 1ISNA 1BT0A 2HD5B 4E74A 2D3GA 3EFUA 2L0FA 3SD5A 3DDCB 3VH4B 3IFWB 2GOWA 3BY4B 2LGXA 3V61A 4B6WA 3VFKA 2N7DA 3QAQA 2WYQA 1GNUA 2O6VB 1WJ6A 4MSMB 1SE9A 3K9OB 4G3XB 4OVVA 4PS3A 1WM2A 1YX5B 1WJ4A 4FJYA 4DK5A 2JRIB 1E7VA 5G2NA 4W9EA 2Z59B 3ZTDA 2B3AA 2YLMA 3APCA 4W9HA 5BO4B 1XD3B 1PQSA 3UIOB 4LJOB 4BFRA 2RSUA 2DZMA 2CHZA 2NS5A 4EFOA 1WJUA 4DHZB 2BKRB 2IYDB 3APDA 4DDGD 1C1YB 3L10B 5CHVC 4BKGA 1RAXA 2IY1B 4ZYNA 5JH5C 2KC1A 5L95C 4XC2A 1Q1OA 4HDOA 1M94A 2LVOA 2GBMA 2REXA 4AJYB 3EHVA 2G4DB 5D2MB 4GSWA 4W9DA 3ZVVA 4CO7A 1WR1A 2JRHA 2KOXA 3DVGX 4LCDE 3A4SC 1WIAA 3IBEA 2EMSA 2C7NB 1WGYA 2FCSA 5DPSA 1NBFC 4F1SA 4TKNA 2KANA 3UIPB 1E90A 3UGBB 1WM3A 2BYVE 2CR5A 4M8NA 4EZLA 3CF6E 3PRMB 1C3TA 3R7RA 3VHTC 2JT4B 3ZRCA 3JSVB 3M62B 1P1AA 2K8BA 3M63B 5J18A 2K1FA 2NVUI 3IG3A 3ML8A 2MP2A 1JRUA 2FNJB 3QIJA 3ZIMA 3TIXA 1WX7A 4MJSA 4FA6A 4KDIC 2IO3B 1E8ZA 4HPMB 3IHPC 1WXAA 3C0RB 4NAWB 1V5OA 2PEAA 1OEYJ 3OAWA 4PYZA 3T9LA 4MELA 4GN1A 3A1QB 2KWUB 2AL3A 2NCNA 5AZGA 1GC7A 2I1KA 4JIOU 2DZKA 3RULA 4FADA 2L3ZA 5E6NA 3WA0A 3KVFB 5JHAA 3KYDD 4DHZE 1EF5A 3NY5A 4HCPB 3X0WA 5L83A 1R4NI 2QHOA 4KZCA 5DPRA 2K8HA 1WE7A 3PLUA 1UELA 4AUQC 2R2OA 2LWPA 4HK2A 4J6IA 3Q3JA 1HE8A 3VDZA 2RR9A 4N9F4 1FXTB 4KSKC 1H8CA 3U30A 2KN5A 3PSEB 5JHBA 1H4RA 4IW0A 5G55A 3SDLC 3Q3FA 3A9JB 3VTUA 4CHKA 2Z0DB 2IZVB 3WAOA 3ZNID 3ZO5B 4G50A 4TUUA 1U4AA 4E3CA 2MBQA 2WDTB 1LFDA 1F9JA 3JVZX 2FIFA 2L7RA 3PZDA 5GMVA 4ICVA 2V4LA 2ZNVB 2IO0B 5AZFA 5E6OA 2BGFA 3HIZA 3PTFC 4M8MA 4HVBA 4BOSC 1UGMA 4HDQA 3AU4A 4WQOB 3V6CB 2O6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOB A;  1IYF A;  4F7Z A;  2NBW B;  1LXD A;  1YX6 B;  4GDL B;  3LJ3 A;  3AU5 A;  4NNJ B;  5LXH A;  3R7Q A;  1ZKH A;  2KWV B;  3MTN B;  4I6L B;  1J0G A;  1RFA A;  2ZEQ A;  3RT3 B;  3QCA A;  1R4M I;  3QX1 A;  3RZF A;  3VQI A;  3U7D A;  4TQ1 A;  4MGY E;  4KVG B;  1WFY A;  2NPT B;  1KJT A;  2K8C A;  2KTR B;  3L54 A;  5E6P A;  1MG8 A;  3V62 A;  5J17 A;  2KZR A;  3V60 A;  1RLF A;  5C23 A;  3UQA A;  3PRZ A;  3UIN B;  2J0K A;  3PT2 B;  2LAS A;  4IC7 B;  3SHQ A;  2KWC A;  4A3O A;  4OVU A;  3L08 A;  2LVQ A;  4HWI B;  2KDF B;  3ONS A;  1TGZ B;  3RCZ A;  2DAF A;  3VH3 B;  4JGH B;  3ZKJ C;  3EC8 A;  1UBQ A;  3PHX B;  4ANX A;  5EDS A;  4HXD A;  3WAL A;  3ZW3 A;  3AXC A;  5HKH A;  2LI5 A;  3VUY A;  2AEH A;  2A5U A;  2D10 A;  1WXM A;  3JSV A;  2ASQ A;  2D07 B;  1L7Y A;  3KUD B;  2J0M A;  4II3 B;  2XBB C;  2N4F A;  3W1Y A;  2WX0 A;  3R66 C;  4MGZ E;  2MWS B;  4IM2 A;  4K81 A;  3QAR A;  4GDK B;  3WAM A;  1KM7 A;  3ML9 A;  1WH3 A;  1WZ3 A;  1GC6 A;  2Y5B B;  1WX9 A;  1YD8 U;  2C60 A;  4NAW A;  4ZRI A;  2KQS A;  2DAJ A;  3QWZ B;  2KHW B;  2ZZP B;  1K8R B;  1P3Q U;  3MJW A;  1X1M A;  3A1Q A;  1T0Y A;  2IO1 B;  4BBN C;  2KNB A;  1WMH B;  4B9K A;  1OQY A;  1SGH A;  1WGD A;  4FLH A;  1D3Z A;  2FCN A;  2LVP A;  3DCG A;  4MDK E;  4ANV A;  4LJP B;  3SU8 X;  4FBJ B;  4WWN A;  3R3M A;  3N32 A;  3DVN U;  3DPD A;  4KDL B;  3AUL A;  5LLI A;  3RD2 A;  4K7S A;  5KHO A;  2MBB B;  4IWQ A;  2G45 B;  2MSE D;  1NDD A;  2KX0 A;  5DPT A;  1J19 A;  1V81 A;  2KD0 A;  5CHW A;  2N9E B;  1ZW7 A;  3HM3 A;  4XZ4 A;  4JQW C;  4AP4 C;  3A9J A;  2G3Q B;  2HJ8 A;  2KVR A;  3PGE A;  4ICU A;  3H9D A;  2NBU A;  1E8Y A;  3N30 A;  2ZCC A;  2K6D B;  3QK0 A;  4HCN B;  4EEW A;  3PV1 A;  3B0A A;  2N7E A;  3KH0 A;  3S2A A;  4M0W B;  3VAW A;  2LRU A;  3B1L X;  1WJN A;  1LM8 B;  2KFK B;  2KK8 A;  4A20 A;  1P9D U;  2XEW A;  5JZE B;  3LDZ E;  1NI2 A;  3VUW A;  2LJ5 A;  3TJP A;  4W9J A;  2BWF A;  2KJR A;  4K7W A;  3A4R A;  4ZRJ A;  4GDL A;  2UYZ B;  2ZPN A;  2L76 A;  4FN2 A;  1J8C A;  1Q5W B;  2JF5 A;  2Z0E B;  4ZRK A;  2BPS A;  1UD7 A;  3CMM B;  3ECI A;  3U8Z A;  3ZRF A;  3L16 A;  3QJZ A;  4NQL B;  3JYU A;  2NPT A;  1VCB A;  2LD9 A;  3ZNG C;  4DWF A;  2KTR A;  4WWP A;  2DEN B;  2IY0 B;  3ZNZ B;  1LQB A;  2CHX A;  3RUI B;  3PLV A;  1EO6 A;  4IWP A;  2MCN B;  3HK0 A;  1IPG A;  3ZTC A;  4I6N B;  3KUZ A;  3W1S A;  3P2B A;  4FJZ A;  4AJW A;  1EF1 A;  4A3P A;  4FUL A;  4EKU A;  2N9P C;  4PS7 A;  2C7M B;  2ZPY A;  4FJV B;  2XK5 B;  4RM9 A;  1OEY A;  3PRE A;  1V5T A;  3H7S A;  3N3K B;  3ZDT A;  4XX5 A;  4BKS D;  4IG7 B;  3EEC A;  2JWZ A;  2C7H A;  3PHW B;  2KLG A;  4KV2 A;  4I6P A;  4JL9 A;  2AL6 A;  4W9I A;  2V1Y A;  4GIV A;  4NPN A;  4DDI D;  4BKS A;  3MHS D;  3GZN I;  3T8M A;  4CYE A;  2GBK A;  4W9C A;  3OJ4 B;  4TQ0 A;  3NHE B;  2VRR