3DE1X

Proteinase k by lb nanotemplate method after the third step of high x-ray dose on esrf id23-1 beamline
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de1X00
3GCXA 1LW6E 1SIBE 3PTLA 4RYDA 4LVNA 4BWGA 4OV6B 1WVMA 2P4EA 1YJAA 3TECE 3F7MA 1GTJ1 1BFKA 5CW1A 1AK9A 3WIVA 4B5LA 1V5IA 3WIUA 2SICE 4M1ZA 1Y34E 5FFNA 3DVQX 1V6CA 2SNIE 1GTL1 1Y3CE 1PTKA 1EA7A 1KDZA 3SQOA 3LPAA 2GKOA 1CSEE 2Z57A 4DJ5X 4LVOA 5SICE 3VSBA 5AVKA 1P7WA 1AV7A 4CG0A 1SUBA 1Q5PA 4YN3A 1Y4DE 1A2QA 5FBZA 5AMXA 1Y3FE 1C9NA 2WV7A 5ARDA 4NE9A 4WOBA 2PWBA 2PWAA 3T41A 3QTLA 1WMDA 3EIFA 3F7OA 1SELA 1TM7E 3TI7A 1SBIA 2Z2ZA 1WMEA 5ARCA 3EDYA 3D43A 3I34X 1S02A 1JEAA 1YJBA 3CNQS 3L1KA 2QTWB 2W2OA 3Q40A 3A3OA 4Z2AA 1T1GA 4HX2A 1NDUA 3BPSA 1WSDA 2Z2XA 1IC6A 4CFYA 3OSZA 1KE2A 1NLUA 4ZOQI 2Z58A 2PYZA 1OT5A 1Y3BE 1MPTA 3Q5GA 2IXTA 2Z2YA 2W2PA 3DE0X 1TO1E 1SH7A 4KB5A 3TI9A 3CO0S 3GCWA 1P7VA 5ARBA 1DBIA 1GA1A 2PRKA 1SIOA 3A3NA 1SBHA 1T1EA 1AH2A 1THMA 3DE7X 3HJRA 1R0RE 3VV2A 3AFGA 4KPGA 5B1DA 1Y3DE 1TECE 4OMCA 4FONA 1OYOA 2Z56A 3P5BA 5FAXA 1C9MA 2HPZA 1BE6A 1GCIA 4JP8A 4KG7A 1SBNE 1GA6A 1BE8A 1TM4E 4GI3A 3DVRX 1MEEA 3DW1X 2DQKA 3DVSX 2X8JB 1SCBA 4DZTA 4NE7A 1SCNE 1TM1E 2W2MA 1KDVA 1GA4A 2DUJA 1ZVKA 4H6VA 2DP4E 3ZXYA 1Y33E 1PJ8A 5JXIA 2ZWPA 2E1PA 1HT3A 1ZVJA 4H6WA 4NMXB 1AQNA 1T1IA 2ZWOA 4H6XA 3VYVA 3BX1A 2XTJA 3DYBA 2ID4A 1UBNA 1BFUA 1ST3A 1OYVA 1SPBS 3DE5X 1TM5E 1PEKE 3A3PA 5JXJA 3LPCA 4HVLA 2Z30A 1VSBA 3I2YX 2IY9A 3WQBA 2TECE 4CFZA 1SUDA 1YU6A 3SICE 1GT91 2ZRQA 1AF4A 3GT3A 5JMOA 3UNXA 2PKCA 1TMGE 1SUCA 1IAVA 3DDZX 3BGOS 1DUIA 4AKSA 2WUVA 1BJRE 3DWEX 4DWWA 3QFHA 2XRMA 2B6NA 1TO2E 4OMDA 3ZXXA 3GT4A 1CNMA 2PQ2A 2SECE 2G4VA 2WWTA 1EGQA 1SBCA 1S2NA 3PRKE 5B1EA 1SVNA 2V8BA 1ST2A 1KDYA 4AKTA 1GNVA 4K8RB 1TM3E 1Y1KE 3I30X 3VV3A 3H42B 3DE2X 1KE1A 3DW3X 1SCJA 2ST1A 1SBTA 1Y4AE 5I9SA 3I37X 5AQEA 1Y9ZA 1SIUA 3VHQA 1AU9A 3VTAA 5AVJA 3EE6A 1R64A 2X8JA 1C3LA 1XF1A 2W2NA 1BH6A 3LXUX 1P8JA 4I0WB 3WHIA 5JXGA 5K7SA 2HD4A 1SUEA 5JXHA 1SCDA 3D9QX 1Y48E 1GNSA 1PFGA 1WMFA 4WOCA 3DE3X 2WUWE 4C3UA 1C9JA 3DE6X 4ZARA 3AJ9A 3DE4X 3F49S 2PMWB 1YJCA 3DE1X 1R6VA 1SUAA 3QMPA 4J94A 1GTG1 2W2QA 1AVTA 2ID8A 1S01A 4MZDA 2SBTA 1TK2A 1NDQA 4C3VA 1SN7A 3AJ8A 1SCAA 3LPDA 1SUPA
