3DE0X

Proteinase k by lb nanotemplate method after the second step of high x-ray dose on esrf id23-1 beamline
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de0X00
3QTLA 1XF1A 4NMXB 5FAXA 5AMXA 1SPBS 2PYZA 1LW6E 3BPSA 1PFGA 1AVTA 1UBNA 2Z2YA 1A2QA 4M1ZA 1BE8A 5JXGA 1ZVKA 3EE6A 5JXIA 2GKOA 4C3UA 3DE7X 3DE5X 3PRKE 1ZVJA 1Y4AE 2TECE 5ARBA 1Y4DE 1GNVA 4KG7A 4NE7A 1OYVA 2Z57A 5ARCA 1BJRE 3I2YX 1SCDA 3Q5GA 2SECE 2B6NA 3ZXXA 3AJ8A 4AKSA 1OT5A 1T1IA 3WQBA 3DYBA 1IAVA 4WOBA 4I0WB 1SELA 1KDVA 1EA7A 1V5IA 1Y33E 1CSEE 3LPDA 1TM3E 3SICE 1S2NA 1DBIA 3DWEX 3DE1X 2WUVA 2SNIE 3VTAA 1CNMA 1JEAA 4RYDA 4CFYA 2G4VA 2W2NA 3LPCA 4NE9A 1SBHA 2ID4A 2ID8A 2P4EA 1THMA 4AKTA 4C3VA 3P5BA 1EGQA 5JXHA 1OYOA 1TMGE 1ST2A 3L1KA 4Z2AA 3VV2A 1MEEA 1AQNA 3AJ9A 1ST3A 2W2MA 1SUCA 1TM4E 1KE2A 1TECE 1GTG1 1TM5E 1T1GA 2DP4E 4FONA 2PRKA 2IXTA 3DE2X 4ZOQI 1Y3BE 4H6WA 3QMPA 3DVRX 5JXJA 2ZWOA 3GT3A 4GI3A 4CG0A 1SN7A 3D43A 3VV3A 1PJ8A 3Q40A 1Y1KE 3DVSX 1VSBA 1YJCA 1TO1E 2WUWE 1Q5PA 3TECE 1P7VA 2W2OA 3QFHA 3OSZA 3I34X 2PWBA 2X8JA 5I9SA 1P8JA 1S02A 1SBIA 1GNSA 1SCBA 2SBTA 3VHQA 1GA1A 1SUAA 3BGOS 2ST1A 5CW1A 3DW3X 2PQ2A 1SVNA 2Z30A 2DUJA 1MPTA 3UNXA 2IY9A 1C9MA 3ZXYA 3CO0S 3A3NA 4H6VA 3F7MA 2PMWB 2Z58A 5AVJA 3DW1X 4MZDA 4YN3A 5B1EA 1Y3DE 4B5LA 2Z2XA 2WWTA 4HVLA 2W2PA 1GT91 1WSDA 3A3OA 1HT3A 1Y48E 2PWAA 1GA6A 1SUBA 1C3LA 1KE1A 2W2QA 4LVNA 4BWGA 1PTKA 2E1PA 1YU6A 1GA4A 3BX1A 3F7OA 1T1EA 1NDUA 1SH7A 1SBNE 4J94A 1AU9A 1GCIA 1AV7A 4ZARA 1BE6A 1TO2E 1C9NA 5FFNA 3PTLA 1AF4A 1P7WA 2Z56A 2XRMA 1SCAA 1YJAA 4WOCA 5JMOA 3GCWA 3T41A 3EDYA 2XTJA 1SUDA 1SCJA 3TI7A 1KDYA 1V6CA 1SCNE 1S01A 1R6VA 3DE3X 3WHIA 1TM1E 2ZWPA 3SQOA 3HJRA 4OMDA 1PEKE 3GCXA 1SBTA 1WMEA 2SICE 1Y34E 3EIFA 3DE0X 5FBZA 4DWWA 1Y3FE 1NLUA 1AH2A 2DQKA 5B1DA 4DJ5X 2V8BA 2Z2ZA 5AQEA 3H42B 1Y9ZA 3LXUX 3GT4A 1WMDA 3CNQS 1IC6A 1BFKA 4KPGA 1SIBE 1R64A 3VYVA 3DDZX 4OV6B 4LVOA 3A3PA 5K7SA 3VSBA 5SICE 1SBCA 4OMCA 2X8JB 1BFUA 1Y3CE 3I37X 4K8RB 3WIUA 2QTWB 2ZRQA 1SUPA 3LPAA 3DVQX 1SUEA 3DE4X 4HX2A 2HD4A 3D9QX 1DUIA 1GTJ1 2PKCA 5AVKA 3I30X 3AFGA 4H6XA 4KB5A 3TI9A 1AK9A 1TK2A 1SIOA 1WMFA 1YJBA 3F49S 3WIVA 5ARDA 1BH6A 4JP8A 3DE6X 4DZTA 4CFZA 1NDQA 1TM7E 1R0RE 2HPZA 1KDZA 2WV7A 1WVMA 1GTL1 1SIUA 1C9JA
chains in the Genus database with same CATH superfamily
1JTVA 3K2QA 2WV9A 2C7RA 3WLHA 1Z4LA 4PYLA 3S8YA 1L5YA 5KUTA 3A9VA 4PO9A 1YL6A 2G4CA 3E1SA 1XNHA 4FFPA 1P31A 2BR5A 1XP8A 2X5OA 4L6AA 3WNBA 4ZA2A 3TB4A 1C29B 3N8DA 2OSBA 2ZE6A 3M6VA 5GONA 4NOLA 4EY5A 3K2BA 1UCFA 2XLCA 4RMHA 4DJEC 4EI2A 3Q6NA 4BFCA 1AZLA 4JYBA 5HQ3A 3VUEA 4QYTA 2FWJA 3T5BA 4F12A 3L8ZA 2O8FA 1O8BA 2H85A 1OYYA 3AIOA 3EGCA 3GLGE 4WKOA 2P77A 2AYXA 1KI7A 1QYWA 2RHDA 2VWGA 4HNSA 2R1TA 4R6WA 1RMQA 1ZVKA 3BRWA 1VPVA 2A3NA 2OT3B 5KWEA 1KRXA 1C1HA 4JLJA 1M8KA 4FOOA 4RY0A 3N0TA 4WESA 1GUFA 1JQDA 2A5JA 3O75A 4PZPA 2XOKA 2PQ0A 4FGZA 2F8TA 3MGKA 1Y8RB 4RMJA 5K9ZA 4FMDB 4B8YA 2AB0A 1YE8A 1NQTA 1PWYE 2IE0A 4JV5B 3DE5X 4CQNA 4E03A 2GARA 4RK6A 4M9QA 2IXGA 5JSZA 2Q3EA 1AN9A 1CFZA 1PD1A 3AM5A 4C43A 1UBKS 4R1PA 5E6UA 2FSGA 3ROQA 2CFRA 3VM6A 5JSHA 2PSFA 1O5TA 2WYWA 4BAGA 4C4SA 2G8NA 2L18A 2OORA 1PNQA 1Q92A 1X8JA 4DIOA 1FNDA 4I5FA 4PLVA 5DLQC 2WTAA 3NORA 3O26A 4KR0A 3S2FA 3GFFA 2PRYA 2NX2A 2ZBVA 1E1QD 2DQZA 4PSKA 3G8CA 4B43A 2PEYA 4DIUA 3B12A 2EFYA 3EVFA 4QNRA 2NO7A 1SCDA 1M5RA 5DT2A 2Y4NA 3KWLA 3QWHA 1IZ9A 1IB0A 3BWCA 2FP4B 4IDEA 3AJ8A 2P0AA 3U4MA 3OLVA 4S0XA 2X2PA 3OZFA 3LUPA 3DKVA 4BNZA 1N2BA 2JB9A 1DJOA 4HGNA 4OB8A 4NBLA 5ENVA 5GZ1A 5K8LA 2VT2A 1QAMA 4CKCB 4WCFA 1NAHA 2NT3A 4H77A 5I4BA 4I0WB 4FTWA 2XXJA 4M21A 4LYEA 1HE5A 1KDVA 4IEIA 4DUZB 1Q7TA 4XB2A 5BV7A 2BM8A 2IS2A 5BUSA 421PA 4NZZA 3ZKAA 3M4YA 4Y98A 5B4UA 2I29A 5D5PA 1T9HA 2H2AA 3O8NA 4KXFB 4QPPA 4EHAA 1YBHA 3EZLA 3VJRA 3O91A 1E0KA 1FFCA 3QMVA 5P8WA 3F9CA 4B87A 4BLTA 4BQRA 3U5TA 3GA7A 4LC1A 4RMGA 5FEUA 3KXPA 3P2JA 3R74A 3DWEX 2BEVB 1FFBA 2X1HA 721PA 1LI5A 3FKSD 2GI4A 3QX9A 4M9CA 4KR9A 3H8SA 4AF7A 4DMGA 3BK7A 3ECCA 1Z22A 3S0JA 1RLIA 1TQHA 5KBYA 5IFKA 3ZWCA 3IIJA 1ZRMA 1C9YA 1CUIA 3KYDB 4RY9A 2YKGA 1JLHA 4QDOA 4D5EA 4DLYA 3VNBA 1U7ZA 3FKSA 1MX5A 1FQJA 3EY9A 3AZPA 4WGFA 5LBTA 5KX5B 2YWHA 1NBHA 3T12A 4YWHA 5F76A 1SA0A 3VJKA 2X41A 3ZWOA 2X9QA 1IHOA 2YYZA 3AIKA 1JQ3A 4HR7A 4HTAA 4RF3A 5DKFA 3TQCA 1RSZA 3MT8A 4WXYB 3QXCA 2CMDA 4EJSC 3CU5A 3CLSC 5C7LO 3GNSA 3C7CB 3ZD7A 3E1KA 4D6XA 5FWAA 3KBBA 3SZGA 1CE8B 2DXIA 1H8HA 3CEAA 4LRXA 4NG4A 1GZVA 1OROA 3JPWA 3UGQA 3UA3A 2WYVA 4C78A 2EW1A 5B4VA 3WZLA 1S2GA 2XTAA 1TVMA 1SO8A 2R6GA 2B7BA 1TW2A 5EY5B 1A72A 3KQMA 1MH1A 5D3MB 1IRIA 4YRGA 4I4NA 1EVKA 3OFJA 3WHKA 1QGYA 3PC8C 4Z2AA 4YCNA 1AXRA 3BTVA 2PZLA 3KUDA 1EHCA 3R24A 5F35A 4M98A 3G5AA 1RRCA 2O52A 4NP6A 3UIEA 4FHEA 1VJDA 1QVZA 4UEOA 3U4QB 4R9NA 4DXHA 1N5RA 4FE4A 4MHTA 5CAEB 2G8LA 3D6FA 5AM4A 1YIDA 3OICA 4M6WB 4FP9A 1YC5A 4X20A 2FUNB 2OQRA 4UHCA 3DE2X 1NUHA 5EQJB 3MTEA 1GFZA 3I2IA 1Z8DA 4YC7A 3TCXB 2H4JA 3VH1A 4JLWA 3AHFA 1G8AA 3AR7A 5IP5A 4AWAA 5E2IA 3X1JA 4C5AA 8MHTA 1F2UA 4FYMA 4JWKA 3DNMA 4J0GA 2I76A 3GFSA 