B;  2KTF A;  3ZDM C;  4GB9 A;  4DBG A;  2MBE A;  2KXJ A;  3DBH I;  2MQJ A;  2LUE A;  5J2R A;  4FHK A;  1WI0 A;  4RMA A;  4IM0 A;  4GDK A;  4F8C B;  1V2Y A;  4IUM B;  2AWT A;  2MX2 A;  1A5R A;  3UF8 A;  2BYE A;  4MGK E;  2KMC A;  3IVF A;  4EZJ A;  1KLV A;  3D32 A;  2LZ6 A;  2JZ3 B;  1V80 A;  4BVU C;  4WJN A;  3DVG Y;  4NQK E;  4K7U A;  2CKH B;  1WMH A;  3A9K B;  2ZVO A;  4KIK B;  2FCQ A;  2LXA A;  5D7G A;  3QQ8 B;  3H6N A;  1I35 A;  4LDT B;  5C1Z A;  4PYU A;  4KSL C;  2FID A;  4P7I A;  2KJ6 A;  4MSQ B;  3M3J A;  2DZJ A;  2J0J A;  2C9W B;  2MW5 A;  2KO3 A;  3H1U A;  1WGG A;  1WGH A;  1Z5S B;  4MM3 A;  4NY0 A;  5TR5 A;  4ANW A;  1UH6 A;  2ZVN A;  4GMV A;  2L00 B;  4DXA B;  1KOT A;  1E5W A;  4NJ6 A;  3HM6 X;  1UBI A;  4KZ0 A;  1WRD B;  4JLC A;  2DHZ A;  3L17 A;  2CU1 A;  3WAP A;  1SIF A;  1TTN A;  4W9G A;  4WWO A;  2GBR A;  2L05 A;  3PS6 A;  3ALB A;  2G4S A;  2O2V B;  2JUO A;  3H7P B;  4B95 A;  2KDI A;  4MGI E;  4BOZ B;  4DHJ B;  3UQB A;  5IA7 A;  2DYM A;  1WXS A;  1V49 A;  4X57 B;  2K39 A;  2RGF A;  2GBJ A;  3JW0 X;  5FR6 A;  3VXW A;  2MLB A;  2KFK A;  1WX8 A;  1Y8R C;  2LGD A;  2D11 A;  3DBS A;  4GXB A;  1Z2M A;  2GBN A;  1OTR B;  3HHM A;  1V6E A;  3GOE A;  4EOY A;  1Q0W B;  3QA8 A;  2ZNV C;  4BBN F;  1I42 A;  3L0W B;  2BKF A;  3B08 A;  1XQQ A;  1S1Q B;  1YQB A;  2M1M A;  3ENE A;  2V3S A;  3KW5 B;  1AAR A;  1GUA B;  4RM8 A;  2N9X A;  3ZNH B;  2BYF A;  2RD0 A;  1WR6 E;  1TBE A;  2DZI A;  2I1J A;  4PS8 A;  5D6J B;  2L0T A;  1XT9 B;  2KLC A;  3ZUN A;  4FHJ A;  1WXV A;  2JXX A;  1G6J A;  4GGQ A;  2HTH A;  4WJO A;  3QC8 B;  3TMP B;  2BWE S;  1WZ0 A;  3CSF A;  3CST A;  2JZZ A;  3ZLZ A;  4II2 B;  1CMX B;  2XK5 A;  2WWZ A;  3KUC B;  4G0N B;  4GOC A;  1YIW A;  2PE6 B;  5AEK B;  1EUV B;  1WGR A;  1WY8 A;  2PJH A;  3L13 A;  2N1W A;  3DBL I;  5KHQ A;  2AYO B;  2HE7 A;  2M0X A;  2GMI C;  2NBV B;  4IWO A;  4WJQ A;  3W1S C;  3X23 A;  2M17 A;  3PVL A;  3WAN A;  1WE6 A;  2LGY A;  3DVN V;  4GU2 A;  1ZGU B;  2BF8 B;  2IBI B;  2PE9 A;  4ANU A;  2MA9 B;  4EZK A;  1WYW B;  2EKE C;  1E8W A;  3WIM A;  2RPQ A;  3APF A;  2FAZ A;  2M4N A;  2OOB B;  5LXI B;  3VVW B;  1P98 A;  5IAA C;  1GG3 A;  2DYO A;  4W9K A;  4IM3 A;  4K1R B;  2LXC A;  4HLE A;  2KJH B;  2K6Q A;  3OJ3 A;  3TL5 A;  1GJZ A;  2ZCB A;  2YVC A;  2UWQ A;  2R2Q A;  5CHF A;  5AZH A;  3DBR I;  2FCM A;  2EMT A;  4TV3 A;  4MH0 E;  2DYB A;  5CX3 A;  2KC2 A;  3VTW A;  2MP2 B;  2J7Q B;  2K25 A;  2WX1 A;  4LDT D;  2LRW A;  4G11 A;  2MRP A;  1VD2 A;  4W9L A;  3VTV A;  3RYT A;  4MJS B;  3A9K A;  3A33 B;  4KIK A;  4AWJ A;  3TCA A;  2JVC A;  1IP9 A;  2FUH B;  5CTR C;  4ASW C;  1S3S G;  2KQ7 A;  2MBH A;  2L8J A;  2CHW A;  3NS8 A;  3V6E B;  4WJP A;  4HJK A;  3NZU A;  4EUT A;  1TZ1 A;  1E8X A;  3RZW C;  2O6V D;  2W9N A;  2ZJD A;  3M95 A;  3I3T B;  3BIN A;  4WAA A;  3OLM D;  3PRP B;  3QHT A;  4HPL B;  4YL8 A;  1L2N A;  1WF9 A;  1V9J A;  2D2Q A;  2JPH A;  5DCN A;  2KDE B;  1E7U A;  1OGW A;  2CS4 A;  2IO2 B;  2KMA A;  3TBL D;  4DHJ D;  2JY6 A;  3K9P B;  3KYC D;  2MBO A;  2PPH A;  1P0R A;  4URK A;  1RRB A;  2NR2 A;  2DX5 B;  1UZX B;  2O2V A;  4MEM A;  3H7P A;  3AI5 A;  4BKT A;  1QZE A;  2C5L C;  3DOW A;  4NJ7 A;  1YJ1 A;  2KDB A;  2N1V A;  3O65 B;  2KKC A;  4ZDV A;  4E71 A;  2A4Z A;  3DQV A;  3VUX A;  4W9F A;  4AOF A;  3NZS A;  2OJR A;  5DPW A;  5D94 A;  1V86 A;  2KFJ A;  2KX3 A;  3PPA A;  2M8S A;  1ISN A;  1BT0 A;  2HD5 B;  4E74 A;  2D3G A;  3EFU A;  2L0F A;  3SD5 A;  3DDC B;  3VH4 B;  3IFW B;  2GOW A;  3BY4 B;  2LGX A;  3V61 A;  4B6W A;  3VFK A;  2N7D A;  3QAQ A;  2WYQ A;  1GNU A;  2O6V B;  1WJ6 A;  4MSM B;  1SE9 A;  3K9O B;  4G3X B;  4OVV A;  4PS3 A;  1WM2 A;  1YX5 B;  1WJ4 A;  4FJY A;  4DK5 A;  2JRI B;  1E7V A;  5G2N A;  4W9E A;  2Z59 B;  3ZTD A;  2B3A A;  2YLM A;  3APC A;  4W9H A;  5BO4 B;  1XD3 B;  1PQS A;  3UIO B;  4LJO B;  4BFR A;  2RSU A;  2DZM A;  2CHZ A;  2NS5 A;  4EFO A;  1WJU A;  4DHZ B;  2BKR B;  2IYD B;  3APD A;  4DDG D;  1C1Y B;  3L10 B;  5CHV C;  4BKG A;  1RAX A;  2IY1 B;  4ZYN A;  5JH5 C;  2KC1 A;  5L95 C;  4XC2 A;  1Q1O A;  4HDO A;  1M94 A;  2LVO A;  2GBM A;  2REX A;  4AJY B;  3EHV A;  2G4D B;  5D2M B;  4GSW A;  4W9D A;  3ZVV A;  4CO7 A;  1WR1 A;  2JRH A;  2KOX A;  3DVG X;  4LCD E;  3A4S C;  1WIA A;  3IBE A;  2EMS A;  2C7N B;  1WGY A;  2FCS A;  5DPS A;  1NBF C;  4F1S A;  4TKN A;  2KAN A;  3UIP B;  1E90 A;  3UGB B;  1WM3 