3DDPB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor cr8
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
b'SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title CR8, a potent and selective, roscovitine-derived inhibitor of cyclin-dependent kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 95
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddpB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddpB02
3LQ5B 4II5B 4ELLA 2PK9B 2W99A 1ZP2A 1OKVB 3MY1B 4BCMD 5IDPB 1G3NC 1AD6A 4BCNB 4CFNB 3QHRB 4OR5B 1H1PB 1FINB 3F5XB 3DOGB 1D3UB 4CFVB 4EOMB 3EIDB 1UNLD 1H1SB 5HBEB 2X1NB 4YOOA 1O9KB 2C5VB 5LQFB 1H24B 2UZDB 1H27B 1AISB 1OL1B 4CFMB 2PMIB 2PHGA 2QDJA 1GUXB 2WMAB 2WMBB 1E9HB 4YOZA 5IDNB 2WIPB 4BCPB 2EUFA 2C5NB 2UZEB 1C9BA 3POMA 4ROEA 1P5EB 2WFYB 4KRCB 4IMYB 3O0GD 3EJ1B 1H1QB 4BCND 4F7LB 5HNBB 1UNGD 2W9FA 4BCJB 1H26B 1VYWB 4F6WB 1JOWA 2F2CA 1PKDB 3MIAB 4CRLB 1OKWB 5CYIB 4CFUB 2V22B 4I3ZB 1VINA 4EOPB 1H28B 4UN0A 3DDPB 5ICPB 5L2WB 4BCFB 2WPAB 1OL2B 4BCKB 1UNHD 2W9ZA 4RODA 2R7GA 2W2HA 1GY3B 4FX3B 3MI9B 2UZBB 3BLRB 3G33B 1TFBA 3TNWB 5FGKB 1N4MA 2C6TB 1OIYB 4BCMB 3BLQB 5I5ZB 4OGRB 2UZLB 2CCIB 2I53A 4EOLB 1VOLA 4BCOB 5HBHB 2CJMB 2WIHB 1OIUB 2IW9B 3MY5B 4YOSA 4BCIB 4EONB 3RGFB 4NSTB 1URCB 2IW8B 1W98B 1F5QB 2WHBB 4EOQB 1FVVB 3H4CA 1QMZB 3BHUB 4EOKB 4YC3B 4CFXB 4ROCA 3QHWB 3DDQB 4KRDB 4BCQB 5HQ0B 2UUEB 1H1RB 4CFWB 2WEVB 2G9XB 3TN8B 3K7AM 3TNIB 4F6SB 4BCGB 4F70B 1BU2A 2PK2A 1JSTB 1H4LD 5BNJB 1GH6B 4ELJA 4F6UB 5ACBA 2IW6B 4F7NB 4G6LB 1XO2A 5CEIB 1OI9B 2C4GB 3BHVB 2C5XB 1OGUB 2C5OB 2CCHB 1H25B 2WXVB 4EOOB 4F7JB 1O9KA 2BKZB 2W96A 4CXAB 4F7SB 5HVYB 3TNHB 2I40B 2IVXA 5HBJB 1JSUB 3EOCB 4EC8B 4CFUD 4EOIB 4EOSB 3M03A 4EOJB 5EFQB 4EORB 1KXUA 4BCQD 4TTHA 4EC9B 1JKWA 1GUXA 4BCHB 5IF1B 2JGZB 2B9RA 4Y72B 5LMKB 3BLHB 2BPMB 3BHTB
chains in the Genus database with same CATH superfamily