1IYZA 1NBAA 1YR3A 5KVCA 3I3OA 2VJOA 1XALA 1EBFA 4P54A 1A9ZA 1SD2A 1XNGA 1KRHA 4IOJA 2QB5A 2V1XA 2FWPA 3LBNA 1XV5A 5CB0A 1VP9A 1CRLA 1OVMA 3UJ8A 4FDTA 4TXMA 4GOJA 2O2DA 1V8BA 3A9CA 3BIWA 3G17A 5EKUA 5EJ9A 4OHXA 1KNQA 3NBQA 2CF5A 1K68A 3RRFA 2AR0A 4PQRA 4KV7A 4BNYA 3U19A 4WNYA 2VSQA 3IPAA 3OOSA 3AKDA 3PDHA 1W25A 3MB8A 2TMKA 3FMIA 4XWAA 4FQ7A 4MXDA 3WK9A 1FXSA 3P71T 5FAKA 3J7AC 3OPYI 1QKIA 2R97A 1ECPA 4CI0B 1GFIA 1IPHA 1ZD5A 2GTIA 4WFIA 4Y2PA 5JAHA 2WJVA 1I3OA 1H2RS 3AEXA 1S02A 3LNTA 3NG1A 1OZFA 2KX7A 3EMDA 3K0CA 5AYVA 4H9GA 5KSWB 3Q7TA 5KWSA 5KYYB 1RQRA 3VHQA 1FFDA 3GRFA 1GA1A 2IUEA 1LTQA 5JNSA 3WZ2A 1CHNA 1YGYA 3BGOS 2B0CA 2I7TA 3G88A 4MNTA 4QIHA 3MJEA 3VU8A 4CDMA 1KTIA 4R40A 3T7CA 5G3YA 1WD7A 1TI7A 3P9YA 4M87A 1A7UA 4LGMA 4GAEA 4G5YA 4HO1X 4PNHA 4TXJA 5TR9A 3VPCA 1CU1A 4KQMA 3SF0A 5J4KA 5KDOA 5MGNA 3BCRA 5ALNA 3ONFA 2EIXA 1YMUA 1ABEA 1TYDE 2VCEA 4I5DA 3TLJA 2WVGA 5IABA 4BFUA 1F8XA 1XCMA 2EZTA 1OE0A 2WZBA 3N3AC 4MCIA 3UNXA 4ESHA 3ADBA 3QYAA 2IT1A 1YZGA 4DV3B 2JLBA 2IOFA 3LRPA 2INGX 2DYKA 3TR0A 4A8JA 4Z1OA 4G1UC 3W79A 3BRCA 5HUHA 1DAMA 3AEZA 1AHHA 3QFRA 4KODA 3RABA 1K6MA 2QM7A 2PNJA 3SQDA 3VNRA 1U7PA 1K8QA 2J0UB 4N9WA 4XX0B 4XYEA 2VQSA 1YD7A 3H2GA 4TVKA 1XIVA 4PS0A 5AVJA 4E30A 3RYIA 4QSMA 5KNLA 2R86A 2XECA 5KJ1A 3MD9A 4RFLA 3A6DA 3UMVA 1XZFA 4X8OA 1IM8A 4ENPA 4TKVA 3NKLA 4PSAA 4XLZA 2H54A 2PCLA 4AIRA 4J7UA 4UHKA 3RPEA 3VDRA 2XYQA 1EDZA 2WUDA 3T35A 8ABPA 2Q7DA 4D9FA 1VIYA 4MWCA 4NARA 1L7RA 1V7ZA 3ROXA 1IXYA 2R8RA 2QEQA 3IRUA 1Z7EA 1HL3A 2V0GA 5AOBA 4YT2A 1LBHA 3EDCA 4IICA 1Z2OX 3ORHA 2B0JA 3RIXA 5K3SA 1NJ8A 1PTKA 2GNOA 4YMTA 4KI0A 3NKFA 3PIRA 4LCBA 5EUQB 4RGBA 1U0NA 2AKAB 2I71A 3SQNA 3LCJA 5F1PA 3TPFA 4LY6A 3C6MA 3JYHA 4HUQA 1DAPA 1VLVA 2D4HA 4GU5A 2JGRA 3EOBI 3RCBA 1AK1A 5EXXA 5LMNB 3I9LA 3GN1A 4HP8A 2FFHA 2LIVA 5I7RA 1XTSA 2J6CA 2V5VA 1EWQA 1K9VF 4LPSA 4Y2JA 5D51S 4ZDWA 3SVZA 4CR7A 4FLFA 5EL0A 4CMGA 1P1IA 3MCUA 5H82A 1QZUA 2I8AA 3INYA 2GCIA 4BB6A 2X5XA 1G4HA 1XEXA 3LX4A 2PH1A 3TTSA 2QRVB 3RJMA 2QZZA 3FB4A 4D96A 4DQLA 4DUGD 1T4DA 3LT5A 3OM1A 2CHQA 3ENNA 3JWPA 1RM0A 1TLLA 4DLBA 3PPIA 3KLPX 4A10A 4BKUA 3BL8A 1HKUA 2C9ZA 3DHYA 3GCWA 3OT5A 1NVMB 5LBUA 1ZVVA 3G8BA 2Y0CA 2VIIA 1X92A 2HPHA 2QTBA 4A1OA 5JH7A 2PGLA 2G4LA 2PX3A 4OHWA 4JB3A 3SF8A 1CY1A 4ZCSA 3D8HA 3ICEA 3GGCA 3QVUA 4DCJA 2I55A 1NWCA 1Z34A 2RKWA 3FPEA 3OJLA 3E3MA 4D9JA 1YB7A 1R4NA 3UB3A 3L7OA 4TUYB 1S8OA 1EFKA 1YK1A 3EGXB 3GEIA 4DJFC 2OLKA 3ENZA 4G9GA 5AOAA 3SOZA 1DKRA 1GGKA 1K0FA 2IW3A 3EQ7A 4FFRA 4IIVA 1R8XA 1X7XB 2IPAB 4BO6A 1J5PA 4MA5A 1UBFA 621PA 1FVXA 1PNVA 4KRYA 1RYMA 1SHLA 2X40A 3UJNA 2Q3JA 4AYTA 1ZOPA 1JR3D 4JEHA 3ZGZA 3BMCA 1H1LA 1LC3A 3ZUPA 2O7NA 2DE0X 3AINA 4R1SA 4UD6A 3LPMA 3VR5H 3A6LA 1SXJE 4EB6A 3U7QA 3VHXB 2P0EA 4XJTA 1LZLA 2VP6A 2XGOA 4F4HA 3MGGA 3N53A 2Q7XA 2Q3BA 5AIAA 1NQUA 3V46A 1U0HC 5FBZA 3TSCA 2ORWA 4YXWD 1LPNA 3PQEA 3NW9A 4QFCA 3IBFA 3MFQA 2B4AA 4HDAA 3VKWA 3P9RA 3UGTA 2EWMA 2F3TA 2R85A 5U1PA 4P31A 4OKSA 1BJKA 1SHKA 1XB2A 1G60A 5FEMA 4KXUA 3QA3E 3URMA 3DD5A 4P33A 2WHRA 2GESA 1J7JA 1TUGA 3W2GA 1QFYA 3NV9A 4CODB 2D5LA 4E5NA 4YB8A 1VKOA 2BLLA 2RB5A 3NT2A 2ZYIA 4J0IA 3S7ZA 1ZS9A 1NVAA 3C41J 3LF2A 3PQ6A 4YMIA 3W2FA 5HIKA 4L6IA 1NYTA 1I3MA 5HM8A 2XITA 3CLKA 1E2GA 1G3MA 4FZJA 4NZOA 4IKEA 4O1IA 4AMZA 4ZEVA 1SC6A 3TQOA 4YCSA 1WUYA 3BGVA 3D7MA 2P9HA 4UCFA 4DLAA 5BYAA 1T5LA 3N8HA 1PV4A 4QUJA 2QX4A 2DC1A 4GHWA 2VJBA 3IP7A 3HDVA 4Z7QB 1OTYA 4CGZA 4HDMB 5JAOA 1LDMA 1AKMA 2HWWA 4HVCA 1WNFA 3NTRA 3ADDA 5K45A 5G02A 4G1BA 1DEOA 2GSDA 4FT4A 5D84A 2PVCA 3USES 2OSVA 3U6BA 5FUQA 1TT5A 5FYQA 3O90A 3EFBA 4RF4A 6LDHA 1OJ7A 3LPAA 1HTWA 4B3CA 4YRLA 2JRLA 4GWLA 4PXSA 1V3VA 3PDJA 3TZHA 3OZXA 1XJQA 2ZREA 4RV5A 4KXVA 2VDRB 3DO8A 4F11A 2I33A 5KSOA 2JEOA 2VDWB 1CB7A 1YE3A 5ILQA 3UENA 1VYUA 4YIHA 3HL4A 2VAXA 3G2LA 3OCCA 5LYYA 3E70C 1U1EA 1VOTA 1WPQA 2RJOA 3H16A 2B83A 1TFRA 6AT1A 4QJ5A 4REQA 3AVXA 3RB8A 3TI9A 1VHWA 2G88A 2R8OA 4YNBA 4YJGB 3RSHA 3VC3A 4F3KA 2YHBA 1P9OA 3AZQA 4YXFA 1W94A 2JIOA 3H8WA 4CKBB 3BA1A 5J40A 2D1YA 4P4TA 3NO4A 4U2FA 3USZA 2QQEA 2O6LA 3QYPA 4CFZA 3UGKA 3LDUA 3QE9Y 3EG9B 3LKBA 1XWFA 2CZGA 4M8LA 4IJUA 1E7SA 5B7PA 3B5IA 3B78A 4J3FA 1A2KC 1DO2A 2HRCA 4EGFA 5FADA 1YK0A 1Z47A 4KR3A 1D2GA 2B30A 2GYWA 3CZQA 4JN6B 4BQEA 2O4CA 1SXIA 2BZ0A 2DBYA 2QP3A 4Q7KA 4RDXA 2V7UA 1XNRB 5AJVB 3R8CA 2VP0A 1JKJA 3ANMA 3HRIA 4N40A 1NUSA 5JPCA 5TPZD 3LH5A 1U0RA 4K1LA 1XCBA 4KQCA 1J39A 3LY5A 4S2UA 5HW0A 5JC1A 3HUEA 2DHDA 5ALQA 4ZYWA 3ROGA 5C1BA 1C9JA 3DOHA 3W3AD 3K0BA 3Q7IA 1T43A 1ORWA 2W6CX 4LBWA 1UDBA 3HXLA 4PLPA 3ZLJA 3R0ZA 1E94E 3ZJUA 2XXAA 1KPGA 2JAOA 2IZZA 4YMWA 4NFYA 5I7SA 4MRRA 4R9RA 1D1TA 3LTNC 1ESNA 2YNMC 1R0CA 3U62A 4LZOA 4PSCA 2QS9A 1EX6A 3RVOA 1T29A 2VQ6A 2C2YA 3E3OA 2J07A 3ZIUA 3DLBA 4EF5A 2BW0A 3OUZA 1YOBA 1NRWA 4MR9A 2IV3A 5EJEA 3GLFE 1G9TA 1V5GA 1PFGA 2I66A 2UYYA 1X1TA 1Z4IA 2PY6A 5IS2A 3D4PA 5CT4A 3KSRA 3VTKA 2N42A 3U13A 5C35A 4MR7A 2XWJI 3I1FA 3GJYA 1MVOA 2C77A 3VH4A 3JY6A 4OAPA 2G5TA 5KYXA 3VVLA 1AX9A 1BA2A 3DBIA 1U3UA 4JBHA 