3DE1X

Proteinase k by lb nanotemplate method after the third step of high x-ray dose on esrf id23-1 beamline
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de1X00
4LVNA 2ZWPA 1C9NA 1GTJ1 5K7SA 3A3NA 1AU9A 4DZTA 1AK9A 3D43A 3EE6A 3QTLA 1Y3FE 1GA1A 3LPAA 5ARCA 1YJBA 3PTLA 1BJRE 1DUIA 2W2NA 4C3UA 2Z58A 3I34X 1SUCA 3BPSA 2PRKA 2E1PA 3EIFA 1SN7A 1NLUA 4RYDA 1KDZA 3VTAA 2PMWB 4NE9A 1SIUA 4FONA 1THMA 1BFUA 1OT5A 3DE4X 1ST2A 3AFGA 1TM3E 2DQKA 1S2NA 1WSDA 3H42B 1TO1E 5CW1A 3DE1X 3WIVA 4Z2AA 2W2QA 2ZRQA 1PTKA 2DP4E 5SICE 3DVRX 1SBNE 2W2PA 5FAXA 3LPDA 1YJAA 1P7VA 1GA6A 1PEKE 2WWTA 2Z2XA 5I9SA 3EDYA 2PWAA 1SUAA 2IXTA 2B6NA 4AKSA 2SICE 4NE7A 1SELA 4MZDA 1V6CA 1T1IA 1C9JA 4BWGA 3PRKE 5JXIA 4ZOQI 1JEAA 1V5IA 4I0WB 3TI9A 1SCBA 3VV2A 2Z2ZA 3GT3A 3I30X 3BX1A 1S02A 1PJ8A 5JXJA 3SICE 5AVJA 3TECE 2G4VA 3DVSX 3VSBA 1TECE 4JP8A 1BE6A 2Z56A 3CNQS 4H6WA 1SCAA 1ZVKA 3HJRA 2PKCA 3DWEX 3ZXXA 3I37X 2X8JB 5B1EA 1VSBA 2PQ2A 3GCXA 1WMDA 5B1DA 3F49S 1AV7A 4C3VA 3VYVA 1KE2A 3DE3X 2SBTA 3LXUX 5ARBA 1Y34E 1AQNA 2P4EA 4AKTA 3A3PA 3OSZA 4DWWA 1HT3A 1NDQA 2Z2YA 3DVQX 1GNVA 4OMCA 2X8JA 1MEEA 1YU6A 1P8JA 1SPBS 3SQOA 1TO2E 3DW1X 4M1ZA 3BGOS 1Y1KE 1S01A 3DYBA 3I2YX 1Y4AE 1R6VA 5AVKA 4HX2A 3L1KA 1Y9ZA 1GT91 4GI3A 4WOCA 1TM7E 1KDVA 2IY9A 4CFYA 2PWBA 3GCWA 1ZVJA 1MPTA 1Y3DE 1EGQA 4B5LA 1SUPA 1GCIA 1Q5PA 2SNIE 1Y3BE 1KE1A 1Y48E 1PFGA 5JMOA 4HVLA 1SCDA 3AJ8A 1BE8A 4KG7A 4CFZA 3VV3A 4ZARA 2SECE 1BH6A 1TM1E 4CG0A 1T1GA 5ARDA 2W2MA 3T41A 2ID8A 1C3LA 1SH7A 1SBIA 4H6VA 5FFNA 1R0RE 1R64A 1C9MA 2DUJA 5AMXA 3F7OA 1SBHA 2GKOA 3GT4A 3QMPA 3F7MA 2XTJA 3WHIA 2ZWOA 5JXGA 1SCNE 4KB5A 3AJ9A 3ZXYA 3LPCA 1Y4DE 1WMEA 1SVNA 2TECE 1AF4A 1GNSA 1CSEE 1SUBA 3P5BA 4K8RB 1T1EA 1OYOA 1SBCA 4KPGA 3DE6X 4OMDA 4J94A 2V8BA 1XF1A 1YJCA 1SIBE 3DW3X 4H6XA 1P7WA 1TK2A 2HPZA 1GA4A 2WV7A 3DE7X 2XRMA 2WUWE 4NMXB 3D9QX 1SCJA 1SUDA 1AH2A 2Z57A 1Y33E 2WUVA 3WIUA 1IC6A 1IAVA 3UNXA 1GTG1 1OYVA 1SBTA 2HD4A 2ID4A 1LW6E 3TI7A 1BFKA 1GTL1 1AVTA 4YN3A 5FBZA 3A3OA 4LVOA 5AQEA 1TM5E 1A2QA 2QTWB 2Z30A 1TMGE 3WQBA 3VHQA 4WOBA 1SUEA 1ST3A 1NDUA 3DE5X 1WVMA 3Q40A 1TM4E 3QFHA 5JXHA 1UBNA 2W2OA 1CNMA 3DE0X 1SIOA 1Y3CE 1EA7A 2PYZA 4DJ5X 4OV6B 1KDYA 1DBIA 3DDZX 2ST1A 3CO0S 3DE2X 1WMFA 3Q5GA
chains in the Genus database with same CATH superfamily
3BAZA 2XE7A 2QLNA 5ALFA 3W5BA 2P2CA 4RD1A 1AZTA 3F5QA 4JJFA 4I9HA 3FZEA 3NNDA 3RSCA 4O02B 5IG2A 5DCUA 5KC8A 3WA6A 4F96A 2YYAA 2PL1A 5K7SA 4F21A 2J9FB 5FNVB 1TYCA 2MU1A 4YMWA 3GLFE 2WAAA 1XR3A 1CR0A 1ULZA 4QYIA 1P3JA 1TU3A 3B48A 4LXQA 3VTFA 4MVJF 2ZPUA 1V5FA 1CUVA 2BVNA 2PZEA 2GBFA 3GUZA 1GA1A 3OOSA 2F1KA 4KRYA 1MAHA 2P11A 3FZNA 3R0XA 4OFBA 5JY6A 3O4VA 1JQAA 1YJBA 2A88A 1CS4C 2NQTA 3NCHA 2FGKA 3PLRA 4I4LA 1JDVA 2O2GA 5MDHA 4BB5A 1PFQA 2Z58A 3JPWA 3IIEA 5A7HA 2GD2A 4L08A 4Y0AA 3ZTYA 1A9XA 1R5JA 5A0TA 4B82A 3GJ7A 1QBKC 4DMCA 1QRAA 1RP7A 5KSPA 1FFEA 3LY7A 3HJBA 3IS3A 1HZZC 1DXQA 4LI3X 5AM3A 3W5CA 3RVKA 3H6HA 5DLEA 4EB6B 1RRFA 4YDHB 4CKWA 3CIFA 1AV6A 1GQSA 1LNZA 2X1HA 3HSKA 3WBJA 3UJ7A 5E7JA 4EEXA 3PFBA 4LYDA 1M34B 3Q12A 4XUEA 3QU4A 5F4BA 2XNKA 3DA8A 5IUKC 2P6MA 3HYRA 1T0UA 4YV7A 5KOJA 5ALQA 1IDOA 3PVCA 1V8FA 3LQ2A 4KZKA 5ADWA 2C42A 4G0MA 3WRWA 2JGLA 1B6TA 1QYRA 1ST2A 4M89A 3TX6A 2HREA 4R9UC 3AFGA 2GTHA 1P5JA 3LX6A 4BMDA 4S04A 5JSQA 3IP8A 4G0NA 4CL0A 4G6ZA 4X7PA 3GQBB 5F5NA 4BHTA 4EWLA 3AG6A 1CUDA 3CCCA 4OU4A 4AKEA 4F6CA 3THWB 4BBAA 2YY5A 2CMKA 3C3JA 4BO3A 5A04A 2AOUA 3EUAA 3KQPA 4KPFC 2BTEA 2XGMA 1ONPA 3BOSA 2PM8A 2E4ZA 2A9JA 2ZB2A 4KE9A 4R2WA 5L3QA 3O7WA 3WIVA 2NYVA 3OWXA 4ZEMA 3PFNA 4CKBB 1XFAA 5DEOA 2O2XA 4MZXA 3WLKX 5JBQA 1UBTS 2ONCA 1UXJA 4BV2A 4GBGA 5A3JA 5M29A 4YLEA 3MTIA 4NATA 4ATNA 5FRDA 3RROA 1E98A 2WJJA 3P9YA 1ISGA 2B83A 2POCA 3BCSA 4LJ6A 2Q1XA 1LU9A 1MAUA 2X0KA 3HRHA 5LYJA 2JH3A 3SMQA 2ZUWA 4RFVA 3WWCA 5C8XA 1YR7A 2ZUBA 1RYEA 1U8XX 1VMIA 2DQ4A 2Y67A 3OPYA 5DX0A 2OECA 2PKRA 5GZ3A 2Q4BA 1NYLA 2GAIA 3LPNA 5FI0B 1UQTA 3MRSA 5THQA 2QSJA 4RZHA 5JD6A 3S44A 1W85B 4ZT6A 1Q1AA 3JVUA 2ORYA 2PTGA 2PVSA 2WI8A 3ML1A 3ZGZA 4GI1A 3DLBA 2ZR7A 2C4VA 3IQGX 3WSTA 1JLSA 4IHQA 4P08A 4P9NA 4CNQA 4F4CA 1GYRA 1KYYA 3BHMA 2R2AA 1SUAA 3C7DB 4ZAFA 1SZJG 1U0NA 2FPPA 1ONOA 4ZYXA 5AVRA 1NZJA 4DV1B 3C74A 1PKEA 3D6FA 4FFOA 3O8CA 1F0PA 1P1BA 1LDMA 4K88A 4Q05A 3SLKA 2WA1A 3KG2A 8ADHA 1LFDB 2X40A 3GZNA 4CETA 1E9VA 3HZZA 2HMWA 4I9NA 1EESA 3SIRA 1DNPA 2E37A 2SICE 2G9NA 1X7ZB 1RXCA 3K2IA 3NR2A 4W1RA 4TYYA 2H9IA 5BV1A 2ZJ0A 1A0OA 2VPPA 1JIKA 1EJ0A 1Q7BA 1E1RD 1NVVR 2AS0A 2B4AA 3AERB 2V6GA 4IQ8A 3RSQA 4EQ6A 4A6DA 1GHTA 1K5HA 3GVXA 3I1IA 1WA5A 1NVTA 2VT6A 2A92A 4MGIR 4I2NA 4X1KA 4X1IA 2O8DA 3PHGA 1PS8A 1PWHA 1U7DA 4S3MA 3I5XA 5IMBA 4ZYZA 4RZ2A 3L7BA 4TV9F 2RKOA 2X0RA 4JSTA 4FR5A 5JXIA 3H8SA 1A76A 5GV7A 3SKXA 3TH5A 3Q3GE 4ZOQI 2CKMA 3ROKA 3O90A 2R96A 1VLVA 4JLKA 1U0TA 4CLHA 1GG5A 1LF5A 2EX4A 3OVMA 7ADHA 5FOVA 4MUNA 1S6YA 2PY6A 1XNQB 2Z2ZA 4KFCA 3FMIA 2QP3A 3HP7A 3PFGA 3PL1A 3STHA 4BQPA 3H9GA 1O7JA 3P32A 3TUIC 2JNWA 4FW9A 1WX1A 3TQIA 5JXJA 1GDTA 3CRRA 2BMEA 4CCSA 4LCJA 1RWKA 