4II5B 4MFEA 3A8OB 4BCMD 1G3NC 1AD6A 2CZ1B 1H1PB 2CZ0B 3F5XB 4CFVB 4BY1X 2X1NB 1O9KB 4FM4B 1H24B 2QFZA 2UZDB 1H27B 4CFMB 2QF7A 2DMEA 2QDJA 4YOZA 2WMAB 4Z6YA 5IDNB 2WIPB 2D0QB 4IMYB 1H1QB 4BCND 1UNGD 4BBSM 1UGPB 3DTOA 2V22B 4UN0A 4AI6A 3DDPB 3B57A 5ICPB 1OL2B 2W9ZA 4RODA 3BLRB 3G33B 3TNWB 1UGRB 3VYGB 2C6TB 4BCMB 4OGRB 2UZLB 2DXCB 4HL4A 3QYHB 1OIUB 4EONB 4AKIA 4LOCA 4NSTB 4BBRM 1URCB 4JX5A 2WHBB 3H4CA 4EOKB 4CFXB 3DDQB 2ZZDB 4HNTA 2UUEB 4OB1B 4CFWB 2WEVB 2G9XB 3K7AM 4F6SB 2BS2A 1JSTB 4HNVA 1GH6B 2ZCFB 1FKMA 4F6UB 5ACBA 2IW6B 1OI9B 3QWLA 2C5OB 4EOOB 2WXVB 4CXAB 2I40B 2IVXA 4CFUD 4EOSB 1TD6A 5IF1B 4BCQD 1GUXA 2LW4A 3BLHB 1D3UB 3VKGA 4ELLA 2ZPHB 4BY7X 1V29B 3WVDB 3HB9A 3DOGB 3X25B 4YOOA 2C5VB 5LQFB 2PMIB 4MFDA 4MIMA 3HZJA 2WMBB 2EUFA 2C5NB 1QLBA 2WFYB 4KRCB 3O0GD 4JX6A 4BCJB 4ZGEB 4F6WB 2F2CA 5CYIB 1OKWB 4CFUB 5DQVA 5L2WB 4BCFB 1IREB 3X26B 1UNHD 2DXBB 2KMGA 2R7GA 1GY3B 5FGKB 2ZPEB 1W98B 5IHYA 3A8GB 1FVVB 3QHWB 2KR6A 1H1RB 3X20B 2QQ8A 3TNIB 3QYBA 3A8HB 3X24B 3QYGB 1XO2A 5CEIB 4OB3B 1OGUB 4F7JB 2ZPGB 3BG3A 1JSUB 3EOCB 1JKWA 2JGZB 3QYEA 3BHTB 4OB2B 3PO3S 2PK9B 2W99A 1ZP2A 3MY1B 4BCNB 3QHRB 4OR5B 4HNUA 1FINB 4EOMB 3EIDB 2QDYB 1H1SB 5HBEB 5EJCA 1OL1B 3TW7A 3DL1A 2PHGA 2CZ7B 1GUXB 1E9HB 4BCPB 2UZEB 1C9BA 3VKHA 4ROEA 3EJ1B 4F7LB 5HNBB 2W9FA 1VYWB 1JOWA 2CZ6B 3MIAB 3X28B 4CRLB 1VINA 4EOPB 4NC6A 2WPAB 4BCKB 2BS4A 4OB0B 2UZBB 3GTMS 1N4MA 5I5ZB 1OIYB 4EOLB 1VOLA 2WIHB 3MY5B 4YOSA 4BXXX 4BCIB 1UGSB 3RGFB 3NDQA 2DD5B 1F5QB 1QMZB 4YC3B 4KRDB 4QSHA 4BCQB 4M6VA 3TN8B 4BCGB 4F70B 2G77A 1H4LD 5BNJB 3WVEB 4JX4A 4G6LB 2C4GB 1ENWA 2C5XB 2CCHB 3HO8A 1O9KA 5HVYB 4F7SB 3TNHB 5HBJB 4EOIB 3VYHB 4EORB 2BS3A 4EC9B 4BCHB 2ZPFB 2B9RA 4Y72B 3TW6A 2BPMB 3LQ5B 1OKVB 5IDPB 2ZPIB 4CFNB 2CYZB 1UNLD 4HLQA 1AISB 3BG5A 2PJQA 3HBLA 3POMA 1P5EB 1E7PA 2QGSA 3A8MB 1H26B 3DJBA 1PKDB 4I3ZB 1H28B 3QZ5B 3HHTB 3QZ9B 4AKHA 2W2HA 4FX3B 5DQWA 3MI9B 1TFBA 2IN3A 3BLQB 2CCIB 2I53A 2ZPBB 4BCOB 5HBHB 2CJMB 4ZGDB 2IW9B 2IW8B 3KHIA 1UGQB 4EOQB 3BHUB 4ROCA 5HQ0B 4AKGA 1BU2A 2PK2A 1AHJB 4ELJA 4F7NB 2WJ9A 3BHVB 2DPPB 1H25B 2BKZB 2W96A 4EC8B 3M03A 4EOJB 5EFQB 4ZGJB 2AHJB 3BG9A 1KXUA 4TTHA 2DD4B 3A8LB 3QXEB 5LMKB
chains in the Genus database with same CATH topology