3D5EA 4CLHA 1E2LA 2A57A 4Q4JA 1C3OB 1II0A 3LWBA 5BT8A 3SLKA 1MABA 2R4TA 4LDRA 3RRMA 1IEWA 2WW8A 1ZY2A 1T6YA 4F3TA 2GBCA 2WI8A 1U9IC 4J6EA 5FR1A 1QQ7A 3IQXA 3RS8A 1UAAA 1N78A 3Q10A 4PAMA 3RKUA 1O57A 1OW3B 3MT9A 3OLCX 4FDVA 4ID9A 1K92A 2HJHA 3BEDA 3LWZA 1UMCA 3HKDA 4Y2GA 3CW2A 1QZXA 3PBKA 1KSJA 2DJ5A 1QP8A 1UMDA 4B9EA 2OZLB 2P91A 4RX1A 1Y4DE 4NYMQ 5JCOC 1OSNA 3BBPA 4Q9JA 1GNVA 4YUVA 2D0PB 5CBPB 1NBIA 1XFAA 3BE8A 3OOYA 2XUFA 2JGFA 3IDSA 4ZT3A 5B2FA 3FVTA 3RRJA 2NVWA 3PDUA 3ZTYA 4E07A 4QXRA 1FVFA 3QW2A 3WGVA 10MHA 3ES9A 3H9CA 4RO0A 2CCKA 1P4HA 1JVSA 5I9MA 2BPOA 3K9BA 5C8XA 5BN3B 1VSVA 3ZEAA 2NUAB 1PGPA 1HTTA 2D5CA 2GEFA 2A30A 2RAFA 3FFBA 5BWMA 2MSWA 4KWTA 3QEMB 1P5JA 4OBBA 2WU4A 3PC3A 3K9HA 5E2BA 4EW3A 4D2IA 4C14A 5HRAA 2NUTA 2BSQA 3LKDA 3EXAA 1T9CA 1UK8A 1HGXA 1P75A 1TMOA 4IG4A 4HB3A 3W4IA 3WBFA 2QX6A 4A6DA 5A7HA 1VHTA 2Q3FA 2UVQA 5KOYA 2HLDD 3D6MA 1YRAA 1NSFA 3L0SA 4V0ME 4GPEA 4Q9LA 3QEBZ 4JNKA 5EMHA 5AHWA 1SC9A 3ZWVA 2BKXA 3F78A 2Y1OA 4WVFA 2V7TA 4BNWA 1IG0A 2CFIA 4PYMA 5EE1A 3SD7A 2ILVA 3WYDA 5L3QB 3LPDA 2AHOA 2BZGA 2BCJQ 1AD2A 5ALPA 1WW3A 5FOVA 3D4LA 2QA5A 3E8MA 2HLDA 4YDRA 5T3YA 1NG9A 4PG8A 3SSAA 3DE1X 3P2IA 2DG2A 3TD2A 3S1SA 4Q02A 3TLKA 4JUDX 4FD3A 1V7QA 5J9FA 2ZSKA 3OF3A 3VQTA 3IOBA 4D41A 5SYMA 5JJLA 1VLQA 3OOHA 3NXSA 4TT8A 4ZJPA 5ALRA 4X85A 1W5SA 2BCGY 4PAGA 5TT0A 3T4UA 4QO7A 3GGOA 5GIOE 2Y4OA 1WABA 4JGGA 5CLHA 2EJWA 4FDLA 4L15A 3DXZA 1NP6A 3H1AA 3NFYA 3UG7A 4F2DA 4LF8B 3NEYA 3HA2A 1MOQA 3TN7A 5F5XA 4AL4A 5LDDC 5HCNA 3RSCA 1I94B 4GPZA 4NE9A 5LWHA 1LY1A 2ICAA 3FWZA 1YQUA 5GV8A 1IBCA 1R9MA 2GJAA 3GPCA 1H69A 5CTAA 4EUSA 1KI2A 2IUSA 121PA 4X90A 5NULA 3ICQB 1WP9A 4S05A 3G5LA 3HXQA 3UVEA 2C5SA 3P5BA 4KQHA 1AQJA 1HA3A 4OB7A 3CS3A 1CIVA 3N8GA 3IP9A 4JEIA 4Z51A 1TJYA 1X7WA 4DXAA 3CT6A 1U1DA 3THRA 3CPSA 2ZWMA 1RS0A 2C07A 2VS1A 4C0AC 1QHXA 1YIOA 2O1XA 4BLVA 3W8RA 4DS3A 5BV2P 3PLRA 4KH0A 2H4HA 3B85A 2EBUA 3RVMA 4C0JA 4HWRA 1G98A 3TGPA 4JEMA 1IK4A 1I7NA 2M1ZA 1A4UA 3HU5A 1EESA 5LZ5A 2EX0A 4MV1A 4EQ6B 2ZVDA 1YVPA 1GYPA 5KWJA 3CM0A 3B1WA 1F60A 1GTG1 1IEVA 2BHTA 3BE5A 1J00A 1IQUA 3BG5A 3RU2A 4CJXA 4N1AA 5HZMA 4MEBA 1O94C 2FPSA 1VBMA 3WLQA 1A8PA 4UUNA 1W5EA 1ZLYA 4Y0NA 5HF5A 4BMXA 1HQDA 2PKQO 2RGBA 2CJFA 5AJWA 1Z5GA 5I4KA 4XARA 4DLVA 3NDBB 5IX8A 3P9PA 2CGEA 1I7LA 4MV3A 4NMWA 2R8BA 1OASA 2VJCA 4ZAWA 3T3PB 1F4LA 4Q39A 5CM8B 1E1NA 1ACMA 1Z7BA 2CWDA 1RD4A 1TCBA 1XFDA 3LY8A 5HOEA 1R0WA 1VG9B 2OLEA 4OUDA 5ERGB 1H2BA 2WAYA 2IX3A 3EZFA 1G18A 1K1EA 3IBSA 3DVSX 1IHUA 4K9NA 4BE4A 5JBQA 2O8CB 1PJ3A 5I9TA 1Y6RA 1E2DA 2GB4A 1IUPA 3EK2A 4JJGA 3FTPA 5I5GA 4HLUA 2VLIA 3QKWA 5IC5A 3TLXA 1T8WA 4TLBA 1XU4A 3TX6A 1C7JA 2M1XA 5KNDD 2PS3A 3KOOA 1P7VA 3MBKA 2WQZA 3HEBA 2GZ3A 2GD2A 4GECA 4Q37A 5LLSA 5ITZB 2H17A 1N5KA 3V8QA 1W4AA 1WMSA 4F4FA 4YCJA 2OC9A 2UZ3A 1DG9A 4GL4A 4NYIQ 2CVZA 2F1HA 2HI0A 2IIPA 1DE0A 3OLWA 2XVXA 4FFMA 1FRZA 2ZGVA 3OSZA 4M9ZA 5H3CA 4PSUA 3CSSA 4HWKA 5CLQA 4Q01A 5LU8A 3PNYA 3LA6A 5E3IA 1K7EB 4Q05A 3MEQA 2YWEA 5L3ZA 3MS7A 1GUZA 4C89A 2IH2A 3KQSA 5HDBB 5ESXA 3QMWA 4RTQA 3VSEA 2VLBA 1NPDA 2PD4A 4F96A 1MGPA 2J0SA 5BV1A 3S2UA 2EYUA 2VAVA 1Q6ZA 2P9YA 1TAUA 4MRVA 5FIUA 3N74A 1SXJA 1EJ6A 1N36B 2KLBA 1NE7A 1F5SA 2EZUA 3MJ4A 4MIKA 4IOKA 3GJZA 1JPNA 1I2BA 1VSUA 3FF4A 5LXTF 1W88A 5D3KA 3WB2A 3GK3A 2I4TA 1SVNA 4L57A 1P4AA 5K0GA 2CHVA 1B0AA 3HXMA 2PUBA 4WY2A 2OAGA 4ZVQA 1GWNA 3VYRB 3AWDA 4A0FA 1B7GO 3FOEC 4ZGGA 3N2IA 1XPRA 4CIDA 5ISMA 2WLSA 3U26A 2WJJA 3R9KA 5EPEA 4WADA 4HBZA 2B34A 2C9MA 4HH0A 4GYYA 4RCVA 4F3CA 4MQLA 2O8DB 1ZONA 3CIOA 4MYDA 4AZ0A 1A9SA 4MPJA 3HCBA 3NPAA 1PR5A 3BB3A 1VB5A 3C24A 1SQ0A 3K4HA 1FTNA 4OYHA 2P67A 3NEJA 1P0MA 1R0YA 4LF6B 1F9AA 3DTTA 4M53A 1R50A 1TYAE 3R6WA 2BF7A 4FKMA 3CEHA 1T5DX 2C61A 4H7KA 1HZZA 3FAZA 4V0RA 2ASEA 1HNNA 4IF4A 5AW8A 3D4IA 4M4SA 4DGSA 3SBEA 1ES9A 2HPAA 3GLSA 2FPIB 2JLAA 3U4DA 5K0CA 3GNTA 1I3NA 4RLSA 2FZWA 1OC4A 4IFIA 1D1SA 1BD3A 4BNJA 4TYWA 5A4AA 1F2DA 3Q72A 3V1MA 2ZB7A 5JCXA 2AEMA 1XMQB 3OT4A 3IO5A 1JAYA 1YSCA 5HF9A 1C3LA 3EA4A 4JQCA 3T7IA 1T0HB 2XKJE 4YT5A 4V1CA 5K01A 5FOXA 1W2WB 3R7LA 1KYWA 4IFBA 2BZSA 4HSGA 5JWOA 4G8CA 2O2XA 4GM4A 4L9SA 3NYRA 4V3CA 1SBNE 3IA7A 1HZJA 3A1FA 2Q3HA 4K28A 2VPWA 3RFUA 5BWCA 5AVQA 4DHEA 1XTIA 3CVWA 4MIOA 4F1KA 1OFGA 4L0QA 1L5QA 5I7OA 1NLZA 4L6CA 3I9NA 4AUKA 3ICWA 5FPKA 3I42A 3W90A 5EKXA 3HYRA 3FHJA 1JGTA 4X97A 1FS4A 4YDSA 1WPRA 2HRBA 3ZV6A 5ALIA 1EDBA 3FHLA 4RGVA 5TQJA 1HDCA 2YZ2A 1UWVA 1JAZA 1QRDA 1BU5A 5FPQA 4DR2B 4DARA 2MWMA 5TQ2A 3KQKA 3GP5A 5LMZA 2C4UA 2BFCB 3JALA 4AO6A 1LWOA 3WGUA 1JNYA 2RAPA 4B3RB 4XWKA 3BZUA 1MLDA 2NVUB 3VKHA 4GZ5A 4I4IA 4TLDA 4NCBA 3C7KA 4F8JA 3WJAA 1SUDA 1LTHR 2A9OA 3LBFA 3BHIA 3OT1B 4WN3A 4D80A 1JZSA 3ACCA 3OKFA 3U3RA 1KDYA 4ND7A 5KU1A 1V6CA 4WLOA 1KYZA 1YU9A 3MCVA 1G41A 2HRQA 3P7MA 2LKDA 4G89A 3AUFA 2O8CA 2ZIZA 4BE7B 5JLJA 3EB9A 1P1BA 1KU6A 1NRJB 2O2HA 3TLGA 5CDYA 4DWVA 4XIIA 5HQTA 3AI7A 5JDCA 2KMLA 2Z6AA 4A2WA 4D8TA 1J22A 5FWYA 3THXB 2XOEA 1XHFA 3MCAA 3JQDA 2ZWPA 4CEIA 5DULA 4B34A 1PEKE 2MOKA 1R4AA 1YBFA 2AG8A 4LQDA 