1V8PA 2C5SA 2H2IA 3OJFA 1LPBB 1OAOA 2EYUA 2YDYA 1NFQA 3TE6A 2Q3DA 3H0KA 3CVXA 4IDFA 1HE4A 3H5IA 3CV3A 4PX5A 1BE6A 6YASA 1I4WA 3A2LA 1RACA 2RK3A 1DC3A 2M6LA 4B2IA 3HN2A 1A8QA 4MR7B 3WVNA 1T3TA 1Z62A 5G0TA 3IIIA 621PA 5AW8A 4J2TA 5DISB 5FV4A 1V0JA 4RQAA 4OM7A 3F97A 4KR6A 1QGED 3W1WA 5F7XA 3WLHA 5IAGA 2R48A 4JVNA 1KFKB 4GLFA 4URHA 1QRUA 2VTVA 4DPMA 2EJUA 3EPJA 1CRZA 4QD3A 4B79A 4AN4A 4MIEA 1H5UA 1MO3A 2TRSB 4IDGA 3BYZA 4FE4A 2J33A 2VPIA 5KQLA 2JD2A 3D6MA 1ODCA 2AGVA 2HNKA 5DGCA 2D54A 1KDTA 1GAQA 1PBNA 4N5DA 4UD2A 2OLEA 2P1DA 4MV0A 3DULA 1FQJA 3CF2A 1I24A 5KMGA 1ZISA 1T9AA 2ATIA 4B84A 2Q8NA 2OUIA 2Z04A 1Z4MA 1Z5NA 1GY8A 2CXHA 1W4BA 5LN1A 1IHXA 1ZESA 4IHJA 1EJBA 1LGYA 4U7HA 3F98A 5HTOA 3QPDA 2YJ5A 2XCLA 4RD6A 2SBTA 1SHLA 4Y30A 4JX9A 5D3KA 4F46A 2BEKA 1MO2A 3RVNA 3UJ6A 1BJKA 1D2HA 3K6SB 4B3GA 3SSMA 1Z16A 3OQHA 4I5GA 3ZS8A 5BR7A 1AQJA 1QV9A 3DFIA 3A3PA 4JUAA 3KSAC 3OSZA 3ZGNA 2J1LA 2X9QA 2NSDA 3PFCA 4Q21A 2H92A 3GEIA 1ZUHA 2GZAA 2QNRA 5CXXA 2E55A 2AWNA 2I4MA 4DA4A 3ZE6A 4I08A 1M8KA 1OPXA 5CDFA 3OOWA 2ZRIA 1A4IA 1DV1A 4YP0A 4UUOA 1JG2A 5AM5A 3WLOA 2EU8A 1N2GA 4IKPA 1YL7A 2OFWA 1ZX1A 1YJ5A 2XMQA 4G5HA 3L7YA 3OOHA 1RXVA 1U4OA 4YRJA 1K5GA 2B5WA 3CTPA 4D4IA 3H84A 3JZIA 1D3AA 4OH1A 3OIWA 1E4VA 3AVOA 2P69A 2IZ7A 2Y4NA 3DYBA 5ALKA 1LWOA 3PC8A 3MMPA 1N5MA 1GPDG 4RHTA 4ZKDA 4OI0A 5EWLB 2HZ7A 3FTEA 3TOSA 4DCUA 5KSOA 2FMIA 1F48A 2VZLA 2DT5A 3C98A 4RXUA 4C9BA 1KZGB 2C4MA 3ZDZB 4I4TA 1NUAA 1DX4A 1G3QA 1E7SA 3LKVA 5AKGA 3VPSA 2PS0A 2FLKA 4QOFA 2IY9A 3HBFA 2PWBA 3OE7D 4PG5A 7REQA 3ETLA 4DR3B 3RM3A 2PGXA 5TMDA 3HDQA 1KAEA 1ZVMA 2XWJI 2LBPA 2IX3A 4EF6A 5E7MA 2VWQA 3V7FA 3E3NA 4UUPA 1NWHA 3BSSA 4YXWA 4PO9A 5A4JA 1ZI6A 2J6IA 1K5PA 2DBRA 1N7HA 2X6QA 4Q34A 4D57A 3G1WA 2NU7A 3FNEA 3NVMB 4FP9A 4MKGA 1IVNA 2OQRA 4HVLA 3WLMA 3NYRA 3ZCUA 2VTBA 4XYGA 4ZCIA 3AU8A 3JVIA 1MT0A 1BRTA 3KJGA 1EFPA 3UW3A 4N39A 4E1BA 1AKTA 1IAQA 1T34A 4ZO7A 2QG4A 2EX1A 4HDMA 3T0IA 3U1BA 4AQYB 3L06A 4QGSA 3TN7A 1OZAA 3BWYA 4B75A 1HL7A 1F12A 1QH0A 4KQIA 3OF3A 4RZUA 1MO4A 2YMPA 3ZCVA 4INAA 4CL3A 4FOSA 2F3QA 1RKQA 2PUAA 4L51A 1EM6A 1V9LA 3GFBA 4HWTA 1BS9A 3ZU5A 1MGPA 1CETA 4DJJA 4EOGA 5CLLA 2O2SA 1U65A 5JTUA 3NM6B 2CK3A 4W99A 1XMPA 3CWCA 4M9RA 4PN3A 1Y9DA 1BXGA 4KX3A 4KIJA 2NTYC 1HT0A 1MJNA 3CB2A 1KBOA 3E9YA 3GFSA 4TXJA 3U7RA 4ZDIA 3G5TA 1CVRA 2Y0BA 3COSA 1SOWA 1WBJB 2ZAGA 4GL2A 2NUAB 2XWPA 1MTOA 1XCMA 3NIFB 3C6BA 5A1JA 1HE3A 4CTMA 1DU4A 2OORC 4ALMA 4IQGA 5JXGA 1BX3A 3A31A 5EGNA 2AMYA 1KVSA 1D4FA 1P81A 2XBUA 2YBDA 2ZJ6A 1H2YA 1IHPA 2BGNA 3AJ9A 2PXHA 3MOGA 4UHEA 1I7DA 3MERA 1RI3A 1QB7A 3R7BA 1SY7A 4WN9B 4YJFB 2OHFA 1Z4JA 2PK3A 1OASA 2C98A 2GWHA 3FTFA 2VNAA 1CUZA 1FFXA 3MW8A 1OYOA 1PE0A 3ETEA 1L5VA 4KK3A 4MH0R 4MS1B 5ITWA 5KQMA 5TB5A 4LRUA 3EGXA 4HGPA 2CV2A 2O1SA 1FA9A 3NTXA 2RGYA 3ESXA 3FM9A 2DJIA 4FT2A 1G2PA 1NUSA 2F00A 2J6HA 3D3NA 3FOAA 4LV6A 1HFEL 5JZOA 1W87A 2ORED 4F5DA 5KWIA 4OI1A 1YO6A 3SNHA 2ZJAA 1NVBA 4D3ZA 1DAIA 2QRHA 1M7HA 3D8BA 3DF9A 4DJFC 3QPUA 3PGLA 4M1OA 1E2UA 1L5GB 2HPZA 2VJMA 5CIWA 3HBNA 3K4PA 3CUVA 4F45A 3WL6A 4ZI2A 1QIFA 2JLYA 1GFIA 2ZUUA 3ECSA 4P4LA 4DREA 3EPPA 3BZUA 4OCZA 2P4QA 2D5IA 3LQRA 1P2UA 1EU1A 2Q3CA 3AWIA 4LG1A 4X45A 1EJ2A 3HGTA 1FLAA 1OV6A 1HMYA 2JGJA 2D1QA 3A11A 5HIAA 4QPNA 1MR3F 3KLPX 3PKIA 4HRAA 2Y0EA 3WIUA 1R8QA 4PIMA 4RY9A 4XPIB 3SJBA 4C7OA 3N2YA 1BMTA 5K8UA 1M2EA 4K40A 4TTAA 5KIAA 5C8VA 1DHRA 2FR8C 3O1LA 3KELA 3J80A 4R1OA 3ZZTA 4AJIA 2FEPA 1XDDA 1OZFA 2V7QD 4V0RA 2EEZA 3PC6A 3Q2KA 1CUFA 4INPA 4TWJA 5HZHA 3LBFA 5KHLB 1FJXA 3ESCA 1HC7A 1YRYE 2HUNA 2SKEA 3BGDA 3KUXA 1BSVA 1EH5A 4PX3A 3FY4A 3L0YA 3G0DA 3DCIA 2FHPA 4JITA 4LJYA 1USUA 4C29A 1IXYA 4YV1A 4BE7B 1XP5A 5K1ZA 4ZZ1A 1DZ3A 4IH4A 4BLSA 3VXKA 1FYWA 4LQCA 4CM9D 2CBGA 5A06A 1A9YA 2VZ9A 2IVZA 3I04A 4RDHA 4ALKA 4BQQA 1Z26A 3PD0A 1NW9B 1X6VA 2YCLA 3F5DA 4J1TC 1YTUA 1RNLA 3RYHB 2B7BA 3WQQA 4X90A 2OMEA 4P5EA 4M6WB 3RT9A 4Z4FA 3KSDO 2UYYA 1VIVA 4RK7A 4RBNA 1K8QA 3NT5A 5EYPB 1ISMA 1J09A 3M6XA 4GOXA 5MF6A 1F8GA 3F90A 1IBCA 2XB8A 2PU5A 1LJUA 2A9PA 1S1MA 2O57A 1WXIA 3LT2A 4IX9A 4L07A 3S2EA 4EL0A 5KYUB 3BXZA 5C35A 3JY6A 1BEUB 1R1DA 1YMUA 5I7OA 2JH8A 3KT6A 4KE8A 3DKRA 1JDSA 2PPLA 4QU5A 3WGNA 3TL2A 1T3HA 1FDSA 1UOOA 3EQ8A 2JZOA 1IHYA 3G2PA 3IKMB 3CN7A 4DSNA 1KYXA 2VKTA 4M86A 2AH5A 3M6FA 1DWPA 1T5HX 1CDEA 3N2EA 2WUEA 1LD3A 3BXXA 4FMDF 1LWNA 3OO0A 3D4OA 5L6LB 1Q57A 3I2FA 3LKDA 4LJLA 1ESMA 3E7WA 4AJNA 5DNAA 4ZO4A 2C7OA 3DV0A 3KXKA 3EIQA 3EXEA 5F76A 2NUBA 4Z4QA 1U9IA 5FH9A 3KK0A 3U48A 1WS6A 2C31A 3FNBA 4F8EA 4X6UA 1T3GA 3G8AA 1IBMB 4HV4A 1ZMTA 4B0OA 5ITSA 4C89A 4JBIA 3OOYA 1SEPA 2BR5A 4TZKA 1X3SA 4IZHA 1JHRA 2NVWA 3KEQA 4ND6A 4DRYA 1JEQB 4TSKA 3WO1A 4DRXA 3R7DA 5BWCA 5LOVA 3TINA 3T4PA 2B2CA 2OM6A 2JBWA 2ZULA 3ENQA 1T1RA 3DZFA 1PFKA 1FTSA 4Y7CA 2WHXA 3NCTA 3QWHA 2DWOA 1IXZA 2OO5A 4GAEA 2FF7A 3CJTA 2K7FA 4ERNA 2EGUA 3TIFA 5JYDA 1D4AA 4OLHA 5EI5A 5FL7A 1HT2E 3MMXA 1Z0DA 1VHJA 4NU5A 2PT7A 4HCJA 5JOQA 2HSWA 4BRUA 1PWEA 3M5CA 1AKWA 2AOTB 3NZEA 4H15A 4L5YA 3VYUB 2E85A 5IABA 2WZCA 4V3CA 