chains in the Genus database with same CATH superfamily
3EYAA 1B76A 4MJLA 1Z83A 3GCXA 4I4CA 2IW1A 2P41A 3EY4A 3IAAA 2A5FA 3KBOA 1JQAA 3PC3A 1XVAA 3PQCA 4PRLA 3SYTA 4F72A 1J8DA 2O0KA 4OMFG 4DSOA 2QMHA 5I48A 3FI9A 4W5JA 1SC3A 3KM0A 3BGIA 4URWR 4OM7A 4YGYA 1T8UA 1BAPA 1ACLA 1GKIA 1PNTA 2O8NA 2VPZA 3U5TA 4DBZA 2CV1A 3C4QA 2OORA 3LLUA 1RAAA 4LJYA 3E53A 3VKUA 4AN0A 4BMZA 1N33B 1JA1A 1ATZA 1P62B 1YMQA 2QAJA 3F7MA 2DGDA 4QG7A 3RAGA 3AUJB 3IQFA 5IWAB 2JI7A 3WB2A 2ZDQA 3G8BA 3KE9A 2NSLA 5FT9A 4ZT6A 2XZLA 3ORHA 2N1MA 5BMVA 4G5SA 3FYUB 4GI1A 5T4HA 3G1UA 4S12A 4AKIA 5JE8A 4YJFA 4B7CA 4MV4A 2OGTA 4HXYA 2IWHA 4Q3AA 1FSSA 3AFHA 4J4BA 4KMMA 5FFNA 4F2DA 3H2SA 3CG4A 3GLVA 4QBIA 3E8XA 2PKQO 3OG9A 4BXOA 1RPNA 1Q3HA 1TCVA 1IY8A 1Z3CA 2BRUC 2XE7A 3RT7A 2B3DA 3DT9A 1Y7TA 3E3LA 4DHWA 4NFYA 4HV4A 2WWVD 4RXUA 4G2TA 1I3CA 2C7GA 4M0FA 3TNYA 1CQZA 1V41E 4B73A 3HCEA 2PE5A 3E18A 5IMBA 5L4NA 2ZAMA 4LQDA 4JXZA 4JLBA 4KC0A 5F73A 3UAYA 2NUAB 3TTVA 3W8FA 4EGCB 5KYYB 3FNBA 2XXAB 2XH8A 1Q6YA 1SNYA 1F5SA 1JGTA 3NVDA 5I8ZA 2NO7A 3R9XA 1AZTA 3PKZA 2QRJA 3R3XA 3VR4D 3ZLTA 2G67A 3KALA 1V8OA 2IZ7A 1EVJA 4GZLA 1ISMA 5TNXA 2LCFA 4J16C 1ZK2A 3ZW8A 3NH6A 4BO7A 3W5DA 4EHBA 2A9QA 1P3Y1 3LWNA 3ND8A 3H6KA 1VLLA 2FR8A 2GTHA 3H1EA 4UPVA 4ZI5A 3TOVA 4BN0A 1NQAO 3PDIB 3TLGB 5GJVC 3UAVA 1IBCA 1LZKA 5HS6A 3JQFC 4ENTA 3E9EA 1RMQA 1Y3FE 1ZH0A 5B1IA 1OI3A 3L8EA 4JLUA 1P91A 5ELXA 1BWRA 6REQB 3T12A 3EA0A 2QMZA 2XRYA 4ZOLB 4LHWA 3EZ6A 2ZSUA 2HV9A 4XOUA 4QBFA 5JARA 2BEKA 2WPNA 5BVGA 3MA0A 1Z0JA 4IQGA 2XD9A 3GLIE 1C7JA 1UAYA 4QPZA 1GG5A 1IY1A 1WMDA 5F3DA 1VE1A 2ZGVA 2YIDA 3UJ7A 5IWCA 3UA3A 3ZIAD 2BVNA 2XW6A 3GH3A 1NVKA 1YI8A 4CG1A 1SZCA 4X65B 1I10A 2ECOA 1RVV1 1O03A 3KU4A 2YZMA 3KX2A 3JWHA 1JE0A 3QBVA 4PLTA 2IXAA 3WKBA 1EK1A 1VP9A 3MGKA 1JDZA 5IKOA 4EB6A 3UMYA 4C7KA 2YQZA 2VDKB 3D43A 3X43A 2HPAA 1TVCA 2ERYA 4CZ2A 4UHFA 2WQZA 4O5AA 1NF9A 3CNQS 4UJ3A 3OZRA 1E7SA 3MJCA 1L5ZA 4YUAA 4ZOEA 2AE2A 3PFBA 4FFRA 4FW8A 1H93A 1YL5A 3OUZA 2QTBA 4RA9B 2CK3D 