4LEIA 2C4TA 1J70A 2DQ4A 1KSHA 4IQ4A 5CH5A 2X1VA 5M34A 1I4EB 1TJ4A 4MS1B 3SE7A 3H4VA 2Z8YM 5FUBA 2W6PA 4ARZB 3GLFA 1AA9A 2CSXA 5JTUA 2QSZA 4YIKA 2FZVA 5FNVF 3FTNA 4M9SA 3FHCB 1Y1PA 3I8SA 3RFCA 4D9IA 1NLUA 4HLQB 5KTYA 3KSUA 5FBRB 5DIFA 5CPFA 2WB2A 2D6FA 3DAGA 4IVNA 3C3AA 1IBSA 2G40A 2PIAA 4OJQA 2Z2ZA 5AQEA 2GZ1A 2IYQA 3K0HA 4KUEA 1QJCA 2GD1O 4IDDA 4DT1A 1DDOA 4R4JA 2XMQA 3ON5A 4TMKA 2PXCA 3LI2A 1LB1B 4HEA1 2H9YA 4GEGA 4RKWA 3U9SA 3RADC 4YI3A 2FFJA 3NS7A 3QKRA 1H65A 4F9TA 4FYJA 2GEKA 5CXSA 1TM2A 4IHJF 3LLCA 2NXJA 3D7KA 1R64A 4X61A 3FBGA 3RODA 3PX2A 3SN6A 2EATA 2ZFUA 3TNYA 3F46A 2QHXA 4GG1A 4QUAA 3R9WA 4AN1A 4JC4A 3DAYA 3IAEA 3D3WA 3RSOA 5JMPA 5KTKA 1YRBA 1DJLA 1KETA 4ZOLB 1N8KA 3VDNB 2YYAA 1U6JA 1N2GA 5EVJA 4TXHA 2W58A 4IGIA 1VL0A 2HNAA 1QHIA 4M9RA 4E6EA 4E32A 4ZZ1A 2F9MA 2VDLB 3WYGA 3B5EA 2G1PA 1HDYA 4UBIA 1BTOA 1GRRA 4XVRA 3D6UA 1RVV1 3E5NA 5J59A 4UNRA 3NC4A 1RXSA 1JR6A 1L5VA 2GK4A 2O57A 4V0MA 5ERYA 4ZJYA 5FL7A 1FYEA 1S9HA 3ND5A 1YHNA 2QRKA 2GNPA 2QT9A 3M6FA 3ZS9A 4NNOA 2AXPA 3LQ1A 4E5DA 1MOZA 1PZHA 1ICEA 2D2IA 5TDHA 3QK7A 2AS0A 2ZT5A 4XYMA 1RPZA 2WFLA 3ZDBA 2BC9A 4L8LA 4ZV9A 4P7BA 3RVDA 5SYAA 1YJBA 4A82A 2AYYA 5DH9A 1GPUA 1KERA 2FW7A 2UZ1B 1B0UA 4O2BA 4WXRA 2XBMA 1L7DA 3FGPA 1U6KA 4IKOA 1AY0A 1INLA 1T1JA 6PFKA 4NCAA 4EL0A 4C7MA 4PTYA 2AOXA 4G6ZA 2BJVA 3LMKA 2QW8A 4YAFA 4DCVA 1QBKC 1TM7E 2WAAA 3EQ6A 2XUKA 3AEKA 3B3JA 2ZIFA 3KAJA 3QEJA 1FNSA 4ZQBA 3HNRA 3DO6A 3GD5A 4GRIA 1AXEA 5K20A 2C20A 3BKWA 2CNBA 3DOFA 3UMSA 2NUPA 1ZHHA 4YFVA 5LQNA 1NNEA 3E2IA 1BXKA 5ICFA 3X1XA 5B2EA 1U4SA 2I7XA 3CR3C 4GQBA 3WO0A 4J16A 4CG1A 3R9IA 3W5AA 1MTOA 5BOSB 4BN4A 1YTLA 2VUTA 2ZRAA 3PD0A 5EFZA 3WSTA 2B6HA 3TWOA 3BTOA 3I83A 5IUNC 3KPYA 1E8MA 2C83A 4LWZA 2VK8A 1LX6A 3OC6A 4FUQA 5U4QA 3V3KA 5IN4A 2M9MA 1L4MA 2W83A 4EA8A 5K2OA 4B4UA 3ZJVA 2JD2A 1AGPA 4MGYR 4GUAA 3VI3B 3W1VA 4EYQA 3NHWA 4F3NA 1RWMA 4LSGA 1DB3A 1G2OA 1BSVA 3BQMB 1NU8A 4PX2A 3G2PA 3NHLA 2G9RA 2IYPA 2W5UA 1RRVA 2Y99A 4RS4A 3BXXA 3GF4A 2PYZA 1LW6E 3OA2A 4NVRA 3QITA 4NQRA 4Q7MB 4TYMA 5F21A 3THWB 1XN1A 2FB9A 1CUXA 2X7JA 2V4UA 3AEUA 5CR9A 5DYIA 2DCUA 1NC3A 1Y37A 1FP1D 3LA8A 4J1TA 3ESZA 3T5CA 4EABA 3GI1A 3IVGA 1C8KA 5DYGA 4EGSA 4CBVA 2C2WA 3IUSA 2Q6VA 3CLTC 5C52B 1Q3HA 5IVKA 5AICA 3VNSA 4Y1RA 2GPWA 2F3SA 4AXXA 4EA9A 4G5OA 4Q18A 3L5OA 5TY0A 5E4TA 4WNCA 4O1MA 2Z5FA 1JB9A 3W3ZB 5MN4A 1T91A 2C00A 4YRIA 1FA9A 2ZE7A 5IZ4A 1OZ0A 2XUHA 1M34B 3K71B 1KH2A 1ZVJA 3GJTA 1Y4AE 3D4OA 4O4IF 2YN2A 1Z7YA 3I58A 2I6GA 2IDMA 1K6EA 4TXLA 4DV2B 1Z9BA 3VRHA 3JVVA 4ME6A 4H0FA 5IULC 4M36A 1JX6A 2Z1MA 4I5EA 5HKKA 4DSAA 2A0XA 1MR3F 2WE7A 2J4CA 3O73A 1CY2A 2X4DA 3NC0C 4UNPA 1NU6A 2WVJA 3JYPA 1M6EX 1MV5A 2L69A 2LCIA 3RFTA 3U61B 2R5WA 3EAQA 2Z57A 1BN7A 1W0KD 3LC0A 4WZBB 5F2EA 3E4CA 5GJCA 1E2PA 1L5GB 4S35A 3B9BA 4JLMA 1JFLA 1NMYA 3Q5GA 3RSFA 4TYNA 4MUJA 5TEWA 4CL2A 3TEMA 1UBCA 2VATA 3B70A 3KAPA 4YREA 1G0OA 2AUTA 1A50B 2ZSFA 4NBSA 1T1IA 2B4QA 1GY8A 4LYYA 4JVLA 4AJKA 5HZHA 3LQYA 2YWFA 5C53B 1W0JD 2PCJA 1Z13A 3FUTA 1Y98A 4IHJB 3LTEA 1XT6A 2PFKA 3HO6A 4FB5A 3K09C 2UUBB 1CQIB 2ODQA 4MW9A 1UZMA 1KDRA 4XR9A 4LDAA 5K8JB 1SD1A 4B79A 3Q9NA 1SOVA 1AUQA 3ZQUA 3RTEA 4NU0A 3IURA 1RKBA 2DR3A 4RULA 3TSOA 1JU4A 2VZ8A 2Y8EA 3IR7A 5TV2A 1PVOA 2VWQA 2VJKA 2ZUFA 3A0RB 4NV0A 3L49A 3TPZA 5A4IS 4QHYA 2PZJA 1W35A 4OK5A 2GXSA 3TEJA 2FEAA 5I5EA 4R05A 1DIAA 1KBOA 1KC1A 4PIMA 2RGGA 3WLOA 1R0LA 4P3KA 3RHTA 3HBFA 2J0VA 2LVBA 3TLYA 3KOYA 2ECKA 1W5FA 2J3MA 2X6RA 5FBLB 2NPFA 5THKA 1A8UA 4B84A 5IXSA 2PH7A 2ZRJA 4CFYA 3A1UA 4BBPA 4R2WA 3F5DA 4CTOA 1YDGA 2WPNA 3L4BA 1MV8A 4R0NA 3KSAC 4M22A 4XYLA 3WWEA 1J9EA 4AF8A 1L8OA 1A4RA 1G1AA 5TPWB 1SVKA 3GCZA 5ESRA 1JHZA 1I4LD 1QHEA 2PUTA 3LL4A 2AMLA 3S2YA 1Z0ZA 4JI0B 3OTOB 4UNIA 4L02A 2B8EA 3STTA 1I30A 5ENDA 1U3DA 1WVIA 4KKXB 2E5FA 2OBFA 2Q2QA 2O7VA 1JSLA 3OI7A 4UBLA 5KREA 3O1IC 1WKVA 2X8BA 3NBAA 1MF7A 4YMGA 1F51E 5IU6A 1IY1A 5L3SB 3O1LA 4W99A 2BGWA 3R3ZA 5AI5A 4YV1A 5HS6A 1MW9X 3FUXA 4LZNA 1CWUA 1YZUA 3I9OA 4I5GA 4KIGA 3T7SA 4B6RA 4RVCA 3CZPA 1AQNA 4Q48A 1ONBA 3KQYA 4PO1A 2PGXA 3H3XA 4NJOA 4Q7JB 3DB2A 2GYYA 3OAAD 4UXIA 2YJGA 4G63A 1H42A 4N3GA 1TUIA 3GARA 3ZY6A 1Z26A 1Y8AA 5CH8A 3GC6A 1KQOA 1PQUA 2WJ3A 2WKWA 3KYJB 1CR0A 1QV7A 2I67A 4ZU3A 4F85A 1DQNA 3OFND 2QE6A 1VCNA 3GLQA 3ITNA 5JD4A 3QMPA 5F64A 4X44A 1UXHA 2R96A 3QXJA 1AUPA 3B2QA 5BN4B 5A9SA 5ESWA 4LECA 4RENA 1IDN1 4ZPXA 2L2QA 3GFBA 4FUTA 3TQQA 5CB4F 5DTRA 5IH7A 2ZM6B 3VO8A 1GFWA 1RWOA 3PGMA 4QUHA 3I0ZA 3OU2A 1BWPA 4JFAA 1IBKB 2Z4SA 1BVUA 2Z43A 3B1XA 1H3EA 3W5IA 1HX7A 5HJ5A 3EX7C 1PJ4A 2HNKA 1M7HA 4KTTE 1U4NA 4PX5A 5K0LA 2GPAA 3UHFA 3RJTA 5TLSA 1GLGA 4DNPA 1U0TA 1V5EA 1YHYA 5E9JA 4L0MA 3VISA 1QZTA 3PNOA 3QVGA 1QOQB 2RONA 3CF4A 1ZNWA 4BVEA 1L5RA 1FDSA 3GEPA 2D74A 3AKZA 4UAVA 3ABIA 4XM0A 1NNSA 3FJ1A 1Z5WA 4G23A 3W6PA 2DF8A 3KBOA 4LG1A 1K5PA 1NL3A 4L0CA 2GD6A 1Q15A 2PA0A 1OFVA 4HAWA 4DYHA 3WP0A 2QRHA 3EHDA 3F98A 1A4XA 1E6KA 3KIPA 4K9MA 1BMDA 4TMTA 3OZIA 2DM6A 4XCVA 4CPDA 3WVNA 1NR7A 2G09A 5EE0A 5JD6A 3H2HA 3ZQ4A 3EF3A 3EAFA 3HYTA 