1ADFA 1EFCA 1Z39A 2HWKA 3HR4A 1LBQA 4LV5B 1T5SA 3FR8A 2FW6A 3Q11A 1B6RA 1D5WA 4RMGA 4WLNA 3V1TC 4BKQA 3ACBA 3C1AA 3HS3A 4YACA 1H23A 3QELB 2I2AA 3AY3A 3I6IA 3SZRA 4BKMA 2P4HX 2VDUE 1ZR4A 3PUIA 1C3VA 5EKUA 3KSMA 2YWJA 1AKYA 2Y0DA 5IZCA 2A9QA 3M4YA 3P2YA 2XGJA 4C06A 2GF9A 1JQJC 4US0R 4FZ5A 4PR0A 1WPRA 3NGLA 2OPHA 3PXDA 3QV1A 5KJ1A 1O3YA 2VUSA 3ZWYA 2P0EA 2BI4A 1FFCA 4OI4A 4OIFA 1BXZA 4FE3A 3KPYA 2X9VA 4WVFA 5CD9A 2HYIC 1H2RS 2AG8A 2ZPTX 2XUJA 3PQ4A 2I34A 4PSVA 4CU2A 5ENVA 5GOTA 3Q7QA 4D8VA 1SXJB 1XPJA 3E0QA 2WVHA 4DXDA 3CUUA 3QBJA 2X5XA 5P21A 3EBOA 3NP9A 3JZFA 5ESDA 5G53C 5H7XA 5NLLA 3HXLA 4NE9A 1G7RA 3TW0A 4B6GA 3PV0A 3A1TA 4IICA 2GFHA 5IBRA 2JLUA 5LIRA 4JB3A 3H2GA 2XEDA 5FBHA 1DG1G 1KMHA 3L2OB 2EFEB 1AS2A 3ETDA 1WLYA 4UFOA 2MTBA 1DRUA 1R18A 4GXQA 1C3OA 1NVWQ 3HCPA 1MV5A 4UU8A 1NNSA 4RHYA 4DLYA 4Z1OA 1Z75A 1AUOA 2QLBA 1HYBA 5KU7A 1RWOA 2FMKA 4RF3A 1PEYA 1U7XA 2D5BA 4PEVA 2WG0A 4IOKA 4D26A 1HYQA 3U7HB 1VBKA 2RAPA 3GROA 5B1IA 5AVUA 2W6MA 2YIMA 3DTTA 1VMAA 1N2EA 3VDRA 3QKUA 4GOKA 3ZLJA 1TO1E 3MRTA 3HCWA 1NP7A 3OZSA 2C9CA 3WGQA 2ZZKA 4O29A 3L5KA 5BMOA 2WJZB 5LBUA 5TQ0B 1VFPA 1KXZA 2SHKA 5F3DA 3R6GA 3FPKA 3QLVA 4GVLA 5ICMA 2C7GA 1MC8A 2IYAA 2WPDD 2JLBA 3HZRA 3IDQA 4FKZA 4KQ1A 4RPCA 2BGUA 5SZJA 2JGAA 4A8JC 4RPKA 1D07A 1WDTA 2O2DA 2FN8A 3TTSA 3IB3A 1DFHA 5FUVA 1LXCA 4KKVA 1U02A 2DHQA 4JSYA 2MT9A 3A1SA 1L5OA 1YA8A 3PSAA 4XR4A 3HJUA 4L6AA 3ROQA 1TJPB 2BMAA 4BMPB 3QY0A 2NTNA 1FFSA 5EZYB 2RGRA 2O2YA 4N9QA 1C41A 3NHUA 5F64A 3H83A 4RJKA 1U5CA 2CMDA 1FJGB 5DYWA 3IAAA 3QP9A 5CH8A 5CP8A 2P2YA 5FX2A 4LSGA 3ZIAA 3BMNB 3R3YA 1OYYA 5TQVA 1KR2A 2Z2XA 1P1HA 3RWOA 4DA6A 1KEEA 4IDHA 4I9GA 4DV7B 2WWYA 4KACA 4B7ZA 4R71A 5F33A 2VS1A 4H1UA 2FSUA 2W6NA 2H63A 1KEZA 4R5HA 4MK4A 2E7ZA 3DC2A 5C8YF 2B6NA 2IA5A 2QX6A 3HI6A 2Z09A 9GPBA 2CT8A 3P9ZA 3QKSA 1TTTA 2W43A 3JRXA 4IHJF 3EGCA 5D1NA 2H1SA 1B26A 3USES 4I66A 2ZK7A 2Z3WA 3FKSD 5ED0A 2HTFA 4EENA 1E5XA 1QXSA 1ZL2A 3EWAA 4AIRA 2X6RA 3OLVA 4GRDA 2CNWD 4NVRA 3ZCSA 2Z6VA 1PUIA 2W2VA 4RUKA 1J00A 1XZKA 1VPWA 4BXOB 2FLVA 2H16A 1EXDA 2YHBA 3L7CA 1J5PA 2PMCA 3PR1A 1F4VA 2AYZA 3DLAA 4LCEA 1LQ2A 1FNMA 2CXRA 3JAKB 5CYGA 3B85A 5IU6A 5JAPA 2PUDA 1M6WA 2Q41A 4JNKA 4LF6B 2O9JA 1S8FA 1L7RA 4FDUA 2GXUA 2YHAA 5C80A 3Q7IA 2EERA 2YASA 3GPCA 1KVUA 3DJFA 4J94A 3UYKA 2AE1A 1ZVQA 3KKKA 3R5FA 3JWEA 5D6OA 3VU3A 1AOXA 2QL9A 3LU1A 4PGAA 5JSZA 3PITA 2XRYA 3QFTA 4MJ3A 5AXDA 3ZYCA 2FMFA 5DOZA 1FUUA 3GUCA 3LUFA 3ADKA 4FYHA 3SI7A 1CFJA 2N46A 2B0JA 2QV0A 1BEEA 4LN1A 1DGQA 2P2GA 1QH1B 2W4QA 1WV1A 2WDPA 3UJAA 2NU8B 3LCJA 3CNOA 2DE0X 2ZJ5A 2AX4A 3RFVA 3AVQA 4RTQA 2QXYA 1X7XA 3EX7C 3DWIA 2PMKA 1Z3CA 1MTZA 4OYRA 3EAGA 4MQFA 1YKSA 1GGNA 1VKOA 2EIXA 3Q0TA 2YN0A 4Q1DA 5JSHA 1EWRA 4ISBA 1V11A 1IEWA 4GHWA 2FQ1A 4LWPA 4WY5A 3H9JA 5E2AA 5TQ2B 3U80A 1JSZA 5JDIC 1VGVA 2C97A 3I32A 3TRDA 4JI2B 2QJFA 2F9LA 2N47A 3QVWA 3TLGA 5CG1A 1O6GA 3H2ZA 4JL6A 3W5HA 1RABA 4F6RB 1YF3A 2J3LA 4LZPA 4ZICA 4O4HA 4BPRA 4X44A 3IQDB 2IXDA 3ENVA 5KQGA 3JQ7A 2AOTA 1TEHA 2CF6A 2OBFA 3JD1A 1GLVA 3OQBA 4W5WA 5COBA 4KREA 2VP3A 4F4FA 4H3KB 1PR1A 5TPZD 1ZVKA 1VCIA 3F0TA 2AOXA 3UJPA 3BERA 4UEKA 1VJCA 1Y3AA 2V6FA 1A72A 1RLJA 4HH0A 2PRYA 1XJ0A 4HJRA 5JJLA 3AUYA 1LSOA 3SVTA 4C03A 1KZ1A 4NJEB 1HTWA 1WQ4A 1N8KA 3MSXA 1CZHA 1P0FA 3AWDA 1VSBA 3SBXA 1FUIA 3DKPA 1JHAA 1RTKA 5GMOA 4MWSA 2Y0PA 3E9QA 1XZ8A 3ZY2A 4QREA 2FEOA 4CL2A 5TVGA 1KQGA 2DEUA 3GLHE 4CNBA 3K70C 4WGFA 5CFRA 1YKFA 2VK4A 3NRJA 3SK0A 3K5PA 2BGLA 2H48A 1KRWA 3S1SA 2BI7A 2V7WA 1DS6A 1N9ZA 4YFYA 5K0LA 2BMWA 5U4XA 4OLBA 4ID3A 3AR3A 4LGVA 5DWQA 3DZHA 5CLHA 4URVR 4L8YA 4CMAA 3AF3A 1MG0A 3IJRA 1VJ5A 5ARBA 4EARA 1F6WA 2IXEA 4E21A 3ICOA 3HA7A 3OQ6A 1W25A 2J0UA 5AOVA 3C3AA 3I1JA 2CSUA 1N5JA 2IP4A 5H3LA 1SQFA 5JSYA 3UG7A 3KVVA 4CTOA 2XT0A 4IYJA 3GN1A 1C2TA 1CULC 5EUBA 1O94C 2ECKA 1DJPA 2XJ4A 3W0LB 5ED4A 2H5EA 1PNOA 4UU1A 1BKSB 1CDOA 1TKRA 2YXEA 3IBCA 3KB2A 1T1JA 4NCNA 4QNNA 4E70A 4M3NA 3L4JA 4C7VA 2JK0A 3PXGA 4A3SA 3LC1O 3AEUB 1Z07A 2R97A 3GEEA 2BGMA 4PLZA 1G55A 2B94A 5FHRA 2I6SA 5AFSA 1BVRA 1XTPA 3DW1X 1PYDA 3FDJA 1NNI1 3K71B 4IVRA 1G59A 3KU1A 4GXNA 4O8CA 3VR6A 2QM8A 1REQB 2IYLD 4QFDA 2EKLA 3HKBB 2P6NA 1GCUA 4K9RA 4YHBA 5JYBA 1ISHA 2ZCUA 3ONNA 1TCBA 3DR3A 1T9ZA 3EY9A 2VJLA 3DJYA 3H9CA 1GT91 5B7QA 1P2GA 4XQGA 4FZRA 3IHWA 3TZBA 1DP4A 4BLUA 1KI3A 2AJBA 3VO8A 3TZ6A 3KXDA 1QAQA 3QFRA 1RLUA 3ABOB 1EHIA 1RHKA 3SF0A 4B5LA 2A3NA 4ZEOA 1E2LA 3TRKA 1DEOA 1XBTA 2IIBA 1NMXA 2PBZA 4OK6A 5TEWA 5IW8A 1XYGA 2Z2JA 3TW6A 4EUNA 4UAJA 1OIXA 4OKSA 3T7CA 4XA8A 3RC2A 1CPYA 3VJLA 2P2ZA 1BCSB 1U8AA 3LNCA 4G23A 2HRZA 1SCDA 4MQBA 2I4IA 4F3NA 1YNOA 2PYDA 2OFXA 5IXSA 2RGEA 4N0PA 1D6JA 2I1WA 4JMPA 5JFOA 4UXJA 1Y8CA 4MITA 2V3CC 2J30A 1DCFA 3DGEC 4AIIA 1F8YA 3GRFA 4QQFA 1G6KA 1KVQA 4H18A 1BDMA 4WY2A 2RBKA 1IMOA 1IK6A 1JHVA 1TM1E 2DR0A 2EEPA 2QD2A 2WD7B 3C7KA 3L1VA 3P26A 4WX2B 4W5NA 5KYWA 1XEWX 1ACLA 2PUWA 3OX2A 4JAVC 1WPGA 1SKAA 1ND6A 1PBTA 3IPAA 3B52X 1L4MA 3QK7A 1JRLA 2OP0A 3V4VB 3P20A 5E1MA 4A23A 1JR3A 2EFGA 2QVBA 4KFTA 1M74A 1KI2A 1P1JA 