2PGIA 3NHJA 2Y0PA 1VKRA 1Z88A 3RSGA 4DJJA 3EXFB 1SHKA 1UPFA 2MINA 4IHQA 2CDCA 3E2PA 2P69A 1XMXA 2O7RA 3JU3A 1RYMA 5G2OA 5TF0A 3R0QA 2JHFA 3WQRA 3HCRA 3HA2A 1G8SA 2Z8YA 5LB2A 1I0IA 4CKCA 3OH8A 4CTJA 1AMUA 2CYCA 4MUJA 4DFDA 3BCHA 2MSNA 1F1JA 3Q7SA 1XZKA 5GIPE 4HT3B 1FX0B 3KD2A 2IXDA 1S3FA 3OFNA 4K1XA 3IBTA 2LCQA 1U3CA 3EVEA 3HSYA 3L77A 4YCLA 3OIYA 3T7TA 5FOQA 2NZUG 2I78A 3N6RA 3ULKA 3DEYX 2O2CA 3FX2A 4LC9A 3K5WA 1JPVA 2JGMA 3A37A 1QTNA 3HZOA 3OOWA 4RX1A 2G71A 2JGNA 1XNJA 3L0YA 2VJLA 1NW7A 2JEOA 3UAGA 1II9A 4YTEA 1P7VA 2IA5A 1EH5A 1XLTA 2HK7A 4G5QA 2NO4A 4P93A 3PVSA 5FI3A 2G40A 5I3ZA 1QX4A 1NG1A 3FHTA 5MFPA 2X0EA 1LLUA 2I1LA 5ERGB 5LA6B 5TPZD 3U3XA 3UPDA 3OWXA 3DBIA 3ZTTA 1Z8FA 2JEZA 4EPVA 2RG7A 3N0WA 3WKDA 2QAGB 1KIMA 1NUUA 3U7QA 4UTOA 4B6EA 1KL7A 1NNLA 2VWGA 1TB4A 2BI7A 2YMLA 1P7ZA 3BORA 2IEGA 3KOMA 1S1CA 3LBHA 4IQ0A 1X9HA 1Y8CA 4NYMR 1VG9B 1AKQA 2Q1SA 3AUXA 3ZWXA 3LYLA 2Z43A 1K0FA 4RKWA 4DMKA 3B89A 1CK4A 1EGHA 1RC0A 2P2DA 4EQ6A 5HRUA 1W0KA 5EE3A 3WGOA 1SK9A 1QS0A 2VDRB 1XKTA 1XQVA 2DPMA 1C9MA 5JNUA 1KZHA 2QRZA 1GVNB 1PL6A 3BMNA 1I6WA 1DJLA 3OPMA 5TQ2A 3SQNA 3NUQA 4ZOLF 3NG1A 3OU2A 2CFSA 3OLCX 3SS9X 4W9NA 1I3LA 4BEJA 3LC7O 4MAAA 2IV2X 4BIMA 5K5EA 2FETA 3FFTA 2VEDA 4FN4A 9ATCA 1PWXA 4UFPA 3SD7A 5MGBA 1Z2DA 1SWVA 4KGDA 2XMBA 4UM9D 1UPUA 2VPPA 1E9EA 2I6TA 3DVRX 5DV9A 3I4LA 4OHYA 5ALQA 3L4EA 3V9PA 4RTMA 5ICMA 1NKTA 1C80A 1S89A 3OHMA 3DOJA 1RJEA 4C4AA 2XRZA 4JAVC 3CH6A 4AZ3B 5LKRA 3HDVA 2PT7A 3WGTA 1H2WA 3IT0A 4NBWA 1NVWQ 5AKIA 5KTOA 1ZMBA 3BJZA 1PNVA 4DSUA 4QGBA 4TQGA 1QFXA 1UBHS 2GCEA 2IEBA 4L4SA 3U17A 3ZGVA 4DQDA 3ROMA 2YINC 1PJLA 4Q9NA 3Q0TA 3GARA 5CT8A 1WUKS 4M0LA 3LX4A 5ALUA 2IXBA 1NVUQ 3JYNA 5JAQA 2W2TA 3B6JA 3COJA 2A5DA 3WP0A 3L6CA 4X41A 5DBIA 3GB9A 4DMRA 3JAWA 3RIHA 2DWUA 1KI7A 3MAAC 1GOTA 2JCGA 2B61A 1BH2A 1KJQA 2G0TA 1IB0A 4OY3A 4FVTA 4ZAYA 1MV8A 4HQLA 3IR5A 5GOZA 1E4EA 1U9IA 1WUHS 3CUYA 3KR0A 3ZHVA 1N5LA 1UXIA 3OI7A 4Q66C 3C7DB 1ZVKA 4RSMA 1II8B 3RBAA 2DCUA 5JSHA 3ORQA 2HDHA 3EIEA 3G1WA 3SFVA 3LUGA 1Y3HA 4P98A 2MSCB 1EMDA 3BD6A 1PX0A 2VJMA 3I52A 2YDYA 1HT3A 2ZPAA 4B7XA 3W3ZB 2RH4A 4G0MA 