A;  2BYV E;  2CR5 A;  4M8N A;  4EZL A;  3CF6 E;  3PRM B;  1C3T A;  3R7R A;  3VHT C;  2JT4 B;  3ZRC A;  3JSV B;  3M62 B;  1P1A A;  2K8B A;  3M63 B;  5J18 A;  2K1F A;  2NVU I;  3IG3 A;  3ML8 A;  2MP2 A;  1JRU A;  2FNJ B;  3QIJ A;  3ZIM A;  3TIX A;  1WX7 A;  4MJS A;  4FA6 A;  4KDI C;  2IO3 B;  1E8Z A;  4HPM B;  3IHP C;  1WXA A;  3C0R B;  4NAW B;  1V5O A;  2PEA A;  1OEY J;  3OAW A;  4PYZ A;  3T9L A;  4MEL A;  4GN1 A;  3A1Q B;  2KWU B;  2AL3 A;  2NCN A;  5AZG A;  1GC7 A;  2I1K A;  4JIO U;  2DZK A;  3RUL A;  4FAD A;  2L3Z A;  5E6N A;  3WA0 A;  3KVF B;  5JHA A;  3KYD D;  4DHZ E;  1EF5 A;  3NY5 A;  4HCP B;  3X0W A;  5L83 A;  1R4N I;  2QHO A;  4KZC A;  5DPR A;  2K8H A;  1WE7 A;  3PLU A;  1UEL A;  4AUQ C;  2R2O A;  2LWP A;  4HK2 A;  4J6I A;  3Q3J A;  1HE8 A;  3VDZ A;  2RR9 A;  4N9F 4;  1FXT B;  4KSK C;  1H8C A;  3U30 A;  2KN5 A;  3PSE B;  5JHB A;  1H4R A;  4IW0 A;  5G55 A;  3SDL C;  3Q3F A;  3A9J B;  3VTU A;  4CHK A;  2Z0D B;  2IZV B;  3WAO A;  3ZNI D;  3ZO5 B;  4G50 A;  4TUU A;  1U4A A;  4E3C A;  2MBQ A;  2WDT B;  1LFD A;  1F9J A;  3JVZ X;  2FIF A;  2L7R A;  3PZD A;  5GMV A;  4ICV A;  2V4L A;  2ZNV B;  2IO0 B;  5AZF A;  5E6O A;  2BGF A;  3HIZ A;  3PTF C;  4M8M A;  4HVB A;  4BOS C;  1UGM A;  4HDQ A;  3AU4 A;  4WQO B;  3V6C B;  2O6V A; 
#chains in the Genus database with same CATH topology
 2MEK A;  1LXD A;  4GDL B;  4KGR A;  3AH7 A;  3I63 C;  1JAL A;  2WGS A;  3RT3 B;  2N7J A;  2OED A;  1T0Q C;  4MGY E;  3VR8 B;  1F2R I;  2K8C A;  3KWL A;  3B9J A;  3ZXR A;  1MG8 A;  1RLF A;  2QDF A;  2WXO A;  3GS2 A;  2J0K A;  1IBX A;  4IC7 B;  1RWS A;  1SJE D;  1VR9 A;  3L08 A;  3RCZ A;  3ZKJ C;  3LB8 C;  1TS2 A;  3VUY A;  2AEH A;  3BVG A;  3KLS X;  2D07 B;  1L7Y A;  2NTT A;  1QOG A;  3WAM A;  4GDK B;  1XF5 L;  2Y5B B;  3MC8 A;  1BML C;  1WX9 A;  2C60 A;  2KQS A;  4C00 A;  2ZZP B;  2IGH A;  1K8R B;  1VZ6 A;  1VDV A;  3MJW A;  1T0Y A;  3KQ4 A;  2KNB A;  4B9K A;  1OQY A;  2LVP A;  1EM7 A;  4LJP B;  4WWN A;  2V4I B;  5LLI A;  2AQ2 B;  1V97 A;  4IWQ A;  1J19 A;  2V3P A;  1MJD A;  2HJ8 A;  2KVR A;  1FRR A;  2NBU A;  1EU3 A;  1CZP A;  1E8Y A;  3N30 A;  3Q2A C;  3FAH A;  2N7E A;  3BK1 A;  4MT5 A;  1R4M B;  3B1L X;  4DQO C;  1NYR A;  4A20 A;  5JZE B;  3TJP A;  3BK2 A;  4YSY B;  3W5V B;  2L76 A;  1Q5W B;  3DHI C;  4DXG A;  3MP9 A;  1UD7 A;  2XN9 C;  1TY0 A;  3L16 A;  3JYU A;  1VCB A;  2LD9 A;  2IY0 B;  4C7Z A;  4HPP A;  2GLS A;  3Q8C A;  4IWP A;  3ZTC A;  1IPG A;  3ZJU A;  1T3Q A;  1EF1 A;  4RGN A;  4A3P A;  4EKU A;  4ZHO A;  1IGC A;  1HXY D;  1V5T A;  3H7S A;  3N3K B;  3ZDT A;  1P7F A;  4IG7 B;  3R8B A;  4KV2 A;  3V3X A;  4BKS A;  2V3N A;  3T8M A;  4CYE A;  1IGD A;  1ENF A;  2LJI A;  3OJ4 B;  2MBE A;  2KXJ A;  2LUE A;  4JE3 B;  1SE3 A;  2MX2 A;  1B1Z A;  1A5R A;  2KMC A;  3IVF A;  2LZ6 A;  4J3O D;  4NQK E;  2UU7 A;  1WMH A;  1TZO A;  1I35 A;  1SJH D;  3MJ5 A;  5C1Z A;  1N62 A;  2J0J A;  2W54 A;  1KLG D;  1WGG A;  3GB1 A;  1UH6 A;  3SFE B;  4GMV A;  3HM6 X;  4JLC A;  3L17 A;  4A90 A;  4YT0 B;  2GBR A;  3PS6 A;  2G4S A;  3H7P B;  5AUI A;  1YQ4 B;  2KDI A;  3IAS 1;  1AW7 A;  4B95 A;  3GE3 C;  4M0W A;  5IA7 A;  1V49 A;  4X57 B;  2K39 A;  2RGF A;  1RYJ A;  5FR6 A;  3VXW A;  2MLB A;  3RNC C;  1PGA A;  2KFK A;  4GXB A;  1JML A;  2BYT A;  4EOY A;  3ENE A;  2M1M A;  5EE0 A;  1VZ7 A;  2N9X A;  3DBR B;  2VZK B;  2BYF A;  1WR6 E;  4ZRP A;  2WDQ B;  4N59 A;  4C7Y A;  1D5X C;  3ZUN A;  4FHJ A;  2WXN A;  1WXV A;  2ACZ B;  1TJE A;  3QC8 B;  2LGS A;  1WZ0 A;  2K9X A;  2LFI A;  1KTK A;  1CMX B;  2XK5 A;  2WWZ A;  3KUC B;  1YIW A;  1WY8 A;  3DBL I;  4WJQ A;  4IWO A;  3W1S C;  1WYG A;  2WDR B;  1SF0 A;  3DVN V;  2CU3 A;  1T0R C;  2MA9 B;  2ONQ A;  3APF A;  2BVC A;  5IAA C;  3HVD A;  4W9K A;  2LXC A;  2KJH B;  3OJ3 A;  1GJZ A;  2UWQ A;  3DBR I;  2K0P A;  2EMT A;  2KC2 A;  1E7P B;  2K25 A;  5FKA C;  2LRW A;  1MVK A;  2MH7 A;  3A33 B;  4AWJ A;  3TCA A;  3ZGZ A;  3V6E B;  1MFW A;  1F52 A;  3NZU A;  1TZ1 A;  3RZW C;  4N58 A;  2VH1 A;  3BIN A;  3QHT A;  3PRP B;  4WIP A;  4P16 A;  4TMA B;  2B76 B;  3TBL D;  3NVZ A;  4A8X C;  1SXT A;  4XDC A;  1C78 A;  1OFF A;  2MBO A;  2EEL A;  4URK A;  1JRP A;  4LNF A;  2O2V A;  4WUR A;  4MEM A;  2JQR B;  4BKT A;  4M00 A;  2KDB A;  2KKC A;  3NZS A;  2OJR A;  4R3D A;  2D3G A;  2M56 B;  2Q5W D;  2VZK D;  1SIJ A;  3KWV A;  3IFW B;  3BY4 B;  4YTM B;  3B2G A;  4IDI A;  4MSM B;  1STE