3DE1X

Proteinase k by lb nanotemplate method after the third step of high x-ray dose on esrf id23-1 beamline
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de1X00
1JEAA 1DUIA 3QMPA 4C3VA 1SIUA 3QTLA 3DVSX 4NE7A 1HT3A 4KG7A 1C9NA 1YJCA 3PTLA 1OYOA 2WUVA 1GA6A 5JXJA 1KDZA 2W2QA 2WV7A 3F7MA 2ZWOA 2W2OA 1PFGA 1GTL1 1LW6E 1TM7E 3DW3X 1WMDA 2Z2YA 4DZTA 2ZRQA 1BJRE 3LXUX 1GTJ1 1ZVJA 1P7WA 2Z30A 5AQEA 1SCNE 4I0WB 1SN7A 1Y9ZA 2WWTA 4C3UA 1PJ8A 3I34X 3DE5X 3DE7X 4NE9A 3VV3A 1Y4AE 2W2MA 2Z56A 4HX2A 5B1DA 1SH7A 4HVLA 1TK2A 1OT5A 1SCJA 3P5BA 3BGOS 5K7SA 1SBNE 1S01A 3Q40A 1BFKA 2Z2XA 1SUEA 2P4EA 1IC6A 4CFZA 2E1PA 1KE1A 1TM3E 2ST1A 4LVNA 5FBZA 1AV7A 2HPZA 2SECE 5ARCA 4JP8A 3EDYA 3L1KA 1NLUA 2W2NA 4KPGA 4K8RB 4WOCA 1SPBS 2Z2ZA 1TMGE 4DJ5X 3LPAA 1TO2E 3EE6A 1BE8A 1V5IA 2HD4A 1KDVA 1SBIA 3DE1X 1AU9A 3D9QX 1SUDA 4LVOA 1Y34E 1R64A 2B6NA 3AJ9A 2IXTA 3GT3A 3D43A 5CW1A 1SBHA 2W2PA 3CO0S 1S2NA 1IAVA 3GCWA 1T1GA 3EIFA 1C9JA 3AFGA 2Z57A 3TI7A 1CNMA 1SCBA 3GCXA 1WSDA 4NMXB 2GKOA 1SIBE 4WOBA 5JXIA 5FAXA 2PYZA 3HJRA 5AMXA 2G4VA 4H6VA 2PKCA 2SICE 3AJ8A 5FFNA 3TI9A 1BFUA 3BX1A 1Y3BE 1MEEA 5AVKA 1T1EA 4GI3A 1GA1A 1Q5PA 1EGQA 1BE6A 1GA4A 4RYDA 4H6XA 3DE6X 3DE0X 1R6VA 2ZWPA 1EA7A 3DVQX 4CFYA 4FONA 3F7OA 1GNSA 1VSBA 3LPDA 1TM4E 5I9SA 1TM5E 1SUBA 1THMA 3VHQA 1T1IA 1Y3CE 1GTG1 5SICE 3DDZX 1Y3FE 3A3OA 3UNXA 1CSEE 3VSBA 4BWGA 1AF4A 1V6CA 1SUCA 2SNIE 1GNVA 1SCAA 3ZXXA 3VV2A 1Y3DE 1SBCA 3WIUA 1TM1E 3LPCA 4B5LA 1ST2A 4AKTA 1AK9A 1ZVKA 1TO1E 2PQ2A 3DE2X 3DVRX 3BPSA 4H6WA 4KB5A 1R0RE 1Y33E 1Y48E 1TECE 1SELA 2XTJA 3A3NA 3I2YX 2DUJA 3A3PA 3DYBA 3DE4X 3CNQS 3ZXYA 5B1EA 1Y4DE 3VTAA 3I37X 1SCDA 1MPTA 1NDQA 2XRMA 4M1ZA 2TECE 1SBTA 1GCIA 4DWWA 3PRKE 5ARBA 1BH6A 1P7VA 2V8BA 1YJBA 4ZARA 1WMFA 3WIVA 2ID8A 1KE2A 3SQOA 3Q5GA 2PMWB 1C9MA 1SUAA 3I30X 3DE3X 4J94A 1AVTA 4CG0A 4YN3A 1GT91 5JXGA 1WMEA 1YU6A 2ID4A 3VYVA 1Y1KE 4Z2AA 2SBTA 3DW1X 2PWAA 1UBNA 1ST3A 3F49S 1AQNA 5AVJA 1SVNA 5JXHA 1DBIA 2DQKA 4OV6B 1P8JA 3WHIA 3GT4A 1AH2A 1SUPA 3DWEX 2QTWB 1SIOA 1KDYA 3WQBA 1S02A 2X8JB 3T41A 2DP4E 3SICE 4AKSA 2PWBA 1PEKE 3QFHA 1A2QA 4OMDA 5JMOA 4MZDA 5ARDA 1PTKA 1XF1A 2X8JA 1NDUA 1YJAA 2Z58A 3OSZA 2PRKA 2IY9A 1WVMA 4OMCA 4ZOQI 3H42B 3TECE 2WUWE 1OYVA 1C3LA
chains in the Genus database with same CATH superfamily
2A67A 4UPEA 1E2MA 1KH2A 3GUYA 1QZUA 5IPFA 1AN0A 4KPUA 4M88A 4NYIR 2UZ4A 4EF5A 1QM5A 2EDAA 3C7DB 3F96A 5IT5A 3QVGB 4JT4A 4C0HA 1VHQA 1GNQA 5JNTA 3MTEA 3Q87B 1VCIA 2EIXA 4OBXA 5CIWA 4EW3A 4U8HA 1Q3HA 1A9QA 2B8EA 2JCXA 4LTMA 4HNRA 4B4KA 5LWHA 2WMNB 3DAFA 2GKSA 3HFGA 4G0QA 4ASUD 4FBMA 2UZ1B 4O2RA 1N9ZA 3F67A 4TLBA 2VSOA 4B3HA 5DRYA 1DQPA 4J4BA 3R8FA 4HTFB 3ICCA 2O3SA 3OPYA 1XKXA 4TTQA 2R751 3D0KA 1E8NA 3MTJA 4H6PA 4HSEA 4LISA 3M2PA 5ESWA 2WU0A 4IQFA 4HVAA 2OYSA 4JT2A 4P5EA 3KIPA 4DVJA 4IZOA 2BGIA 4NV1A 3DW3X 4EO4A 2HMSA 3LGSA 3N2KB 1CCWA 1JDSA 4G97A 1VDZA 1QVVA 2F3UA 3B6MA 5K3FB 2WT8A 3CF4G 4AULA 2IPOA 1U28C 4WRRA 3L2OB 3OFSA 2QXUA 4ARZB 3VZBA 2C4NA 4DNOA 1YB5A 3GPLA 1FFCA 4EBBA 4IM7A 4Z4IA 3ZTYA 4K9KA 3EXEB 4NYJR 4XARA 4B4WA 4PPYA 3RKSA 2QENA 2Y27A 1I1HA 2WFAA 3F47A 3B38A 1S2GA 4IDEA 4DC1A 3WB0A 4KDFA 3W34A 2QXTA 1Q17A 4DHWA 4FYJA 2P5UA 3AFMA 5JJ5A 3EDOA 1FNMA 2R4QA 3LDGA 4RQTA 1JXQA 2Q5EA 5HKAA 2P7IA 4P82A 1ESZA 2R7MA 1Z16A 2H2WA 2WKQA 2XB9A 4KQKA 1IBSA 4MGZR 4YJDA 3VV3A 2YHIB 4DA6A 4U7DA 3EPHA 2H7CA 4HX2A 1W52X 3TD9A 2UUCB 4B6EA 4W1SA 4ZMRA 3NW9A 2ZT7A 1ZNQO 1SCJA 3AMVA 1JQAA 3RSFA 1CE8B 1M6HA 4BQIA 1FDUA 5FLEX 1HX7A 2RI6A 3DM9B 1ZNXA 5ADVA 2Q3EA 1EP2B 2O8DB 4K7JA 3DBRA 2GT1A 3IKTA 1YJ5A 5A3VA 2KLHA 1DBPA 3DEFA 3ADKA 3VGPA 1QQTA 2BR4A 3H5LA 3N8HA 4BWVA 1I4OA 3RT9A 3WV4A 3UWSA 1CETA 5THXA 3U3RA 3LQQA 3CUVA 3UMBA 3IQDB 3HB1A 5H9WA 2JJ2A 1E3LA 3KALA 4RA9A 4AJNA 3U7FB 1WZIA 1MOSA 2FWJA 2HJHA 2NNLD 4HADA 2Q1SA 3BN3A 1E5TA 3GRAA 4L7QA 3WKAA 5JD6A 4PCUA 2GWRA 3G5TA 2YJ6A 5ALTA 4Q7EA 4X1IA 1FMTA 2QAJA 3OE5A 1CUGA 1Y0BA 1ZD3A 2V8OA 1U4OA 2FQXA 5A03A 5EEGA 1UPXA 2Q6TA 1N5JA 4GAEA 5JAUA 1VXRA 4KHZA 3OECA 4NFSA 2BUBA 1M6VB 1Z5WA 1UANA 1ARZA 4XD7D 4ZXFA 4A8PA 4JJ6A 4EPWA 1AM4D 5TPWB 4AZTA 2AOTA 4LY6A 4MITA 3LK6A 2BDUA 1Y5RA 1FEZA 3O9MA 1SC9A 4HZUA 4RL6A 5JROA 3NYIA 1SPXA 2JLBA 2GMWA 3PGA1 4GI1A 3H7IA 3RS0A 1ACLA 1ZIPA 5EUQB 1CLUA 3HVRA 4OBBA 1Z2AA 2ZSUA 1N2ZA 2XUOA 1OIXA 1EB9A 4MLCA 5KAMA 4UBLA 3JYLA 5JSQA 4DLZA 4RJKA 4A23A 3KKNA 5A6SA 2YL2A 1AU9A 1RQLA 3GVCA 3TLAA 4W5NA 3DMRA 2YXDA 2QIPA 2X9GA 2CLFB 1C3EA 5ABPA 3LCUA 1SUDA 1X38A 1H6DA 3K1YA 3MTGA 2UYQA 2CXTA 3PVCA 5FUVA 5KYYA 4QXQA 1QTQA 3ONNA 3JSAA 2V5VA 3PUHA 4XLZA 3DV0A 5DEOA 1D3AA 3EPPA 3G8BA 4UHKA 4QIHA 3FYUB 4YJHB 4DREA 3GD7A 2RH4A 1SUSA 4YCMA 4L73A 1ISJA 3AJ9A 1ICEA 3ZCVA 1QU2A 4DR6B 4EG3A 3CKMA 4OXQA 3SYRA 4TLAA 3ESRA 4EI7A 3O91A 4QOFA 3RRMA 4DDKA 4MS4B 1EDOA 2JVJA 3H5VA 3OZCA 1P4AA 2BF4A 1TLFA 1X1DA 2GXSA 4NEGA 1OQAA 1WCIB 2AEFA 3DVAB 4I1RA 1SXJA 2R79A 4P9NA 3TBHA 4B3DA 5JYEA 1II8A 4YBRA 1YCGA 4PLGA 4NK4A 2A9OA 3BWVA 5J4YA 1ZJ5A 1W88B 2GYUA 2Y93A 2YNMD 2C2YA 2E18A 3HB5X 3NP7A 1U8ZA 3VM6A 2LIVA 