4TMKA 4E2WA 1L7AA 4G67A 2UUAB 1KMHB 1MFZA 1YA8A 2H7CA 2YW2A 2FSSA 3FROA 4FTWA 3E9DA 4QNMA 5TQJA 3RFVA 4DV4B 3WGVA 1EUDA 3IQIX 3ZXSA 4WACA 1IWPB 2KWIA 5F64A 2EKBA 2ANBA 4C21A 3ZCPA 5DGCA 1QHHB 1SU6A 4MW9A 3GLHB 2IC5A 4QRHA 3LA8A 4WWHA 2Q6OA 5EESA 2PU5A 4WCDA 3F5MA 2WAMA 2V6IA 4X8OA 4GYKA 1NSTA 4MB6A 4CMCA 3AJEA 4OX9B 2RCNA 2ZRHA 3EY9A 5KYXB 4A0SA 4PO8A 4BVAA 1CE8A 1G4UR 3DZHA 1UQRA 1PZHA 4OH7A 1J56A 3AHJA 2UU9B 5A2QA 1UK7A 1KDOA 3TZKA 2NMVA 4BLVA 4URZR 5E1OA 3WLKX 5KIAA 1XN4A 1LPOA 1CRWG 2FHSA 2OOSA 3NP7A 2WWYA 2NQTA 2DKOA 4I1UA 4GGOA 3EGXA 4Q1CA 2X5XA 2CNDA 1J06A 3AR7A 1ZVVA 1V1RB 1X9IA 1XYGA 1TZKA 2UUPA 3NDBB 1AGRA 1QV9A 2A0YA 1E77A 3DUFA 4KX3A 2ZQYA 3MTIA 1P77A 2MJLA 4RVHA 2BDEA 3DWIA 2WWIA 3FSRA 4LY9A 2NXEA 1YQQA 3FTCA 4AL4A 4X1OA 2I2AA 3EH2A 5DHSA 5EIEA 5HCNA 3FPGA 3PDUA 4YO8A 2A94A 2VP3A 1UBEA 3D7SA 1UFOA 4BNVA 1E9SA 4HUQB 4GEGA 4MK4A 3BCRA 4RMIA 3RQIA 4B2IA 5K0CA 3MT9A 4XGQA 1RQRA 4FS8A 3HBAA 2OHIA 1T8RA 2DBZA 4NDAA 3TSWA 1SCUB 1ZSVA 1HNXB 2NO5A 1CTQA 1GYRA 2HGSA 3JPWA 3LQFA 3QUTA 4DS3A 3PNMA 2B6NA 4QLAA 4UBIA 4DA6A 1GGVA 4AO8A 2QG9A 2WHPB 4AJNA 3L4JA 3OA2A 1G59A 4CM4A 4U7JA 1UBRS 1JSRA 4L8VA 3I4CA 3TEMA 2NXNA 2Q3HA 3SE0A 5I7HA 2PS3A 1SOMA 3K09A 1XHEA 2WFMA 2NU8A 3IVMA 2AXEA 1X0VA 1FDWA 3W8RA 4BZQA 5YASA 3AF5A 1C0EA 4BO9A 2F48A 2GFQA 3RSOA 4F92B 2AA3A 2ZB4A 3B9QA 3BS4A 5JDIA 3RUDA 5CITA 2XA2A 1N0UA 2B1QA 1LVGA 3UMBA 2ZXUA 2H31A 5LBTA 5D3MB 3HKCB 2VT2A 4Q01A 3T5PA 2QE6A 1T5IA 4H6PA 3FVQA 3R7LA 4UUAA 4R9SA 1JMKC 1ZJZA 1W5TA 1T4CA 2C0PA 2NZVG 2WKPA 1K5HA 4PICA 4MVJM 5SY4A 4LG1A 5J2UF 2OORC 1AG9A 5ALXA 3ZKAA 4GL2A 4E46A 5HFJA 2BFCA 2OLKA 3HO1A 1W25A 3WGUA 5A03A 4E70A 3M7IA 4E5VA 5JISA 3B48A 4DSNA 1XD9A 1KYVA 4RVSA 3NUZA 1G9TA 2O2DA 1M72A 2EX0A 4JVOA 5FB3A 2C2OA 4J0FA 4JYMA 5FRDA 2F8SA 2GR9A 1ODKA 5I9SA 4P5DA 2DUWA 5TE9A 1DIRA 1E1RA 4O3FA 1F4LA 2J67A 3WHLA 3HYRA 1NVGA 5CDUA 3QE2A 1DG3A 3E05A 4BVHA 4MPDA 5K8LA 4KR2A 3O21A 4G4SO 2XNHA 2DFVA 2IDKA 4Q7LA 4JLDA 3NGMA 1IM2A 5JZVA 4V0QA 1GR0A 2AOUB 2YZ7A 4NS4A 4YMUA 4WINA 1F6BA 3PWKA 2QL6A 4O33A 4QJ4A 2GZHA 3VHXB 1CEYA 5FHQA 4DNPA 5GM2A 1JDJA 