2QTCA 4QG3A 1TFRA 4LX8A 3THXA 4XFDA 5EVCA 2R7AA 2X4IA 2DCUA 3DEZA 2CGEA 3O94A 5FEUA 3M49A 3WYBA 2B36A 3KR2A 4XWGA 4B8ZA 1CK4A 1F8UA 3GDOA 3MBKA 5AMXA 3ZJVA 1GPWB 2FNAA 2R7MA 2XF8A 3CXUA 3ECCA 3C41J 4QDOA 3VKGA 3PQ8A 5TT0A 1ECLA 3VKHA 3HJFA 1Z36A 2IXGA 1B0PA 1ZC3A 3FJYA 4FLFA 3G23A 4G5FA 4QZVA 4J43A 4B7AA 4HLQB 3MXTA 2EOAA 1ESZA 1NW8A 4ODIA 2AEFA 3MWJA 2Z98A 3I1FA 4JJ4A 4G0QA 1E3IA 1YK1A 4UDYX 4ARIA 4BEBA 1DKRA 1X9IA 1YB1A 5IJ9A 1EGHA 1ZKDA 2A4MA 3TTYA 2XHZA 4TXMA 5CNKA 3W1VA 4CR7A 4DIUA 4BVHA 1G17A 4LYYA 3SHTA 3BWDD 1T13A 1JH8A 3ON5A 5AHWA 3UK0A 1H4QA 4ZI5A 2I0FA 4H1HA 4AS1A 1SO8A 1QNLA 1E7MA 4G1MB 2FSPA 3RU7A 1E7WA 2CHVA 3RGWS 3BTUA 2ZQ5A 3EFEA 2X4DA 4RNDB 1GNTA 5K2MA 3UAGA 4C08A 3ND9A 5H59A 4UVDA 4RKWA 1L4EA 3G49A 1UDBA 1P45A 1SULA 3DMDA 1W1IA 3EDQA 1USVA 2O4CA 4GGOA 5BN4B 3WHKA 4A92A 3NV7A 2HQOA 1PQYA 3LP8A 4HBZA 2PHZA 2QSYA 1JQLB 1QHHA 4Z0HO 3GCGA 3ROFA 1RQ2A 2BY4A 3A6FA 3LGSA 2IEZA 3GLSA 1P7WA 4OB6A 2ZYSA 5SY6A 4CM1A 3KD2A 3BKWA 3G88A 5LOVF 1XRSB 3CZAA 2CBZA 2QN3A 4C0WA 3OO1A 2DERA 3DE7X 1Q44A 4AZWA 3O47A 3ZDEA 1E2NA 1C1YA 1DQNA 2WSBA 2IPOA 5AOBA 2QU8A 3WL8A 3ITDA 4AZ3B 4L3WA 3T5CA 4N3NA 3SC4A 3AESB 3RB8A 1CUBA 4JS0A 4F38A 2Z57A 1RIIA 3KWJA 1JMYA 1ZSNA 3D4NA 3BE4A 4JASB 1DJOA 3T4XA 1OWNA 1XCPA 2VOJA 2VTKA 3PIRA 4WGGA 5DDIP 1RAFA 1LBSA 4D4JA 5AVWA 2YJ3A 1P0PA 3PQ2A 1RAEA 1SG9A 5I7AA 5IC5A 5CITA 5IYZB 2BYTA 1GUZA 3IUPA 3T7AA 2VBCA 4H77A 5BYAA 5KTKA 5HQJA 2CL5A 2Q3HA 1JFTA 3F4BA 3HMQA 2EJTA 5DNCA 4FYVA 3N58A 1JZTA 1YB6A 1HEYA 3Q15C 2XGSA 1IJKA 2HIHA 1U0BB 1ZGJA 2C0QA 3GG9A 1AH2A 1N3IA 5BV7A 4O2LA 2HC9A 4C43A 4JLWA 2C92A 2XMZA 5TC4A 2XA1A 5B4TA 1RHQA 2Z3VA 4KXVA 3DBRB 4F97A 3KJIA 4URZR 2HCFA 1LNSA 2AG0A 2FW9A 2DFTA 2J45A 3PNSA 1IB0A 4LJ8A 2UUOA 1PJZA 4Q1VA 1EQAA 1WCWA 4H7HA 2JHPA 3RS2A 1NW4A 3E7XA 5K2OA 2HLPA 3K31A 2IF0A 5CVDA 4H1WA 1I3LA 4PSDA 1PI3A 4L6IA 4WA8A 3TVYA 5A5GA 5KSZA 3ZEAA 3ZH9B 1RWBA 2FFHA 4P81A 2W48A 4XKJA 3ZNPA 2AZXA 4LX0A 4DFDA 3MGCA 2ZM6B 2PFKA 5JEEA 2UYHA 4BZZA 3ANNA 1BHJA 1ULBA 1W48A 3HEBA 3HU1A 1UDAA 3E8XA 4NYJQ 1REQA 3V97A 3GEPA 4KMMA 3WOVA 5BR1A 4WBXC 1R12A 4YP5A 5HKKD 1YB4A 2AKYA 1NSFA 4GBED 3RTAA 3WGLA 5TR9A 1DEHA 1X9GA 4GDMA 4DC0A 1QS0B 2B4RO 2D13A 4MRMB 2CFOA 1TT5A 2FQQA 3TLEA 1QWSA 1T2EA 2EFJA 1H5NA 3F5MA 3G8CA 1JFFB 3K4QA 4OP2A 1L5LA 1T43A 1KK2A 1EE2A 1TXGA 3FGPA 1T9KA 4N8EA 4QBFA 4DUZB 2HW8A 1Y81A 1XQYA 1WUTA 2QTBA 3KOOA 4IVQA 3AJDA 1JW9B 2GPBA 2X8AA 2Y4OA 3Q8WA 2XNSA 4JDPA 4RK5A 1GAXA 4FLEA 3ORSA 1KAHA 1IE3A 1U8UA 1N5IA 5CB8A 4R01A 3Q7SA 1P60A 4NJMA 4M1MA 3GZTB 5BSEA 1ZH8A 3DEKA 3L4BC 4DA7A 3E9ZA 5AW2A 4A2WA 3UEOA 5F4ZA 1P91A 2I3AA 2QROA 4OV6B 5J47A 1SBQA 2P6OA 2JIBA 4TKLA 2A9VA 3OJCA 1OLXB 1FDWA 1QZTA 1XYYA 3CO0S 4HLUA 5FQOA 2O59A 3LY5A 1J06A 2FPRA 1QGAA 3KTDA 4N8SA 4NULA 4NH0A 4F3YA 2UZ4A 3M9WA 3WRXA 1R0KA 4DL9A 3FYUA 3BIWA 4L50A 1TYZA 2AN5A 2ZCVA 3M34A 1P9WA 3WQRA 2VK8A 4AMBA 5LNK6 1Q3TA 4MTCA 4RXMA 2CJYA 4O0MA 3V5NA 4CBVA 1QG6A 1RJEA 3ZDCA 4S1TA 3WK6A 2EGGA 3IE2A 3LCVB 2PUVA 5IEBA 1XXHB 4TGLA 1W4AA 1RPJA 4CF5A 4MCHA 1QE0A 1P7YA 1S7GA 1TCVA 1V16A 2NVOA 3HFSA 3KOYA 4WZAE 3RJZA 4NMMA 1BJRE 1OI7A 3RADC 3AIKA 2BFOA 3I34X 1SUCA 2CBXA 2XTMA 3IEUA 5D2CA 5EJEA 2H9AA 1TIPA 5K3EA 2Q4EA 3JD4A 4A5OA 3DEJA 1SN7A 3IUEA 1U2GA 3HCBA 4J0DA 4M1TA 1QWOA 4Q4HB 1XCJA 2PKEA 3BDVA 4V1CI 2R11A 2VRNA 2GYUA 2CD9A 3BG5A 3CG0A 3V8QA 4GOJA 1UDCA 2HIMA 3C45A 4Q7KA 4RVHA 4KXNA 1IK4A 3C6ZA 4B9EA 4EVQA 1QCDA 5KREA 4JR1A 3UWOA 2W6CX 1FZQA 3B78A 4MR9A 3IESA 1LBEA 1TU0A 2ZYHA 5BN5A 1O87A 1T5TA 5FO0A 4XH9B 5EWMA 5KC9A 3U3KA 1VSQA 1UODA 3KYDB 3GJ6A 1ULHA 2OWDA 1BOFA 2VIIA 3AQIA 4L5JA 4NXNB 3PZRA 3DAPA 4BP1A 5KTSA 4HS9A 2GX6A 5HXAA 1E1CA 5JYCA 1AMNA 3K05A 4TYQA 1S2NA 3T34A 1WSDA 3OC0A 2YW9A 1TAQA 4OGFA 2DWUA 1E4YA 1KFBB 3R3WA 1M0WA 3E15A 3G5AA 4MUFA 3RS5A 3NHKA 2J3QA 3OKAA 3PRYA 1PHRA 4W5HA 3PHCA 2VPTA 1L5MA 1QYVA 4WIAA 1XIVA 4IV8A 3NFYA 2E89A 1QO7A 2P3LA 1H1DA 2GPJA 2I80A 2QTLA 4YCAA 4BZQA 2P6PA 1P0CA 4PGHA 4FNAA 5A6SA 3FLAA 1E7RA 2RK6A 1QRSA 1WO8A 2LRHA 2FUNB 3MT8A 2QGNA 3JQEA 1WCIA 4DILA 4POAA 2OYRA 3RWMB 1Q1BA 2PZFA 4CXMA 4O6VA 2PPVA 1MLDA 1L7MA 2W6QA 2OSBA 4RTNA 1N8TA 2GPSA 3N75A 3R0QA 4P8RA 4MYHA 5LLDA 3OD1A 1K2VN 1SJ9A 5C1PA 4DDMA 1E1MA 3HBJA 5JZMA 4TL9A 4JQYA 1ULSA 3E5HA 5DWVA 4DADA 3GF4A 3FIJA 2Y1KA 1ZICA 3NHRA 3T7JA 3IT2A 1FNCA 4AYWA 3TSAA 4EPTA 1J8YF 1X0VA 2BFBA 3CZCA 1W5FA 2P9BA 4IGIA 2WWRA 4DEXA 1FP1D 4G1VA 5T3UA 4D97A 4Q9IA 3PHIA 1KWKA 1T3ZA 1IHOA 1JEEA 4TRMA 2K4MA 3AM5A 1N9GA 5FTJA 5MFPA 3G0BA 4B47A 1ILWA 3AC0A 1KJZA 3DBRA 2Q1WA 3EXAA 3MMZA 3NBUA 1UANA 4B6FA 2BPOA 3T1HB 3S70A 2W9XA 5KS2A 4ZOEA 2MDTA 3O8RA 1OSNA 5DN6A 3UANA 1G8SA 3OTIA 3R0IA 5ALTA 4PG7A 2FP4B 1EK0A 1OKKD 3NONA 3TQHA 4K9NA 4EMTA 1VG8A 1LPAB 1GV1A 3IVXA 4XJSA 3DTVD 1LLDA 1NF3A 3F6EX 3OESA 3ZBPA 4BBZA 2VOEA 3R0ZA 4KUHA 2ZSKA 1LDBA 4O2BF 3SY8A 1Z56C 3Q1LA 5CB4B 1GSHA 1H22A 3CZQA 3E48A 3O7MA 4KDFA 1DMSA 3A6HA 3K20A 3A6PC 3AL2A 3NTLA 2XRZA 3HQ4O 4TVBA 4UHJA 5BYKA 4JJAA 3IIMA 2RHMA 1ZD5A 4CV1A 4QDXA 3E3AA 1G8YA 1YBHA 