A;  4WQM A;  1ZDV A;  1VZ8 A;  4OVV A;  1F77 A;  5FR3 A;  2LHE A;  3ZTD A;  3APC A;  4W9H A;  5BO4 B;  1PQS A;  4LJO B;  3TEW A;  4P6V F;  2BKR B;  1KH0 A;  3APD A;  4DDG D;  1C1Y B;  1YQ3 B;  5CHV C;  3ETR A;  1MPE A;  1IBX B;  1FNW A;  1T0S C;  3EGR A;  4NJC A;  2REX A;  2KAC A;  3EHV A;  5D2M B;  4C56 C;  2Y5C A;  2JRH A;  4XGA B;  1GOZ A;  2BB6 A;  1JWM D;  4H2A A;  3IBE A;  2I38 A;  3R2I A;  3CF6 E;  3R7R A;  3VHT C;  3M63 B;  3M62 B;  2K8B A;  5J18 A;  4KKJ A;  1C77 A;  2BTE A;  2MP2 A;  1JRU A;  3NZ3 A;  2FNJ B;  3T3O A;  4MJS A;  4YXD B;  3AE9 B;  3AM9 A;  4KDI C;  4RFB A;  1XLP A;  3C0R B;  3N1Y C;  3AMZ A;  4MEL A;  4REZ A;  4JIO U;  3RUL A;  3WA0 A;  4DHZ E;  1EF5 A;  4UDU C;  2QHO A;  1WE7 A;  5H8Y E;  2LWP A;  3Q3J A;  4OZC A;  3PSE B;  1H4R A;  3FIL A;  3SDL C;  3SR6 A;  3WAO A;  4A9A A;  4TUU A;  4E3C A;  2WDT B;  3JVZ X;  3AE6 B;  3MFG A;  2V4L A;  2IO0 B;  2L32 A;  3N1X C;  2JX5 A;  2AX5 A;  4HDQ A;  1UWM A;  1IYF A;  3MHZ A;  2NBW B;  1FFV A;  1ZKH A;  2KWV B;  1J0G A;  2W55 A;  2X38 A;  2G9H D;  3ABV B;  4NAM A;  3AEG B;  2PVG C;  2WXM A;  3U7D A;  4KVG B;  1WFY A;  2LEK A;  5E6P A;  2LHD A;  5J17 A;  3U7Z A;  3PRZ A;  3PT2 B;  2LAS A;  1DYQ A;  4OVU A;  4S17 A;  3HUI A;  2KDF B;  3ONS A;  1TGZ B;  2DAF A;  2FE8 A;  1UBQ A;  3PHX B;  4LNI A;  1HZ5 A;  3ZW3 A;  2R61 A;  2A5U A;  1WXM A;  4GLS C;  2ASQ A;  1QKZ A;  3KUD B;  3NUH B;  3DHG C;  1L0X B;  2PMV A;  3AN1 A;  3W1Y A;  3R2T A;  1TS5 A;  1WH3 A;  1WZ3 A;  1GC6 A;  3AE8 B;  4NAW A;  4ARI A;  3IAM 1;  1P3Q U;  1X1M A;  1BXT A;  1P7E A;  4RF1 A;  1ZP0 B;  1WMH B;  3N1Z C;  4FLH A;  3U4E G;  1D3Z A;  2FCN A;  3DCG A;  4MDK E;  2QIL A;  2JXT A;  3N32 A;  3DVN U;  3TEY A;  3RD2 A;  1JWB D;  1OQQ A;  1XXG A;  2G45 B;  1NDD A;  3AE4 B;  5DPT A;  1V81 A;  2KWD A;  3HM3 A;  4JQW C;  3A9J A;  2BS3 B;  3PGE A;  2BQQ A;  2ICI A;  2KDM A;  4BZA A;  2CJN A;  4M0W B;  3VAW A;  1N60 A;  1LM8 B;  4JWU C;  2KFK B;  3IXS A;  2SEB D;  3LDZ E;  4LNK A;  3A4R A;  1TT5 B;  1D6E C;  2PW9 A;  1UF0 A;  4P1B C;  4FN2 A;  2BPS A;  3CMM B;  3ZRF A;  1AYF A;  1N63 A;  2KTR A;  3PLV A;  1EO6 A;  3HK0 A;  3KUZ A;  3P2B A;  2IDY A;  5IP4 D;  4PS7 A;  1YOV B;  2XK5 B;  1OEY A;  4BKS D;  1QF6 A;  2KLG A;  3Q8E A;  4I6P A;  4GIV A;  3GZN I;  1UGJ A;  4W9C A;  3NHE B;  2VRR B;  1QQR A;  3DBH I;  2WXQ A;  3BII D;  1WI0 A;  1DOY A;  4IUM B;  1L0Y B;  3UF8 A;  2BYE A;  1K53 A;  4HKZ E;  4EZJ A;  1KLV A;  5IN7 A;  4BVU C;  1V80 A;  4WJN A;  1PFD A;  2RDB C;  2CKH B;  2ZVO A;  2LXA A;  4LTU A;  3QQ8 B;  2Y3A A;  4RH6 A;  2KJ6 A;  4MSQ B;  2MW5 A;  2KO3 A;  3MC9 A;  3RPF C;  2WQY B;  1WXQ A;  3E9S A;  1UBI A;  1ACC A;  2WXH A;  2RPV A;  1TTN A;  2O2V B;  2JUO A;  4BOZ B;  2DYM A;  1NVI D;  4RGT A;  3JW0 X;  1E0Z A;  1WX8 A;  1FCC C;  1Y8R C;  2GBN A;  3HHM A;  2V9H A;  4BBN F;  5C3J B;  3B08 A;  5HFY A;  1XQQ A;  2H89 B;  4XDD A;  2RD0 A;  2I1J A;  4PS8 A;  1T5X D;  2L0T A;  2QC8 A;  1XT9 B;  2JXX A;  1V8C A;  1E6E B;  5G5H A;  4M02 A;  3TMP B;  1KFY B;  3CSF A;  3PZ8 A;  4AS1 A;  2JZZ A;  3ZLZ A;  5AEK B;  1WGR A;  1PGX A;  5E6J A;  1M4V A;  2N1W A;  5KHQ A;  2AYO B;  2K5P A;  3DHH C;  1XCQ L;  2GMI C;  1C79 A;  3WAN A;  4IOI E;  2LGY A;  1ZGU B;  1SBB B;  3L4P A;  2EKE C;  3WIM A;  2M4N A;  1EWY C;  5LXI B;  3VVW B;  3BZD B;  2W3R A;  2WP9 B;  2PIA A;  1GG3 A;  2DYO A;  4ITK A;  2R2Q A;  2J52 A;  1YJI A;  4KKI A;  1QOA A;  2FCM A;  4MH0 E;  1I4H A;  2MP2 B;  2J7Q B;  1I4P A;  1SB3 C;  2MRP A;  3RYT A;  4MJS B;  2IND C;  3A9K A;  2JVC A;  5BYS A;  4JX1 C;  5BMH A;  1L5P A;  4WJP A;  3GE8 C;  1XLO A;  1E8X A;  2O6V D;  2ZJD A;  4YSX B;  4WAA A;  3Q3M C;  3Q8F A;  4HPL B;  4YL8 A;  2ON8 A;  1WF9 A;  1E7U A;  1OGW A;  2IO2 B;  3K9P B;  2JZP A;  3NJT A;  1P0R A;  1RRB A;  1QLB B;  1FD6 A;  3DOW A;  1FMA D;  2N1V A;  5AUK A;  4E71 A;  3DQV A;  5D94 A;  1V86 A;  4TSS A;  2M8S A;  1ISN A;  2HD5 B;  4E74 A;  3RMK C;  1XO3 A;  3EFU A;  1UUP A;  2FBW B;  3SD5 A;  2WU2 B;  4M01 A;  2GOW A;  2LGX A;  2SAK A;  2WYQ A;  3K9O B;  3HVZ A;  3BYT B;  1WM2 A;  1FXI A;  3DBL B;  4MAC A;  4BFR A;  3C8Y A;  1D5M C;  3FC4 A;  2CHZ A;  4OZB A;  4DHZ B;  2IYD B;  1WRI A;  4QAY A;  3L10 B;  3BVZ A;  4BKG A;  1RAX A;  3CWI A;  2KC1 A;  3ZXV A;  2IJ0 A;  4AJY B;  2RDH A;  1WR1 A;  3DVG X;  1FXA A;  2JSV X;  2NTS A;  2C7N B;  1WGY A;  1YN4 A;  1ZXI