3LQ5B 4II5B 4ELLA 2PK9B 2W99A 1ZP2A 1OKVB 3MY1B 4BCMD 5IDPB 1G3NC 1AD6A 4BCNB 4CFNB 3QHRB 4OR5B 1H1PB 1FINB 3F5XB 3DOGB 1D3UB 4CFVB 4EOMB 3EIDB 1UNLD 1H1SB 5HBEB 2X1NB 4YOOA 1O9KB 2C5VB 5LQFB 1H24B 2UZDB 1H27B 1AISB 1OL1B 4CFMB 2PMIB 2PHGA 2QDJA 1GUXB 2WMAB 2WMBB 1E9HB 4YOZA 5IDNB 2WIPB 4BCPB 2EUFA 2C5NB 2UZEB 1C9BA 3POMA 4ROEA 1P5EB 2WFYB 4KRCB 4IMYB 3O0GD 3EJ1B 1H1QB 4BCND 4F7LB 5HNBB 1UNGD 2W9FA 4BCJB 1H26B 1VYWB 4F6WB 1JOWA 2F2CA 1PKDB 3MIAB 4CRLB 1OKWB 5CYIB 4CFUB 2V22B 4I3ZB 1VINA 4EOPB 1H28B 4UN0A 3DDPB 5ICPB 5L2WB 4BCFB 2WPAB 1OL2B 4BCKB 1UNHD 2W9ZA 4RODA 2R7GA 2W2HA 1GY3B 4FX3B 3MI9B 2UZBB 3BLRB 3G33B 1TFBA 3TNWB 5FGKB 1N4MA 2C6TB 1OIYB 4BCMB 3BLQB 5I5ZB 4OGRB 2UZLB 2CCIB 2I53A 4EOLB 1VOLA 4BCOB 5HBHB 2CJMB 2WIHB 1OIUB 2IW9B 3MY5B 4YOSA 4BCIB 4EONB 3RGFB 4NSTB 1URCB 2IW8B 1W98B 1F5QB 2WHBB 4EOQB 1FVVB 3H4CA 1QMZB 3BHUB 4EOKB 4YC3B 4CFXB 4ROCA 3QHWB 3DDQB 4KRDB 4BCQB 5HQ0B 2UUEB 1H1RB 4CFWB 2WEVB 2G9XB 3TN8B 3K7AM 3TNIB 4F6SB 4BCGB 4F70B 1BU2A 2PK2A 1JSTB 1H4LD 5BNJB 1GH6B 4ELJA 4F6UB 5ACBA 2IW6B 4F7NB 4G6LB 1XO2A 5CEIB 1OI9B 2C4GB 3BHVB 2C5XB 1OGUB 2C5OB 2CCHB 1H25B 2WXVB 4EOOB 4F7JB 1O9KA 2BKZB 2W96A 4CXAB 4F7SB 5HVYB 3TNHB 2I40B 2IVXA 5HBJB 1JSUB 3EOCB 4EC8B 4CFUD 4EOIB 4EOSB 3M03A 4EOJB 5EFQB 4EORB 1KXUA 4BCQD 4TTHA 4EC9B 1JKWA 1GUXA 4BCHB 5IF1B 2JGZB 2B9RA 4Y72B 5LMKB 3BLHB 2BPMB 3BHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ5 B;  4II5 B;  4ELL A;  2PK9 B;  2W99 A;  1ZP2 A;  1OKV B;  3MY1 B;  4BCM D;  5IDP B;  1G3N C;  1AD6 A;  4BCN B;  4CFN B;  3QHR B;  4OR5 B;  1H1P B;  1FIN B;  3F5X B;  3DOG B;  1D3U B;  4CFV B;  4EOM B;  3EID B;  1UNL D;  1H1S B;  5HBE B;  2X1N B;  4YOO A;  1O9K B;  2C5V B;  5LQF B;  1H24 B;  2UZD B;  1H27 B;  1AIS B;  1OL1 B;  4CFM B;  2PMI B;  2PHG A;  2QDJ A;  1GUX B;  2WMA B;  2WMB B;  1E9H B;  4YOZ A;  5IDN B;  2WIP B;  4BCP B;  2EUF A;  2C5N B;  2UZE B;  1C9B A;  3POM A;  4ROE A;  1P5E B;  2WFY B;  4KRC B;  4IMY B;  3O0G D;  3EJ1 B;  1H1Q B;  4BCN D;  4F7L B;  5HNB B;  1UNG D;  2W9F A;  4BCJ B;  1H26 B;  1VYW B;  4F6W B;  1JOW A;  2F2C A;  1PKD B;  3MIA B;  4CRL B;  1OKW B;  5CYI B;  4CFU B;  2V22 B;  4I3Z B;  1VIN A;  4EOP B;  1H28 B;  4UN0 A;  3DDP B;  5ICP B;  5L2W B;  4BCF B;  2WPA B;  1OL2 B;  4BCK B;  1UNH D;  2W9Z A;  4ROD A;  2R7G A;  2W2H A;  1GY3 B;  4FX3 B;  3MI9 B;  2UZB B;  3BLR B;  3G33 B;  1TFB A;  3TNW B;  5FGK B;  1N4M A;  