1KI4A 2RIPA 3ZW9A 4WZ6A 1N75A 1KJ8A 2AMLA 2CNOA 3CKKA 3OUZA 3S44A 1FP2A 1WXDA 4HUTA 3R4CA 1K3FA 2IZ5A 5FOSA 1D9ZA 4GMXA 3HNPA 1GKIA 3TM5A 1UXHA 1SK9A 3LKZA 1GARA 1Z6AA 1SCBA 3PFCA 2XUKA 1JS1X 2D06A 4LJAA 1E61A 3SBXA 1QRUA 1LLFA 2O8CA 2XNHA 4BFSA 4OSPA 3Q98A 4YIHA 4K8OA 1FNCA 3QGMA 4P32A 1NNEA 2HGZA 4Q1VA 3R3VA 5I4KA 3L84A 5AMXA 3U9SA 1BVRA 1JDPA 2CMFA 2QHXA 1KK3A 2D1QA 2X7HA 1KFEB 3QYFA 4LHVA 4QDZA 4XB1A 3DTVA 3V3KA 3WTBA 1XALA 1ZD4A 4IIXA 3CPJB 3G82C 1SHJA 4BFUA 2OOSA 1E3TA 1LTHR 2F43A 4IHKA 3ZBUA 3ZZ1A 3GPIA 2OMEA 3F8SA 4MRMA 3SVZA 1XZ8A 3K2QA 1ENZA 4CL0A 1ZH2A 1N4AA 4D9KA 3E27A 1VHJA 3C85A 1J97A 3PENA 4BV2A 5JS7A 5K3FA 1O5TA 3WL7A 1GITA 2OGSA 4ADSG 5HPYB 2QT0A 3H9EO 2Y68A 3U0BA 1CJCA 1U0GA 1KDTA 2XNSA 4JJAA 3MZ0A 3B1WA 4MS3B 5EJ6A 3PGLA 4RO0A 4QOEA 4RYDA 3CSDA 5C81A 4LZOA 2CLOB 3V8NA 5IW8A 4FE7A 3EXEA 3GFTA 4TWIA 4ZYVA 1R1DA 1W19A 5CPFA 5FPPA 4X66B 3BIFA 4MJLA 3NRBA 1M9NA 3RSZA 1W49A 1RHUA 4X44A 1XAJA 1VMIA 6NULA 3KDPA 3PHBE 1KIAA 1JDNA 3F1KA 3G9UA 4HUQB 2QW8A 2XAAA 3WB1A 4LQLA 2GRAA 3K0SA 2JEOA 2OCIA 4IRUB 1ZHFA 4UBOA 3W7VA 3RC2A 4UW9A 1FFDA 1W7AA 1U1IA 1N6LA 3ETJA 4URZR 3L8YA 3MOIA 3N5CA 1VHTA 1HSZA 3HJCA 4R2KA 3WMEA 2ZBVA 3SQXA 2PUJA 4FWBA 2QBYA 4QPPA 3FFXA 5TC4A 2RI1A 4NTZA 2R11A 4PNPA 4QFCA 4XQEA 2AJDA 3LHIA 4UOEA 1RYHA 4MLPA 4DUGA 2Q5IA 4R71A 1ODSA 1Q1ZA 1ESDA 4GPBA 3VSBA 3L40A 3HJNA 1P0QA 4HN2A 4EY7A 3MELA 4NBWA 5BSGA 5KKCA 4EJ0A 5DYWA 1CVRA 2QTMA 2ZYSA 3K8YA 3DBOB 4XIIA 3I42A 1YR6A 2BJWA 3VZSA 3G8DA 1P9OA 3HB0A 2ZRNA 1ODFA 3NR2A 4MB0A 1Y3DE 3B20A 4WKGA 4OO3A 4CUJA 3VUEA 1DAMA 1V9CA 3PHCA 5CXQA 5M7EA 4YRAA 3WAGA 3GPCA 2GFQA 4J2HA 3V00A 2WWYA 1Q15A 1UPTA 4HG2A 4UULA 3RTGA 3W1VA 1ULAA 3W5IA 2XKKA 4E13A 2VHWA 1XAGA 1NYQA 1TO1E 2VWGA 3R09A 5B2ZA 5EJMA 4V2UA 1KP2A 1KI8A 2PQ2A 2IYWA 3BTVA 2ZQ5A 1YQUA 3C97A 4GP6A 4QUJA 2AXPA 4X85A 5A5EA 1B93A 4QVIA 3A9VA 2R2AA 3DVRX 1KGDA 3MERA 2HDHA 1HRKA 3SR3A 4TYNA 3THYA 1NW7A 4B79A 3NDBB 4B7XA 1TECE 2XTJA 2B2XA 5SZIA 1XUOA 4FOLA 1HQCA 5AQ1A 2BMDA 1ATIA 2CY0A 2JGMA 3M81A 3BOSA 5B3AA 2P9ZA 5FUQA 4YNBA 1N36B 1LW7A 1JYFA 4JU9A 2GCIA 1GQOA 4M3NA 3BSFA 4PC7A 5DE3A 4D5EA 4OB6A 2WE7A 3S1SA 3ZXYA 2GI4A 4HX5A 4BLWA 1LD3A 4HDKB 3ROTA 4D8TA 3QVLA 5B1EA 3TOSA 2I29A 4PC6A 3NBMA 2FMKA 2PVSA 1TM2A 3FYUA 4NU0A 4XGRA 4FHGA 4YJHA 2Q2QA 1D2NA 2EDCA 5BV1A 3U4QB 4WKCA 1YK0A 1KARA 3I3OA 1MPTA 2NYVA 2TMKA 2VXCA 2O8NA 3LDAA 2NACA 4N6NA 3FPEA 5F1PA 4F11A 3HY6A 1NUUA 1PG0A 4DYHA 4BO1A 4MS4A 4Q4HB 2NVUA 1Z82A 3R7AA 2CLSA 1N57A 4E5YA 3SX2A 4WJKB 3SX0A 1SBTA 3QX8A 2HRDA 1Q83A 1VJDA 1W85A 4KI0A 4WX2B 5CLIA 1NI4A 5AJZA 1XDBA 2C4HA 2ASEA 1VPEA 2GSWA 3O4FA 4J6EA 4L3VA 4U7PB 4RZXA 2OYCA 2ISQA 2NZ2A 5D3QA 3ZOZA 4BC1A 2X5JO 2EBWA 2G77B 2O0JA 1NJ2A 3ZE8A 4FYWA 1ML4A 3VZCA 4JVSB 4C5BA 4WECA 1UJBA 3IE1A 4BNDA 3P9ZA 3DLAA 5I45A 2RSLA 2B83A 4S2UA 5JEEA 1QYVA 1V5EA 1COWD 2ZQZA 3GLHE 4H7EA 2HF8A 2VHEA 1CQPA 3T7DA 4GT1A 1N7HA 1W96A 4Y2JA 3BGDA 1R0SA 3SM9A 3UMGA 2BM0A 3SYNA 1R9MA 1XCGB 2FP3A 5EWMA 3MS7A 1YR8A 3FMVA 4ZPXA 3RADC 2JIQA 3M6MD 2NZWA 3OI7A 4J0QA 4I1SA 1E6LA 3EEYA 2PX6A 1AVTA 4UU0A 1VYTA 5FUXA 1G9SA 3GNSA 1IY8A 2JH9A 2OL4A 3ZWDA 1WMEA 3T7AA 4RELA 4EX6A 1VHLA 1KWGA 1HT1E 1QGZA 2VYND 3BWMA 3Q9LA 1Y8RA 3MN1A 1X1AA 4E7OA 3H5OA 3MQFA 3TMAA 2QVXX 1BW9B 3ILSA 4MCIA 5AK3A 2QRNA 4GP9A 5HKLA 4GL4A 4YLYA 1U0TA 1YQ9A 3WGLA 1E7MA 5EWLB 4LQ4A 2WJGA 4BN0A 3GLIE 4B3SB 4Z7OB 3HYNA 3V4PB 1ZS9A 5DZSA 3F97A 3K9CA 4MR8B 4U6NA 3RRZA 3NIBA 1I4TD 3HHEA 4TMZA 1G2PA 5F33A 4F3KA 2NO1A 4YT8A 3U6KA 4HUQA 4N65A 4OXXA 3EWNA 4L08A 3T5TA 3F1LA 3MAJA 3ROXA 1Q3KA 1T2NA 4Z9FA 5IS2A 2QJTA 2LKCA 2F7SA 1J2YA 3O3NB 3PJEA 3R7DA 1X7ZA 4EIWA 2YXPX 3D6TB 3SM3A 2V3CC 3FKSA 4XUDA 4RM3A 2AZ4A 1KDPA 1E1QD 3BORA 4J7CA 4ANFA 3QOWA 4ABYA 5B58C 2QTBA 3AVXA 1X14A 4D98A 1PLLA 2K7ZA 4Y7DA 1U0LA 3WLIA 5IZ4A 1G4AE 5BN4B 3JS5A 1Z2PX 3IEPA 5SY4A 1UKZA 4YO7A 2ZBFA 1JE0A 2VAXA 1Q74A 2JFGA 4NBUA 2NU9A 2N1BA 3RTEA 1N3BA 1GKUB 2OAQ1 2YIJA 3MIZA 2J3MA 3K2IA 2WWVD 4MUBA 1WDWB 1ILWA 2A86A 3S2IA 1NLZA 1HT2E 2FPLA 2WJVA 4KSCA 3HKBB 4DMKA 1YJAA 3AEZA 3EXFB 4IP0A 2H0AA 1R4NB 5AW5A 4QYTA 3OEEA 5A62A 3M1LA 4U2KA 2XLCA 2XNCA 1HTTA 3NBYC 3AUKA 4FFLA 3P2YA 3IUSA 4WK2B 1N5MA 2IS6A 3NHSA 1YS2X 2VDMB 1MIHA 1BKDR 1K7YA 3C7TA 4KR3A 1T26A 2AFHE 2PXAA 1C4KA 2BUCA 2CFSA 2IHJA 3GPDG 4D46A 4YXFA 4DJAA 4ZYUA 1H8EA 2G7MC 2H65A 5G2OA 1QJCA 1A5ZA 4C30A 5KOHA 5KWEA 3OTOB 5B6JA 1WULS 1B0ZA 1UWKA 2CL7X 3B1FA 3H42B 3NONA 3FBWA 1RWBA 5LBTA 4K86A 1TLLA 1B8OA 3UJ8A 1ZYUA 1G63A 4G5XA 4I55A 3QE0A 2Q3BA 4LC9A 2P8SA 2NXNA 4J0FA 2ZBRA 4P2GA 3A9SA 1PUXA 3FX2A 1KK2A 5IBCA 1OI4A 3EA4A 3WMXA 4I50B 1XZPA 4DV0B 3NYQA 3F6PA 1XTJA 2G4CA 1RWMA 3M89A 2A1TS 4HMQA 4E2XA 2GXAA 3MMNA 1JTEA 2PV7A 3B6KA 5A4MS 4HDKA 1NXWA 3O8OB 3KQLA 4W1QA 3CJQA 4G4SO 3W2EA 3TF5A 1Z75A 1UBHS 4GZ3A 4RQAA 5IG2A 1FNNA 1T4BA 2NSHA 3FCSB 1EB8A 3QX9A 5DO9A 1N5RA 4BN5A 3OMWA 3LOUA 4N82A 2GETA 3DB2A 3TQCA 4BQRA 3C5CA 3OD5A 1HETA 1H2YA 4WHMA 1ZMOA 4WVLA 4EL5A 4R51A 1GTL1 1C0EA 4NBNA 1JR2A 1QBKC 1XAIA 3OQVA 5IMBA 3E15A 