3VR5A 4CI9A 4P38A 3IMKA 5ALWA 1KQGA 3JQ6A 4L74A 1G16A 3BEOA 5LP6C 2QORA 3T7KA 3G2KA 4C6SA 1MNQA 1AN0A 3EGWA 5C8YB 3FLBA 4W5JA 2BEVA 1PGQA 5ALGA 2B2CA 1ZA2A 4COOA 1EG7A 3MQ4A 4V02A 3RH0A 3G79A 3RREA 3FFXA 4D3XA 3BC1A 1RDFA 3V1LA 3Q8WA 3T9DA 4DDKA 3HA7A 5FJIA 2R1VB 4MWBA 1PT8A 1H9AA 3AHIA 3C39A 3CZ9A 2Q07A 3AETA 3VC7A 1QKKA 4LF5B 1WD5A 2C8LA 4Q3KA 5LA6F 4G81A 4KE9A 2DUJA 3ZH2A 1MPTA 3SM9A 3FLAA 4E5KA 1B3RA 2BKEA 5EE5B 5BQFA 2J7PD 5J5VA 2VVTA 3R3UA 1JPUA 1RQLA 3ZVNA 1ONNA 2QYHA 2X7HA 4G0YA 4YJ3F 4BC0A 1RNLA 2EDAA 5KYWB 1CX9B 1RPJA 4YP9A 2ZT8A 3DULA 4BNVA 3ROPA 3L5KA 5H3LA 2VNKA 1EUDB 3L6RA 2YHAA 5KVAA 1U0EA 2VNSA 1G6KA 1NDHA 1ZO8A 5EHIA 1P5FA 2YXLA 4QICA 5JPDA 2J7PA 5C1IA 1WDTA 2WIKA 3KPWA 2H11A 3A3KA 2Q29A 3ESBA 3T3IA 1PX0A 5BW6B 3WB1A 2H1WA 4MRMB 4B4VA 2VG8A 4DRXB 3ZWDA 1RJ9B 5BSGA 4L5CA 4B0OA 3NH6A 4D3SA 4GI5A 3SC2A 4A0RA 1TZCA 2VTKA 3ETNA 3BH7A 1R12A 4QLAA 3VO2A 4KWEA 1YGPA 1EJBA 4LRSB 2BFBB 1Z4OA 2CW5A 1V1JA 1MB0A 2PWAA 3CF2A 3I9MA 4XJSA 2XCSB 2XF2A 4KO8A 4BP1A 1JS1X 4HB4A 1EWTA 1UJ6A 2F62A 2VP9A 4X45A 3WLMA 4BLQA 7GPBA 2F1IA 1O5IA 1GPMA 1EQ2A 5C7YA 4YGYA 4N39A 5IJ9B 1CQZA 2BGJA 2C5EA 5HTKA 1YASA 5E0OA 2YS6A 5IYZA 3NUZA 1E69A 2WM9B 5THQA 3OA0A 3DMNA 4ZAFA 2XUGA 4BO5A 1LSOA 1AB6A 3VNUA 2FWMX 3CEJA 1ZKMA 1YO6A 2OTCA 3C43A 4N4AA 4CM1A 4E33A 4CLDA 3HSYA 3ABSB 2AFIE 1EFPB 2VP3A 1KFCB 3NHZA 1GCIA 5KJFA 3SZMA 1FFEA 3ED1A 3KG2A 5IJ0B 2XXAB 3UH0A 1KMHB 4C4AA 1JAXA 3H2SA 1GKKA 3ORQA 5HRCA 1NFFA 4P5DA 5L3RA 4WZZA 1QQ6A 2SKDA 4F2PA 2Q3MA 3NOVA 3I3SR 1DRUA 1VI2A 1ZAKA 3DL0A 1GVHA 2Y93A 4MUXA 1H2YA 3DWGA 3JQGB 4HB2A 1Y5LA 5LQAA 4R16A 2ZSJA 1PZMA 1T9KA 1YBVA 1RLOA 4W5OA 1JMVA 4A2CA 2YJ4A 4BO2A 3M0EA 2CK3D 3GUZA 3REGA 3PNLA 2GERA 1AS2A 3CT4A 2JFVA 3EDYA 3JZFA 2AD1A 4JDUA 3STYA 3GXBA 1PBNA 4G0MA 4QRHA 3SX2A 3WS7A 1DX9A 2OQIA 2VJYA 2G1AA 2J9FA 4KDFA 3H9GA 3GPBA 1NF8A 4R2IA 3ANTA 1ZBDA 4UATA 2NU8A 3T9AA 3ER9A 2BSAA 4FINA 2H5EA 4IQGA 3T7TA 5E9WA 5ADHA 1NF2A 2O4UX 1EUQA 3GT0A 5CB4B 2QTZA 4J7AA 4F8EA 1DBVO 3N0VA 3HC7A 1E1LA 2CK3A 4QRDA 4RA9B 1OH6A 1E9AA 1NNLA 3DV9A 4PAOA 3A27A 4U63A 1LKZA 1VJCA 5BR4A 2HCJB 1V1MB 5D5HA 2H57A 2QW1A 4YRZA 5L95A 2VRBA 1IZ7A 3FLEA 5LNK1 3RFVA 2AWNA 4KC0A 1Z37A 3WFIA 4TT3A 1ADCA 3BFPA 4EB8A 4NJEB 4EH1A 3BJEA 2ZUDA 5DGXA 3SDSA 3EZ6A 3OPYA 1JAIA 1Z5NA 3NAQA 4ML3A 1L7BA 3E9EA 4ROSA 1HOTA 4Q7EA 2YV5A 1JHXA 5EYPA 3H11A 5I45A 3LV8A 4IDAA 1YDHA 1Z62A 1AUOA 4G97A 3ZZ0A 1MJ5A 5FPYA 2OV4A 1H2FA 1KBZA 1UC9A 3VJLA 3HJHA 3KZCA 1HWYA 1KMIY 1LPBB 1FEZA 4ZVLA 4GLFA 4YCDA 1U5CA 1XTUA 1UP4A 4CGYA 5L51A 3HM2A 1J06A 5KVQA 1T0BA 2HN9A 1DU4A 2GJ9A 4CMHA 1EQAA 1QS0A 1BEZA 1NURA 1QHHB 4XUCA 4ZV7A 1DBQA 4C7OB 4IX9A 1KIMA 1RWQA 1NY5A 1SAYA 2PIDA 2RKBA 4GWGA 5IN5A 3FGOA 3U3MA 3LUHA 1EKXA 4IO0A 2FXVA 2LTAA 2A2ZA 3LKZA 4KYUA 2QNBA 2VH1A 4MB0A 4CT5A 1WCV1 5HX7A 2HWXA 2WWGA 5K8CA 1IZZA 1IC6A 1YDFA 3GAAA 4I50A 3LOQA 2Q1YA 4KPUB 5E7JA 2CBXA 1V25A 2JANA 5DXAA 3L8HA 2EKPA 1H2WA 2MTBA 4JLBA 4NFHA 1M7GA 1ZISA 4KQIA 4BFTA 1GPAA 3IP3A 3QU5A 3TM5A 1SOMA 2JF0A 4MS3B 4QM7A 3B1KA 2PX6A 1N1MA 1LQUA 2AT1A 3B7WA 4NNPA 4IIBA 1TZ2A 4IIEA 4HDQB 3COZA 3UHJA 4UM9B 3SQXA 1A27A 2P1RA 5CA1A 1ZMXA 2Y1CA 4UAGA 3SNHA 3U4CA 2XRFA 3AGPA 3FWNA 4N03A 5JT1A 4YJ3B 1SXJC 1F6DA 3ESQA 3COJA 3GMDA 4DR6B 4MP3A 1EVQA 1QHSA 3PUWA 1U2EA 4L9RA 4TZKA 5K0BA 4BXOA 2F67A 4JU8A 5FTMA 3IUNA 2VBGA 3IAUA 4BO1A 5LYJA 2H00A 2QENA 2IDJA 3HXTA 1QGOA 4P7GA 2H7CA 4LDNA 1KWGA 4YECA 5KQSA 4WN9A 2MINA 5C8DA 1SUPA 1PP4A 2ZUUA 3T4XA 4DWJA 2Z9DA 1DV2A 1NKTA 3G89A 4OFWA 2NO5A 4TZ0A 4UBNA 3F47A 1XROA 2HO4A 1RJWA 1R5OA 1ZIOA 4EDFA 4JUAA 2DHQA 3KV1A 3MOIA 1WZUA 4FEEA 4ZCRA 2D1TA 3JTEA 2RGNA 3KSBC 4BNTA 2P8JA 3M3HA 1ZR2A 1HQYE 1JHAA 4GX1A 1R15A 1XZBA 1JLLA 2GKSA 3BA6A 4K05A 1BQ4A 4MAFA 5FULA 4ZEXA 3ROTA 2X3YA 3RV3A 3DOEA 2Q28A 1MX9A 2QD2A 1N6LA 4Z9YA 4Q5IA 1Q20A 3CLRC 4AB1A 4TTTS 1EVIA 3JXEA 1OVGA 5L3VA 3E53A 4JU9A 1U7TA 4G0QA 4QFDA 3OZAA 1E6UA 3RIYA 3CZ4A 4HG2A 5IMBA 2H31A 3IIEA 3RC8A 2NV2B 3F97A 4K6HA 1PR0A 3I5MA 2IIVA 3OEED 1F8YA 2GEDA 1SK9A 2M2IA 5K3FB 3V7YA 2AX3A 3ZHCA 4BASA 4CKEA 4EF4A 5CLJA 1IIRA 5M04A 5FDFA 1WVMA 1XD9A 2G07A 3ZU3A 5DGDA 2WD9A 3DLIA 2QX7A 3VSCA 1F3LA 2PMEA 3AM3A 5DDIP 4RTNA 1I13A 4G24A 1JLKA 1UFOA 3R3YA 4A3SA 3ZCRA 4JFRA 4FQ5A 3WQRA 3OE1A 4PFJA 4WA7A 1Q44A 3OOEA 4IINA 1VJRA 3OEEA 2MDTA 1I1NA 4NJMB 5JCZA 2D06A 1T5IA 4EJ6A 1Q57A 3OTGA 2R47A 5K3BA 2XSZA 3P2OA 2I4RA 3JQ7A 4DV7B 3KUKA 2EARA 5AKZA 4ZEOA 3UAYA 1E2IA 4GMXA 5JZ9A 2B82A 3UYKA 3ZJYA 4AY6A 2AYZA 5AW5A 2H1OA 3O1JC 4ZO6A 4AJ4A 1YONA 3DYIA 2ZYUX 3AVQA 3PXCX 1JVBA 1UBOS 2OLJA 1D0SA 3A4VA 1NMZA 1E3DA 1EWRA 2NP6A 4KWHA 1S5PA 2YWJA 1A2QA 1KAGA 2ABWA 3HBJA 1ZZGA 2E48A 1Q7EA 4MI6A 2QVXX 1J1UA 1J0AA 2VHUA 2FPUA 1XPOA 1E7MA 1UXKA 3A11A 4GOMD 2LWIA 2O0LA 1TCCA 3KKPA 3QOXA 1DTWB 5E6SB 4X1YA 5ECWA 1QV6A 1JFVA 1ZOLA 2OHVA 3T6KA 3USCS 3PNSA 5KDDA 4XKJA 1XXHE 1V9SA 3EXFB 3HKCB 4COKA 5E3HA 1NWHA 4OI4A 4G8JA 3OZTA 1ZCZA 4UUPA 4LW8A 3PGJA 4EO4A 5MF6A 3BH0A 3HY3A 3UBTA 3W9UA 5CEFA 1ESMA 3AOEC 3EUAA 1G64A 1G2QA 3LDHA 