A;  1NBF C;  5DPS A;  4F1S A;  4TKN A;  2KAN A;  1E90 A;  2BYV E;  3AB5 A;  2CR5 A;  3MC0 B;  1UWX A;  3PRM B;  3ZRC A;  2JT4 B;  1UNS A;  1QOB A;  4OHJ A;  2PVO D;  3IG3 A;  3ML8 A;  1GAQ B;  2BS4 B;  3SFD B;  1E8Z A;  3AE5 B;  1FCL A;  2JU6 X;  1WXA A;  4NAW B;  1HA5 A;  1V5O A;  2PEA A;  1N61 A;  3OAW A;  2KYW A;  1XEE A;  3T9L A;  4N6E B;  4B0M A;  2KWU B;  2I1K A;  1I4Q A;  3NY5 A;  4HCP B;  1R4N I;  4ZOH C;  1ET9 A;  2R2O A;  1RM6 C;  4YTP B;  1FXT B;  1TIF A;  2K22 A;  5G55 A;  4IW0 A;  1E10 A;  3A9J B;  3VTU A;  1AN8 A;  3ZO5 B;  1U4A A;  2J53 A;  2WU5 B;  4ICV A;  2ZNV B;  5E6O A;  2BGF A;  1TKE A;  4M8M A;  4HVB A;  3AU4 A;  3V6C B;  2O6V A;  2AQ1 B;  2LMC A;  3NOB A;  4RGO S;  1YX6 B;  3HRD D;  4NNJ B;  3AU5 A;  3R7Q A;  3VR9 B;  3BVM A;  1C4A A;  2INN E;  4I6L B;  3NVW A;  1RFA A;  3RNG C;  2QJL A;  3I5J C;  3QCA A;  3VQI A;  3QX1 A;  1L4Z B;  4PK1 A;  1ZPS A;  2KTR B;  1SEB D;  1Q10 A;  4KGS A;  2D3B A;  3UQA A;  2OJW A;  3UIN B;  4S0R A;  1YN5 A;  3U52 E;  1WWT A;  3O13 A;  2KWC A;  2LVQ A;  2DLB A;  3EC8 A;  3IT6 B;  4ANX A;  4HXD A;  3ZYY X;  3AXC A;  3ZQ4 A;  2WXG A;  2D10 A;  3Q3O C;  4II3 B;  1XCT L;  3VRA B;  1FEH A;  2JWU A;  1KM7 A;  3ML9 A;  1SE2 A;  1YD8 U;  3P4P B;  2W82 A;  4WAF A;  4ZRI A;  2FUG 1;  3QWZ B;  1EWC A;  4RGM A;  4BBN C;  1FIQ A;  1SGH A;  1WGD A;  1D5Z C;  1PDX A;  2EKI A;  3AUL A;  1FFU A;  4K7S A;  3SEB A;  2DBY A;  2MSE D;  2PKO A;  2KD0 A;  2N9E B;  1ZW7 A;  2RMM A;  3U2S C;  2ZW1 A;  2G3Q B;  2HDE A;  4YTN B;  4ICU A;  2TSS A;  3H9D A;  2ZCC A;  4EEW A;  3QK0 A;  3URY A;  3PV1 A;  3GP7 A;  4C80 A;  3I57 A;  2KK8 A;  1P9D U;  2XEW A;  1NI2 A;  3VUW A;  2BWF A;  2KJR A;  4K7W A;  1J7A A;  2ZPN A;  3ZJT A;  4ZRK A;  1TYG B;  3QJZ A;  1ZUD 2;  2NPT A;  3ZNG C;  4DWF A;  4WWP A;  3P63 A;  4FXC A;  2CHX A;  3RUI B;  2WXL A;  2MCN B;  3W1S A;  4FJZ A;  3W5U B;  4FUL A;  1ZXH A;  2N9P C;  2C7M B;  2ZPY A;  4LLG M;  4FJV B;  3PRE A;  4XX5 A;  3EEC A;  3V05 A;  2ZW0 A;  3E56 A;  2C7H A;  1K50 A;  4JL9 A;  2AL6 A;  4DDI D;  3OWE B;  4HJG E;  3MHS D;  4XWW A;  2INP E;  1PGB A;  2KTF A;  3ZDM C;  4DBG A;  1CK1 A;  2GI9 A;  2MQJ A;  2L52 A;  4IM0 A;  1YN3 A;  5G5G A;  4O1N A;  3D32 A;  2JZ3 B;  4C4V A;  3DVG Y;  4K7U A;  3VRB B;  1B9R A;  3A9K B;  3W9C B;  2FCQ A;  3H6N A;  4KSL C;  2FID A;  4P7I A;  3M3J A;  2C9W B;  4MM3 A;  4NY0 A;  5TR5 A;  2ZVN A;  4NJ6 A;  3ZJV A;  3NVY A;  2OHF A;  1WRD B;  2DHZ A;  3WAP A;  1SIF A;  4WWO A;  2L05 A;  1V1O A;  3UQB A;  2AQ3 B;  1GB1 A;  2GBJ A;  3DBS A;  1Z2M A;  1OTR B;  2MJE A;  1QIL A;  1FO4 A;  1GPX A;  3QA8 A;  3RFZ B;  3L0W B;  2BKF A;  2V3S A;  3RI7 C;  3ZNH B;  5BYQ A;  1TBE A;  2DZI A;  5D6J B;  4OVZ A;  1R7S A;  1G6J A;  1N5X A;  2HTH A;  3GZN B;  4II2 B;  4K3C A;  4GOC A;  5BMI A;  2J4X A;  1EUV B;  3OG5 A;  2HE7 A;  3DBH B;  2M0X A;  2M17 A;  1WE6 A;  2BF8 B;  1IUE A;  4EZK A;  2K3U A;  1E8W A;  3FKY A;  2FAZ A;  2OOB B;  3RN9 C;  4P1C C;  4WWM A;  1XLQ A;  4IM3 A;  4ARC A;  1ZE3 D;  5CHF A;  1I4X A;  5AZH A;  5LNK 1;  4TV3 A;  2DYB A;  5CX3 A;  1JWU D;  2WX1 A;  1VD2 A;  3VTV A;  4KIK A;  3CIR B;  1F1H A;  3NG0 A;  2D3C A;  1S3S G;  2MBH A;  3NS8 A;  2Z8L A;  2W9N A;  2WXK A;  4DXF A;  1L2N A;  5TSS A;  4ZHP A;  2JPH A;  2KDE B;  4US8 A;  2CS4 A;  2JY6 A;  2E6X A;  2N9L A;  2NR2 A;  1MI0 A;  2DX5 B;  1I7H A;  5GXG B;  3AI5 A;  1QZE A;  1JWS D;  4NJ7 A;  3O65 B;  4D2K A;  2A4Z A;  3PO0 A;  2KX3 A;  1CQV A;  2H88 B;  1V1P A;  2L0F A;  3VH4 B;  1L6V A;  4B6W A;  3AEF B;  3VFK A;  3QAQ A;  2N0S B;  1DOI A;  1GNU A;  2O6V B;  1F2R C;  4PS3 A;  4A6Q A;  5IO9 A;  2N9K A;  1L6U A;  1YX5 B;  4FJY A;  1FM0 D;  1E7V A;  2Z59 B;  2YLM A;  2GB1 A;  4HRO A;  5T8I A;  2RSU A;  2DZM A;  2NS5 A;  3DWG C;  2LGI A;  2IY1 B;  5JH5 C;  3PZ7 A;  3Q8B A;  5L95 C;  3AEE B;  2WLB A;  4XC2 A;  1Q1O A;  3C19 A;  3RNE C;  1NEK B;  3Q3N C;  4GSW A;  4W9D A;  3ZVV A;  4CO7 A;  4JPS A;  5EE3 A;  4LCD E;  2EMS A;  2FCS A;  2IGG A;  3AE2 B;  2LUM A;  3H8H A;  1K51 A;  2QEJ C;  1C3T A;  1ROE A;  1T6B X;  2NVU I;  4CQN A;  5JXV A;  3QIJ A;  5EE9 A;  3TIX A;  1WX7 A;  1I4R A;  2IO3 B;  4L1B A;  4HPM B;  3IHP C;  4B0E A;  4Q2J A;  3EFC A;  4PYZ A;  2NMQ A;  2NCN A;  4JWS C;  1F0Z A;  2DZK A;  4FAD A;  3KVF B;  4KGT A;  3EUB 2;  5DPR A;  2WS3 B;  1PYW D;  3VDZ A;  4N9F 4;  4KSK C;  3LYY A;  1MHH E;  2Z0D