5BOVA 5B1YA 5FBVB 2O54A 1W0KD 1XOIA 3OEHA 1WMDA 3OWXA 1F5SA 1QONA 4TMWA 3VI4B 4CLOB 2FFAA 2ZRJA 4ZDJA 1FBTA 3ITNA 1Q57A 3GP3A 2A9VA 5EXSA 2P9GA 1T9CA 1QK4A 1QVZA 3A05A 4CE6A 1OH5A 1OAOA 1HE3A 3D2CA 3HKCA 3ESQA 3OZRA 5FR1A 3VU3A 4W5RA 2WD7A 4N6OA 2GZDA 3TRFA 4IXNA 1Z08A 2BSQA 1OREA 2VYVA 1YUMA 2VBGA 3PNMA 1P7WA 2O57A 3W8EA 3V4FA 1JHMA 1XFAA 4BMVA 4F6RA 1LU9A 5DHPA 3I64A 4I3HA 4G0ZA 1CUXA 3EZ2A 1CUIA 2NSLA 4HGPA 1E89A 1P74A 3ZZ0A 4BMNA 3O47A 5BO5A 5KYKA 4FFVA 3LAWA 4BRSA 3E3OA 1OBHA 1IN1A 2KB0A 2ECPA 1JG3A 3B89A 1PR2A 1UPBA 3PQCA 2GA8A 3OU6A 1AGXA 1CQJB 2OO3A 2JJYA 3DAOA 1L8LA 2BGRA 3FGNA 3LVQE 4E5PA 1ZH4A 2HADA 1Q16A 2OUKA 3CIFA 4LTNA 5CLGA 5KYWA 2OZPA 4TN1A 5COAA 1XP5A 1E6UA 2JAHA 3E7DA 3G7SA 1G19A 3I01M 4L4UA 3GNLA 3FR7A 4TMXA 1ID8A 3U80A 1XTRA 3RVRA 1Y7IA 2IZ7A 1Y1PA 4DCMA 1M10A 2XX3A 1YDEA 2NYAA 1YQGA 1E79A 1QO9A 3BG5A 3VC2A 5L9AA 2FDRA 1XEWY 3TR5A 2HF9A 3UA3A 3UC9A 4B8ZA 5K8UA 3KJXA 5EWLA 2Q5CA 5JQWA 3OZTA 3LM8A 4CM6A 4G07A 4GHWA 3SX4A 4N4AA 2AFHA 3UMYA 2K2QB 1GQ2A 3ASUA 4TQGA 3HJTA 4XDYA 4MA0A 3PNSA 3VVBA 2QMOA 3SQDA 3WWPA 4CIYA 1JALA 1ZSVA 4O4JA 5I7SA 1MB3A 2QI9C 4MZXA 4AYWA 4E46A 2XY4A 3PXUA 3BFJA 3I5UA 4JR0A 2OHIA 1DOHA 1ESMA 4B5KA 3ON5A 4B74A 1CY0A 4EDHA 1J9ZA 1ZWLA 3MJ4A 1RWXA 4LPSA 2IPLA 3MINA 3QXXA 4M0FA 3S68A 3CLHA 3UK7A 2BGGA 1PNVA 9GPBA 2VOJA 1JNXX 4EHJA 3C4VA 1CJTC 3T0FA 3TIFA 2VP0A 5EP2A 3EULA 2J4FA 3BUSA 2OOKA 4B75A 4AYXA 2I7VA 1SPBS 2FRXA 3U7JA 3BT7A 2FDXA 1CUDA 4JT8A 5HTOA 4WQMA 4CLRB 4OHMA 2PR7A 4GQBA 1ZI8A 3OCYA 4ZDWA 1Z28A 5FTWA 3FOZA 3AETB 3SYKA 1G5QA 4KQWA 4JYPA 4X20A 4XQCA 1XYYA 4A15A 5ECYA 3VHXB 4ASUA 5A4JA 4CTKA 4UHJA 1HLFA 3V1UA 1BYIA 3R9IA 3E7XA 1U4NA 2XCUA 3KKQA 3EVEA 3HKBA 3IA2A 1APBA 1ZXBA 3DF7A 2G1KA 3CUTA 2D7DA 1RABA 2VP4A 4ZVLA 3AR2A 2DHCA 4J0IA 2W00A 2C1EA 2BKLA 1R64A 2IHZA 1EG7A 3QUSA 1EP3B 4H0FA 1XQWA 3I45A 1TA0A 1GPJA 3AJEA 3NJRA 3K72B 3GT3A 3O75A 4H3VA 1B4DA 4QARA 3H17A 4NJEA 1SVOA 1IG3A 1Z88A 2XA1A 4GKAA 3VBCA 2XNDD 2IUUA 2APJA 3A4MA 4MI6A 2Q4DA 4ARAA 1JJFA 3KXPA 5K8LA 2WHQA 1DX9A 4Z86A 3CX6A 1KI2A 1C8BA 5IAAA 3WV5A 3JTEA 4UARA 2ZETA 2RB5A 3B12A 5C8YF 2OAEA 3G5UA 4FZVA 1R18A 2C4WA 2VHJA 3HZHA 4P0PB 1I2AA 4ZMBA 5BVHB 1UH5A 2YYAA 3DZCA 1CS0A 3MFYA 1P2VA 5AYVA 2V7UA 3UB3A 1JHVA 1MH1A 2Z57A 3R77A 3K09A 5DYNA 3RHZA 5FTKA 5JSUA 5LOVF 2C29D 2EYQA 3LPNA 3D3JA 3SD7A 3HEBA 3ULKA 2A5YB 3U3DA 2RFLA 3TTUA 1F51E 4CMEA 3AKCA 1I2CA 4WOBA 5FX2A 5DOVA 5JXIA 2OO5A 4BCCA 2VPIA 1YS1X 4IKPA 3ZG6A 4EUHA 3PF8A 2HA7A 4Y1GA 2JGRA 1XA4A 3D0QA 3TVDA 4MRVA 3WNCA 2Y0BA 4II7A 3R7BA 2AWOA 1XRMA 4TXMA 1E9RA 1FF9A 3L01A 3QKRB 3BMXA 4OBEA 3PTAA 2JPDA 2BMJA 3DD1A 4US1R 4L4ZA 5H82A 1X1TA 4WNYA 3D4LA 3WAKA 1PGQA 3MWEB 1O96B 2V6JA 3OLVA 4YCNA 1K8XB 2G17A 2J4CA 4NS1A 5J63A 5LM3A 5FB3A 3ZC3A 3LJKA 3IELA 1ORIA 4QDJA 2Q8NA 3UGJA 4R68A 1Z83A 5ERYA 4WPGA 2XCLA 3M9XA 5GIOE 4P98A 4M8KA 4KSBA 3TR0A 3DPIA 1R74A 2QTVB 3V6MA 1VKOA 4DV6B 2W6NA 1RTKA 5IARA 1RQPA 2VXYA 3QNWA 3E2MA 3ZGNA 4C7MA 2YWHA 1GU7A 2ADFA 3NOOA 4KQIA 4RIIA 1I94B 2AG0A 2FG7C 3QEMB 4JKYA 2BCJQ 3T4UA 4P5PA 1KSHA 1W47A 1YA4A 4MKXA 1M8JA 3EASA 2PUDA 2YY6A 3L41A 3TLGB 1LBHA 2QK4A 4XD7A 1ODLA 1V1MB 2P9FA 4YPVA 1IG0A 1LA2A 1RKVA 4X1OA 4P7GA 6PFKA 3L0OA 4DSZA 2YV5A 2F1OA 2YV4A 2RC5A 3P94A 1TQDA 1M34B 1RRCA 3ZD7A 5I4BA 2WZQA 1C0IA 1N6KA 3L92A 1AXEA 4KOAA 3W5BA 3A6HA 5HYVA 4BPRA 4JLMA 4OLJA 1U2GC 5EUCA 1XZCA 4BZQA 1P1RA 1USKA 1EFLA 2FEWB 1T9GR 1WDTA 1HOTA 3PDHA 1KQ3A 1E2IA 1V7PC 4QJIA 4INOA 1YCFA 4HYQA 1HM5A 2F9MA 1TGYA 1UBLS 1WPRA 2IYYA 4FCWA 3V55A 1LK0A 2DGDA 2VP3A 4LOAA 4PSCA 1VMAA 4BVFA 1CUAA 3ETHA 4RH3A 2PAFA 1MCZA 4G5RA 5LLDA 1VPWA 3T94A 3UH1A 3GGDA 2B34A 1UOOA 1S2MA 3NB0A 3ZZMA 1G41A 4WMLA 4BMOB 4BLTA 1RM4A 1PX0A 4Q7KA 2I87A 5JAQA 3T3NA 2FHPA 2XOKD 2E89A 2ID7A 1FFBA 4R1OA 3RTBA 1BMFD 5JI2E 3ED1A 3OOHA 1QQ7A 2AMYA 4BFYA 1SWWA 5LMZA 2YC4C 1A72A 2A5GA 5K0GA 4MUAA 1K7FB 1QP8A 5LZ2A 5B1IA 2ZK7A 1Z6GA 4NONA 4YMUA 2BGKA 4WFKA 1U8UA 4IQ0A 5TR9A 2RKWA 4YQEA 4G01B 3E9NA 4NFYA 1TAGA 5EIBC 1ZXXA 4JI4B 1ILEA 3OQIB 3IEVA 4F3CA 2JAUA 2YNMA 3F5FA 1V41E 2CB0A 1NPYA 2JFUA 3WXMA 5JH7B 2GPAA 5EAIA 1BDJA 3IL2A 2G5CA 2G7ZA 4QDTA 2G07A 5M3BA 1LJ8A 2M98A 4BASA 4P33A 3UOGA 1IQ0A 1TADA 3O94A 1H05A 4M9XA 4YALA 2WIKA 3AETA 1S1CA 1QUFA 2Q46A 1L5NA 1PQYA 4FLMA 4Z9AA 2PX2A 3HFJA 2M2IA 1QWOA 4K6GA 1B1AA 5FH9A 3CLTC 4LY3A 3UV3A 3WB2A 2B5VA 3N3AC 4FU0A 2WAXA 4QELA 4KQ9A 4PZ0A 1CF4A 2PVPA 5SY9A 1PJ4A 5BW6B 1OFGA 1A9XB 5LQNA 1TE2A 3RJZA 3TX6A 4R9NA 1MNAA 1VCMA 2BZSA 1L4UA 4IIVA 3OZUA 4AMBA 3G13A 4KLNA 1OH7A 1LFAA 3DNPA 3P4XA 4OATA 1C80A 2QMZA 1CQIA 3ANNA 3LXRA 4BY9E 1AQ6A 1US8B 1OC2A 4PYNA 3SS8A 4TYWA 3UM9A 4GGMX 2GM4A 1P7ZA 3BJZA 1WXIA 2CLIB 3UA4A 2C07A 2Q6LA 5T3YA 2ZJ2A 2DT5A 3RUCA 2VJPA 4JI2B 4LHEA 4LI3X 2IEDA 4D4MA 5EPUA 3LLMA 4LQDA 5A3QA 3A31A 3IPRA 2TYSB 4EA8A 1KIFA 3UV7A 1W25A 4HNTA 1CIPA 3NATA 2JD1A 2B36A 1GIAA 3DKIA 4UCFA 3PIRA 8MHTA 1CUBA 1BHQ1 1HNXB 1YI1A 1KS9A 2PXHA 1P29A 1D1TA 5CUQA 3U3XA 4HEA6 3HLYA 4M46A 1OH8A 4RTPA 4ZI3A 1L7BA 1CY6A 1GWNA 1MB9A 1XNGA 