4FDMA 5EIBD 1XRMA 1FLDA 2H06A 1P4SA 4AJHA 3ITEA 4C4RA 5JDCC 3DV0A 4OJYA 3KR2A 1H5QA 4AZTA 1LSSA 4HDMA 2PL5A 1B8PA 3KOUA 4WNAA 1R9NA 1OAAA 2Z9CA 5KU7A 5KOHB 3BSWA 5MGBA 1T36B 4RDHA 2GO7A 4KO4S 2JA2A 5K8UA 5A5VA 5IKOA 1OYVA 4MHOA 2VRWA 3KT6A 2OCYC 2YXDA 3GNLA 5ARCA 1IOVA 2YCBA 4DLZA 2R62A 4XDZA 3OZEA 3JRWA 1ZNXA 4YRBA 4GZ3A 1F0YA 4J0HA 4RSHA 2A92A 5BMVA 5DNYB 1CKEA 2PMBA 1DJNA 4KR2A 4L5BA 2WD7B 2I3DA 4E13A 1NQWA 3JWGA 1ZUHA 1BXGA 2XIQA 2J7KA 3MSXA 4BCCA 4KKVA 4BNUA 5JASA 3WGTA 2IUUA 3EISA 4LOHA 4LCEA 4MVYA 4QYMA 2C59A 3NHAA 3M8KA 3TCNA 1BCSA 4MCAA 3KFVA 2WT4A 5GTDA 2FZKA 3W05A 1O2DA 1UT5A 3LYHA 4UVHA 1B4DA 4AJJA 3PFGA 4CKBA 1Q1QA 1ZNZA 5IDQA 3HXPA 4NHEA 2KBFA 3TR6A 3KHTA 3F1KA 3GDHA 2P8SA 4FFVA 3U16A 3RS5A 3EVDA 2WICA 3SICE 2ZVQX 1N92A 5AVSA 2PFGA 4OG2A 4RS3A 1SWVA 3VR4D 2V58A 1D04A 3TINA 3CVUA 4ZCQA 2I54A 2NO4A 2BKVA 2JHPA 2OXRA 5IXYA 5IBRA 1U1GA 1V71A 3AU9A 3K7EA 2NTNA 4XEHA 5ALLA 5KNBH 4Q9AA 1PR2A 4RH1A 2JLZA 3WLSA 4DLTA 3M9WA 1RR6A 5EERA 1U3VA 1WW8A 2VCYA 4KREA 1C8BA 3H1FA 5F2KA 4QGAA 4DQXA 5L7WA 1QB7A 2B2NA 4R3WA 4FILA 1JIXA 3JWHA 1VHQA 1X1CA 2YIVX 3DSRA 1EE1A 5ALFA 3K94A 3LZ6A 3CX3A 1C7FA 2QJWA 4GOXA 1YCDA 1QGED 3HKBA 1KFJB 1SB9A 4EK9A 3PC2A 5JATA 1GITA 3FETA 5E4JA 5LB4A 1PN3A 1T2UA 3MK31 2G0AA 1Y7IA 3HJBA 2FZLA 4KGXA 1MMFB 1CY7A 1TEXA 4PPQA 3GVPA 4XRRA 3KJGA 5ILGA 4HGOA 1HV8A 1YDWA 1ZOSA 4OY3A 2VCHA 4OXIA 3TLEA 3ZD8A 1T24A 1T0PA 1M5TA 3ZDAA 3U4GA 3ZXUB 3C16C 5EUBA 2XQIA 3FZNA 3UT5A 1Z2DA 1RCTE 2QZSA 1XD2B 3DDCA 2WABA 4G0PA 3BYZA 1U8CB 4TXNA 4LXQA 3WYBA 1CNFA 1VCOA 3FMPB 2GXUA 5TJHA 3KQOA 4B31A 1SUCA 4PGAA 2DH6A 3P9KA 1E4EA 3ZJ5A 1Y89A 3OQOA 4MDYA 4Z3KA 5BQ3A 3MA0A 1KYIA 1T5BA 4G5XA 2AFIA 3QWBA 2BFMA 3FIUA 3KC2A 3P9SA 1WP4A 4GKBA 3HBLA 3L6EA 1TVEA 1QPGA 3KJZA 4UASA 4ZOCA 5BN5A 1RZRD 4Y18A 7AT1A 2CDBA 2IYXA 2JI4A 3RUHA 3KCNA 1B6RA 3FDZB 4I6GA 1TZKA 1OWMA 2P5SA 3Q3VA 4J16C 3IDOA 1GPJA 2HA0A 3KEMA 4YONB 3FGZA 9MHTA 3AFOA 2VT7A 5FR2A 1NI4A 1L4HA 3SKXA 1K3TA 2PR2A 1M6VA 2JAHA 1FJGB 1UFQA 1VPLA 2NU6B 2YJTD 3U3XA 4GPBA 3S5JA 5DBHX 1ECFA 4R8RA 1GHTA 1YXMA 3QI2A 2P7IA 4J0CA 1LPOA 4HXFB 2G0TA 1HKHA 2XLBA 3G5TA 3AM4A 5ICSA 2VJMB 4XFDA 3GH1A 4CU2A 2P2CA 2A5FA 2GWHA 4R8SA 2E4UA 1XVLA 3OFKA 2A1TS 1N57A 5T64A 4E14A 3QBDA 2V96A 1V16A 2OXCA 1VP3A 2G9VA 3N2KB 4I46A 4JUIA 4O4LF 1PK9A 1RC8A 1XRJA 2CMGA 3PFWO 1C0PA 1PIWA 3GWZA 3RU7A 3FPFA 2GPBA 2YOFA 2X8JA 4H35A 4MROA 4R98A 1GCGA 1US8A 2OO5A 4CEJB 3KVRA 3PEUA 1KY2A 2Q1XA 3PYMA 5B2ZA 1USUA 4BNFA 2BE9A 1Z45A 2EDCA 2IPLA 5HR5A 3NRJA 4MV7A 2P1DA 1SKBA 2VNJA 3ADPA 5FPHA 4YRCA 1UPFA 5AM0A 1GPKA 1XQ9A 1JIUA 4B5KA 2BMAA 2XT9A 5J23A 3IE0A 4MA4A 1RM5A 1KSGA 3AY7A 4HGZA 1JG2A 4YO7A 1BRTA 3A6HA 4K6FA 5CPBA 3BWDD 2OYRA 2NU9A 5IT5A 5EIXA 3V8RA 4DUYB 2WUEA 3VKGA 4TVOA 2P75A 4GR4A 3OD1A 4KFTA 3N0XA 2Q99A 2PXHA 5J2UF 3CG4A 5FCDA 4U6NA 5BRJA 4ZK6A 4TVSA 5JUWA 3H6KA 1Y80A 3K1JA 4TWZA 3VO9A 4GIBA 3TNDA 1HEYA 1KI3A 5AW1A 4RXUA 2CVPA 1W8DA 2N0SA 1CUAA 3PA8A 4YDQA 3PDCA 2ZIXB 4LJKA 3U7FB 1DG3A 3OPMA 1H6DA 5GQSA 4E3WA 2FNAA 5FFMA 4DY4A 1GZDA 4IIYA 3ROMA 2QQFA 4X3CA 2G9QA 3C4JA 3DW1X 1K6XA 5F7ZA 3ZCPA 4FCWA 4QREA 4N6NA 4BYMA 4D81A 4GMDA 5TQVA 3EFOA 4U9UA 4JI5B 1AKRA 2CF6A 3IJRA 4IWYA 2WWTA 3THSA 3HSKA 4U7GA 3QU4A 5M5BA 2ZJ2A 1DAIA 2XNCA 3R5JA 5AKEA 3IVXA 2EKDA 3ML1A 1IHPA 5J47A 1JG1A 2G5GX 3QVOA 1VMKA 4K9OA 3ORYA 1WSDA 4Q4AB 3U1VA 5MN5A 2J32A 3A3OA 1L4BA 1D09A 4E3ZA 2X0FA 4M8IA 1K8RA 5LQKA 4HYYA 4BX0A 4F71A 3YASA 1ATZA 1KE1A 2FN7A 5IBPA 3D8BA 5LZ9A 1CBUA 3E15A 1MU0A 2RSLA 3K2IA 1GKLA 2GCOA 5CVCA 4JT9A 4DQDA 3ZZ1A 2V1UA 4BNNA 5IT4A 5KHLB 4MICA 2ZRMA 4ND5A 5BWLA 1QQTA 2VR1A 4W9RA 2HBRA 3L8DA 1QLHA 1E1RA 3CURA 2FW6A 4FKZA 4M54A 1F8GA 2WJAA 3QHQA 3VBEA 4RJKA 4QSHA 1DMSA 2XB8A 3X2EA 4ZYLA 3QEAZ 1LD3A 4ZI7A 3D3KA 4PGFA 1Z4KA 1E6LA 3H7IA 3FPJA 4M0EA 4YQFA 4IH9A 3DF7A 3KKMA 4WZ6A 1CUEA 2HQSA 2ZRFA 3PD1A 4I14A 1T8UA 3CX6A 3KCQA 2J4FA 3M5PA 2JLVA 4JBLA 3PFIA 4LC0A 4QQ8A 3MNFA 4C1NA 3Q12A 2CD9A 4H3VA 1DLJA 1ULUA 2WM3A 3UAWA 2XF8A 1GQQA 4PZLA 2DKOA 2QVLA 4D4MA 2RIRA 1XA0A 4GO1A 2IS1A 2IIBA 4IS2A 1GGVA 1WBBA 3PNQA 3EWNA 3H2IA 3LRXA 5ITZA 4YAWA 2XEDA 3FYHA 1DTSA 1OKKD 4DA4A 4FHGA 3HUDA 2BGTA 3L8YA 1MHTA 5EJIA 2ZJAA 3OU6A 2WHEA 1REQA 1WHSB 1J21A 1H0SA 2YH2A 6ABPA 2LW7A 5A6VA 1KO4A 1NTRA 2CXQA 2B35A 2EEZA 1ICIA 2FSIA 2DFLA 2H4FA 2H5IA 2O07A 3EA5A 4K6GA 1MB4A 5FLXA 3A04A 1MJHA 4RESA 4L4RA 4ZHQF 4II2A 5HCIA 3X1WA 3DVAB 1L4UA 5ICEA 3IA2A 3V2GA 4B6SA 5EN4A 1V5WA 1F2TB 4IHQA 4LBVA 1K5DA 4P84A 3TZQA 3L18A 5I3CA 2EFEB 5EE3A 5G53C 4Q0MA 3BXPA 3R5XA 4DSZA 3LDGA 3QE3A 1QE3A 4J1QA 4CQJA 1RC0A 1TM1E 4WA8A 3I52A 3SQOA 4EB0A 2RBKA 3DMHA 4Z8XA 3RTCA 4F3RA 4Z4GA 3HS3A 1ODLA 1HG0A 5J1SB 3MUEA 1ZUD1 4PRZA 2RCNA 2AD5A 3AVVA 5IDXA 3GZTB 3C3MA 4WD3A 1BYIA 2B8JA 1N75A 4MWOA 2HU5A 3MWDA 3I2GA 3UJ3X 2MYNA 5CXQA 2SICE 1JFSA 5IJAA 1KH1A 3JPYA 1L5OA 4RGQA 1KGDA 1VGRA 3HBAA 2ARKA 4RW0A 1O77A 2PYIA 4XVQA 5DN6D 2JFQA 4HVTA 3NFRA 2DVMA 2XQFA 3DE0X 3RWBA 3KWJA 2G6BA 3MRSA 3SFVA 1XJWA 1PW7A 3KX2A 3MM4A 4WBSA 5A3QA 2QE7D 4EKDA 