1A71A 1RIFA 1YOVB 1L4FA 1YR6A 4UNQA 2KBFA 2AF3C 3DLHA 4MW1A 1P8JA 1BVHA 5I7SA 4X61A 2GYVA 1TT5B 3P32A 3UATA 1PEDA 2OAP1 2FR0A 1RADA 5FV7A 3JQ9C 2WAAA 3L7IA 1SCDA 1UJ4A 2P90A 1P1KA 5A4KA 2X8LA 1J33A 1E6LA 5H68A 3IA2A 4UEKA 3JWPA 4HLDA 4AYTA 1T9KA 2FR8C 1M2VA 3R9KA 1OFTA 5DBOA 4KO8A 1A5ZA 3GHYA 4QBTA 3SF8A 4NCNA 4A73A 2M98A 3OQPA 1ZI8A 5HKKA 1DV2A 3CVVA 2WD7B 1OTHA 3N70A 3NBUA 4G9GA 3H19A 4TT3A 3SR4A 2JLWA 2PBFA 1WCIB 4WN3A 1Z8NA 2QGNA 3VI3B 3G82C 5DNWA 2Q2WA 4R6XA 4RQUA 1RKXA 5L4LA 1S8OA 3IV6A 3U7FB 3MMZA 1Q0LA 1E3WB 4NLLA 2RI6A 2G6BA 2GK7A 2QYTA 1WD7A 4BNLA 4B43A 5EMJA 3DE6X 4HFJA 2JARA 4YLYA 1QFJA 4DLRA 1RZUA 3DT6A 3TNJA 4DRZA 5CFQA 3G0DA 3GLGE 1C4OA 3FOBA 2EWWA 4FEEA 1IOLA 2B35A 3GJRA 4JLOA 4KN6A 2XF2A 2WSYB 2XB6A 4GP7A 1J2TA 2AXNA 2R84A 3DDCA 2ISQA 1XIVA 3QVJA 4FMPA 2J08A 1QIJA 3PIIA 4HATA 4TTTS 2IZZA 3ESCA 1YJCA 5REQB 2MWMA 4DG9A 3TF5A 5K0FA 1DCMA 4LPKA 4LRTB 3EXG2 1ML3A 2QN3A 2FFQA 3KQLA 1HDIA 2I4IA 1DDGA 2GEDA 4IDCA 1KU6A 2PWPA 2XCIA 2R8BA 3ZZ1A 3L5KA 1JRLA 2H1CA 2I4RA 2ZATA 1G8GA 3ZHZA 5AUNB 3MUOA 1V45E 3QFCA 4OQEA 4E07A 2CXRA 4KI0A 3F73A 4MZDA 4PCVA 4L50A 1O6ZA 4BU0A 1AV6A 2YICA 4IH4A 5B2FA 1TTPB 1XK7A 2EJWA 2Q1TA 4NARA 3ZI4A 1RXVA 2PRIA 4B6RA 2DHCA 4TTVA 3C3PA 5I9TA 2EKLA 2AFHE 3BRCA 3JQAD 2XVZA 5K0EA 4Z5XA 3GGOA 5J40A 5DX8A 4BFVA 5LLDA 5EWJB 2G6TA 2G28A 2HRZA 3FSEA 4YALA 4EABA 2C9ZA 1Z2OX 1XNGA 1V96A 4LXXA 1L4KA 1LI4A 3WBJA 2WTUA 3JWEA 1UKEA 2JCVA 5LU9A 1BMFA 2A84A 1RQLA 2YWRA 4P4GA 3SBXA 4AG6A 5I7FA 1ZCAA 3RF7A 4TSFA 1RJDA 1JIKA 3PTLA 1RM4A 2H8KA 3HB9A 5JADA 3ETGA 3Q3EA 3PNBA 4IY1A 2PD3A 3OCXA 1INLA 3BMQA 4BKQA 1M5UA 4KJXA 3C6XA 5JAZA 1XLTC 1X7WA 1CP2A 1JEYB 1J4AA 1WV0A 2AFIA 3EQ8A 5AP9A 2JATA 3H7IA 3V4ZA 3ZWNA 5CA1B 1L7EA 3TSAA 1QF6A 1SM4A 4H1HA 1VPDA 1U3VA 1SQ5A 3GFBA 1LV7A 3CT6A 3JVIA 3RWMB 2JW5A 1SKQA 2LPMA 5EZYA 1ZITA 3D6MA 3UGJA 2BHNA 2WA1A 3BQ9A 4KE7A 4O25A 3JATA 1N1MA 5TQ0A 4G9EA 3SC4A 5L7TA 2C1EA 1G66A 1HTBA 2WYUA 3D6NB 1BW9B 3R3ZA 2MSWA 1ESDA 4KAFA 4FFBB 4MS4A 1E4VA 2NZWA 4RHEA 4XVRA 1ZH6A 2VC2B 4X93A 3RYTC 3V7UA 2Y1CA 5C35A 3AONB 1QG0A 3AM3A 2PRZA 4BJ1A 1Q0ZA 3ZDDA 