2QP9X 2VHYA 2PKWA 3GARA 3P0IA 3UT6A 4EYQA 1S96A 2GXQA 4R8MA 4YV2A 4RA6B 5HFJA 2HA0A 4G26A 3VZQA 5H02A 5GVSA 1GU1A 3A1WA 3ZHOA 3HP7A 2N75A 4FXOA 2BTOA 4KVGA 2M1ZA 3RD5A 3G5LA 2OBYA 2OHJA 1K97A 3IAUA 3C8ZA 3TQSA 3JYOA 4A1OA 3FTNA 1MQSA 3GFSA 2PUVA 3KTOA 3QFCA 1UBCA 4I5EA 5REQB 3RVDA 1KTVA 1KY5A 2C9BA 3RARA 3T5MA 1CKEA 3A1SA 3GXOA 4WGFA 4KLZA 4JUBA 4KKXB 3RAFC 2FG6C 3LX4A 3HXKA 1U2EA 3MC1A 3KOUA 3RIGA 4TMTA 2ZSIA 3DBHA 5BSVA 4Q1CA 3ITKA 2VJCA 1QP4A 5JTTA 5AXDA 3HKEB 4LCEA 3O8RA 4RLQA 1MQAA 1MNQA 4YYEA 3BE6A 1Z0UA 4UUBA 1ISHA 1KQOA 2VJDA 4ND1A 4JP3A 3ZS9A 4ECAA 5K8TA 2ZREA 3FLEA 3KT8A 5CYFA 3ROEA 1LBSA 2CHGA 3N3BC 1Y1RA 4MPRA 2HMTA 5DCYA 1W0JD 1TUEA 1YFZA 1QG4A 3AR4A 3ZWXA 2QTVA 4C4TA 1GEGA 5DM70 3OAAD 4QUGA 1PS8A 1QV9A 2YZNA 1RBMA 1U8TA 4TUYA 5IJWA 1PVVA 3DUFA 1PKXA 3G5AA 4H15A 4XX0A 2XUDA 1HRDA 4EKYA 2ABWA 3ORRA 1LSSA 2NAPA 3QEMA 4I5IA 5KNLA 1ECPA 2XVYA 3AZPA 5LUAA 4J4HA 2FG5A 2YZ2A 3G85A 4JKIA 1V1MA 4ETNA 5AM5A 1RXWA 1XYVA 1Y8CA 4KLCA 2ICAA 2C4KA 4MKHA 4BVEA 1DJQA 1KIMA 1NMQA 4FIDA 1NVVQ 3JZAA 1DXOA 3TG2A 3NIWA 4X3PA 4B8WA 3O3MB 5CVTA 1YE8A 1G4UR 3PQ4A 3GI1A 821PA 3WQBA 2WF9A 1ZJ6A 5IAGA 1XLTC 1SHKA 1OLSB 1XQ6A 1CF9A 2DP4E 4ZREA 3Q7RA 1XD2A 1UK9A 4RW0A 4DSAA 3U19A 4HH0A 4B3RB 4JI5B 5HRAA 1LRKA 1D1QA 1RT9A 2G28A 4HWRA 3O0DA 3SYLA 7REQA 1K86A 3F8TA 5MFZA 2QRKA 4Q4LA 4HZGA 3NTQA 1DBVO 4ZJZA 4HDMB 4CI9A 3QBDA 1G20A 1FRFS 1JHAA 3H8WA 4Z3DA 2AYXA 1IM5A 1V8DA 3I5YA 1VE5A 1BHJA 1Y7TA 1A9PA 2BJHA 1RKUA 2K2WA 1E9CA 2WU1A 2HI0A 4G1BA 4H77A 4Y2RA 3VDNB 2CMDA 2P6OA 2XTMA 2ZUVA 4G3XA 1QBGA 4MYUA 1YNOA 4OGKA 5CA1B 2QVLA 2WTMA 1KFCB 2VJKA 3LC0A 4RSRA 3IQHX 5FWYB 5C32A 3THWA 4GVXA 3R0VA 3JZMA 3ORYA 1N2EA 1C1HA 4Z3OA 3FUTA 1GZUA 1UWLA 1BWSA 1NRJB 2C5GA 3G9XA 3GCDA 3OQIA 4LV6A 3A0UA 1AS3A 1YTLA 2WWWA 3FTPA 4HWPA 4Q48A 1DMSA 1IB6A 4Y6PA 2ZJZA 5CT6A 2ZE5A 4KNWA 3P9YA 4F4HA 5DHFA 3DD5A 5AI5A 3SF8B 2HN9A 4ZOQI 2I65A 3OJOA 3TAUA 4DXDA 3PD7A 3I62A 4EG6A 1COWA 1LGYA 2LZ0A 3FPKA 1UZNA 4BX2A 1EDBA 5KBYA 1XZNA 1ISSA 3P0EA 5G0VA 3LCRA 2OV4A 3GCZA 4GYYA 2XT9A 1K1EA 3DDWA 1O5IA 4U63A 4Y9RA 4B6FA 3IBFA 2OHXA 4JU8A 2GAIA 3WXBA 1HNZB 1O94D 3HMQA 3A1DA 2QRQA 2BGMA 2F3SA 1Y1TA 1U8YA 3L8EA 3MEQA 1P2TA 3AESA 3IBYA 1XVTA 3PXAA 1JLRA 4IKEA 1YH3A 4BV3A 4JYAB 2G3YA 1V11A 1KC1A 2YX1A 3CC8A 2EL7A 3GEEA 1HE5A 4KMSA 5CFNA 1HQYE 2HH9A 4BVLA 4J7UA 3UUGA 3C3WA 5NLLA 3PE3A 1U3UA 1XK6A 2VYNA 2D3TA 4LJ6A 1ZH0A 3F3KA 1Z4NA 4HDOB 5EHNA 5B55A 1S7CA 2A4KA 3RYCB 1KDZA 3UJ6A 2QX7A 2WV7A 4IIDA 2YZMA 4YVFA 3AINA 3FY4A 2SCUA 3KTFA 2ZJ4A 1ZGAA 3CRW1 2GN9A 3BMNB 2JATA 4F4CA 4MHTA 1J2RA 2DFVA 1K27A 2TMYA 4PGGA 6AT1A 2CLEB 4D45A 1EPUA 4KQ2A 4KN8A 2YWDA 1VHDA 1USUA 4NL4H 1XX6A 3W6OA 1R4MB 2JBWA 2QTGA 4GOMD 4TT3A 3AGPA 4H1WA 4Z9BA 1V5FA 3BF7A 3T3IA 3U9LA 3PFHA 1JNYA 1RJWA 3AIIA 4TTSA 3ESXA 1EAYA 4QXMA 4D8XA 1LV7A 1PFKA 2GO7A 1TGVA 4GP7A 5DV9A 5F4BA 4E2ZA 5CH3A 1W5FA 1T4CA 4RA6A 3QVSA 4U2BA 4M0LA 4PPNA 4MR7B 5IABA 2IHUA 2PMKA 2AB0A 3CX8A 3M8KA 1M1YA 2C83A 2CNKA 3QTBA 2GRUA 1X3LA 1CZRA 4O4IA 4A0SA 1YULA 1E1QA 4BNMA 1F2UB 2QSUA 3ROGA 3SIWA 1A5BB 2PANA 3U31A 5REQA 5A06A 3K1TA 2PQ6A 2EARA 1JFVA 3AEKB 3OIDA 2W2MA 4PFSA 1R6XA 1G3RA 1MC5A 5CU7A 3IB6A 2VRWA 4L5BA 1ETHA 1QTIA 1PJZA 1QWSA 1UWCA 4RD4A 4CZ2A 2QZJA 2OG2A 4YO8A 4UKDA 4YJGB 1E4EA 1QS0B 3BTOA 3IUJA 4I55F 1W6RA 4WXHA 1EM6A 1I4WA 2YQZA 3EFOB 2GBFA 1NN5A 1GY8A 2HDNB 3HCOA 3NKFA 4FHDA 3WISA 3W05A 5K7SA 5KSZA 3SDSA 3GLGA 3Q4GA 1FDRA 3C3JA 2K87A 5IJZA 3A7DA 2WQ7A 1KZHA 3NVAA 1W1UA 3E5RA 4DEVA 4G24A 1JHDA 2ZZNA 4ZEXA 1E2KA 3RBXA 4ER0A 3IBTA 1MHPA 2AC7A 4OSEA 5E3IA 3RQSA 4AJKA 3E3AA 4UFNA 1U5CA 2C8VA 2FI1A 2DE0X 2P4EA 1UBSB 2CUTA 1C0KA 2EJWA 3BKXA 2NMVA 3KQHA 4F60A 4WN9B 2L19A 4W5JA 1SA0A 4LGVA 3WMWA 4ZAXA 4EB6B 5MN6A 3PNBA 4P4SA 5DVZA 4DDVA 4IEEA 3OKFA 3GA7A 4EB3A 1C1DA 3NTVA 4GM1A 1SC4A 2RGWA 4QGAA 4U0KA 1RZUA 5BRNA 4B6PA 2CSXA 4RHTA 4YUZA 4TQUS 3FTEA 4KE8A 3T0IA 1H3EA 4D0SA 2FSFA 4F1WA 1FQWA 1DX6A 1PGOA 2GA9A 3AONB 1U90A 1K92A 4JJKA 3T52A 2H9AA 5J2UA 1QGOA 4YFVA 3SY8A 3B51X 3BD7A 3DMYA 3GT7A 3QBTA 4DRXA 4MKZA 1L5RA 2VUIB 1RMTA 1IM8A 3WNDA 4QJBA 2AEJA 5D84A 3TOVA 1L3CA 3K9GA 3K9QO 3Q2IA 3P8ZA 3T5BA 4BTEA 3V3TA 3IH5A 5ALEA 2FN9A 3WK7A 4L7VA 1E2PA 5C80A 4OQEA 1NW8A 2AXNA 1Q91A 2ADOA 2GH1A 4CR6A 4HDMA 2EVWX 5JUWA 4JJGA 1OUMA 4S12A 4PQRA 3WK8A 2WKRA 4QSHA 4Z9XA 1Q84A 3D4IA 5CRIA 4ZEMA 1E0SA 1ZC3A 2WSIA 2A33A 1UC5B 2FN7A 1DC5A 5AJWA 3SC2A 1XSEA 2W6JD 5CJJA 1KEUA 4NZYA 4FCVA 1OLOA 3R3JA 4G37A 4X62B 5CA1A 5IT4A 4L0QA 3PPVA 5FWYA 2BEVB 3HLTA 2G0TA 2ZRHA 1BWRA 1Q6YA 2ZEJA 4YPFA 4CV2A 1M7GA 4WK4B 3P32A 1NSTA 1NFRA 4KTTE 2LE0A 3HU1A 2C9YA 5LNK6 3A1UA 4UUAA 1IOLA 5LXTF 4BXOB 3BEDA 3NLLA 2AJTA 4RWEA 1X39A 1D6NA 1UBUS 5HNKA 1G3QA 3HA7A 4FIZA 4OFZA 1PJTA 3TX2A 2W2PA 3ZD9A 1ZMTA 4KC0A 3D81A 2H9IA 1JIIA 1XKTA 3ID6C 3V8PA 5IDXA 1WY5A 1DJLA 3V4ZA 1E3SA 2ZANA 1M2FA 4PG4A 3EFBA 4CEHB 3COVA 3LBFA 4YP0A 2P0EA 3LT2A 1JA0A 3WO0A 1VG1A 5L3QA 3HYTA 1T1JA 3NIDB 1JEOA 3A1NA 1FRNA 2V6FA 5EMLA 1NM5C 2IE0A 2MMGA 2XWBF 5EL0A 3FOFC 3NFRA 2HV8A 