4RE5A 2P2GA 3IEUA 3K6KA 3UJDA 1XXHA 3W9YA 1KZYC 1F4PA 4PCUA 4KQ1A 4BIMA 2G1UA 1Q7RA 3ESCA 1EK0A 4X1IA 1N8SA 8AT1A 1JLMA 1O58A 3NCTA 1TCVA 2B1JA 4GNKA 2QPLA 3TUIC 5AH0A 4YRKA 5BUQA 3EA0A 5BRNA 2XE7A 4JYPA 1Q17A 2FPIA 1DL5A 3PJDA 3CNQS 3V7FA 4DC9A 2QE7A 4DOMA 1M8PA 3S29A 4X92A 2ENUA 4Q21A 1GG5A 4QZVA 1XZAA 3QUBA 4GRAA 2E82A 3PEFA 3BL6A 4W8GA 5FWXB 4O3MA 1LLCA 3BWMA 1OLXB 1YQQA 2IEBA 1T25A 1VPDA 1X7YA 1Z2AA 3O92A 3II6X 1J1IA 3FOAA 4H7EA 5AHOA 3SFZA 3T9FA 4F38A 2HJRA 4CMEA 4BRZA 3BVPA 4L78A 3ZI7A 4QOSA 4C0KA 2JW5A 2QU7A 3MF4A 4YAIA 1EEXB 3SXJA 3IJ5A 4REOA 1XK7A 3G2OA 1E5QA 4RIHA 4FB4A 5BYJA 3OQMA 1GPH1 4ZT2A 4PVCA 4UCWA 2JIDA 1ZA1A 1DC4A 2IXFA 2H4XA 2PL1A 3KS9A 4JJ7A 5FI3A 3K70B 4Y30A 1GVNB 3AUJB 1KF0A 4EFKA 5A4MS 1U7HA 2D4AA 3GLVA 2Q0XA 2QTWB 2H2FA 3DP7A 2RGXA 5DM60 1COZA 2UYGA 2X5JO 1K06A 2MHCA 3ZE9A 4DMKA 4YRDA 4GMFA 3DVQX 4EEZA 1UDWA 2NIPA 4QBIA 5EIHA 3PWTA 3DE4X 1AZWA 4POOA 4O6VA 3PIIA 3L7LA 4LY3A 3SI7A 1XD8A 3VNQA 4MUGA 4HNVA 1IATA 3DUWA 1LDYA 4UFNA 2W11A 5HXAA 4QEZA 3ZQ6A 3DMGA 4EFDA 3AUTA 4ARVA 4ZZIA 3I6BA 3CUKA 1TU3A 2YY5A 5FBKA 5F2OA 2H9AA 1AIPA 2EF1A 1NVVQ 3X0DA 4F2GA 3PTAA 5KWIA 4PSVA 1EPUA 2W4QA 3WIVA 3O4HA 3L7IA 1E32A 2ZK7A 2ZIGA 5K0NA 3A37A 2X0RA 3NIBA 1U0GA 3Q7PA 4KIUA 2VJQA 4LSWA 4MB2A 5KNCH 2ZPUA 2NN3C 5JMTA 3QF4B 5IC4A 3H18A 2A7XA 3MWJA 2VUSA 1V3QE 3N0WA 3U3JA 3EW9A 4ZC8A 5JNTA 2BEUA 5JW6A 3BDVA 3JZDA 2AMFA 4BNKA 5EZYA 2FSUA 1B00A 1G5PA 2BGNA 2FZEA 3L8CA 4X5OA 4X63A 2BEJA 4L9AA 1E0SA 2Z9BA 3BERA 3MJCA 3QPCA 4HEHA 5DGIA 3KB2A 3LM8A 4PLHA 1U9JA 3K8ZA 2W8ZA 2BWJA 3WLAA 1DC5A 3GJQA 3OPXA 4CNQA 2Y27A 4IQ0A 2JKZA 3ED5A 3QNUA 1G21B 3A0UA 5E3JA 4LNUB 4ABTA 3BDIA 4LBZA 2OB2A 2Q6TA 4MIEA 5G41A 4HQ6A 3GJRA 4ER5A 1W46A 2B20A 4XWOA 4I1PA 4CCYB 3A14A 1VIAA 2POCA 2W6ID 3SP1A 2F7SA 2WTXA 3KJIA 4HZUA 2EG5A 1ZJWA 3IBYA 1JYFA 3HDQA 2OXTA 2FPRA 3T1HB 2JIQA 2RHGB 2FGJA 5BUCA 2P79A 1WA5A 3KZ1E 3P26A 1Z06A 1ESCA 4D8VA 3ICOA 2OENG 1U2SA 2C9BA 3PITA 2XKBA 1N0VC 3DLAA 3OPVA 4XE5A 1HNWB 2UXDB 2Q5FA 5HILA 1VKJA 1YA4A 3RASA 4QAJA 5BRAA 4IO1A 1IZ8A 3T4PA 1L9KA 1M1NA 3EH2A 3GIDA 3V6MA 1M0EA 4KHPB 3KU4A 3UJHA 4RD1A 5H7XA 1K8XB 4RPHA 4QU5A 2C5HA 1EVLA 2WT8A 3VUFA 2Y1EA 1Z08A 1II8A 1QO0A 4QOGA 5B53A 5TJ9A 3ZDXB 1Y7HA 1U2DC 4IGKA 3HDTA 4P34A 4H7JA 4Y7DA 4P98A 2IE8A 3U5ZB 1VHLA 1RWPA 1JPJA 3VYSB 2YBEA 3IEMA 2GRUA 3UJPA 3SIXA 4JT2A 1MC4A 3NHPA 4EBFA 4S04A 1AJEA 2GYUA 1ZGHA 3EMVA 1AM4D 4TROA 4DILA 4DV0B 4Q4LA 1VXRA 1PLKA 4FN5A 1EFVB 2WSSD 5GONF 4B82A 4EJ2A 1MH9A 1HI9A 1VBNA 1K5GA 2MYPA 4R1QA 3LUKA 2VHQA 4FGLA 2ZI6A 2OV2A 4INPA 4Z1MD 3H84A 1VG1A 4H1UA 3QX8A 2REQB 1HQCA 2XUJA 3DZFA 3LDAA 2WOJA 1CEXA 1PG0A 3RU3A 2JI9A 2FPMA 3I2YX 2FP3A 3Q41A 2J3KA 1EFLA 4K9SA 3HP1A 1X9HA 4X91A 3U3KA 3GCGA 3R0IA 3L7KA 4WXEA 4C05A 3NGLA 3SX4A 5C80A 3SMVA 2YHIA 3LLMA 1FJ2A 4B6EA 2WSSA 2YQ5A 2D8MA 4NMMA 3TOXA 4A5OA 1ORTA 4Z1MA 3CPHA 4OXYA 4IJVA 3QELA 2ZAOA 3QTTA 1HT2E 1YNSA 4LSZA 3HP7A 3HABA 1GUAA 1H8ED 4I1VA 1QG4A 3RS2A 2RI6A 4W5RA 1KDTA 1ZHOA 3HXOA 2HU2A 4BQQA 2VC2B 1A9YA 2AEFA 4KEAA 1ATIA 4PYIA 1QUFA 2NZ2A 3NX4A 5EP3A 3WGOA 3ZDYB 4ARCA 5SY4A 2UXCB 5IZCA 1R1DA 4DA6A 5H4GA 4MUKA 4MGEA 4WERA 3OE5A 5EQDA 3SSNA 5EKDA 2I2FA 1PR3A 4MUIA 2J3LA 3C4QA 3EWSA 4NBWA 2VZLA 4TRJA 1MJNA 3TLCA 1KMNA 1XEWX 4ERNA 3KB8A 2QK4A 4KHZA 3OTHA 4ASUD 1OLSB 1FZTA 4R1NA 4IUBS 1YMQA 1ZGZA 1J5EB 1FB5A 2JHFA 2W6JA 2YR0A 1DXQA 4TZ6A 1SBZA 5HP4A 4PO8A 2DY1A 1KAQA 1SUFA 1JLRA 3GG2A 3F0TA 1A5BB 1TF5A 2JIBA 5ALDA 1CQJB 1E9VA 3HY4A 4MO9A 4N5MA 2QV0A 5G1NA 1T2NA 5J2TA 3PUJA 1H4QA 4JI4B 2AR7A 2CXSA 1RYEA 4J29A 1BW9B 5E1MA 1UKVY 2JL1A 1SC1A 2AMYA 4JYZA 1D4OA 2PBLA 3CG0A 2VXYA 3CLVA 4LIPD 3RLFA 1BN6A 1BX3A 3L4KA 4P0PB 2WF5A 4X1KB 1R3DA 3VR3D 1DUSA 3R0XA 1WUIS 5LOVA 2B8WA 1RQ2A 1ODJA 2FAXA 4DCGA 1A9TA 3C0KA 1X87A 5FOTA 4E08A 1OF1A 4AKTA 4C3VA 1OXBB 2QLJA 2LR0A 3QV2A 3VX4A 4DBVO 4PIPA 2FPOA 3JYLA 4ENTA 1JEQA 1IUNA 1I9CA 3LX8A 2DPYA 4O0LA 4OGGA 4EOGA 2QI9C 2OCLA 4MVJH 3E7WA 5BPFA 3FNFA 3L8EA 3H99A 4P4NA 1BVRA 3IBGA 3AESB 5DGCA 5AM3A 1RABA 4CM8A 1S9DA 1GQYA 4I4TF 5DK6A 5LNK6 3GGPA 3L0ZA 1EINA 5LQSA 5KEIA 1RHKA 2B37A 5C8ZA 1MEEA 3KQQA 2YV2A 4M99A 1ST3A 1IJFA 2VDJA 2GOYA 2OEPA 1HH4A 5KS2A 3WYNA 4R9VA 4XIFA 4UTVA 1WB5A 2DERA 1B2LA 2QRPA 4JGIA 4JJZA 4FJ2A 4XWTA 3V33A 1RLTA 3TK1A 3K0AB 2Q21A 2DOKA 2KB0A 2WSMA 1MZVA 2ZI7A 3IE2A 1BWQA 1R00A 1T4MA 4P5EA 5D7BA 4PPGA 1E2EA 5SZJA 3VPHA 5CFOA 4MUBA 3F8SA 5DNVA 3T06B 2ZEJA 5LQCA 1FQWA 1U0BB 1BOOA 4NENB 4IIUA 4TTSA 2WYUA 4LJ5A 1P9RA 4KIJA 4C76A 4KRFA 3LSYA 4AD8A 1XA4A 3NH9A 5F9HA 4NV1A 2WTMA 5FQNA 1ISMA 1CJKC 2BFPA 2M6SA 2ZS9A 3ANNA 3OHPA 4HDNB 3EG5A 4RSRA 1P74A 1SNYA 1ZD1A 5FFFA 4D8WA 4DVJA 1IOWA 1DEAA 2FDCA 4AZ3A 1A9XB 2X9LA 1Q0PA 3WLEA 2C2XA 2JKYA 3L7DA 1SKYB 3DZKA 4W7HA 4JSTA 1CQWA 4ARBA 1B8UA 2O1WA 1QH0A 3GUCA 3T38A 1M6HA 1XAIA 1MJGA 2AUMA 3D1JA 2IYFA 4YRJA 4DA0A 1X80A 4Q4CA 4BQSA 3CMMA 1WZEA 3ICCA 1PV1A 5IJXA 5KTMA 1M76A 5I9IA 1B26A 4KXYA 4U3JA 5DJ5A 4Z4CA 4IGEA 3CN7A 3AK4A 2MR6A 4TS4A 4P0TA 4X71A 3EPJA 3LQ4A 3OY7A 5FF9A 1F0PA 