4OHRA 4Q1AA 1ZOSA 4FBLA 4QDTA 4W9NC 2ZJAA 4FDMA 5F51A 1CUDA 5JNLA 2UZ1B 5D7NA 2Z08A 1JLHA 5DX0A 3VPSA 1H4SA 2ZIXB 1T24A 4HXGA 4Q3OA 2C99A 4MWEA 5DTMA 1FSPA 4IHAA 3FPLA 4PYMA 3DL7A 3IAM6 2QUHA 4E22A 3BMOA 3QKRB 5HHTA 3AILA 1X80B 2BZ0A 5F7ZA 4BQSA 2JLAA 5DTEA 3SIXA 3AUFA 4X66B 1LVHA 4XOIA 5AR1A 5K8JB 2XT9A 5KYUB 4KQ1A 4ZPXA 4BQEA 3GZ4A 4EMBA 2V8OA 4V39A 1NIPA 4EPTA 5JMTA 2HLDA 1QAMA 1XTIA 2HFJA 4MWCA 5JSQA 3KUXA 4GM0A 1I3OA 1P61B 1YR3A 3JSXA 1O58A 4W99A 5DK4A 3AI1A 1QVVA 5EPOA 3AERB 1RWPA 4OGKA 5EXXA 4BX3A 3NETA 1PZMA 2ZT5A 1WZNA 4KVFA 3HA5A 2INGX 2O8CA 2FG7C 4HYEA 1Z74A 221PA 2VYFA 3B1WA 5T4FA 1B6GA 3WL8A 5FO0A 4EJMA 2YY5A 3EDOA 3PUVA 4MTLA 3B85A 2P79A 1E79A 3C7KA 3GNSA 3HCDA 3OFND 5DWVA 1NNI1 3AGQA 3VPAA 4C6TA 1A9ZA 2AJDA 3HKEA 2MOKA 4IMRA 4ISCA 5JBIA 2IP4A 3NAMA 4F7DA 5FD8A 1U9IC 1FP4B 2N1BA 1I51A 3GJTA 3NIGB 4GOLD 4H1VA 1B4DA 2YRFA 2WU4A 4PLGA 5EGNA 5ADWA 3N1UA 1JKJA 2K5UA 1X7ZA 3MRXA 1AA6A 1P2GA 2A0XA 3JVEA 4S1WA 4HDNB 5I7VA 2R47A 3ISTA 2AG8A 4I1YA 1MO3A 4X90A 3WFZA 5EFOA 3M9WA 2HK6A 1QZTA 3R6TA 2RJNA 4H7EA 4UU0A 4CR8A 1EDOA 2QTWB 3K1ZA 8MHTA 1MDBA 1XD2B 2C98A 2W2OA 1XRJA 1HDXA 1KZ1A 3LU1A 2E6UX 2YHIB 1WZ2A 4N0PA 1NTOA 3BFJA 2CUZA 2CDRA 3RYCB 2ZBRA 2O3TA 3KR2A 3WIEA 2PX0A 2JKVA 5HF9A 4UMEA 1II0A 3KCQA 5SZJA 3LT4A 4XSVA 3AVYA 3DFIA 5ENZA 2B7LA 3N0VA 3U31A 1YRWA 2DC1A 2VSXA 3GHHA 4TVOA 2W90A 4BQPA 4DNFA 3LL7A 4R2JA 3UOWA 1N8NA 1WUTA 1KC1A 2ZBEA 4OJNA 3U1TA 4N76A 2ZR7A 4C1BA 4L8FA 4C7OA 4N0QA 3V4LA 1JG3A 3OT1A 1MD9A 2Y1EA 4ZFNA 4ZVQA 1JV2B 4JUDX 1KYTA 1ZI6A 3PSAA 2YOGA 4CMIA 4IIJA 5BR7A 3KQOA 2VPYA 5CG1A 4X3PA 4M1WA 4NNPA 4WCFC 1W0KD 2ZIZA 3AQIA 3D02A 2NQ2C 2X14A 3K1YA 4YI5A 1U2TA 3M83A 3A6GA 1IBKB 2W43A 3VOTA 2FQQA 1DAIA 2EZ8A 4ALJA 1N7GA 3KFXA 1EUZA 4FCCA 3RU9A 2C9MA 3U4AA 5E3HA 4KB5A 3AHEA 4L6CA 4OJMX 3G2LA 1GU1A 3ZW7A 1ECFA 5IBQA 2WJ4A 3LUHA 4AIIA 1RCFA 2P40A 2A14A 4GX1A 4JR1A 3R0ZA 4TXNA 3KFVA 2Z6QA 2F8LA 1T4GA 5ALLA 1HWYA 1Z7EA 1JDSA 3J80A 2A59A 1OLUA 4D57A 3K0EA 1BDIA 2XKJE 3VR6H 3LXXA 4XD7A 3R9IA 4AJ1A 4IWYA 1EHIA 2PQ6A 5BMVB 2Z95A 3I2HA 2ZYHA 5AKGA 3QPCA 1OXKB 4KJZA 2AFHA 4NG5A 