2HF8A 3FGNA 3UHPA 2FSFA 5I7VA 16PKA 1JWLA 1Q7RA 4R40A 2QDKA 3TTTA 2GN1A 1QS0A 1CY2A 5DNVA 4B4KA 3OM0A 3QBDA 1PJRA 2Q3LA 3AHJA 1ZUNB 3FDIA 4I6GA 3EPKA 5BSMA 4D6PA 4C4TA 4C6TA 2BHTA 2FUG6 1DDIA 4ZI7A 2DWPA 4DJAA 3P0IA 1V5GA 4E7PA 2XODA 3ZV3A 2QBYA 3BE8A 3U0BA 3VC7A 2RHDA 2BEJA 2IY8A 3FSGD 3LUGA 2BL4A 1PS0A 2G4VA 3O9MA 1FX1A 3WWOA 2EFYA 2HDHA 1J0EA 2HLDD 3FHCB 5DHTA 2W98A 3GC6A 4KBFA 5FWAA 5L3RA 3AFHA 3JW8A 2CVPA 2GNPA 1DPFA 2BH9A 4L76A 4LZNA 4M9ZA 3VNQA 4YYZA 2ZLBA 1NI5A 3ICCA 4YK7A 4QIHA 4XJXA 4UKDA 3PNLA 1M0TA 4FMDB 3PNVA 4I14A 1JDUA 3O9ZA 4RETA 3DMTC 3F6PA 4YMLA 1XAGA 4U3JA 2XYHA 3RIYA 3ES9A 1GCOA 1VJ0A 3LQYA 3QVXA 1K6MA 2F48A 3B5IA 3BMCA 4OY3A 3SF8A 3AMVA 2GM4A 4JVMA 4ND8A 4B81A 3W5DA 4P22A 1E9AA 1QHXA 3DBHA 4MCAA 5CDHA 1Y89A 5FJJA 5D7NA 1JR2A 1L8OA 1JTEA 2X9NA 3HJRA 2YMQA 4MWZA 4XGQA 5EFZA 4D8WA 4U7GA 4CLOA 2RMKA 2VUHB 2OR3A 3KQOA 1HE5A 2ZTLA 3M1IA 4G67A 2I3BA 1W9MA 5LJIA 2NQ2C 3DOEA 4QDKA 2IC5A 1Y4ZA 2VT2A 3BK1A 3MAAC 4R2HA 3WDMA 4B87A 1DX9A 3R7WA 4QHSA 3LE8A 3PFKA 2ESRA 1D7AA 3VYVA 1R5NA 1Y7IA 3WDKA 2OMKA 4MEAA 3QVSA 4PHTA 1YB5A 2BP7B 2QRPA 3D7LA 1KDPA 3OFND 4ZOLA 4Q48A 2A5LA 3JYNA 5FUWA 3P52A 3BMOB 3BMQA 1ZD1A 4R8MA 5DB4A 4ZOCA 3TRFA 1Y7HA 1ETHA 1BO6A 3ZTTA 1EMDA 1Y34E 2OVBA 2QR3A 1C0PA 5FUMA 4YCDA 3RUCA 2CLOB 4RY2A 2XNDA 1YTLA 5FTWA 2Z2YA 2FEXA 4QOHA 2O8EB 4FS8A 3NGXA 3JQAA 1J70A 2E2WA 2ZBRA 2DBZA 1XQ9A 1NRWA 1G9TA 4J8PA 3BL8A 3WGMA 2APJA 3PFHA 2OGZA 4HNSA 3LV8A 3LZ6A 4FEAA 4P7GA 2O5EA 2OBYA 4YX9A 2GF0A 5A4MS 5I4CA 1BXRA 1ZZEA 3TIIA 2R2GA 2X19A 3RK0A 2G9QA 2P9YA 2PKYX 3QOFA 2A5YB 4RFLA 4XIJA 5CK5A 3M9XA 4OBXA 1UKCA 2HKIA 4DDUA 1DO8A 2VJNA 1DKOA 1HG0A 1JKFA 1S2LA 1F2DA 4K6CA 5B3JC 5AHXA 5K09A 1OQAA 5BVHB 4WDRA 2ZVPX 5C5CA 1SMKA 2JLRA 1KDRA 3MWLA 2Y27A 1QQAA 4Y2GA 1J39A 2PZGA 5GWXA 1KDVA 4ENVA 2HK8A 3EIHA 1J0AA 3DGFC 3TZKA 2REXB 3E6AA 3A70A 3DKKA 3P4YA 1LC0A 4WH0A 3HR7A 5IYZF 2FPWA 5I8PA 2V59A 3KT8A 3IJEB 3V4FA 4C1BA 2EBFX 1UK9A 5KYGA 1BDIA 2PUFA 4XXHA 2CCJA 4LRTB 2XT6A 1U98A 4H7JA 3CH6A 3GGJA 2D0OB 2RBGA 1B1AA 2AJTA 4M7WA 1CS0A 2ZRPA 1M67A 2CE2X 3G2KA 4V0KA 1YNSA 2EWVA 2IYRA 2W11A 2B5OA 3EG9A 3LKZA 5AXAA 2W2XA 4A2PA 2PD3A 5KVQA 1I3OA 3I5AA 4PHHA 4LA4A 1CR2A 3FFTA 3GXBA 4EG4A 2Q7XA 1HR0B 3MWKA 4Q9LA 3NWEA 2GNAA 3MLAA 4IZ6A 2PXAA 2VYCA 3IEPA 2IV3A 3WLLA 2WJAA 4P7JA 1YFKA 2NXJA 3IODA 2HJRA 3VV3A 4ZARA 2YZNA 2ZWAA 3DZDA 4RCZA 4MP3A 3GBSA 3I5MA 5I4BA 3PEFA 1ZM9A 3U9SA 1NLFA 2JB9A 3WK7A 3GGOA 2FOXA 3GH1A 2ID8A 4G0YA 1AS3A 2QUAA 3CKYA 4V2IA 1EXMA 3MS2A 2ODEA 1ICIA 2FSGA 3DQZA 4RY8A 2Q5EA 2G40A 2IYUA 5EKTA 4GS5A 1SK8A 1OU4A 2OK8A 4GMDA 2ZBDA 4HWPA 5FWYA 4RLHA 2Q6KA 1XMVA 4BGDA 2H0RA 4DYDA 4E32A 2H1FA 1FY2A 4KODA 3EF0A 3OEEA 1UDRA 2JGRA 1DV2A 4KI7A 4KJZA 4QQKA 4QU0A 2JHGA 2JFXA 1JVBA 4WK2B 3EDOA 4EJ6A 2YOHA 1SB9A 3U9LA 3PNKA 3ZWQA 5C8YB 4RTOA 4TTIA 2FPIA 3QVJA 2VDWA 2Q3EA 1THGA 4F0JA 1R0XA 1M72A 4YCMA 1Y3IA 4EY6A 1HRKA 1NSTA 2EC5A 2WU3A 4NV3A 4Z4EA 5E3HA 1MZPA 5LNK1 4EJSA 4GGMX 1D0IA 1E3WB 1OY1A 4PWYA 3OETA 3PF8A 5DBEX 4D4MA 1T0JB 1NTRA 2AE2A 4L85A 3QKRB 3AEKA 1NONA 2QN7A 1PT5A 3PUJA 4IGEA 2PKQO 2VYVD 3EA4A 4M9SA 1R5OA 3UY4A 4B35A 1W5AA 1PT6A 5F1PA 2IUUA 3SBOA 4FC6A 2P91A 4CYMA 4H3HB 3JALB 5G2OA 4BU0A 2AX3A 2HHJA 1DTWB 4MYCA 4QOJA 3SNKA 4M9UA 3WLPA 3VYRB 3D64A 3FH0A 2B5VA 4PG4A 1VJGA 4IWNA 4B4WA 2LR0A 3K6RA 2Q4DA 2IY7A 2V8BA 5ALIA 4BFSA 3BC1A 3AHFA 1K68A 4EYGA 2AR9A 2JASA 4HWRA 4WKCA 2Z8YA 4J3FA 4J7CA 2G71A 4DS3A 1EUQA 3LWNA 1K8ZB 3P0HA 4H6XA 4RIHA 3SEZA 1V5WA 3TZHA 3DOOA 4BMXA 1PNTA 1GVNB 1WXXA 1VFNA 4Q4AA 1FDTA 4BLVA 4LXUA 1UT8A 1N0HA 2GK6A 2WV7A 3TKYA 3B1WA 1EX9A 5FADA 3I62A 3HU3A 4FHFA 3A6JA 1ZRHA 3JASA 1V1RB 3GT0A 4JODA 3N1UA 3O5AA 4PLHA 1XLTC 1RXUA 2WFMA 3AP1A 3G6WA 4DMGA 4DSTA 3UUEA 4UFPA 2I6UA 3KHUA 1H2WA 3ASZA 5BNTA 2Q3MA 1EZ1A 3U31A 1BHSA 4LYHA 4YRPA 3A1NA 1NKTA 5G41A 4TXLA 1MA3A 1UBJS 4ML3A 1R8JA 1MEJA 1U9CA 2ZXUA 2JA1A 1DDOA 2NPIA 3H18A 1B41A 4GPAA 3BRWA 1ADJA 5E7QA 2ZXEA 4Q39A 4ABTA 2OK7A 3PQ6A 2HFJA 3WADA 5LA6A 1GTG1 3MTBA 4D80A 2AUNA 1QAMA 3ANSA 5L3SA 1B1CA 2FPUA 3IT1A 2H1IA 4MHOA 3QMMA 2WSSA 1O96B 2WAYA 4HNGA 1F7UA 4WNYA 1UOEA 5CIQA 2Y77A 2FTKE 3RVQA 4DIEA 5DGIA 3FKQA 5HFNA 3WWEA 4E07A 2R62A 4QWMA 3UJCA 3HV0A 3IAEA 2BE9A 3VDQA 4MUGA 1TYAE 3IMKA 1X39A 4L15A 4R8LA 4BV3A 3LDAA 4FMCF 3UFXA 2P5SA 4EBFA 3EDRA 1I0IA 2PMDA 2P8JA 5JCJA 1C0EA 3HVJA 4UHHA 5FBZA 2G5TA 1TDJA 2XZTA 1JJ7A 1JYFA 2CVFA 3IBGA 2H3HA 2AR7A 1JAZA 5DULA 1A2QA 3ZDXB 1E0KA 4UMVA 4PTLA 1J1IA 1Q7CA 2OHVA 4GEGA 4J0QA 5ALEA 1DELA 3KNZA 3OCXA 1XELA 3WRYA 3WQBA 5I4IA 1G21E 2A9FA 2OCLA 3O26A 3RC9A 3ROGA 3TG2A 3A32A 4B3HA 4TN1A 3OOEA 4QFBA 3UA4A 4GP9A 5HF8A 2IVFA 3LVBA 1ADCA 4K9SA 2QGFA 1T9GS 3H75A 1HRDA 4P84A 3N2LA 3VR1A 4FSXA 4LJSA 1FW6A 4IJ5A 2XUPA 1QKIA 2VRBA 3C8MA 3EMVA 5JAQA 2XB2A 3OT4A 4NENA 4LQDA 4CEHB 5CA1A 3VR4D 4MEJA 2YRWA 2N75A 5TLSA 2JANA 1L4LA 4TTPA 1APBA 2RGUA 2BF7A 2BMDA 3CVWA 3DXYA 4DIMA 1CF4A 9LDTA 4HDNA 3NATA 1C3JA 4DDTA 1NX9A 4PZPA 3BRCA 1QV7A 4RL4A 2AFVA 3L93A 5F3WB 1U11A 3LRXA 3WSWA 4DB2A 2F67A 