2C6T B;  1OIY B;  4BCM B;  3BLQ B;  5I5Z B;  4OGR B;  2UZL B;  2CCI B;  2I53 A;  4EOL B;  1VOL A;  4BCO B;  5HBH B;  2CJM B;  2WIH B;  1OIU B;  2IW9 B;  3MY5 B;  4YOS A;  4BCI B;  4EON B;  3RGF B;  4NST B;  1URC B;  2IW8 B;  1W98 B;  1F5Q B;  2WHB B;  4EOQ B;  1FVV B;  3H4C A;  1QMZ B;  3BHU B;  4EOK B;  4YC3 B;  4CFX B;  4ROC A;  3QHW B;  3DDQ B;  4KRD B;  4BCQ B;  5HQ0 B;  2UUE B;  1H1R B;  4CFW B;  2WEV B;  2G9X B;  3TN8 B;  3K7A M;  3TNI B;  4F6S B;  4BCG B;  4F70 B;  1BU2 A;  2PK2 A;  1JST B;  1H4L D;  5BNJ B;  1GH6 B;  4ELJ A;  4F6U B;  5ACB A;  2IW6 B;  4F7N B;  4G6L B;  1XO2 A;  5CEI B;  1OI9 B;  2C4G B;  3BHV B;  2C5X B;  1OGU B;  2C5O B;  2CCH B;  1H25 B;  2WXV B;  4EOO B;  4F7J B;  1O9K A;  2BKZ B;  2W96 A;  4CXA B;  4F7S B;  5HVY B;  3TNH B;  2I40 B;  2IVX A;  5HBJ B;  1JSU B;  3EOC B;  4EC8 B;  4CFU D;  4EOI B;  4EOS B;  3M03 A;  4EOJ B;  5EFQ B;  4EOR B;  1KXU A;  4BCQ D;  4TTH A;  4EC9 B;  1JKW A;  1GUX A;  4BCH B;  5IF1 B;  2JGZ B;  2B9R A;  4Y72 B;  5LMK B;  3BLH B;  2BPM B;  3BHT B; 
#chains in the Genus database with same CATH topology
 4II5 B;  4MFE A;  3A8O B;  4BCM D;  1G3N C;  1AD6 A;  2CZ1 B;  1H1P B;  2CZ0 B;  3F5X B;  4CFV B;  4BY1 X;  2X1N B;  1O9K B;  4FM4 B;  1H24 B;  2QFZ A;  2UZD B;  1H27 B;  4CFM B;  2QF7 A;  2DME A;  2QDJ A;  4YOZ A;  2WMA B;  4Z6Y A;  5IDN B;  2WIP B;  2D0Q B;  4IMY B;  1H1Q B;  4BCN D;  1UNG D;  4BBS M;  1UGP B;  3DTO A;  2V22 B;  4UN0 A;  4AI6 A;  3DDP B;  3B57 A;  5ICP B;  1OL2 B;  2W9Z A;  4ROD A;  3BLR B;  3G33 B;  3TNW B;  1UGR B;  3VYG B;  2C6T B;  4BCM B;  4OGR B;  2UZL B;  2DXC B;  4HL4 A;  3QYH B;  1OIU B;  4EON B;  4AKI A;  4LOC A;  4NST B;  4BBR M;  1URC B;  4JX5 A;  2WHB B;  3H4C A;  4EOK B;  4CFX B;  3DDQ B;  2ZZD B;  4HNT A;  2UUE B;  4OB1 B;  4CFW B;  2WEV B;  2G9X B;  3K7A M;  4F6S B;  2BS2 A;  1JST B;  4HNV A;  1GH6 B;  2ZCF B;  1FKM A;  4F6U B;  5ACB A;  2IW6 B;  1OI9 B;  3QWL A;  2C5O B;  4EOO B;  2WXV B;  4CXA B;  2I40 B;  2IVX A;  4CFU D;  4EOS B;  1TD6 A;  5IF1 B;  4BCQ D;  1GUX A;  2LW4 A;  3BLH B;  1D3U B;  3VKG A;  4ELL A;  2ZPH B;  4BY7 X;  1V29 B;  3WVD B;  3HB9 A;  3DOG B;  3X25 