1R88A 3K9NA 4CUKA 3N28A 1IUKA 1RXYA 3VAYA 3VVBA 4A5SA 5CVJA 1PJCA 3CKLA 3GL9A 3I34X 4JKIA 3TKAA 3UC5A 3CA8A 4G4IA 2C2ZA 1WY5A 1KDOA 1TXGA 1I2ZA 1L0BA 3O9ZA 1UKCA 1R5JA 1ZU5A 1JXAA 3EFHA 3CUEF 4YJ2A 2WVAA 4JBXA 3L07A 3QWFA 1XMIA 1R7RA 2XUZA 3MOSA 4CIVA 3A2MA 3KVNA 4EA7A 3IQDB 2XH8A 3AF6A 5B7GA 5GONB 3STVA 1EVZA 2VF5X 6REQA 4XSVA 4W82A 1YVUA 5B1YA 1IN5A 1FYFA 3BJMA 1DAOA 3S2EA 5HQ3B 4IQFA 3DCJA 4QXPA 3FYUC 4WNIA 2CDNA 2FF7A 3ZIDA 3THOA 3M83A 5IG2A 3IOMA 3HWRA 3QYJA 4M88A 1GQ2A 1LK7A 4KH1A 1GZSA 2V45A 4O4JA 4CIWA 4ALNA 1XZKA 3OC0A 4KPEC 3VH3A 1U7WA 2PU7A 2FR0A 3D4BA 4WPGA 4OA8A 2AMJA 3HZZA 5BNZA 1KAEA 1JQ5A 4LWOA 1MFPA 1TC2A 2FPWA 4OSOA 1EJ0A 2EKZA 2PLRA 4WESB 4MH0R 3KPVA 2GRJA 4UTRA 4BX8A 4G07A 1RPNA 3K5HA 4X24A 1JQEA 4NZ9A 4LV6A 5ALZA 1CS0A 1XMPA 1CETA 1O6BA 1XAHA 2B8NA 1G66A 1YWGO 1F48A 4HPJB 4IUDS 4YP5A 1UOOA 2M98A 1BX1A 4UMEA 3RS9A 4F9EA 1CZLA 5JSZB 5K09A 4GT1A 2CSUA 2I9PA 3H5WA 3T3OA 2VBIA 2JIZA 4XQ0A 4H1VA 5FTJA 5E6UB 1ZD2P 1P7ZA 5IDVA 3JSAA 3WRYC 2QR5A 2N46A 4N0MA 1XRLA 1ML3A 1SMKA 5GGXA 4FFOA 5I8WA 3F6SA 4IKPA 4F72A 4HVLA 4JKOA 1L4EA 2GLUA 2QAIA 4AG6A 2ZI5A 5JHHB 3P9XA 4W7SA 3JRXA 3DVLA 1WTCA 4IRUB 4PQFA 2PUCA 3HZRA 4BO7A 4ENUA 3U6KA 3V55A 1KL7A 2AZTA 1HDOA 1XELA 1Y48E 4AI6A 1M0SA 2IXEA 4H2DA 1IRXA 3D3NA 4G1CA 2AG0A 2C7VA 4LQ4A 4PLWA 3V97A 1B16A 4N47A 2ZKLA 3COVA 4MQ4A 2PGDA 1W48A 2QRGA 3PF9A 4D92A 1TAHA 3I2FA 3I92A 3WWOA 3TG2A 1UBSB 2JKVA 5AJHA 4LN1A 4TV9F 3A1TA 3VR0A 1YI0A 3B52X 5TVGA 2ON6A 3PXEA 4E5PA 1ETHA 2IHYA 4WCFB 3NNSA 1CQPA 3WAGA 1T4CA 2QTGA 2C29D 1FF9A 1TEVA 2VDNB 3A36A 4H27A 4K9LA 3CCFA 4LGVA 3GFRA 3RC2A 3HV2A 1VBKA 3ZHBA 5AT1A 4B3FX 3UHPA 3R3VA 1KNXA 3PCRB 3HJNA 2XBUA 5DX1A 4OHYA 1I9GA 1UT6A 4JASB 4F5EA 3ZE0B 1VJ5A 1ECCA 5ER6A 1SOWA 5CXXA 3B13B 1HORA 4RHXA 2UUCB 2ZM5A 2I2AA 1FFSA 1H2ZA 1NVDA 3ETJA 2P9EA 4FYWA 4HGRA 1T2CA 5IWCA 1BE6A 1YDEA 4C2UA 1C9NA 2WSBA 3I1YA 2C2MA 4D9CA 4MWZA 3DOCA 4FW8A 5HMLA 5KVVA 4WBNF 4PE5B 1U11A 3W78A 5EUCA 5JY6A 2JLUA 3C6QA 1D2HA 1HK7A 2HHAA 3ET4A 1OGIA 3KHKA 2YDYA 3UMCA 4Y2XA 1P45A 2ZI4A 4ZT4A 821PA 2X19A 3PRHA 2HB6A 5TMPA 3UCFA 1MPXA 5CYFA 2V0NA 2IHNA 3HB5X 1DJQA 2KPOA 4CQLA 1NUPA 3B7GA 5JMOA 2BOVA 2NO6A 4LZPA 4WGGA 3FSEA 2H1IA 1JQKA 2NVOA 3IODA 2P40A 2X22A 4Z0TA 2C3YA 4ZCIA 2C4MA 3JVDA 3QOWA 3AVPA 1BX0A 1EB9A 2CKMA 1U63A 2NTEA 2CFTA 4ZRDA 4Z4EA 1KS9A 1SA0B 4W6ZA 4ENSA 1NW4A 1QZZA 1S01A 1J8QA 2UYHA 1MB9A 1O4VA 2AK2A 2PFSA 3BAFA 4PLYA 2X8LA 4OLAA 3R3SA 4OMUA 3FR7A 2JFBA 2ZRCA 1B6SA 4RD3A 4RELA 5IWAB 2FMUA 3G1UA 4LYAA 2IZ6A 2X4GA 3HI4A 3PQFA 4F1WA 1DG1G 1WPXA 1W19A 5CYPA 1EX1A 4DMUB 4OX9Y 4AULA 3HJRA 1W73A 2RCYA 3HCRA 1PJTA 3WYCA 2C97A 4CM9D 1EP3B 3NANA 4DA7A 1ZH4A 1GV0A 1Y8ZA 4H4EA 4BNLA 8ATCA 3UMFA 1XQVA 1KI8A 4L5IA 4WFJA 4X7RA 4TWBA 1IB6A 5HUQA 4NK4A 2F8LA 3AUAA 3L6CA 5BYBA 3U39A 1GZ3A 4HX9A 4TQ9A 3LCMA 5DLPA 3CKKA 5IAJA 1ULTA 3DLCA 3U7IA 3R23A 4S0ZA 3MD0A 4NIMA 4RL4A 4K88A 5F3RA 3ZGLA 5G1PA 4X20B 1RZ3A 5JH7F 1DXOA 4FGSA 5FT9A 3LFHA 4YYZA 4KNVA 5DYNA 1K88A 3IKJA 3ZZUA 2ZUSA 4EHKA 1AH2A 4E5VA 3JQ8A 1TTQB 3UC9A 1W29A 3HDHA 4RD6A 4EZBA 1LI4A 5JDIA 3DYVA 1PG2A 2YRWA 3PRJA 3JZAA 4KFSA 1E6MA 1F2UB 2BMVA 3NWBA 4IDFA 2ZSEA 3H7AA 1UXGA 2O8VA 2RG7A 2ZQYA 3N5CA 4KJZA 4OXNA 3PQ4A 2WPDD 5GGYA 2AQ8A 1KQNA 3T34A 3WKEA 2EIHA 4WH0A 3T0FA 2YW9A 3WL8A 3AG5A 1ZWLA 4JJ8A 4CN8A 4ZHSA 1OB5A 1B0PA 3DFKA 4PBTA 1V3TA 2BFBA 4O5AA 4BDTA 1I7QB 5SZHB 1XLWA 1OXUA 1JZTA 2OO5C 1SBYA 3ZW8A 3I1IA 5ESDA 2E6UX 3KEFA 4D98A 4OQZA 3CWZA 3AH8A 4HXEB 2X13A 4EPVA 8LDHA 4DC0A 3PP8A 4MHSA 3DDZX 4ZV4A 1GN8A 2WPDA 1Y7LA 4Q24A 4QJBA 5IW8A 1YOVA 1NBEA 3EUEA 1L2TA 4EHIA 1FSFA 1XYVA 5K7SA 3R7DA 2EZ8A 4CKXA 2WIAA 2YMMA 2Y1WA 1ECLA 4X93A 2VF2A 1MD9A 1QYVA 3I32A 4RABA 5CVDA 4I8XA 2J1LA 4F5WA 1CR1A 3GA5A 3I6QA 1YR2A 1M2OA 1OAOA 2IXDA 1UJ5A 1X6VA 4GFDA 1F5NA 3WL7A 4XLLA 3MRVA 1P3DA 2GK3A 3TBHA 5D3ZA 1OI7A 1PTJA 1XDWA 2Y77A 1F2VA 3CISA 4QU8A 2PT7A 4XYGA 1W93A 4G8BA 4TM8A 3RJ9A 1CS4C 4YO8A 3S2GA 3UUWA 3WJ2A 4GP6A 3WFJA 3G9QA 1WPGA 4PWYA 2PZKA 2VJPA 3CSDA 1KOFA 3RUEA 4B32A 1BXZA 4GKAA 4C29A 4BP9A 1LH0A 2XNDD 4G1FA 4HWPA 4C0SA 4OQQA 2VK2A 3H5IA 2NACA 4ZCPA 2PKCA 5KNBA 1P39A 1C81A 3AFGA 3ZVLA 3ZV4A 1TK2A 1C8VB 3GRPA 3ZHXA 4EELA 1FTSA 4HLDA 3R3XA 1AQUA 2WEKA 2Q9BA 1SZJG 2OXFA 5IAEA 1LLFA 3RVLA 1Z33A 2VDMB 1CTQA 1YS4A 2AXQA 3A4LA 3AHCA 3U0BA 4UAUA 1L5SA 1DS6A 3VH2A 3D6AA 4Q6WA 4RV9A 1IMJA 2Z5VA 3W9BA 3V8EA 4TMFA 3PVCA 3RBXA 2WJHA 2CYBA 3FAKA 2ZU0C 4NBRA 4KSBA 5FXMA 1U3TA 3RYIB 2EF0A 3A1SA 2MU1A 3ZGNA 5TS3A 3PFKA 3TL2A 4UOEA 6NULA 4D44A 4R8VA 2Q9AA 1PNTA 4P93A 4EG1A 5K05A 4JX9A 1P6UA 1U7OA 1T9GS 3IELA 2F9LA 1IN8A 4IFTA 3WHLA 4E0BA 1NBME 1F0KA 2RI0A 1YR6A 2WFMA 4QODA 1MRSA 3D31A 3BK1A 1TU0A 4RKYA 3DM5A 1JFTA 1SPXA 2R6HA 3KE8A 4KGVA 4N01A 4BB5A 3I2HA 1ULAA 3GDGA 4HGYA 5KMGA 5JYDA 4IBOA 1L4GA 1LA2A 4MRSA 1M2GA 2IZOA 4EM6A 3UZUA 1FYVA 1Q95A 4RUKA 2VTVA 4YP7A 5AUPB 2E5WA 1KVSA 1N7IA 5LDHA 1M2VA 2GAAA 3I2JA 3CEPB 3KPUA 2EWWA 2DKNA 3AKCA 4CKZA 1SC3A 3O6VA 1XLTC 3L82B 3HCOA 2O2SA 3K9QO 4RIFA 4UDYX 3PI6A 1ADYA