4LXHA 4CLXA 1AKQA 1EFPB 3G6KA 2PXCA 5JLAA 5K9ZA 3UJNA 2WB4A 2AEMA 1M2OA 3WWYA 2O5EA 1AQJA 1ISRA 3BVPA 1WSDA 3JYHA 4O4HA 3UAXA 3C3XA 1R5NA 2DY1A 2JFBA 1ODKA 1UDBA 4N3GA 3R7FA 3V1LA 3HCCA 1I5EA 4MK4A 5B7PA 3ZLVA 2XHEA 3BXHA 4JHLA 3RYCA 3COZA 5EERA 3T0GA 2R25B 3DL2A 4FQ8A 1W0CA 3VMFA 3HYSA 2QAGB 1IB0A 4WK0B 5IH7A 2BFOA 1K6JA 1PZMA 1YZHA 1ZM4A 3GA0A 4I4TA 5FFNA 3L9WA 5KVAA 2WVAA 2O3RA 1O5OA 2FVXA 2QQ5A 1P5ZB 4QSMA 4W8OA 1V2HE 4DDTA 2PT5A 5FYQA 3IDSA 1AKNA 4CKBB 4XEHA 1BKYA 4EKGA 3HCBA 2BJVA 4YAGA 1V6SA 2OB1A 3M5CA 1UM8A 2PSFA 1XC7A 2G9VA 1U0OC 3FOWA 4ZZ0A 4WXMA 2ZJ3A 5JBNA 2OKCA 2G1PA 3IAXA 2A35A 3G0DA 3CBGA 5DN6D 1XWWA 1LLDA 3AR3A 4GOKA 4KAFA 3X1JA 4Z1MD 1U94A 4UNIA 3VOAA 4MR7A 3W8FA 1XDUA 2J3EA 2JI8A 4FDMA 4F5DA 2YMPA 5LYYA 3OCVA 3ROZA 4ZGBA 1RLTA 1WUHS 4WW0A 1FSZA 3L18A 3T1NA 1NPTO 1L3BA 2NU6B 4JT9A 4M86A 4YUXA 4DV7B 1Y3HA 2VWPA 1IHOA 3EIHA 1WABA 5HBGA 1L1RA 2H6EA 3DT6A 1QGAA 3PFFA 1OZHA 4FC6A 3R0QA 5IASA 4H17A 3LSTA 5BYJA 1RXSA 1BX3A 5E4JA 3M5PA 4TTVA 1WDKA 3G0GA 4B7CA 4HDQB 1F3OA 5BQXA 4KPEC 1T1IA 3T15A 1Y6FA 1F06A 1G59A 3JAWB 4P93A 4ZKEA 1I4LD 3PUZA 2C5HA 3ND6A 2V54A 2W6OA 5CXSA 1ZIYA 2HPHA 1E4OA 4WGGA 2PRYA 3ZCTA 2XVAA 1UBGA 1GG8A 2FPRA 1G6KA 3RRBA 4UTXA 2C00A 2EEZA 3SJAA 2B25A 4P3YA 4RKQA 1PJ3A 2GGSA 1FS6A 3HBNA 2OYRA 4RDCA 3N0WA 5AOBA 1ZD1A 4RVOA 2ZWAA 5CX1B 1W94A 3BFKA 3RUEA 2BWJA 3I01A 3EAQA 4JBNA 4KWIA 5A3RA 3HCNA 1WB9A 4WN9A 1FA9A 3T3PB 3ZD8A 3UHOA 4PZLA 4BCBA 3PIDA 2YMLA 1JHUA 3A9TA 2XB6A 2XNDA 3D3WA 1C1YA 3M3HA 4OHFA 3UWPA 4BU0A 1DKPA 1QRSA 1I10A 5FWDA 4KR6A 2CJXA 3WGGA 3CWCA 3NEPX 4F06A 1AK9A 2ZE8A 1XJ5A 3G2KA 4R41A 5KJFA 3U4IA 4BVGA 1I36A 2PZFA 3F74A 3ST7A 3OZVA 2ECOA 4MARA 2O8EB 1GSHA 5H70A 3IJRA 5AUQA 4AT1A 1JWLA 1W9MA 3VX3A 1XEFA 2C9MA 2PL1A 3FPJA 2RGNA 3BRWD 4HLCA 3LHKA 4V2IA 3LY7A 1XRJA 3QKSA 4DV1B 5LSAA 1YMQA 4DCCA 2NUTB 5DBEX 3QJGA 1V7CA 3WRWA 1ZK0A 2WHXA 4I8DA 2ZTVA 3UHPA 2QL5A 2EFYA 4YWJA 5ITSA 4NCXA 1WMSA 5HK9A 5ALOA 3RK4A 1BGWA 4DSNA 3BILA 1AQIA 4MWTA 3CVXA 3MK31 1QLWA 4M76B 2A3NA 2YHAA 2X22A 5MGBA 4UUPA 4O8ZA 2QGNA 3N8DA 3P0FA 4PEVA 1SU4A 1T3SA 3NO4A 1JJIA 1NUTA 1YZ3A 1S2LA 3ABIA 1NKVA 2V7QD 2QKYA 3JWIA 2H57A 5EP4A 5DDIP 3OESA 4JQCA 3T4PA 2YIDA 3CN7A 1QYIA 2A8YA 1TD1A 1JLLB 1XRSB 5B57C 1JKJA 1TVKB 2NO4A 3KUUA 2IJGX 2I2DA 2HEIA 1LDEA 2QYTA 1TYZA 1H94A 1QHEA 3PXBA 4MUMA 3FNQA 5E9JA 2Y66A 4ZAFA 3SS7X 1P4GA 1G1AA 1OA0A 1PK9A 3UKOA 4AJPA 2I66A 2XV1A 3RSHA 1CZKA 5JZVA 1DQZA 1QCYA 4YHBA 5KYTA 3GCGA 3USES 2WAAA 2HSJA 1U8XX 3R5HA 3JQ9C 2IYRA 1J8QA 2WJ3A 1YK1A 4JL8A 4HDAA 1T5OA 4KAJA 2CCKA 4J43A 5E9WA 3IDQA 4BOYA 4F5EA 3IRUA 3SXJA 3N8KA 4TYMA 1GD1O 1W4ZA 1XWIA 5ARBA 4HH3C 4UC0A 3QNMA 4JA2A 1R0XA 3HXPA 3MLAA 5CP8A 5JW6A 5B53A 3M6WA 5AHKA 4KGXA 3ZU4A 1XZKA 3AKZA 5CXXA 1L7MA 2ONYA 3UUEA 1NW5A 2W22A 2CLLB 2XYHA 3ZQJA 5B1HA 1MAVA 1KS2A 1NY5A 1XR3A 2PT6A 2VHVA 5BMVA 3D2BA 4DYVA 4BJHB 2GNPA 3PFNA 2E4VA 4UVDA 5ALYA 1ZA2A 5AHRA 1GUDA 3VVMA 4JJFA 2VPQA 1WEKA 4IJKA 4GIBA 4PHHA 4XEUA 5L40A 3MWDB 5MFPA 1TAHA 2AR9A 1OE0A 2WUGA 3CONA 3H0KA 2YZKA 3OOSA 4DANA 4RKWA 4F1KA 1Z8HA 4M55A 2BZ1A 4ZU6X 5JARA 1JIJA 3UQZA 4E2FA 4NSNA 4G0YA 3FDFA 2VPYA 1RJGA 1U02A 3PJDA 3PT5A 1IRIA 1CUEA 1F1JA 3RYHA 4INJA 4H3SA 2VDUE 2X1VA 3BGVA 2SBTA 4JOCA 5JE8A 2YWRA 3AG6A 1T6YA 4QPJC 4DLYA 4LJSA 3I32A 1DKOA 3AWDA 3R3YA 5JO0A 2EF1A 2W6ZA 3NJ8A 4KXQA 3FWKA 2XOKA 1BMFA 2Y0EA 3BB1A 1M67A 2CNNA 2ZUWA 1E7WA 1F0PA 1HZJA 2WYUA 2IU6A 4PLTA 4CMBA 1SKMA 4EHBA 3IDAA 1RBYA 3AZOA 5TLSA 5FHQA 4R40A 2OEPA 5K8JB 4MWEA 1JXOA 3TIGA 2JHAA 4UNSA 1HXHA 2J0UB 3H65A 4K81B 2ZVDA 2I33A 1EFKA 2J3IA 1DRKA 3GT4A 4MV3A 2JDIA 2XXBA 3AHEA 3DWEX 1D2MA 2NO9A 3IQIX 2QTWB 4LHYA 1P7YA 1PGNA 4MGKR 4RGBA 2PFGA 3BWXA 1K8RA 4IDPA 4FDAA 4XGQA 3NBQA 4EW6A 1BU8A 1RAGA 1RCTE 2JLUA 2M6RA 1N2BA 3CEPB 4JCCA 5BVGB 3JAWA 4LJ4A 1JMKC 3EB9A 3WGQA 3UG6A 1AY0A 4F3YA 1Z6ZA 3Q0EA 1DAFA 4N49A 5TF4A 3BGIA 4MSUA 4DNXA 4EI8A 2C58A 1UBOS 4HFRA 5KSPA 4AKSA 1DWUA 3LVFO 4YP9A 3LYUA 4FOOA 4Y2PA 1EUQA 2XNJA 2ETVA 3DJFA 5FCDA 1A2QA 2CNWA 4DG5A 1L7QA 3NQ41 3EC7A 1MOPA 1D2HA 4PGFA 4DYDA 1PD1A 3E9CA 5HJ2A 1UKVY 4NZ9A 2AA3A 4U7GA 3SLGA 4DZZA 2GD1O 4FDLA 3ZIDA 4AURA 4ZT3A 5EJIA 5D2CA 3EPKA 3RLFA 3HE3A 3HI6A 2GR9A 3O8BA 4FFBB 2BV3A 5AW6A 1XRLA 1EBUA 1L8XA 1V5WA 5DHSA 1U99A 4ZV7A 2P6UA 3Q6NA 5IXYA 3G1UA 1VECA 2CL0X 3W4KA 4K9NA 3MTQA 2CHEA 4HDRB 2QL7A 3ZKWA 1LCIA 1EIWA 3K9BA 4I9HA 1NVFA 2JFYA 1JEQB 4WNAB 3ICPA 2AW3A 2EX1A 3QRWA 1HKHA 3RANA 4KE7A 2VK8A 4N3BA 4ID9A 1T0PA 2B2NA 5CCXA 2VBIA 2OGZA 4BBAA 1O57A 3QJYA 4KITB 1DJMA 2O06A 4F7WA 3WKDA 3I4FA 4D3YA 2R85A 3O8LA 2ORYA 3MT0A 1K7XB 3LBNA 4K6MA 5E3HA 1D2GA 3UUFA 3FIUA 2PD4A 121PA 2HW8A 4BE7B 2XJ9A 1IVNA 2ZUDA 4JB8A 5T8KA 1M5UA 3B6IA 2DWCA 2JGFA 5IJ9B 1QHXA 4YIKA 3DONA 5A6VA 4X9XA 5BXYA 4MV5A 3A9RA 3K4PA 3D02A 4G1VA 4IJQA 4YJ2B 3TNJA 3B13B 3LF2A 4B2PA 2ZR0A 3EMVA 3EGIA 1RHQA 3VO1A 3DVSX 3W77A 5DMXA 4ZU1X 1SAYA 3C7KA 1USWA 4Q6BA 4Y2XA 1AG9A 3K71B 1C9NA 3EUAA 3LIIA 3F3MA 1LZLA 1J56A 4R9VA 5KX5A 4I1YA 1LB1B 5CFRA 3AF6A 1VP3A 3FWNA 1S2IA 