B;  4YOO A;  2C5V B;  5LQF B;  2PMI B;  4MFD A;  4MIM A;  3HZJ A;  2WMB B;  2EUF A;  2C5N B;  1QLB A;  2WFY B;  4KRC B;  3O0G D;  4JX6 A;  4BCJ B;  4ZGE B;  4F6W B;  2F2C A;  5CYI B;  1OKW B;  4CFU B;  5DQV A;  5L2W B;  4BCF B;  1IRE B;  3X26 B;  1UNH D;  2DXB B;  2KMG A;  2R7G A;  1GY3 B;  5FGK B;  2ZPE B;  1W98 B;  5IHY A;  3A8G B;  1FVV B;  3QHW B;  2KR6 A;  1H1R B;  3X20 B;  2QQ8 A;  3TNI B;  3QYB A;  3A8H B;  3X24 B;  3QYG B;  1XO2 A;  5CEI B;  4OB3 B;  1OGU B;  4F7J B;  2ZPG B;  3BG3 A;  1JSU B;  3EOC B;  1JKW A;  2JGZ B;  3QYE A;  3BHT B;  4OB2 B;  3PO3 S;  2PK9 B;  2W99 A;  1ZP2 A;  3MY1 B;  4BCN B;  3QHR B;  4OR5 B;  4HNU A;  1FIN B;  4EOM B;  3EID B;  2QDY B;  1H1S B;  5HBE B;  5EJC A;  1OL1 B;  3TW7 A;  3DL1 A;  2PHG A;  2CZ7 B;  1GUX B;  1E9H B;  4BCP B;  2UZE B;  1C9B A;  3VKH A;  4ROE A;  3EJ1 B;  4F7L B;  5HNB B;  2W9F A;  1VYW B;  1JOW A;  2CZ6 B;  3MIA B;  3X28 B;  4CRL B;  1VIN A;  4EOP B;  4NC6 A;  2WPA B;  4BCK B;  2BS4 A;  4OB0 B;  2UZB B;  3GTM S;  1N4M A;  5I5Z B;  1OIY B;  4EOL B;  1VOL A;  2WIH B;  3MY5 B;  4YOS A;  4BXX X;  4BCI B;  1UGS B;  3RGF B;  3NDQ A;  2DD5 B;  1F5Q B;  1QMZ B;  4YC3 B;  4KRD B;  4QSH A;  4BCQ B;  4M6V A;  3TN8 B;  4BCG B;  4F70 B;  2G77 A;  1H4L D;  5BNJ B;  3WVE B;  4JX4 A;  4G6L B;  2C4G B;  1ENW A;  2C5X B;  2CCH B;  3HO8 A;  1O9K A;  5HVY B;  4F7S B;  3TNH B;  5HBJ B;  4EOI B;  3VYH B;  4EOR B;  2BS3 A;  4EC9 B;  4BCH B;  2ZPF B;  2B9R A;  4Y72 B;  3TW6 A;  2BPM B;  3LQ5 B;  1OKV B;  5IDP B;  2ZPI B;  4CFN B;  2CYZ B;  1UNL D;  4HLQ A;  1AIS B;  3BG5 A;  2PJQ A;  3HBL A;  3POM A;  1P5E B;  1E7P A;  2QGS A;  3A8M B;  1H26 B;  3DJB A;  1PKD B;  4I3Z B;  1H28 B;  3QZ5 B;  3HHT B;  3QZ9 B;  4AKH A;  2W2H A;  4FX3 B;  5DQW A;  3MI9 B;  1TFB A;  2IN3 A;  3BLQ B;  2CCI B;  2I53 A;  2ZPB B;  4BCO B;  5HBH B;  2CJM B;  4ZGD B;  2IW9 B;  2IW8 B;  3KHI A;  1UGQ B;  4EOQ B;  3BHU B;  4ROC A;  5HQ0 B;  4AKG A;  1BU2 A;  2PK2 A;  1AHJ B;  4ELJ A;  4F7N B;  2WJ9 A;  3BHV B;  2DPP B;  1H25 B;  2BKZ B;  2W96 A;  4EC8 B;  3M03 A;  4EOJ B;  5EFQ B;  4ZGJ B;  2AHJ B;  3BG9 A;  1KXU A;  4TTH A;  2DD4 B;  3A8L B;  3QXE B;  5LMK B; 