3C0KA 3PFWO 3PJDA 4O4IA 4PLGA 4AY2A 4QYTA 1L6RA 1Z2PX 3Q8MA 4L57A 4D3YA 3J81k 2DOKA 1RC1A 3AR9A 2BH2A 5G3YA 1M2JA 3DE2X 4RMIA 5HFAA 1R74A 2CN1A 4MSUA 3LKBA 3Q5GA 4LKRA 2RSLA 3WLRA 5C2JB 4XVUA 1I1NA 3E7PA 3E58A 4AMUA 4LFAB 3LIPA 2RIRA 2MSEB 4TLMB 2B1GA 2IZ5A 5B30A 3WGZA 4TTRA 5JROA 4PLTA 4XLTA 4DANA 1GPAA 3I04M 1RP1A 2P9TA 1DKPA 1S2GA 3EE6A 3G0CA 4RVCA 5G0WA 1EGAA 2KSQA 1KJJA 1C81A 2ASEA 4W7HA 3LPAA 3QHAA 5EWJB 5IJZA 5L3VA 1AHNA 1J4AA 2H1LA 1NZDA 2QORA 3B3AA 3PTLA 4KC0A 4RIEA 2AJCA 5BQFA 3OJ0A 4A0HA 1HDIA 3REQB 1V96A 1U2QA 4E5UA 1V1JA 2IXAA 4P3YA 3I9OA 3PC2A 3EQ9A 1RKBA 1J0CA 1QANA 2XGOA 4DPLA 2C9ZA 1NXSA 3KS9A 2G8LA 3PXEA 4MS3B 3B53X 2RHGB 2FMXA 1O5OA 2H1WA 3KLOA 3Q7EA 4ZDKA 6REQA 5EEGA 4NMHA 2C2KA 1Z45A 4A73A 1QH8A 5T5QA 2F4VB 1R2QA 1E79D 5CGQB 1V39A 5K6AA 4NZPA 2ONKA 4H7PA 4PX2A 2PMWB 1NVFA 2AMJA 4YP6A 4L02A 1W36D 4WI1A 3I73A 1E6LA 4FFLA 4XDGA 3TLYA 4C6SA 4JY7A 1UR5A 1KFCB 3A10A 1DBRA 1EFDN 3DH0A 2FWNA 2V03A 3KTAA 2WF8A 3MF4A 3NUZA 1YL5A 3QKRA 1NW3A 3DDNA 3H7AA 4LE1A 4R68A 5DGTA 4KSCA 3MLBA 4XDZA 4YP1A 1QGUB 4IXNA 3C3EA 3ESQA 4GKBA 5JS2A 3L8MA 2YYZA 4DJTA 1N7JA 1NN5A 1TVKA 1F0KA 3QW2A 2QLTA 3CRMA 2XYRA 2DQKA 2QY9A 5DK6A 5CLJA 1PJQA 1PJ2A 2XKBA 4MLCA 5IFLA 2FPOA 2GUGA 4ZI7F 2ZCJA 3VR0A 1XZPA 1RRGA 1T5OA 4O4JF 2BR3A 1ESEA 4PLYA 5J4YA 5IX8A 4P3PA 1CE8A 2W8BB 3AETA 1K7SN 1Z38A 3P2JA 4PLWA 1NMSA 5KKNB 4K26A 1NOIA 3HI4A 4O4LF 4BLRA 1WXFA 1Y7TA 4P3OA 1Q20A 4QBIA 5E9AA 4FYIA 4YRTA 1I1HA 3TBHA 1UM9A 4TLEA 2UZ1B 3SLGA 4ZCTA 2PX5A 5JNLA 3O73A 2BCEA 3DLIA 4JEHA 1PLKA 2OHXA 3HGQA 3MIZA 1GPBA 4G07A 3OPXA 3E18A 4FC7A 5FYDA 4V38A 4LQ4A 3ELYA 5J4LA 1SU8A 5AUNB 1VE6A 3H13A 2CZGA 2PR2A 2QTNA 4NZOA 3RK1A 5HQTA 4GYWA 3E35A 3TG8A 1JX6A 5IARA 4COKA 2EZ9A 1O9BA 4CLRB 2J9YB 1MP0A 4ZYVA 4IWXA 4A6PA 4ROTA 5A7FA 2WSIA 1POXA 2X9LA 1UAYA 2ACEA 3CEJA 1E6WA 4PE5B 1PEKE 1UKEA 1RRMA 3EFHA 5IMSA 1N78A 3M8KA 1U28C 4RQBA 3L6UA 1YGPA 3PEEA 1GIAA 2X1VA 4X63A 4C7JA 5KNCH 3H1FA 3AJRA 2YDXA 4HL6A 3BFKA 4JUCA 1W46A 4TMVA 1O0BA 3L6DA 4G2NA 1RJDA 4G5YA 3DEYX 3AVUA 1SKUA 2GM3A 5LQNA 3HHEA 5T57A 1N5OX 4UMDA 3GPLA 4BNKA 1JIQA 4ZOLF 3ZHZA 3KDPA 3B3GA 5G0SA 4IILA 3OIDA 4LRXA 4PFJA 2QPLA 3E4CA 1T8RA 1Q22A 4PGMA 4WJLA 4MTLA 4I50F 5JIBA 4BC0A 1K98A 4ZO6A 2FU5C 1DAKA 2Z1DA 3IR6A 3SEAA 1PFUA 2KBFA 4MA4A 3NU1A 1P4JA 1EFRA 3BL5A 2GAOA 2IZZA 2MJLA 2GCNA 1U0GA 2ERYA 4OHWA 4KR3A 4OHFA 3C2QA 3FX2A 2XQIA 4INOA 1JG6A 2G76A 3QVTA 2WY2D 2IBMA 2BUCA 4CMKA 5BN3B 1XZHA 2C82A 2FPMA 4CQMA 5DGXA 2AMFA 1A50B 4N54A 2R1VB 3FUUA 1X87A 4YAWA 4QVIA 3B7PA 4JD5A 4KGDA 4PYIA 5ALXA 3G5UA 4AKGA 4LMAA 2WM2A 1Z35A 4JA0A 1YB2A 2PLNA 2B9EA 5LZ4A 2G88A 3NHBA 1RT9A 4NXMB 1WV0A 4JOCA 2WYUA 3LUDA 4TYPA 1E1YA 2C8LA 1Y4SA 5KDLA 4I5FA 1U7UA 3R20A 5C0OE 4DEYA 1GD1O 2BFDA 3T61A 3P2EA 1NX6A 2C2XA 1E2MA 3CUEF 4TMFA 5AVJA 5AXBA 1NPYA 1PTJC 1H66A 1V3UA 2FJ0A 2A5JA 2WTMA 3AM3A 3AZOA 4GZ6A 1FTGA 2C3UA 4UPVA 4QASA 3EZFA 5DIZA 4O3FA 2DPGA 2O0KA 1M34E 2FVYA 2XE8A 3ANMA 4ER3A 3H4TA 3QEBZ 4P0PB 1Z4IA 3Q72A 4MB0A 2B25A 3TUZC 5J58A 4ZZ3A 4NJOA 4G8BA 2ZRDA 1V4VA 2YZ7A 1RPNA 3CMCO 4GZ3A 4IIJA 4RDIA 4B6OA 1Z0SA 3ZOKA 5I5EA 4KQKA 4D56A 2HA3A 1FQWA 2H0AA 3FMPB 3UICA 3W06A 2WB2A 5FWXB 2FW1A 1WZEA 1E3QA 1E3JA 5AM0A 3MD9A 3UCEA 5ADHA 1KWGA 4LKOA 2JFPA 4WXYB 5ADVA 1NF2A 3EGWA 1KP3A 2DLNA 4EKEA 4FWTA 1PGOA 3O1HB 5F1OA 3MQ2A 1FIUA 3DWEX 1MOZA 1SHJA 1Y82A 2Y0CA 3IAUA 3MJTA 5BQ3A 1KP2A 2DHEA 1TYBE 3KLNA 3VDMA 1NW7A 3OEHA 4K81B 3OTGA 2ZSDA 2PQ2A 2X5OA 4B34A 1S9HA 3WYFA 3K2EA 4BGEA 4B09A 3ASUA 4G8CA 1W5SA 1JBQA 3OC6A 4JK3A 2IPLA 4ADSG 1AV7A 5AM2A 4OGKA 2RKWA 4WFQA 4EZEA 3GLGB 4PV7A 1WE2A 5LMNB 1IHUA 1NJ2A 2W6JA 3MJHA 1YZ3A 1KE2A 3A8TA 4E51A 2VDPB 2P3QA 3NMUF 1S0UA 1GGHA 2AXEA 2OC4A 2ZJYA 4Y1GA 4DRZA 1IN8A 3HJHA 4IJ6A 1GKLA 1KQOA 1JKMA 3N6RA 1QYCA 2J7PA 2WWGA 4NU6A 2GPNA 1ZJWA 3ZHSA 3PX3A 1DT3A 2J46A 5K99A 2JAUA 5ECDA 2W4MA 1YJXA 5HDQA 2X1LA 4IDPA 2VR1A 3WGKA 1VMKA 3EASA 3DMYA 4NY1A 1D4OA 1T1SA 1QVRA 1YRWA 4FDLA 4R2IA 2A30A 1AXGA 1H69A 2HWYA 2OCPA 3E84A 1NHGA 3PWKA 4MKZA 1FU8A 4AJ1A 1HY3A 2JC3A 4EGJA 3AHGA 4I4NA 1R37A 1ZOPA 2VHUA 4E22A 3VC2A 1G16A 1KJNA 1TA4A 4G25A 2NU9B 1EBUA 1JA1A 2ZETA 2BMJA 121PA 1A8IA 1SU4A 2J9ZB 3R77A 1X1QA 4DLAA 2BEWA 2GHIA 4BFWA 1KOGA 2EKPA 3BJIC 1WU8A 2C29D 1KRXA 4BCDA 2QM7A 1TF7A 1FRVA 3I2YX 3LQQA 4XM1A 4A2CA 3PA8A 4EMSA 4JLOA 2I5PO 2P67A 3HEMA 2JLQA 3UV3A 2PJZA 4F9EA 1N2CE 3ESDA 1M1NA 4WUVA 4RQUA 4X60A 1P2FA 2X77A 1TM7E 2YCBA 1ZQ1A 3KP1A 3D2BA 5DHPA 4R9NA 5F35A 2QE7A 3MJVA 3R6WA 5FA6A 3V8EA 4ZMBA 5JVDB 1GKYA 3EGOA 5CXSA 2V7PA 2BDTA 5HR5A 4MLDA 2IU4A 1AGNA 1EBBA 3ET5A 4E03A 4FVTA 2PKQP 1MPTA 4PIPA 4NZYA 1P3DA 2Z9DA 3LQ1A 1J2YA 1Z6XA 4AURA 2ZB3A 1U3CA 3RS9A 4KRFA 4AJHA 1WNFA 1Q5PA 3DL7A 5H16A 4JJGA 4AI6A 4QRDA 1FTWA 1GZ4A 3CX3A 4E3WA 2P5TB 2VJCA 4RVNA 4FPXA 1X8KA 4X20B 3QQ5A 5HJ5A 1BJTA 4WNAA 3E9MA 1R16A 4PLPA 2OQVA 3SIWA 2COKA 3AJ8A 4TL6A 4EPWA 5AO9A 1UOPA 3U5ZB 1GPYA 4Y2QA 1RRCA 1OH8A 3S8MA 4OSOA 2Y66A 2LDXA 5AI9A 1KJWA 1H65A 4BNTA 2E49A 13PKA 1N1MA 2VDVE 5B36A 4DMFA 1H3NA 2EQBA 