2ZSKA 2GTHA 2O6HA 4XSVA 4M1QA 2G4LA 2EW8A 2R00C 4YR9A 1TJ4A 2OV6A 3GBPA 3I9JA 1WX1A 4PLYA 3CH6A 4LE0A 5FL3A 4AICA 5AHXA 4AK9A 5KHOC 2MWMA 5CDTA 3ZEAA 4R0MA 2KLBA 3FMIA 5INTA 3VNVA 1KEEB 4E88A 1LW6E 2OLJA 2I6XA 3BMQB 2Z2YA 1W0JA 1W46A 1WRBA 1ZHHA 5LC1A 2V9PA 1EEHA 4BLSA 3ZOKA 3Q3HA 3BL8A 5IVPA 3FMFA 4M89A 2Z4SA 4AP9A 3IPLA 2RGAA 1GAWA 4IDDA 4R6XA 2WF5A 4HEQA 2PBZA 2I9KA 1Z74A 2FOXA 5HTKA 1OU4A 2FNAA 3AT1A 3VAYA 4AF7A 2HQOA 3PRHA 4B09A 4DBZA 2X0KA 4DDWA 4PTZA 5K0EA 3L6UA 3WLLA 2DHQA 2XQGA 4C7OA 2GZAA 1LQTA 1C7FA 5CB6A 1NIJA 3HB4X 3PWTA 3HV0A 3QOYA 2YTZA 1GDHA 4WZAE 3ROPA 2RE8A 1SVSA 1U11A 4I5FA 5I9BA 4BO8A 5IFLA 4EVIA 2X7JA 2X2PA 5AICA 2HPVA 5JH7F 2O8BA 2RHCA 1ADJA 2PU5A 3LP6A 2IE8A 3LP5A 3MWDA 3RIXA 1PE0A 1GQFA 4CDGA 3UIEA 4W5WA 1SURA 4KTVE 4ZRNA 5JPCA 2MSKA 3CZCA 3AOEA 2ZIAA 3FUXA 2QTZA 1V26A 5HKBA 1L0BA 2OUIA 3NAQA 2Q62A 1SQ0A 3LECA 5EZQA 1I80A 4G4IA 4FMDF 2H1WA 2Q50A 3UN1A 2JBAB 3VZDA 1NUSA 4IX9A 3CVUA 2NM0A 1V4VA 4DV5B 2I4TA 3BQ9A 1OILA 3BXGA 4MUGA 3NT4A 3BDIA 3WKEA 1TJ3A 1JVSA 1PD0A 2PFKA 3S4YA 2AL7A 1YOBA 1PR1A 3WP0A 4ND4A 1OFVA 2RB4A 2Y76A 2IHTA 3QP9A 3QY0A 3TNYA 1FXWA 3CRQA 4O2AB 5I01A 5KNBA 5KJ6A 3G0IA 4R98A 4KSYA 1N5IA 2YS6A 3PNPA 4RNCA 3SFTA 3IX7A 1GFSA 4TSKA 4S1NA 1UDRA 4GE3A 2HV9A 4OFBA 4GECA 3TOXA 1RBQA 2J0UA 2GK6A 4S1WA 4ERXA 1W5AA 4B45A 2B5OA 1TUIA 1WP9A 4P31A 1K5HA 2QP3A 2DFDA 2WABA 3KOYA 3UT5B 4M0KA 5EJ4A 2ST1A 3CINA 5DGXA 2JLVA 3L0IB 5I7FA 4QYIB 2O0HA 4XM0A 3OEWA 1CUZA 2IPNA 3MWFA 2O14A 3IP3A 2NSYA 1R0ZA 4OQDA 5IRCD 4NG5A 3KQQA 4YC7A 5BVGA 3B3FA 4C7BA 2AVDA 1S8NA 2XTAA 1PVDA 5FLXA 1JDBC 3H5AA 4BNKA 2R1VB 3IB3A 4RK5A 2WKSA 1N3IA 2WWRA 3FMGA 3F3YA 3GRRA 1O94A 2C5EA 4JODA 1KYVA 5E0KB 3EOBI 5BSRA 5A0VA 4NV0A 1CX9B 2X8WA 9ABPA 2IYQA 3ET5A 3ELDA 1T8UA 4JB0A 3FLMA 4ZEVA 1PDWA 4TLMB 3WGKA 4YMHA 4DR4B 4PRKA 1R0WA 3B1KA 3M2TA 2FK7A 1C3OA 1JYEA 2LBPA 5E6RA 4E5VA 1Q1GA 4FFBA 3TZEA 2HLNA 4KVZA 1UK8A 3HPQA 2VDJA 3MNFA 1VSQA 2R47A 3OPYI 5EE9A 3FW1A 4NICA 2C94A 1PT8A 3D9QX 5KREA 4DUYB 4CM4B 3U7HB 4IRMA 5ITZB 5JAHA 3Q9NA 4EMSA 4DB4A 4EKNB 3NGXA 1JEQA 1N5LA 2XDQA 2B4TO 3MW8A 5AJVB 5IYZB 1FYEA 5SV2A 3CW2A 4MTCA 1BRTA 1C7ZA 4RY9A 4JNKA 4RS3A 3WL5A 5FWAA 3BH7A 4YRKA 5BYAA 4OY3A 3AB7A 2AMVA 3PPXA 3HU2A 5GGYA 2CL6X 3EC2A 3M33A 1EM8A 1EUDB 3JQ8A 1BSVA 3PC2A 2AC4A 4REMA 4X63A 3IURA 3H9UA 2EF0A 2A58A 4JLKA 3I04M 1H2ZA 2HIMA 2PSEA 4H3KB 4DR2B 1UP6A 4WINA 3OKAA 2X6RA 1WU8A 4PF1A 3N53A 4S1OA 3FHTA 3GEIA 1E1KA 4ARBA 5KJ1A 1PZGA 2EGUA 4U9IS 4EEZA 1TCBA 1SBYA 4O6VA 1XRNA 4UVGA 1H2EA 1PJRA 3VSEA 2QAGC 3K0FA 1V48A 1FCJA 2WBLC 3DFFA 2E49A 3LY5A 3NWBA 3O4IA 2X8AA 4KO1S 4LOHA 3WYEA 3V4VB 1J0XO 5G0UA 4TVSA 1M74A 2JJMA 1DRUA 2OBMA 3MQ2A 2XTZA 3H16A 3P9PA 2OBNA 4QICA 4AZSA 1GNTA 2F1KA 3HJRA 3LP8A 3OQNA 1EFRD 4KUGA 1OXBB 1GGVA 1QHNA 1ZESA 3H2ZA 8AT1A 4OXRA 5FPYA 2HA2A 4EGSA 3ZIAD 1T2AA 2R44A 4ZEWA 1DJNA 3ZUPA 3E58A 1N8KA 2XECA 4P54A 1SG0A 2CLDX 2VFAA 3BGSA 2O5CA 3VMMA 3I76A 4XSHA 1PAUA 3ANLA 2O1EA 3PKIA 2VP9A 4K03A 3MRVA 4LUCA 1GPKA 1VGRA 4INAA 4W8GA 2GJ9A 3PUIA 3R5SA 1NMXA 4LQCA 4BWYA 1Y3BE 2OWEA 2DTXA 3NWPA 3QY9A 4KACA 1GL3A 1L7VC 1X9IA 4ITRC 3ZLJA 2VK4A 1DO2A 2FEOA 3C24A 3FUUA 3KCQA 5IDWA 2R7LA 3KM0A 3B7GA 4ML3A 1E9FA 3S2FA 1A5AB 5HRCA 2UYYA 4FC7A 4DHEA 2JH8A 1PFQA 1ZPDA 2B4RO 4J9VA 1QH8A 2QVZX 4RH1A 3WLKX 5CA1F 4RBNA 2HRRA 1GM5A 2CVOA 5K51A 5BY2A 2BM8A 1ODTC 5A5VA 5AK4A 4M9QA 3B8EA 4YGXB 3NNNA 1UCFA 2ZIUB 3AI7A 3IMEA 2AEEA 1JPUA 4HO1X 1RYDA 3ZE7A 4L4XA 2IUSA 2AWNA 1IHXA 4ZT4A 2BMVA 2JIBA 4X3OA 3SMVA 3ML1A 1DJOA 4G4GA 5AESA 1AKMA 3LPDA 1CR1A 5HZHA 1OW3B 4TVOA 1A4IA 2XQJA 4IH4A 3LXMA 1RW4A 5B36A 1KGSA 1AN9A 1XWFA 3DQQA 4RM2A 4XCVA 3H2SA 4G8BA 3TM4A 1NGSA 3N58A 2HAEA 2L82A 3PA8A 5LZ8A 1V6AA 3GEGA 3L93A 3V7FA 1YAJA 3NIGB 4ZRDA 4Q7QA 2CXHA 3PKZA 2W6JA 1J7KA 1U6JA 1XJCA 5FA5A 2JS7A 3EIEA 3C70A 1JAIA 1DQRA 1TZKA 2Q1YA 3GJ8A 4MHOA 2B4AA 2DUUA 3A58B 5CT5A 1WUTA 3HS3A 4K2AA 3WYFA 4NU5A 1BROA 3NC4A 2C77A 4M21A 3UJCA 1NA5A 4QHTA 5NULA 3UATA 2VT7A 3HBLA 1WUIS 1AOXA 3CF6R 2I3AA 2IUTA 4GZMA 4MVJP 4FUQA 4QYIA 1K0UA 1QO7A 2HU5A 4HEJA 5FHRA 3SHTA 4I4TF 3AB8A 1Q1NA 1T6BY 1NZFA 2R8XA 3BD8A 3ZHVA 4BVAA 1IXZA 2DBVO 4ZCRA 3WAJA 1WBJB 4ER7A 4GU5A 2JFPA 3G2OA 1JUDA 3TW6A 1XQXA 3EG9B 4WACA 1RXIA 4DPMA 2NUPB 3SXUB 1YQDA 3R0ZA 3O21A 4TVKA 2H1VA 2P75A 4DMUB 3JWPA 3NRCA 4CGYA 3CKLA 3PNLA 4OHKA 2R8OA 4UHEA 2VRNA 3DC7A 4WESB 4OHOA 3VXKA 4DV2B 2CLCX 1Y9AA 3EGXA 3FNEA 2IWHA 3ZV4A 3AR6A 3V34A 3KT6A 1II0A 4XCQA 1KJWA 2J3QA 5EJEA 3EZ9A 1KA9H 3FNHA 4G81A 3HDTA 4GM0A 1W30A 4RPHA 3OLYA 2R8RA 4CQMD 3NHMA 3F0TA 2OHFA 3S55A 2V6BA 1FSSA 1R0CA 4WFJA 3FYTA 5JNWA 1LRJA 5AP9A 5HIMA 4JMPA 1FX0A 1JZSA 3DYBA 4MV8A 1FFGA 3KCNA 5CT4A 4BMYA 3FHJA 1L5HB 3CNQS 3U4GA 3OF2A 3DZIA 5DX1A 4BJ6A 3MWJA 1BXGB 4IINA 3NOXA 4DJDC 6REQB 4R1LA 4Y6LA 3IODA 1I14A 2BFEA 3CRRA 3ENZA 4U00A 3SIRA 2C2OA 5IYZA 4YRCA 1ZR2A 2XJ4A 1DRWA 4M9RA 3S8MA 3VTAA 2V74B 5AW7A 1GZ3A 1MQ8B 4D0NA 1NDQA 2YMQA 3MAGA 4PSUA 4FP9A 2X1LA 4NOLA 5BUQA 2L0XA 3EARA 3FF1A 4E5SA 1SXGA 1F2TA 1EXMA 4L4RA 3A6KA 