B;  2IZV B;  1C9F A;  4G50 A;  4XWT A;  2MBQ A;  1LFD A;  1F9J A;  1YJJ A;  4RNA A;  3PZD A;  5GMV A;  5AZF A;  4XYC A;  4YSZ B;  2MHJ A;  3HIZ A;  1K52 A;  2Y5P A;  3PTF C;  3Q6B A;  1NI3 A;  3NS1 A;  4F7Z A;  2BT6 A;  5LXH A;  3LJ3 A;  2BB5 A;  3MTN B;  1NYQ A;  2ZEQ A;  2QMT A;  3AE7 B;  1R4M I;  3RZF A;  4TQ1 A;  2NPT B;  3FIL B;  1KJT A;  3L54 A;  4US9 A;  3V62 A;  2KZR A;  3V60 A;  2HTM E;  5C23 A;  2G1E A;  1Y56 A;  3SHQ A;  1DOX A;  4A3O A;  4AQ7 A;  4HWI B;  4WH4 A;  3VH3 B;  4JGH B;  5EDS A;  4XE0 A;  4MH8 A;  3WAL A;  5HKH A;  1YMH E;  2D3A A;  2LI5 A;  2QCZ A;  2WDV B;  3RNA C;  4HRS A;  2QIE B;  3JSV A;  2J0M A;  2XBB C;  4ACF A;  1JQ4 A;  2N4F A;  2W3S A;  2WX0 A;  3R66 C;  4MGZ E;  2MWS B;  4IM2 A;  4K81 A;  3QAR A;  2KQ4 X;  4L23 A;  2J42 A;  1R4N B;  2M19 A;  2DAJ A;  2KHW B;  4LK0 M;  2WHI A;  4C4V B;  3A1Q A;  2IO1 B;  2MJ3 A;  1HQR D;  4LNO A;  1I4G A;  4ANV A;  5BYR A;  1L4D B;  3SU8 X;  4FBJ B;  1TKG A;  3R3M A;  4EE2 A;  3DPD A;  4KDL B;  5KHO A;  2MBB B;  5HHD G;  3Q69 A;  4MM3 B;  2KX0 A;  5CHW A;  4XZ4 A;  4AP4 C;  1KLU D;  1JRO A;  2DNF A;  3B2F A;  1J7C A;  1QOF A;  4HCN B;  2K6D B;  3AEA B;  5IOI A;  3B0A A;  3S2A A;  3KH0 A;  3TSS A;  2LRU A;  3P1M A;  1WJN A;  2LJ5 A;  4W9J A;  1TY2 A;  1FRD A;  4ZRJ A;  2JYE A;  4GDL A;  2UYZ B;  4OZA A;  1A70 A;  5D3I B;  1J8C A;  2JF5 A;  2Z0E B;  3ECI A;  3U8Z A;  5HI1 A;  2E3T A;  4NQL B;  1HTQ A;  2DEN B;  1FPY A;  1XLN A;  3ZNZ B;  1LQB A;  2WXI A;  1VJK A;  1E9M A;  4I6N B;  2RDG A;  4AJW A;  3TEX A;  1LO5 D;  4RM9 A;  3AEB B;  5H92 C;  2JWZ A;  1TKY A;  3PHW B;  4BAX A;  4W9I A;  2V1Y A;  4NPN A;  1N5W A;  4USA A;  1DGJ A;  2JYT A;  3T3N A;  2V0G A;  2BW2 A;  2GBK A;  3P4R B;  1J7B A;  4TQ0 A;  4GB9 A;  1KF6 B;  3DWM A;  5J2R A;  4FHK A;  4RMA A;  4F8C B;  4GDK A;  1V2Y A;  3TEZ A;  5MPO A;  2YEP F;  2AWT A;  3J9C A;  1BUI C;  1WSP A;  4MGK E;  5D3D A;  1HTO A;  4KIK B;  5D7G A;  2VH2 A;  1MG4 A;  1L0V B;  4LDT B;  4PYU A;  2BS2 B;  2DZJ A;  3H1U A;  1WGH A;  1Z5S B;  2QSD A;  4ANW A;  3BWU D;  1C4P A;  1LGR A;  2L00 B;  4DXA B;  4ZYS A;  1KOT A;  1E5W A;  5I4D A;  4KZ0 A;  2WXF A;  4OW0 A;  2CU1 A;  4W9G A;  1FNU A;  3ALB A;  1HZ6 A;  4DHJ B;  3P4Q B;  4MGI E;  1WXS A;  1MHX A;  2PLP A;  3UI3 A;  1D4B A;  2LGD A;  2D11 A;  4IKG A;  3Q8A A;  1V6E A;  2WXP A;  1V1P B;  3GOE A;  1Q0W B;  1TS3 A;  2ZNV C;  1I42 A;  2PTL A;  2KMM A;  5FK9 C;  1S1Q B;  1YQB A;  3KW5 B;  1AAR A;  1GUA B;  4RM8 A;  2D5G A;  1QT9 A;  2KN4 A;  2KLC A;  5C2T B;  4GGQ A;  1AWD A;  4WJO A;  2BWE S;  3CST A;  3P4S B;  5EE1 A;  2KT7 A;  4G0N B;  2PE6 B;  1C4C A;  1KRH A;  2PJH A;  3L13 A;  4RF0 A;  3P42 A;  1C76 A;  3N20 C;  3AE3 B;  2NBV B;  3X23 A;  3IT4 B;  3PVL A;  4GU2 A;  3NRZ A;  2IBI B;  3N9Y C;  2PE9 A;  4ANU A;  1WYW B;  2RPQ A;  1P98 A;  4K1R B;  4HLE A;  3NVV A;  3TL5 A;  2K6Q A;  2ZCB A;  2YVC A;  1ZDX A;  3LXF A;  3VTW A;  4LDT D;  4G11 A;  4W9L A;  1IP9 A;  2FUH B;  5CTR C;  4ASW C;  2KQ7 A;  2L8J A;  2CHW A;  2L1A A;  4HJK A;  4EUT A;  1SSN A;  3M95 A;  3I3T B;  2WXR A;  3OLM D;  1JCK B;  1V9J A;  2D2Q A;  5DCN A;  2KMA A;  4DHJ D;  3I9V 1;  3KYC D;  2PPH A;  2WXJ A;  1UZX B;  3H7P A;  2C5L C;  1ESF A;  1YJ1 A;  2GRI A;  4ZDV A;  4PT5 A;  3VUX A;  3AE1 B;  4W9F A;  4AOF A;  3AV8 A;  5DPW A;  2KFJ A;  1PUT A;  3PPA A;  1BT0 A;  1VRA B;  3DDC B;  3V61 A;  2X8X X;  1OQR A;  2N7D A;  1JWA D;  2DWQ A;  1WJ6 A;  2I2Y A;  1SE9 A;  4G3X B;  2XNA C;  1WJ4 A;  1NEN B;  1ZOY B;  4DK5 A;  2JRI B;  5G2N A;  4YWG G;  4W9E A;  2B3A A;  1XD3 B;  3UIO B;  4EFO A;  1WJU A;  4ZYN A;  3RNF C;  1TS4 A;  1EU4 A;  1RFK A;  3AED B;  4HKQ A;  4HDO A;  2CJO A;  1M94 A;  2LVO A;  5BMG A;  2GBM A;  2YEP B;  3W2D A;  3EA6 A;  2G4D B;  1WGK A;  2KOX A;  3Q14 C;  4A55 A;  3A4S C;  1WIA A;  2IPK D;  3UIP B;  3UGB B;  1WM3 A;  4M8N A;  2KVZ A;  4EZL A;  2L83 A;  2MJD A;  3JSV B;  1N6Z A;  1P1A A;  4RCO A;  2K1F A;  4HEA 1;  1HEZ E;  2WNM A;  1JW9 D;  2IGD A;  1FNV A;  3BYY B;  3ZIM A;  1GB4 A;  3RNB C;  4ZRQ A;  4FA6 A;  2BBC A;  3WCQ A;  1OEY J;  4L2Y A;  4GN1 A;  3A1Q B;  2AL3 A;  5AZG A;  2INC C;  1GC7 A;  2L3Z A;  5E6N A;  5JHA A;  3KYD D;  5HG2 A;  5L83 A;  3X0W A;  2M0A A;  4KZC A;  2K8H A;  3PLU A;  1UEL A;  4AUQ C;  4HK2 A;  4J6I A;  1HE8 A;  2RR9 A;  4KX6 B;  1H8C A;  3U30 A;  2KN5 A;  1SE4 A;  5JHB A;  1YNT E;  3Q3F A;  4NZL B;  4CHK A;  1ET6 A;  2KAJ A;  3ZNI D;  2HJ1 A;  5IKC M;  4K3B A;  2FIF A;  2L7R A;  1VLB A;  4LNN A;  4BOS C;  3TUO A;  1UGM A;  3AEC B;  1CJE A;  4WQO B; 