3GBPA 4CMIB 2A78A 3OZFA 3FTCA 2N9UA 3GJ4A 1EHYA 1AB5A 1X19A 3AKCA 3IB6A 4OOFA 2ZIWB 1E4EA 5K0SA 5KWSA 3MGAA 4Q7JB 3ZD8A 3FETA 4B44A 3GGPA 3F6RA 3P0RA 3I6YA 3NJ8A 1NJ1A 1FFGA 1MAAA 1ODIA 2FDRA 2J7KA 1KDOA 2PO7A 4RJIA 5FR2A 2EBWA 3HBLA 1Z2CA 2YNMD 4JUFA 2JGNA 4OQEA 5E1DA 1P44A 4AUMA 1VIYA 1C9MA 4ND2A 3KZNA 4LYEA 4ISCA 3G9QA 5KNBH 4DMMA 3EVGA 2X0NA 4C87A 2D62A 2VQDA 3K0BA 3G2OA 2GK7A 1ORTA 3IQFA 3H1EA 4JGIA 3PQ5A 1RM0A 3FB4A 1HE1C 1KQPA 5IXJA 4YIKA 5KX5A 5SZKB 4R2XA 5IBQA 2AFHA 4ZHQB 5LVAA 1SA0B 4PAQA 4JP1A 2C20A 4MUIA 4YUWA 1JT2A 4KB5A 5EJMA 4WECA 5FOUA 3FCYA 2X2OA 1IU9A 1OLUB 4YRIA 4BVLA 3I45A 4GOLD 3I58A 5CX1A 4BJHB 1AKNA 3VZRA 4CIDA 2HNBA 1A5TA 1SVNA 1ZD4A 4LY9A 3RJMA 1GNSA 4IIFA 5A5VA 2NT4A 5F7ZA 5AVOA 5LQAA 4ZTZB 3OZGA 4O2BB 4V2UA 3BTSA 3MTJA 3AK4A 1K06A 2ENUA 5CA1F 1ISJA 2ZI9A 5LYYA 3FDZA 4YO8A 2XUFA 3QBVA 3SS9X 1LJ8A 2ZRJA 4D3XA 1VL2A 1ZLYA 1C30B 4EY7A 2CLDX 2ASVA 4UE2A 4FB5A 1J2RA 1NUHA 1H1LB 5B37A 4EX7A 5ES3A 4BO4A 3SFZA 1JNXX 4NYJR 4KVFA 3MA0A 3MWDA 3BXGA 3ADDA 2YH2A 2WTNA 2Y93A 4HYEA 3SOZA 4O4IF 5JATA 4JNCA 2Q0XA 4D45A 1YFJA 2R7KA 2YIDA 3H05A 3HC7A 4GRIA 2UZ3A 1GYQA 1E6KA 3UAYA 4DMKA 5CJ2A 4FDVA 2OZLB 2ILVA 1PD1A 4OFWA 1R4ZA 1SUSA 3L7AA 1ZW6A 1J49A 2X2PA 4YRSA 3P1JA 1AHHA 3PDJA 2R0QC 2X8WA 1SUIA 1ZM4A 3E23A 5LDGA 3SDSA 3T7IA 3GLFA 4JYMA 4AW9A 4DKJA 1J0BA 2HA2A 5EMKA 1ICEA 3W6ZA 2JLAA 2B7LA 3PUWA 3L0OA 2VVTA 3M9LA 3L7OA 1HM5A 4V0OA 4D9HA 4EPVA 1M7GA 1B4DA 2XAUA 3OLZA 4DDKA 4N7MA 3T94A 2B0CA 4CVNA 2EGHA 3DR5A 2QTHA 2ZSJA 4XARA 2OM2A 5I7WA 2OC9A 2BT4A 3QUQA 1O77A 2DUWA 5LKAA 4JR2A 4CLEA 1NVEA 2GEJA 1S2OA 4CT5A 2Y1LA 5C52B 2QL5A 3BD7A 1NU6A 2HRDA 1C8KA 3V1KA 1TKBA 2XOXA 4J29A 2DRIA 3GRVA 3QIVA 4PZYA 3DD5A 3DHEA 3L8DA 2QPOA 3MRVA 2P79A 5AOCA 5KVAA 3ILXA 3HE3A 2GAJA 3GFQA 2G28A 1GILA 2CLHB 3TI7A 421PA 3MYRA 1VHDA 5EUCA 2GCOB 2Y92A 4TT3D 4CDRA 1UZLA 5CFPA 3ND6A 1ISFA 4LVOA 4C7MA 4XTRA 3JR7A 2X13A 2IIVA 2WE8A 3HH8A 3MWEA 3BF7A 4BB0A 4BVEA 1ZGZA 1WSBA 2VWPA 3ODPA 5DTQA 5BVGB 2GK4A 4FGKA 4YAUA 5L51A 2CYAA 4FDMA 4UPEA 2PWYA 1GEGA 1VZ3A 2WILA 2UVDA 3TPCA 1PUXA 3WNVA 2D6FA 4G65A 1DIAA 2CY0A 3STYA 1WU7A 3TGLA 1WEHA 2QX4A 3DCNA 1E2FA 2AI3A 3I76A 3P4UA 4FR0A 3TQRA 3W5AA 2HSZA 4EGQA 2Z8ZA 4ILKA 2H1OA 4UTNA 3SIXA 5LUBA 1XK7A 4HFNA 2QZPA 5JVDA 1G3MA 4OA8A 4PAGA 1BFDA 3V8BA 2DUMA 4QT4A 2A14A 3P0JA 3S4YA 3UB4A 4WACA 4G89A 1LVUA 4QUEA 1AKRA 3DE0X 1B42A 1U0SY 2F3UA 2WVGA 1WUKS 1ZLXA 5FWDA 5G0UA 3TDNA 4EHBA 1MHTA 1TMYA 1UQUA 1Y3CE 4LTDA 1TA9A 1QRTA 5IS2A 3CRVA 4Z1MA 1MB2A 3T9CA 4INJA 1JJIA 1KDYA 1TAUA 3IOEA 4LNAA 2RAVA 4RA9B 1T4CB 2KB0A 4AN1A 3M33A 1MORA 1N5RA 4JOSA 4MCJA 4BAGA 5CBPA 4DR4B 2O0MA 1NR1A 3CT6A 3NEPX 3OY2A 4RHCA 5BWMA 2CLCX 1R8YA 3T1OA 2ODQA 1N2ZA 4KZPA 1NRJB 3TL6A 1XV5A 1HETA 1JG1A 3ELBA 4HLCA 2NO1A 2KLBA 3NPMA 4XM0A 3EYWA 3PX2A 3ZHXA 1Q21A 3WYNA 4DM3A 2H06A 3I61A 1UMDA 5C4GB 1K0UA 1AU9A 4NSNA 2XRFA 1TUGA 4OHKA 3OQMA 4F4JA 4W8OA 5ALUA 1MDBA 1Q7TA 1P2VA 3VZQA 2Q2WA 1U2ZA 2YVAA 3C4JA 1JG3A 2C8JA 1G20B 2QZJA 3KJZA 1O6ZA 2V97A 1E1RA 1RKXA 3PE4A 4NCJA 1GRQA 1E1QD 1HQCA 4ME6A 3WHLA 1H8HA 1XDUA 2A7QA 2XOEA 2YQ4A 3KZXA 1L4GA 4MYDA 4AY6A 3V2IA 1T0IA 2PUGA 3R9XB 1B2RA 1J6UA 4GX0A 4ALIA 1JKJB 5D87A 1ID8A 1Z13A 3L18A 4E46A 4AY3A 4ZMRA 3N2GA 3RU9A 4BQIA 3JYPA 4MKHA 2QTRA 3N5CA 5TARA 3R7SA 4MDEA 3T7SA 4NABA 1X7WA 4D43A 2PTHA 3AUKA 3W4JA 1D2MA 4XWOA 1FNNA 4KQHA 3ICVA 4BNGA 4EHDA 1THMA 1SFRA 1X7GA 2IUFA 1V7CA 1OUMA 3FHTA 1AXEA 4FHZA 5FEMA 4YJHB 2CL0X 3AKYA 3MS7A 1U7PA 5LU8A 1P4AA 4KAAA 2O3UA 3IH5A 4E5NA 1DQZA 1AQIA 3E82A 3V9AA 1JEOA 4KQMA 1R50A 1RHRA 5B58T 3IKLA 3EAQA 4JC0A 5G4KA 1NMEA 2CSXA 4P3NA 1XU7A 1W30A 2PVPA 4N18A 2Z6UA 4RJJA 1AQ6A 4RVUA 2O8CA 3D59A 4BC1A 2JJQA 2Z83A 4MIOA 3KTOA 3RFXA 2JIDA 1Q12A 3ISTA 2BFCA 5CDSA 2I3GA 5KHOC 4CMCA 1IXKA 2HR1A 1CYEA 3RBAA 1ZK1A 1OX4B 5EHXA 4ZGGA 4M87A 4MUBA 1ONSA 4OHOA 1UJ2A 1JAIA 4HQ0A 1M2FA 1WBBA 2JJYA 3FVRA 3I6MA 4Q3BA 3DVRX 1XKQA 1TZ2A 3JARB 4FYPA 3EMDA 4I55B 4QXQA 4L0CA 2YRXA 4Y18A 4F4UA 3A05A 5IF9A 3M81A 1EUCA 1LVHA 2O7VA 5DI3B 2GK3A 2XMCA 1K89A 2YV1A 3DFZA 2MINA 3G2MA 1J2TA 1MB4A 3BQMB 4PSAA 3WMRA 1FF9A 2ZXFA 3SZOA 1Z29A 1IBSA 4KVZA 2DSNA 1JDBB 1H8ED 1PF7E 4UZSA 3PJFA 4R69A 2YUTA 2P77A 3NKVA 4GMHA 1TE2A 2R1ZA 4CMBA 1YZHA 1UBRS 4BN0A 2HEGA 4L9WA 3H17A 4K9LA 5FNZA 4BX8A 2H17A 1WPXA 4IFIA 1QPBA 4QXOA 2NNLD 5JJBA 1TKCA 1H6AA 3BH0A 3K1AA 1OBFO 2YHIB 3A27A 2ZM5A 2ADMA 3L1HA 5G1OA 4L3OA 3TW4A 5H83A 4ACBA 2C7QA 1Y6FA 3FSRA 1A1VA 2R68A 3LOQA 2FW0A 3WKDA 4IIUA 3K5HA 3HKEB 5JADA 3D7RA 5ENDA 4W9NA 2WJ4A 3D7NA 1G8PA 3FXAA 1NQ5A 5TS3A 3RVJA 5KJ6A 5LSAA 3P9SA 4YA6A 4CLDA 3ZE7A 3R3XA 1T8YA 5DM70 3DBIA 3ICPA 4ZP1A 4Z0PA 1H6DA 1E2QA 1ZCAA 4OKIA 4U2DA 3LY8A 3VU9B 3R7NA 3NANA 5MFZA 1QYWA 1HDEA 4BVBA 2Z95A 1WP9A 3RAGA 3SQMA 2CMFA 4I1UA 3ZDAA 3AINA 1KJ9A 3LHFA 2R8XA 3KEMA 2WZQA 3A26A 4FMCB 3ZEIA 3ER6A 4MYTA 1HFWA 3ZI7A 4M4SA 4B40A 5U9CA 1V5IA 4B71A 4XD7A 1G1AA 2A5DA 3FMGA 1CBUA 3DZ8A 3U4MA 4ON9A 3T7RA 5JASA 3DQPA 4MI3A 1EX1A 4PSKA 3VV2A 3H1AA 4XCXA 3IXMA 2AW3A 2JJMA 4BX3A 