1M7BA 4US0R 2ODWA 3JQAB 5CTJA 4YVFA 2OMKA 4FONA 4N3CA 3WMRA 1O89A 3SZMA 4GIBA 1WDMA 2W22A 2WVAA 3LHDA 4QGFA 3VR0A 2WWGA 1A8IA 4PQFA 2AXPA 2H9YA 2O3JA 2XMSA 5ALNA 5E6UB 5IH3A 5MN4A 2JLZA 5IK2A 1H69A 3K70C 3K09C 4J2TA 1PRYA 5H3HA 2B8EA 4YAFA 4TN5A 2CBGA 1G16A 2BFOA 2IU0A 2DBVO 1E59A 2P75A 5AJHA 2FQYA 2HHHB 3V48A 1RACA 3NVAA 4ZVRA 1ZUNA 2BR3A 2O7NA 3QX7A 2KE5A 4DLLA 4KPUA 5JDIC 3L7BA 2XQVA 1NXXA 3UYKA 4KN9S 2YWJA 4TZTA 2QMUA 1CKEA 4JIMA 1NPTO 3T3EA 1C9YA 2WILA 1JXAA 4UBMA 1ETHA 1ZRHA 4ZAGA 4C2TA 2Q0HA 5ESRA 3SSNA 4JUCA 1NJ8A 4HO1X 1SCBA 2ILTA 2MR5A 2AHOA 2GBLA 5DSXA 3GLFE 3IBYA 3GJQA 5E2BA 1EWRA 1RLOA 3V46A 2F62A 3BMXA 4EX7A 3AL0C 3T7DA 1GARA 2FZ5A 1JTFA 1P33A 4RTPA 3QEOA 2A57A 5B55A 3VRHA 4O4JA 2ECFA 4FQ5A 2P3SA 3KRTA 3R5FA 4H77A 1HLDA 5A04A 4LFBB 2KW5A 3ORFA 4JBGA 3RDPA 4HNTA 2Z8XA 4Q5IA 4C7XA 4M55A 5DGIA 5BVGB 4RD1A 3N8IA 1Z68A 3WGNA 2FPRA 4I9UA 4LF7B 5JFOA 4PWZA 4QFCA 2KI5A 3FDJA 2Q7OE 4JI2B 2Y9MB 4GO1A 1KS9A 2C29D 2AWNA 4XLLA 4F1JA 4KGXA 3UWSA 3NV9A 5A02A 1TCAA 1F17A 2I71A 1BA2A 1JAXA 3P9IA 4MAFA 1ULHA 3I9KA 3QG1A 4CL3A 3CVUA 4HDSA 4X7BA 1JI3A 2VF4X 3NIWA 1ACJA 5CLJA 4EB6B 1OQAA 1P60A 5BN4A 1A5SB 3VAYA 2YZ2A 4D44A 1CFJA 1DU4A 4H6WA 3K8YA 3UXYA 2Z3VA 3M5DA 3LUPA 4U9IS 3QTTA 3VTFA 1K0UA 2ZWOA 2Q49A 3C5CA 1VHWA 1UXOA 3T4UA 4D74A 2ZTMA 1GITA 3CSSA 3IULA 1XNRB 1D1QA 1JQBA 2QUAA 1G8JA 2X5JO 1J90A 3T9EA 1ESZA 4EZIA 1EI9A 3BQMB 3TCXB 4G01B 3UY4A 3VU1A 2ZCUA 4R8RA 4DGSA 4CKCB 1EWQA 3TW8B 3QEKA 3VOAA 2VQFB 3AEXA 2Q5EA 4UASA 1JYFA 3FYHA 4CUZA 3C3MA 5D5QA 1OYVA 1DPGA 2OCIA 3AI7A 3GBVA 5E1DA 5JHHB 1CYDA 4YIKA 5BMVF 4Z49A 5JNRA 2SCUA 5FPSA 4UTZA 1SD5A 3CEPB 1SOWA 3GWGA 3JR7A 2ODNA 3EVTA 3FWZA 4PNZA 3GAZA 1IHUA 1ONOA 2IDMA 3O82A 2DBQA 3PIRA 4S1PA 3K70D 2ZB8A 1EWTA 1FXWF 3KEFA 1YZLA 1P6UA 4CODB 2H2GA 1RBMA 1W4LA 2AJTA 3SHVA 3U40A 1J2UA 2P9EA 4FSXA 3UKJA 4C5BA 3DXZA 4BNDA 3DH0A 1QHFA 3QZUA 1GLVA 2ZIWB 1YR2A 4F4JA 1A5BB 2WUEA 3COZA 1Z17A 2AB0A 3AF1A 4JXKA 1O87A 2WW8A 1IAVA 3K9CA 2DQYA 2R4TA 3DDZX 1DBWA 4R6WA 5BYJA 1M34E 5C2JB 1QVWA 2X7JA 3ACDA 1P75A 2E89A 3DTTA 2G76A 4FYHA 2KS6A 3MQFA 3O8QB 4MIOA 1ZK0A 