#chains in the Genus database with same CATH homology
 3NOB A;  1IYF A;  4F7Z A;  2NBW B;  1LXD A;  1YX6 B;  4GDL B;  3LJ3 A;  3AU5 A;  4NNJ B;  5LXH A;  3R7Q A;  1ZKH A;  2KWV B;  3MTN B;  4I6L B;  1J0G A;  1RFA A;  2ZEQ A;  3RT3 B;  3QCA A;  1R4M I;  3QX1 A;  3RZF A;  3VQI A;  3U7D A;  4TQ1 A;  4MGY E;  4KVG B;  1WFY A;  2NPT B;  1KJT A;  2K8C A;  2KTR B;  3L54 A;  5E6P A;  1MG8 A;  3V62 A;  5J17 A;  2KZR A;  3V60 A;  1RLF A;  5C23 A;  3UQA A;  3PRZ A;  3UIN B;  2J0K A;  3PT2 B;  2LAS A;  4IC7 B;  3SHQ A;  2KWC A;  4A3O A;  4OVU A;  3L08 A;  2LVQ A;  4HWI B;  2KDF B;  3ONS A;  1TGZ B;  3RCZ A;  2DAF A;  3VH3 B;  4JGH B;  3ZKJ C;  3EC8 A;  1UBQ A;  3PHX B;  4ANX A;  5EDS A;  4HXD A;  3WAL A;  3ZW3 A;  3AXC A;  5HKH A;  2LI5 A;  3VUY A;  2AEH A;  2A5U A;  2D10 A;  1WXM A;  3JSV A;  2ASQ A;  2D07 B;  1L7Y A;  3KUD B;  2J0M A;  4II3 B;  2XBB C;  2N4F A;  3W1Y A;  2WX0 A;  3R66 C;  4MGZ E;  2MWS B;  4IM2 A;  4K81 A;  3QAR A;  4GDK B;  3WAM A;  1KM7 A;  3ML9 A;  1WH3 A;  1WZ3 A;  1GC6 A;  2Y5B B;  1WX9 A;  1YD8 U;  2C60 A;  4NAW A;  4ZRI A;  2KQS A;  2DAJ A;  3QWZ B;  2KHW B;  2ZZP B;  1K8R B;  1P3Q U;  3MJW A;  1X1M A;  3A1Q A;  1T0Y A;  2IO1 B;  4BBN C;  2KNB A;  1WMH B;  4B9K A;  1OQY A;  1SGH A;  1WGD A;  4FLH A;  1D3Z A;  2FCN A;  2LVP A;  3DCG A;  4MDK E;  4ANV A;  4LJP B;  3SU8 X;  4FBJ B;  4WWN A;  3R3M A;  3N32 A;  3DVN U;  3DPD A;  4KDL B;  3AUL A;  5LLI A;  3RD2 A;  4K7S A;  5KHO A;  2MBB B;  4IWQ A;  2G45 B;  2MSE D;  1NDD A;  2KX0 A;  5DPT A;  1J19 A;  1V81 A;  2KD0 A;  5CHW A;  2N9E B;  1ZW7 A;  3HM3 A;  4XZ4 A;  4JQW C;  4AP4 C;  3A9J A;  2G3Q B;  2HJ8 A;  2KVR A;  3PGE A;  4ICU A;  3H9D A;  2NBU A;  1E8Y A;  3N30 A;  2ZCC A;  2K6D B;  3QK0 A;  4HCN B;  4EEW A;  3PV1 A;  3B0A A;  2N7E A;  3KH0 A;  3S2A A;  4M0W B;  3VAW A;  2LRU A;  3B1L X;  1WJN A;  1LM8 B;  2KFK B;  2KK8 A;  4A20 A;  1P9D U;  2XEW A;  5JZE B;  3LDZ E;  1NI2 A;  3VUW A;  2LJ5 A;  3TJP A;  4W9J A;  2BWF A;  2KJR A;  4K7W A;  3A4R A;  4ZRJ A;  4GDL A;  2UYZ B;  2ZPN A;  2L76 A;  4FN2 A;  1J8C A;  1Q5W B;  2JF5 A;  2Z0E B;  4ZRK A;  2BPS A;  1UD7 A;  3CMM B;  3ECI A;  3U8Z A;  3ZRF A;  3L16 A;  3QJZ A;  4NQL B;  3JYU A;  2NPT A;  1VCB A;  2LD9 A;  3ZNG C;  4DWF A;  2KTR A;  4WWP A;  2DEN B;  2IY0 B;  3ZNZ B;  1LQB A;  2CHX A;  3RUI B;  3PLV A;  1EO6 A;  4IWP A;  2MCN B;  3HK0 A;  1IPG A;  3ZTC A;  4I6N B;  3KUZ A;  3W1S A;  3P2B A;  4FJZ A;  4AJW A;  1EF1 A;  4A3P A;  4FUL A;  4EKU A;  2N9P C;  4PS7 A;  2C7M B;  2ZPY A;  4FJV B;  2XK5 B;  4RM9 A;  1OEY A;  3PRE A;  1V5T A;  3H7S A;  3N3K B;  3ZDT A;  4XX5 A;  4BKS D;  4IG7 B;  3EEC A;  2JWZ A;  2C7H A;  3PHW B;  2KLG A;  4KV2 A;  4I6P A;  4JL9 A;  2AL6 A;  4W9I A;  2V1Y A;  4GIV A;  4NPN A;  4DDI D;  4BKS A;  3MHS D;  3GZN I;  3T8M A;  4CYE A;  2GBK A;  4W9C A;  3OJ4 B;  4TQ0 A;  3NHE B;  2VRR B;  2KTF A;  3ZDM C;  4GB9 A;  4DBG A;  2MBE A;  2KXJ A;  3DBH I;  2MQJ A;  2LUE A;  5J2R A;  4FHK A;  1WI0 A;  4RMA A;  4IM0 A;  4GDK A;  4F8C B;  1V2Y A;  4IUM B;  2AWT A;  2MX2 A;  1A5R A;  3UF8 A;  2BYE A;  4MGK E;  2KMC A;  3IVF A;  4EZJ A;  1KLV A;  3D32 A;  2LZ6 A;  2JZ3 B;  1V80 A;  4BVU C;  4WJN A;  3DVG Y;  4NQK E;  4K7U A;  2CKH B;  1WMH A;  3A9K B;  2ZVO A;  4KIK B;  2FCQ A;  2LXA A;  5D7G A;  3QQ8 B;  3H6N A;  1I35 A;  4LDT B;  5C1Z A;  4PYU A;  4KSL C;  2FID A;  4P7I A;  2KJ6 A;  4MSQ B;  3M3J A;  2DZJ A;  2J0J A;  2C9W B;  2MW5 A;  2KO3 A;  3H1U A;  1WGG A;  1WGH A;  1Z5S B;  4MM3 A;  4NY0 A;  5TR5 A;  4ANW A;  1UH6 A;  2ZVN A;  4GMV A;  2L00 B;  4DXA B;  1KOT A;  1E5W A;  4NJ6 A;  3HM6 X;  1UBI A;  4KZ0 A;  1WRD B;  4JLC A;  2DHZ A;  3L17 A;  2CU1 A;  3WAP A;  1SIF A;  1TTN A;  4W9G A;  4WWO A;  2GBR A;  2L05 A;  3PS6 A;  3ALB A;  2G4S A;  2O2V B;  2JUO A;  3H7P B;  4B95 A;  2KDI A;  4MGI E;  4BOZ B;  4DHJ B;  3UQB A;  5IA7 A;  2DYM A;  1WXS A;  1V49 A;  4X57 B;  2K39 A;  2RGF A;  2GBJ A;  3JW0 X;  5FR6 A;  3VXW A;  2MLB A;  2KFK A;  1WX8 A;  1Y8R C;  2LGD A;  2D11 A;  3DBS A;  4GXB A;  1Z2M A;  2GBN A;  1OTR B;  3HHM A;  1V6E A;  3GOE A;  4EOY A;  1Q0W B;  3QA8 A;  2ZNV C;  4BBN F;  1I42 A;  3L0W B;  2BKF A;  3B08 A;  1XQQ A;  1S1Q B;  1YQB A;  2M1M A;  3ENE