3F4KA 1TEXA 2MHCA 3WLRA 1XPJA 1TU4A 2VDRB 2Z5VA 3BJRA 1ZHOA 3PWKA 4DCUA 4DM4A 1I7PA 3GLQA 3I1IA 4QXRA 4Z1MA 3CLRD 2WIGA 1KJZA 5L3VA 4B2LA 1V4NA 3GDHA 1MAUA 1L3IA 2IUFA 3PBKA 1ULTA 2E3JA 2AR0A 3GX1A 3SGLA 1O1YA 3TRJA 4D4IA 3ZGLA 3HK2A 3EEFA 5BWBA 4OUDB 4ZALA 5BXQC 2BIFA 2DHDA 5IM4A 5KTYA 1EEXB 1GNRA 1WV0A 2RAFA 2VDQB 3DZKA 4LJRA 4JC5A 3DUWA 3STUA 4Z4FA 3DZ8A 4QGSA 2GAAA 2VL7A 3ESYA 3H7AA 4JUDX 3H8JA 4Z51A 2GBLC 2QN1A 1MFZA 1IJBA 5TS3A 2BTQB 3BSWA 5AI9A 5JSZB 1UXOA 1R12A 1SZJG 3OZFA 3KKEA 3D7RA 3LHDA 2VTDA 5D3ZA 1JJAA 1NUPA 3UMRA 3W7BA 5LJIA 1XZQA 2ZAYA 4O8CA 2F4VB 3GJ7A 4AUEA 1XZLA 1KNQA 2QOEA 3AUTA 2ORED 4OQXA 4YCDA 2QD5A 2VO1A 1B8NA 2BGLA 3FCUB 4YN3A 4J2TA 4LWOA 5D8DA 3TXXA 1U3FA 2WIJA 2GPTA 3IAM6 2HFJA 1AZWA 3VOBA 1Y8ZA 1U3GA 1YU6A 1U2DA 1VLHA 4ZVRA 2A0YA 1FK8A 2VKTA 1UDXA 3BIXA 4KFTA 3RUAA 3OQOA 3RPEA 3MQ4A 4UMEA 3CVOA 2CVHA 2B0CA 4FSDA 4YRNA 3AEUA 1PFVA 1XRQA 1GPNA 3LWBA 3UTCA 1E2HA 2BONA 3ZYCA 5DASA 4DCSA 5B2FA 4IMRA 4WOJA 5DTQA 5A2GA 1F0NA 3EVTA 3PF9A 4YJKA 4K9SA 5KKAA 1Q0SA 1RJDA 2D2XA 4UVIA 1OWOA 3R75A 1KI6B 2PRSA 2ILVA 2HU2A 3WLNA 4GWKA 4QOSA 4RTKA 4MRPA 3SXPA 3PFKA 3PZBA 5BMOA 1P8JA 4EY6A 5BSEA 4LMBA 4OB8A 3H3JA 2R7AA 4HWSA 3CHYA 3EZ7A 3BMOB 1I8TA 3IT3A 1ND5A 2JNWA 3BRWA 4UBMA 1IH8A 1SQ6A 3ENKA 3M6VA 2GDZA 4JQSA 3ZDFA 4P36A 3UH0A 2AOWA 4B9EA 1QH0A 3IUYA 2P41A 2ZIZA 3T4XA 4LXXA 1K08A 3MF4A 4PO8A 5EPOA 4YP1A 4ZVQA 1TC1A 3Q8WA 5BQPA 2UXCB 4BU1A 2KHZA 4GUAA 4UBJA 1JLMA 4A6DA 4AY4A 1P7PA 3RSCA 3THXB 3FLBA 2C88A 1LPAB 1VKNA 3I92A 5IM5A 1N78A 1X77A 3OPQA 1UXKA 3DT9A 4KQMA 3HBJA 3FWYA 4YAEA 4WTOA 3VYSB 4O2BB 4NBLA 1GL7A 4OLFA 1HMYA 5I9NA 1FP7A 1JBKA 2FN3A 5LCXA 1GQYA 3SCZA 4BMPB 5C5CA 4OMDA 2P6NA 5GM2A 1CUHA 1KP9A 1FY2A 1XMVA 3EBLA 3CR3C 2CDRA 4MMXB 1W5SA 3JYQA 4NZNA 2HA4A 1TF2A 1ZICA 1BWQA 3HCWA 1PTKA 5HE9A 3QBEA 4FGSA 4HAXA 1QX3A 2V7QA 2HHHB 3L8ZA 2M1XA 3F9RA 5JQGA 4M0MA 4JFAA 4G5FA 1PRYA 3OF3A 4YFYA 3P19A 2O3TA 5ECDA 4X64B 4E2WA 3QSYA 5DNAA 5EWJB 5EP3A 5LWQA 3G7NA 5TPZD 3PX7A 1DARA 2C3YA 2R6R1 1M2VA 1TVCA 1ZKMA 2Z58A 2NXWA 3ISVA 4IVRA 1VFPA 1Z62A 2DSTA 3EMDA 4FJ1A 5KYUA 3TR6A 2WNIA 3FCXA 3OVMA 2QL6A 4WJLA 5K6AA 3K6SA 4V1CB 1Y6RA 4Q1EA 3C41J 4BB0A 3IBGA 3E9YA 3UF0A 2J32A 1CUUA 1NN0A 4J16A 4EJMA 1CD5A 3AY0A 1E5QA 1UMCB 2Y1LA 2W42A 2F4NA 2QJWA 5C31A 3TPZA 3WGIA 4WL0A 2GBGA 1I01A 1L4YA 4PPGA 4RGYA 2PH5A 2J7PD 3IBSA 4C0AC 1NP3A 2FSPA 3OA0A 1NLMA 4WDRA 4JQYA 2ZTMA 3PZRA 3WWDA 4DWJA 4ESHA 4A8JA 4CTOA 1F7VA 2HBQA 3WK6A 2O59A 1YS7A 3ER8A 2YRFA 2H5EA 2DRIA 3GLFE 2CJYA 4URFA 4P3KA 3PE6A 4MIOA 2FSSA 4XYBA 1ZI6A 1DE0A 2HJVA 2Z5GA 3TQHA 3H99A 2D5LA 1ZUWA 4PZEA 4RK7A 4W1PA 4RCYA 3CKYA 4JOBA 1NVKA 3AERB 3E0XA 3WKBA 4DEXA 1IMJA 1RYFA 5JC1A 4KG7A 3K20A 3A06A 1TYAE 3I0ZA 1DKUA 4OKNA 1UADA 2Q5QA 4RTSA 3BYZA 2P2ZA 3DEKA 4OBWA 1OV6A 3H6KA 4IF4A 4N7JA 3L8CA 1XPOA 1MFPA 1F4LA 4IG9A 1EFUA 2XA9A 1EP1B 3GFFA 3NH6A 4RV5A 3AV3A 1DQYA 2RHGB 4RHCA 5ETJA 3RF6A 3C43A 4JBGA 4MJ7A 1AUXA 1IWOA 4X97A 1G2IA 2GSDA 2HK6A 2J8ZA 3C6KA 2JGEA 5JS8A 1EAMA 1N7IA 1EWRA 1PJBA 1VBMA 2BM1A 1UODA 1W93A 2ACWA 2GFHA 3IIMA 2VOEA 3K0AB 3KSBC 1BJRE 3MJHA 1RRGA 3J80A 3NETA 4IQ4A 4B6QA 2FWNA 2PBLA 3HR7A 2ACKA 2Q2WA 1NP6A 5ALXA 5E8JA 3FPHA 1J9GA 2ZPUA 3UAOA 4NXMB 3GH1A 2EQAA 3P2IA 4L50A 3HBMA 1CEYA 2MINB 2OZLB 3K70D 1D5CA 4CEIB 1Q95A 4W4TA 4O1IA 1FTYA 5JSZA 2ZJ1A 2PEYA 4KO4S 1WIWA 3NHKA 3P2OA 4NH0A 4X7RA 1I7DA 4URHA 1UKEA 3ELBA 3D6HA 5DKFA 1E69A 4B40A 3R7SA 5FJIA 2PL9A 1PR5A 4EHHA 2C5AA 2HT6A 2OD9A 2ODPA 2XGSA 5B1DA 2J41A 1DCKA 2OCPA 3GFGA 1BCRA 2ZXFA 1YQWA 1L5KA 4EYGA 1RKQA 2AFIB 2WQZA 1MG5A 1D5WA 3BGOS 3KYCA 5DRTA 3VR2A 3LUJA 3B85A 1V8FA 4ZYYA 3R9XA 5B3JA 2FUG1 3LQFA 5JY1A 5D1NA 1I2MA 5AM2A 1OHHD 4GLBA 4HLUC 1BXZA 3DYIA 4X1KB 4BVBA 4Y30A 2NT4A 1J5XA 3A4TA 4YI5A 1I3LA 3H5IA 5KX5F 4L76A 3FSGD 3BREA 3CPSA 5A3JA 4X6XA 4IO1A 3TAHA 4DLBA 1HZZA 1FFXB 4G0MA 2YJ4A 1GPWB 3MMZA 2PMDA 1KZYC 2BCGY 4GOOD 1KVQA 4KXVA 3KWLA 3KQVA 2VF5X 3P7MA 1FU7A 2GAOA 2BKAA 2BFNA 2G36A 4RKEA 4W5TA 5JS1A 3IUNA 1BO6A 3OCCA 2GO1A 2HCTA 2SECE 4DDUA 3P9IA 3JATB 4KIWA 4S35A 1JHPA 4KHPB 2IDZA 2YXEA 4BECA 4ZCQA 5I7HA 1NLUA 2O7RA 2W2NA 4HR7A 4NI5A 2W2KA 2JEZA 1T1RA 4XCXA 1IUNA 1YT5A 4K8RB 4L51A 3TQFA 3LBIA 3JU3A 1FIUA 4BMSA 1A2OA 3MGBA 1A9YA 1TZBA 4KVFA 3TTSA 1Z5UA 3I8XA 1BE8A 3GB9A 3OP1A 4F1JA 2XCSB 2VPXA 5CFLA 1DAHA 1EA5A 2HD4A 4FLEA 2VYQA 5TX7A 2J3JA 3G6WA 3ZVKA 1O58A 2FEAA 3H3XA 4LXQA 4OHBA 4U9UA 4M8NE 4UZFA 4BFVA 4FFOA 1W36D 2XSZD 3Q2KA 1XA3A 4HZIA 5F5XA 4F2PA 4WLUA 3JQGA 3QENA 2Y1CA 1TEZA 4R8KA 4MQEB 1JSLA 1QB8A 1YJQA 2I91A 3I1YA 2B21A 1EX1A 1Z9BA 4X8MA 3WFZA 2AQ8A 3PC4A 3RNLA 2PLNA 4RTNA 2C9CA 5T7BA 3FVVA 4Q1FA 1AJEA 3CNHA 1A7AA 4Y3UA 2O2HA 3DMTA 1HUQA 1OAOC 1SQFA 2JK1A 2VUSA 2WWGA 3H5WA 2O5RA 3K4QA 4Q3LA 4ROSA 5CK5A 2HMUA 1FPQA 3QWIA 1J00A 4S2EA 3ZI7A 1H5NA 3LKVA 4RVSA 4EPVA 1WF3A 1JEYB 3X1KA 5CB4B 4YJ3B 4BKOA 3HRIA 3O5AA 4MDHA 4O4LA 3WIDA 4FZ5A 2J85A 3MG9A 1P3JA 4JC8A 5IVKA 4OA8A 1GCOA 1FXWF 1JWAB 2ZVJA 2ZVPX 4OQQA 1UF9A 5LYJB 1KMMA 1RLOA 2AZXA 1Q3TA 3QFFA 2HRQA 