3D7SA 2VRWA 3SG0A 5AW9A 4EB0A 3ZVNA 1F5NA 1RZUA 3AF6A 1N6PA 4UNNA 2Q6OA 3Q6IA 1OXTA 2CNBA 4WCFB 4WNCA 3IPYA 4KLCA 4TQAA 5TT1A 1GT6A 2DLDA 2ODBA 1SXJE 1SOMA 4MAAA 2DPLA 4X8LA 1OAOC 3PGJA 1CEEA 2PV7A 2IYZA 3JZAA 1T9GR 2O19A 3AR6A 1T4CA 1PKXA 2YYSA 4FGSA 4NI5A 1QLWA 5LLTA 1PVOA 4B3IA 2R66A 2PSHA 3EXHB 3IMGA 4RVGA 5IN5A 1ZMXA 1RRVA 2VDQB 2VUIB 4V0LA 1UMBA 1VPVA 3ZHOA 3CF4A 1ZCBA 1SHKA 1S3IA 1ZGCA 1XKXA 2MR6A 4YEDA 1QHGA 2F43B 1ZRSA 5CAEB 2ON6A 4H08A 3S1AA 3U6KA 4DIOA 1VTKA 4D82A 5KOIA 2XXAA 4C7BA 5HQ3B 4JL5A 1J8FA 4QQ8A 3CX6A 1H2EA 1L4YA 4F84A 4U6QA 1EG2A 3LMKA 4OUDB 3VYSB 4TWZA 2QT9A 4V3BA 5G1PA 3GRUA 4IPTA 5TMBA 1DAOA 1H4VB 4F1JA 2C9DA 2PGDA 3RQIA 2X5NA 5K45A 3RUFA 2AXNA 1H2XA 3CKMA 4PWZA 3P94A 4TV8F 1AGXA 2I76A 3IAXA 5DIFA 3IDOA 3W6NA 4TPKA 1GUBA 5JQGA 4DCGA 1CQIA 3KYCA 1JE1A 4GPD1 4M38A 3RG8A 1M6VA 4IYRA 1RCFA 1V26A 2X22A 3FVWA 1Y6QA 3GJSA 5DVZA 5DPMA 5FUQA 2CHGA 1BMFD 3DAHA 4I2VA 5DP1A 4HNQA 2WJYA 1IJBA 2AEMA 3HGMA 4PX9A 3G1UA 3E3MA 1HT3A 4EGCB 3LA8A 3T3GA 4TWRA 3AFIA 1W6UA 4JI6B 1C4OA 2I2BA 3BFVA 3F7TA 3MTEA 4JLPA 1H4SA 4UBIA 5KX5F 3RODA 1HQYE 3H9BA 3RS3A 1K7EB 2AB0A 5D1HA 2HBQA 3V32A 4QJIA 1A5SB 4ZEWA 1R6UA 5JWHA 3SEQA 4ENTA 2BHSA 1S4MA 1X7YB 4G8JA 5C46F 4F93B 5LP6F 4X8OA 1W44A 5FTKA 1Y1KE 2DETA 1TZBA 2IS6A 3IPLA 4RE5A 3A4IA 4U00A 1GGVA 2JVKA 3DXFA 2HMSA 5HCIA 4CU5A 4PCUA 4W1QA 1NJFA 1V6SA 3AOEC 2OEPA 5REQA 4MDFA 1KI9A 5HFJA 1DAMA 5AVKA 3KQMA 3O8DA 4NMLA 3UOGA 2JBAB 4KSBA 1VKRA 2QXUA 2WJHA 4UHBA 2V58A 3L7KA 3PC8C 5D86A 3ZBTA 2GWRA 3CIOA 1ZC4A 3RS0A 4EMBA 2OWEA 2YVKA 2VNSA 4HGQA 4HFRA 4LDZA 1RQRA 5HZMA 3I2GA 4LZJA 3W6PA 1OWPA 4NOLA 4Q1CA 4MRSA 4EUSA 4JZKA 1Y80A 2INGX 2PQ0A 4IDCA 3RARA 4RKYA 4WFJA 4Y9UA 4A8TA 4ZIRA 3T3PB 1O0CA 5H3HA 6GPBA 2RIPA 1XZDA 3WX0A 3M5DA 5DT2A 1EWYA 1UPBA 2AQIA 2SKCA 2XCQA 3Q9LA 3QUTA 2YTZA 4RULA 3GJ5A 3JATB 4O4JB 1I10A 2QGZA 5IASA 4Y6QA 5J2UA 3NDBB 1PRYA 1VL0A 3CNLA 4YJ2A 3GV0A 1YQWA 2PYIA 5EJ8A 2TMGA 1FRFS 4MWCA 4E1VA 4O4LB 4IIGA 4LXYA 1IMJA 2Q21A 3QXCA 4PQGA 4RESA 2WIBA 2CEAA 2QUJA 5A1TA 5CDGA 1KH1A 4Y7DA 4FOTA 3W3AA 1KZ6A 3DXZA 1T0PA 5GM1A 4D0GA 2ZS8A 3VKVA 3NIWA 3JAWA 4PFKA 1AHPA 3NAMA 3ZKWA 1CQJA 1DKUA 4QLBA 3VH2A 5WRFA 4K5QA 1UOQA 1U3WA 2Q6LA 5DOVA 5JZBA 5CVEA 1XZMA 3AFOA 3HVUA 4JVLA 4ZQFA 2IWRA 4U7JA 3UVEA 1V25A 4BE4A 4CDMA 3R3HA 4HZUA 1FCJA 5K03A 2H11A 4Q3DA 1TL7C 1QK3A 2OXIA 2BGJA 2PXXA 4EHIA 3FNRA 1ANKA 4B3CA 5LFAA 5J1SB 3QE9Y 3GFRA 1KO8A 3ZV5A 4B7CA 5K6TA 3D8NA 5DHUA 3UZUA 3DZGA 4H17A 4E14A 3JQ9A 3ZZ0A 4II2A 1Z5ZA 3HADA 4XVCA 4KXLA 2BEVB 1NI4A 3HJGA 2XTJA 4CM8B 3G9TA 3IV9A 4IXDA 1Z7BA 1ZXBA 5LD2C 2JZCA 3FUTA 1Q1GA 2XQFA 3HKDA 4R1LA 2CHQA 3JQ8B 1FP4A 4RU1A 3A6LA 3BSYA 4WLVA 3ESRA 4C76A 4J9VA 4KE7A 4UBNA 4I5EA 4C21A 2ISSD 3EVCA 4AJ2A 2RE8A 2VP5A 3LO5A 3T7TA 4CKCA 4XOUA 5DHFA 3ABRB 4I50B 2C3PA 3LPMA 2EDAA 2QI9F 4E4YA 1KKMA 4LV8B 5AKHA 2FZGA 1EM8B 2YWHA 4ITVA 1AE1A 1SZPA 3G17A 2XUKA 1CU1A 5GJCA 4LZLA 4LSMA 1ZONA 3HCAA 3N87A 4PHCA 2ZIUB 1F1JA 4N03A 2G4CA 2IS2A 2RB4A 1UINA 4ER5A 4X65B 1DI0A 1VXOA 3I0NA 4A8HA 1FFBA 1M1UA 2I6XA 4U4AA 1QGOA 5HJ7A 1ZWKA 5TGTA 2IPXA 2QN8A 1YZUA 5EXEA 4CMJA 4PC7A 5F5LA 1VL5A 4WK4B 4MPRA 4OQZA 1OFUA 1LSJA 5BXYA 1G9SA 4MVJD 3FHJA 4MV9A 4LOJA 5ALDA 2F43A 1EFTA 1GQFA 1YRBA 4AJEA 5KTNA 3VDXA 1O03A 4GUDA 4EEZA 2Z5FA 4YRMA 4DCCA 2RG7A 2R4QA 3KVYA 4QBTA 4DB4A 4LDNA 2LGJA 3DZKA 1JFSA 3F8TA 2WWFA 3I09A 5IANA 5J5CA 5IDWA 2E3JA 1FP6A 4PGGA 2D8MA 4Z9AA 5CX4A 3CM0A 3TJZA 4D3DA 4OM8A 1OFHA 2FRXA 4GGPA 1Q15A 3C8DA 3K8OE 5J5VA 3F46A 2D74A 2IZ1A 3UQZA 4DPKA 1FXSA 4JA2A 3DF7A 1DL5A 3PQFA 3OCWA 5BQPA 2GDZA 1XEXA 2ZJ7A 1MMFB 3H2JA 4R2KA 4RGQA 1HURA 1TW3A 4GLJA 4YALA 4ZXFA 4DLXA 2J87A 1M6NA 1JIXA 2JPDA 3DLCA 4TMTA 5A3RA 2ZT8A 2ZIAA 4RL6A 4AT1A 4JEUA 3UWSA 1O2DA 3ULKA 4DR6B 3KQNA 4ER6A 1E94E 1BFKA 2BJWA 2G4LA 3AY6A 3M3HA 3D3JA 4MW7A 4BX0A 3KQTA 1CXZA 2ZGVA 4ETMA 1Z0UA 3D0RA 2GR9A 5DBFA 4D2IA 3DNMA 3H2YA 5FWYB 2GVDC 3MAGA 5EC8A 4W4TA 1JA9A 4G3XA 5AJUA 5FL3A 3SMVA 1MXFA 2OZVA 1Q3KA 3QSGA 4HDCA 1R27A 5DTMA 3S0JA 5KVSA 2CVHA 5KWJA 3ME5A 1BWSA 4AY4A 3ZJYA 3KDSE 5G4LA 1ST3A 1T6XA 3NHZA 3RHZA 2MIIA 3S2FA 1VQ1A 4NF2A 3P45A 4TZTA 4GSLA 3VISA 4M53A 3L1UA 4AJKA 4PPFA 1GXSB 1WVMA 1GAWA 4WFKA 2WPDA 5CB0A 5HW0A 1U0OC 2NVBA 2VP0A 3AR2A 3TO5A 5DW3A 1FK8A 3RKUA 3QEMB 3UMFA 2AZMA 3A1DA 3K3PA 3DWFA 1RJ9B 2OOSA 4K05A 4MAMA 3SHFA 5IC4A 4MW5A 4HAOA 4EFKA 4F2DA 3ZU3A 1QZUA 2MSCB 4L0MA 5C37A 4PICA 2F1OA 3OE5A 3B6KA 5EZ5A 2JGDB 5GTDA 2ZYTX 1OH6A 1YH3A 2XLCA 3DTNA 3FDXA 4FFPA 2QRQA 4PZAA 4UTZA 3E22A 4FGLA 4GVXA 4UBJA 1ODSA 1QQBA 1Q91A 3UTCA 2ES4A 2QTGA 1U9IC 1L7OA 1G8KA 3OIGA 2IWHA 5F7OA 4REQB 2W90A 4AM8A 1SCQA 2NAPA 5IKMA 2FPGB 2W6ZA 4RAOA 1U0LA 2QAGA 3I52A 3WO0A 5JCPA 4WWHA 5JALA 4WJZA 2V7EA 4Q03A 3I9JA 1I9CA 4NMWA 3IPRA 3MBIA 3BUSA 3AIOA 4OOEA 4CL8A 4TL8A 1GYPA 3T3DA 2XUQA 4EG1A 1ZIDA 1TQ8A 2C8VA 4EQZA 4XR9A 2A59A 3D2LA 1HI9A 3WI7A 3O75A 1Z6PA 1H2BA 4ZCLA 1FSGA 2OO5C 2FWRA 3C3DA 4IMJB 2NUTA 2UZIR 4Q3LA 4DXAA 2ZB8A 5FTLA 5JAOA 2YICA 3I9LA 4PM4A 2MCFA 3WMGA 2VJPA 4EG7A 1YU9A