A;  2V3S A;  3KW5 B;  1AAR A;  1GUA B;  4RM8 A;  2N9X A;  3ZNH B;  2BYF A;  2RD0 A;  1WR6 E;  1TBE A;  2DZI A;  2I1J A;  4PS8 A;  5D6J B;  2L0T A;  1XT9 B;  2KLC A;  3ZUN A;  4FHJ A;  1WXV A;  2JXX A;  1G6J A;  4GGQ A;  2HTH A;  4WJO A;  3QC8 B;  3TMP B;  2BWE S;  1WZ0 A;  3CSF A;  3CST A;  2JZZ A;  3ZLZ A;  4II2 B;  1CMX B;  2XK5 A;  2WWZ A;  3KUC B;  4G0N B;  4GOC A;  1YIW A;  2PE6 B;  5AEK B;  1EUV B;  1WGR A;  1WY8 A;  2PJH A;  3L13 A;  2N1W A;  3DBL I;  5KHQ A;  2AYO B;  2HE7 A;  2M0X A;  2GMI C;  2NBV B;  4IWO A;  4WJQ A;  3W1S C;  3X23 A;  2M17 A;  3PVL A;  3WAN A;  1WE6 A;  2LGY A;  3DVN V;  4GU2 A;  1ZGU B;  2BF8 B;  2IBI B;  2PE9 A;  4ANU A;  2MA9 B;  4EZK A;  1WYW B;  2EKE C;  1E8W A;  3WIM A;  2RPQ A;  3APF A;  2FAZ A;  2M4N A;  2OOB B;  5LXI B;  3VVW B;  1P98 A;  5IAA C;  1GG3 A;  2DYO A;  4W9K A;  4IM3 A;  4K1R B;  2LXC A;  4HLE A;  2KJH B;  2K6Q A;  3OJ3 A;  3TL5 A;  1GJZ A;  2ZCB A;  2YVC A;  2UWQ A;  2R2Q A;  5CHF A;  5AZH A;  3DBR I;  2FCM A;  2EMT A;  4TV3 A;  4MH0 E;  2DYB A;  5CX3 A;  2KC2 A;  3VTW A;  2MP2 B;  2J7Q B;  2K25 A;  2WX1 A;  4LDT D;  2LRW A;  4G11 A;  2MRP A;  1VD2 A;  4W9L A;  3VTV A;  3RYT A;  4MJS B;  3A9K A;  3A33 B;  4KIK A;  4AWJ A;  3TCA A;  2JVC A;  1IP9 A;  2FUH B;  5CTR C;  4ASW C;  1S3S G;  2KQ7 A;  2MBH A;  2L8J A;  2CHW A;  3NS8 A;  3V6E B;  4WJP A;  4HJK A;  3NZU A;  4EUT A;  1TZ1 A;  1E8X A;  3RZW C;  2O6V D;  2W9N A;  2ZJD A;  3M95 A;  3I3T B;  3BIN A;  4WAA A;  3OLM D;  3PRP B;  3QHT A;  4HPL B;  4YL8 A;  1L2N A;  1WF9 A;  1V9J A;  2D2Q A;  2JPH A;  5DCN A;  2KDE B;  1E7U A;  1OGW A;  2CS4 A;  2IO2 B;  2KMA A;  3TBL D;  4DHJ D;  2JY6 A;  3K9P B;  3KYC D;  2MBO A;  2PPH A;  1P0R A;  4URK A;  1RRB A;  2NR2 A;  2DX5 B;  1UZX B;  2O2V A;  4MEM A;  3H7P A;  3AI5 A;  4BKT A;  1QZE A;  2C5L C;  3DOW A;  4NJ7 A;  1YJ1 A;  2KDB A;  2N1V A;  3O65 B;  2KKC A;  4ZDV A;  4E71 A;  2A4Z A;  3DQV A;  3VUX A;  4W9F A;  4AOF A;  3NZS A;  2OJR A;  5DPW A;  5D94 A;  1V86 A;  2KFJ A;  2KX3 A;  3PPA A;  2M8S A;  1ISN A;  1BT0 A;  2HD5 B;  4E74 A;  2D3G A;  3EFU A;  2L0F A;  3SD5 A;  3DDC B;  3VH4 B;  3IFW B;  2GOW A;  3BY4 B;  2LGX A;  3V61 A;  4B6W A;  3VFK A;  2N7D A;  3QAQ A;  2WYQ A;  1GNU A;  2O6V B;  1WJ6 A;  4MSM B;  1SE9 A;  3K9O B;  4G3X B;  4OVV A;  4PS3 A;  1WM2 A;  1YX5 B;  1WJ4 A;  4FJY A;  4DK5 A;  2JRI B;  1E7V A;  5G2N A;  4W9E A;  2Z59 B;  3ZTD A;  2B3A A;  2YLM A;  3APC A;  4W9H A;  5BO4 B;  1XD3 B;  1PQS A;  3UIO B;  4LJO B;  4BFR A;  2RSU A;  2DZM A;  2CHZ A;  2NS5 A;  4EFO A;  1WJU A;  4DHZ B;  2BKR B;  2IYD B;  3APD A;  4DDG D;  1C1Y B;  3L10 B;  5CHV C;  4BKG A;  1RAX A;  2IY1 B;  4ZYN A;  5JH5 C;  2KC1 A;  5L95 C;  4XC2 A;  1Q1O A;  4HDO A;  1M94 A;  2LVO A;  2GBM A;  2REX A;  4AJY B;  3EHV A;  2G4D B;  5D2M B;  4GSW A;  4W9D A;  3ZVV A;  4CO7 A;  1WR1 A;  2JRH A;  2KOX A;  3DVG X;  4LCD E;  3A4S C;  1WIA A;  3IBE A;  2EMS A;  2C7N B;  1WGY A;  2FCS A;  5DPS A;  1NBF C;  4F1S A;  4TKN A;  2KAN A;  3UIP B;  1E90 A;  3UGB B;  1WM3 A;  2BYV E;  2CR5 A;  4M8N A;  4EZL A;  3CF6 E;  3PRM B;  1C3T A;  3R7R A;  3VHT C;  2JT4 B;  3ZRC A;  3JSV B;  3M62 B;  1P1A A;  2K8B A;  3M63 B;  5J18 A;  2K1F A;  2NVU I;  3IG3 A;  3ML8 A;  2MP2 A;  1JRU A;  2FNJ B;  3QIJ A;  3ZIM A;  3TIX A;  1WX7 A;  4MJS A;  4FA6 A;  4KDI C;  2IO3 B;  1E8Z A;  4HPM B;  3IHP C;  1WXA A;  3C0R B;  4NAW B;  1V5O A;  2PEA A;  1OEY J;  3OAW A;  4PYZ A;  3T9L A;  4MEL A;  4GN1 A;  3A1Q B;  2KWU B;  2AL3 A;  2NCN A;  5AZG A;  1GC7 A;  2I1K A;  4JIO U;  2DZK A;  3RUL A;  4FAD A;  2L3Z A;  5E6N A;  3WA0 A;  3KVF B;  5JHA A;  3KYD D;  4DHZ E;  1EF5 A;  3NY5 A;  4HCP B;  3X0W A;  5L83 A;  1R4N I;  2QHO A;  4KZC A;  5DPR A;  2K8H A;  1WE7 A;  3PLU A;  1UEL A;  4AUQ C;  2R2O A;  2LWP A;  4HK2 A;  4J6I A;  3Q3J A;  1HE8 A;  3VDZ A;  2RR9 A;  4N9F 4;  1FXT B;  4KSK C;  1H8C A;  3U30 A;  2KN5 A;  3PSE B;  5JHB A;  1H4R A;  4IW0 A;  5G55 A;  3SDL C;  3Q3F A;  3A9J B;  3VTU A;  4CHK A;  2Z0D B;  2IZV B;  3WAO A;  3ZNI D;  3ZO5 B;  4G50 A;  4TUU A;  1U4A A;  4E3C A;  2MBQ A;  2WDT B;  1LFD A;  1F9J A;  3JVZ X;  2FIF A;  2L7R A;  3PZD A;  5GMV A;  4ICV A;  2V4L A;  2ZNV B;  2IO0 B;  5AZF A;  5E6O A;  2BGF A;  3HIZ A;  3PTF C;  4M8M A;  4HVB A;  4BOS C;  1UGM A;  4HDQ A;  3AU4 A;  4WQO B;  3V6C B;  2O6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...