1J90A 1V9SA 1WVIA 2QQGA 1RLJA 1BJKA 3ZWAA 1I6KA 3EPRA 4DB2A 3EZ6A 1YR1A 1KSGA 2XBMA 5DM4A 1P6XA 3EODA 2PYDA 3PGMA 4XKJA 3JQRA 1PEYA 4NYMR 5I8WA 3GIDA 2O7NA 4ZI7B 2WM3A 4ZXPA 4QHYA 4TWAA 5ALVA 3AERA 2QMYA 2CVFA 4ZVPA 3N2YA 3RT1A 5KHAA 3F5QA 2P9QA 1DAPA 3CA8A 2Q3CA 5EIHA 4O02B 4ZAYA 5BSKA 1Q7EA 1D4OA 2QR5A 1TVEA 4E07A 1J0BA 1D7OA 1PT7A 3BWEA 3H1EA 2AOUB 3HEMA 2GCEA 3RG8A 1JFFA 1H4TA 1MGOA 1P9RA 2IEGA 3H9BA 1FDTA 3OC6A 4HH1A 4N01A 5DIZA 5JG7A 3T3HA 2FQ1A 3AH8A 1WLSA 3BFPA 3R74A 4BFTA 5ES3A 3SYTA 3ORQA 1J06A 2XKAA 2FFJA 3P52A 1Q0HA 1WUYA 4MAAA 2RDMA 3GZ4A 4XVHA 3RRFA 3TI9A 3UHAA 7ABPA 1K6IA 4OQLA 5E1BA 3OWOA 1N2CE 4CG3A 5KTPA 1F6BA 1QHHA 1Z35A 1RJFA 1SOMA 1YIDA 3NANA 4IFIA 4JBLA 3W06A 1S8FA 4LECA 5AKZA 3WGTA 3OQPA 5AW4A 1GA1A 1TL7C 2DLDA 5KTMA 3T6KA 4KAAA 3UJBA 1EUCB 4QBTA 3P9SA 3QITA 1EX9A 5CDFE 1QYWA 1YJ8A 1JHXA 1C81A 2VNHA 4IDGA 1Z29A 4TLCA 3O3CA 4CTNA 1H66A 3UMFA 3C6BA 1YRLA 2VF8A 3CH5A 4U3JB 4WLEA 5IU6A 1LVUA 3UK0A 1Z7GA 2Y2UA 3WRYA 3DE0X 4D44A 4YAWA 4ZYZA 1AZTA 1JSRA 1VC2A 1A5TA 4MQLA 1W4AA 1CNFA 4LZWA 2VH5R 1DPGA 1GCAA 4R2LA 3F7OA 3B2NA 4JUFA 4KQCA 1GNSA 1VSBA 4ILKA 3I09A 3DNMA 4V03A 4ZODA 4Z49A 2X0EA 1GV1A 1XN1A 1OJ7A 3L7JA 4FCCA 5BNFA 3IJPA 5JI3E 1GUBA 1WQ3A 1C2TA 1TM4E 2BHNA 4J07A 4I3FA 3U7QA 4P0QB 4ZOCA 3X1XA 3T3EA 3WICA 1GN9A 4C6SA 1KI7A 521PA 1PGJA 3QVJA 3MTIA 2AFIA 4RVHA 4RUKA 1JG4A 2IP1A 4EI9A 1UXIA 5FRDA 4YJ2F 2HO5A 1P2FA 1NI5A 1YR9A 3MWGA 3KTDA 4XWWA 2X6QA 4L6AA 1YZGA 1E2UA 4QUEA 4CUZA 2O0KA 2R1TB 5IJ0B 3HWSA 1DCTA 2FR8A 4A0HA 4D42A 1DX4A 4DILA 3SNHA 4MVJI 4NEHB 5K45A 4L78A 1A8SA 2ZJAA 2GERA 1MTOA 1QFYA 4MI3A 5TMPA 2DHRA 4J3JA 2OK8A 1L5QA 4NE2A 4DXAA 3OWHA 1N8NA 1SOAA 2CE2X 2CK3D 4F8YA 3K1AB 4IAOA 5F12A 2HUNA 3Q3GE 3EJWA 1KBOA 5KVVA 1FFYA 3KUKA 4ZTZB 1KK0A 4GI7A 4Y2QA 1J42A 5F73A 5LBIA 4QGGA 4UHHA 5E95A 1AZLA 3V32A 2AXEA 2BRUA 3DDSA 3RREA 1IXSB 4UZSA 5K0TA 1IXYA 3TMYA 3K09C 3ME5A 4LGMA 2V7BA 5EXDA 1MAHA 2LDBA 5AI4A 3SE0A 2FPWA 3FUCA 1CLEA 5H68A 3S99A 4M1MA 4BGVA 4C14A 3QTTA 1QO0D 1WKCA 2DC1A 1NAHA 1OZGA 3I8OA 1ONPA 1U0NA 4Q39A 5HILA 1CUYA 1QP7A 3OOEA 1U80A 2RC6A 3PJRA 3VYWA 1EFRA 4QE3A 3KVYA 2WJ4A 1Y3AA 1HF3A 1VOTA 3EGDB 3ZIAA 1K2WA 1VKHA 1ZY2A 3ZE0B 4C29A 4LGYA 3JQAD 3KZKA 3R8XA 3OX1A 4U2FA 3GG2A 1VZ2A 1U7UA 4RFSB 1TEVA 5DLDA 1H6CA 1VQ1A 4C78A 1H85A 4RHFA 2P3SA 3SJCA 2CCJA 1FC0A 1RXCA 2BI4A 3B7PA 4G89A 5DULA 5EMJA 3C45A 2Q4EA 3P9NA 1SCDA 3OO1A 4I2NA 4IJUA 4OD0A 4UM8B 4BUJA 5CB4A 1GGFA 1P1KA 2AG1A 3GN2A 1I3KA 3L49A 3R2JA 3EVZA 5I4IA 3KSMA 1MD9A 4J75A 4JJEA 2CBGA 1GCIA 4I46A 5LYJA 2ZTSA 4ZIRA 3U7IA 2PQMA 3BQNB 2O8VA 2P5SA 4EW2A 1V3VA 2Y1DA 1SCQA 2EX0A 3IP5A 4XOUA 4EQZA 1TKBA 2ZIEA 5F3DA 2GCPA 4B7UA 1G66A 5LBUA 4CMIB 1KDOA 2F8LA 3H87A 3ZBTA 3ABOB 5ECGC 1C7QA 3BWDD 3A0RB 4RLSA 2VWHA 4X1YB 1JQJC 1SOVA 3VPXA 4BKUA 1IMOA 5BR4A 3O74A 3S28A 3IMCA 2RK6A 5JC8A 3VPHA 3TRKA 3KJIA 4MI9A 2ATXA 2X9QA 4US0R 2GEFA 2QT1A 1IZ8A 2UXDB 4ZQIA 2PL3A 4V02A 5FEMA 2IP2A 1YZFA 1ZUHA 4OMFG 3CX7A 3FDZB 1P19A 3H9JA 4O1MA 1VLZA 2BGJA 1Z4LA 4IVNA 3N2NA 4B6RA 3RYIA 2D6FA 4DR1B 4D8WA 3AK4A 4PYKA 4DCNA 2ZIXB 3N2EA 4B7ZA 3CNNA 5KO2A 2I1QA 4MPTA 4REOA 3VQTA 1T6XA 4RWZA 1N1DA 1RI5A 1EZZA 3IVCA 5JSHA 4HYYA 4NQZA 1IY2A 5DLYA 5C34B 3SVLA 2AI1A 2FJUA 2WJHA 3KHUA 3JPWA 2G72A 4IGKA 4X3CA 3I0NA 1MV5A 2GNAA 5AI0A 3DEJA 4M87A 3B36A 4EELA 4K9LA 2BP7B 1X3SA 3JARA 3IXQA 3LWZA 4IXDA 5CPBA 5LP6C 4B3IA 4WIAA 3O8NA 1E9BA 3LVRE 4AMZA 2JAXA 2ZCVA 2X19A 5L4LA 2L2QA 5HCIA 3ZQUA 3NBAA 5AVJA 3QNUA 1CR4A 2HKIA 4DY4A 2F2TA 3OE7D 1DTSA 4F84A 5K0CA 3WA7A 1QAOA 1UZLA 4ZDIA 1RM0A 1TKAA 3WR5A 3MHTA 1SZDA 2XBUA 3VPCA 2JF0A 1DTEA 5IYZF 2YNMC 3P9QA 3E22B 4M8IA 3ILYA 3ASVA 4OV6B 4ETWA 4E4RA 1OX5A 3FWPA 1RBZA 4IMJB 2WPDD 3KZNA 4A4DA 3WFIA 3DOHA 2YJGA 1IQRA 3RC9A 3NC0C 4RDIA 2CHVA 2NPIA 1CR6A 4GMDA 1ABFA 4QPNA 4IDFA 4NAVA 1JU3A 3PP8A 1G3IA 3KNZA 4KDCA 4MUKA 1HBJA 3QU7A 1KDYA 1BE1A 4TRMA 5TGTA 3WLQA 1CZLA 4KO3S 5C1DA 4MW1A 5EKTA 9LDBA 1SD1A 5EESA 4U1RA 4CQMA 1OBCA 1YS9A 1FTQA 5K99A 1PX2A 3RTCA 3ETLA 1YKFA 5J2TA 4KN9S 4KMMA 1MIOA 4NJMB 3TZBA 1AA9A 1I32A 3QU9A 4IWNA 2JJ1D 4BFCA 4CM9A 1CC1S 1PS9A 3H5NA 4ETMA 2C97A 2H1LA 2WT9A 1PR3A 5AJYA 4N0PA 1BRMA 3G2IA 4YAOA 3FYCA 1OVMA 5IC4A 3H1BA 1G18A 2BHLA 1UM9B 5CLHA 2JGLA 2Y0DA 1R88A 2B82A 4CPDA 1QF6A 1H2FA 2D62A 2H1IA 4IR7A 3P71T 1RPTA 1BS1A 2X9NA 3DPUA 4FYKA 2E6UX 4MWGA 1N2SA 4QO7A 4YAFA 4ND5A 2PE5A 1ZM3A 1J2JA 2GDJA 2QNRA 2WR8A 3FNIA 3LC1O 3PUVA 4GOND 3LC2O 4MP3A 4N39A 4AZ3B 2X14A 4B3TB 1DCMA 1SQSA 5JZOA 3K1AA 1ZI9A 3OT1B 1USIA 1O8BA 3OQBA 1B42A 5E6UB 5CNKA 1V3UA 3CE9A 4YT2A 1KRWA 2R4UA 3ZDCA 3KHSA 5FP0A 1EWYA 1FQJA 1PEAA 2IY9A 2XXAA 2P30A 5BYKA 1JAXA 4Q7JB 5JEDA 3ZD6A 1NW4A 2FOIA 4K9MA 4XDGA 4C89A 3EX7C 1XMIA 4ODIA 4RFLA 2P2SA 5F52A 3OMLA 4DG8A 1UMBB 1K3TA 4NAHA 4YV1A 3RSGA 3BZBA 1RD4A 1LDYA 2ZAMA 1RM5A 3DDHA 4B47A 2HHCA 4UHFA 3L4BC 1DUIA 3M34A 5DLEA 2PCLA 1Q50A 2JLRA 3BE8A 4A03A 4CJXA 1KF0A 2BFDA 3V1MA 2RHOA 1AHNA 1NLFA 3DO6A 3G49A 1PJCA 2DQSA 4GC9A 5KSOA 2XCRB 2D0PB 1H8HD 2PWYA 1C29B 3KJNA 4TMYA 3IOMA