#chains in the Genus database with same CATH homology
 3LQ5 B;  4II5 B;  4ELL A;  2PK9 B;  2W99 A;  1ZP2 A;  1OKV B;  3MY1 B;  4BCM D;  5IDP B;  1G3N C;  1AD6 A;  4BCN B;  4CFN B;  3QHR B;  4OR5 B;  1H1P B;  1FIN B;  3F5X B;  3DOG B;  1D3U B;  4CFV B;  4EOM B;  3EID B;  1UNL D;  1H1S B;  5HBE B;  2X1N B;  4YOO A;  1O9K B;  2C5V B;  5LQF B;  1H24 B;  2UZD B;  1H27 B;  1AIS B;  1OL1 B;  4CFM B;  2PMI B;  2PHG A;  2QDJ A;  1GUX B;  2WMA B;  2WMB B;  1E9H B;  4YOZ A;  5IDN B;  2WIP B;  4BCP B;  2EUF A;  2C5N B;  2UZE B;  1C9B A;  3POM A;  4ROE A;  1P5E B;  2WFY B;  4KRC B;  4IMY B;  3O0G D;  3EJ1 B;  1H1Q B;  4BCN D;  4F7L B;  5HNB B;  1UNG D;  2W9F A;  4BCJ B;  1H26 B;  1VYW B;  4F6W B;  1JOW A;  2F2C A;  1PKD B;  3MIA B;  4CRL B;  1OKW B;  5CYI B;  4CFU B;  2V22 B;  4I3Z B;  1VIN A;  4EOP B;  1H28 B;  4UN0 A;  3DDP B;  5ICP B;  5L2W B;  4BCF B;  2WPA B;  1OL2 B;  4BCK B;  1UNH D;  2W9Z A;  4ROD A;  2R7G A;  2W2H A;  1GY3 B;  4FX3 B;  3MI9 B;  2UZB B;  3BLR B;  3G33 B;  1TFB A;  3TNW B;  5FGK B;  1N4M A;  2C6T B;  1OIY B;  4BCM B;  3BLQ B;  5I5Z B;  4OGR B;  2UZL B;  2CCI B;  2I53 A;  4EOL B;  1VOL A;  4BCO B;  5HBH B;  2CJM B;  2WIH B;  1OIU B;  2IW9 B;  3MY5 B;  4YOS A;  4BCI B;  4EON B;  3RGF B;  4NST B;  1URC B;  2IW8 B;  1W98 B;  1F5Q B;  2WHB B;  4EOQ B;  1FVV B;  3H4C A;  1QMZ B;  3BHU B;  4EOK B;  4YC3 B;  4CFX B;  4ROC A;  3QHW B;  3DDQ B;  4KRD B;  4BCQ B;  5HQ0 B;  2UUE B;  1H1R B;  4CFW B;  2WEV B;  2G9X B;  3TN8 B;  3K7A M;  3TNI B;  4F6S B;  4BCG B;  4F70 B;  1BU2 A;  2PK2 A;  1JST B;  1H4L D;  5BNJ B;  1GH6 B;  4ELJ A;  4F6U B;  5ACB A;  2IW6 B;  4F7N B;  4G6L B;  1XO2 A;  5CEI B;  1OI9 B;  2C4G B;  3BHV B;  2C5X B;  1OGU B;  2C5O B;  2CCH B;  1H25 B;  2WXV B;  4EOO B;  4F7J B;  1O9K A;  2BKZ B;  2W96 A;  4CXA B;  4F7S B;  5HVY B;  3TNH B;  2I40 B;  2IVX A;  5HBJ B;  1JSU B;  3EOC B;  4EC8 B;  4CFU D;  4EOI B;  4EOS B;  3M03 A;  4EOJ B;  5EFQ B;  4EOR B;  1KXU A;  4BCQ D;  4TTH A;  4EC9 B;  1JKW A;  1GUX A;  4BCH B;  5IF1 B;  2JGZ B;  2B9R A;  4Y72 B;  5LMK B;  3BLH B;  2BPM B;  3BHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...