2WSSA 2B3TA 3I5MA 1JFTA 3PT5A 4PAQA 3P9YA 3L0SA 4GRAA 1E9DA 1H5NA 4YGXB 3U7QB 4R1TA 1OB2A 4N48A 1XV5A 4LFCB 2JC3A 2AW3A 3BFXA 3KNZA 4KKVA 1TO2E 4J03A 1P2SA 1CVLA 3OAAD 3T5TA 3NONA 3TDNA 3ZEAA 3I5XA 4WW0A 1A96A 1WF3A 2FPSA 3PWTA 1KBQA 2CVZA 4X5OA 5AJWA 5A5FA 3FJ1A 1U0OC 2CBZA 1RI1A 1QS0B 2ESRA 2GYUA 2PGDA 2PMDA 5AOVA 3QVOA 5EIFA 1EGQA 2OXCA 3ZWCA 1IK4A 2VBFA 5LDGA 1FEZA 1E1RD 2QM0A 3CLUD 3N2ZB 2GJ4A 1NLMA 3P27A 5KYWA 421PA 3HFGA 4GX5A 3WNZA 3NKFA 4RPLA 3ER8A 3VAAA 4N41A 3LVFO 3HGQA 4DWOA 2BGGA 4M49A 3BK2A 5I4KA 2UUOA 1QPBA 4J4HA 2QNIA 3D2LA 4P3OA 3GRAA 3B78A 3ST7A 1OSNA 5G0WA 3SEFA 1TZCA 3UAWA 4R31A 1R5OA 2WMYA 3TBFA 2KLHA 3BZUA 4HYYA 4JJKA 3CRRA 4ZO9A 1Q3TA 2E6KA 4Q6BA 1XCBA 3R8XA 1V71A 2OFOA 4RORA 1KE1A 1BTOA 3QPUA 4YJ2B 2QL9A 4AK9A 3EFOB 1PZFA 5EFZA 4BPBA 1NJ1A 4HDOB 4JC8A 3DHWC 4EO4A 4WXEA 3REOA 3RBZA 3CN7A 4O1HA 1Y4AE 1IYZA 2OM6A 3CB2A 4Y2PA 1Q1NA 2BR5A 5L4SA 3FAZA 2GD0A 4DCMA 1D9ZA 1Z4KA 1PGQA 2F4NA 3JAWB 3BICA 3AF6A 1PLJA 3LZ6A 4FLMA 4KDRA 4R0MA 5HE8A 1LF0A 4Z7QB 2FG5A 5HKKD 2V45A 5JJKA 5AKZA 3PNOA 5P8WA 2IVZA 5AW2A 4IFTA 4HVCA 5PNTA 4TT3D 4GOMD 1Q95A 3PD7A 4WRRA 1E4EB 2O5VA 3WRWA 3IR6A 2WM8A 3O84A 3TOSA 1SRQA 4JNCA 4MKFA 4GP6A 3U3OA 1TF5A 5JYEA 3K0FA 1Z6PA 2R00A 1LVUA 1BH6A 1KR2A 2VF2A 4JC0A 4PNPA 2RB4A 3LXUX 3CG0A 1ODIA 5HBRA 3OURA 5KAMA 1H5UA 4FEAA 3SZ3A 2Q5HA 4U9HS 2RAUA 2EJUA 1S3GA 3D9QX 1KORA 1Y48E 4DEVA 1AX9A 1HQKA 1EESA 3KJNA 2MCFA 3DBRB 2ZSBA 3QXGA 4Q21A 4OFBA 5EP2A 3ZVKA 5TF4A 3FPJA 1IG3A 3RARA 1QTIA 1DQYA 1X1SA 4UJ5A 4ZYXA 4H7DA 2VDJA 1KU0A 4MYRA 3ONVA 521PA 3WP1B 5JV5A 4ZVKA 3WB9A 3WBFA 4TQ9A 2YYYA 5B3KA 1WB9A 3AF0A 4HY3A 2JA1A 3IUJA 4AKHA 3H13A 5AIBA 1F7VA 1SR8A 4TRRA 2O2IA 4F3KA 2Q9CA 3BT7A 4EHFA 1X7XA 2OPBA 4CUJA 4BO5A 5K4GA 2R6GA 3CONA 4JUBA 5J2TF 2C96A 1USIA 1Q6ZA 4WCFB 4F56A 2GMWA 4M8LA 4MIKA 5E6SA 2DPLA 4TVBA 3INRA 1C9JA 1ZXBA 3WIOA 5AVZA 2HJRA 4AX8A 5EOVA 4I46A 1HV8A 4DC0A 4KRGA 3RVKA 2RK4A 4JVSB 4OA8A 4HRVA 4OFWA 2P0AA 1JA9A 1JLRA 2QP4A 3G6KA 3PPWA 4GXNA 5G02A 4IPTA 1YMVA 3ZY5A 1R4NB 1WV1A 4ZALA 4B74A 5IKXA 1ZIXA 5K6AC 1F2VA 1BMFD 2HJHA 3QUCA 1U8EA 2CF5A 2GEKA 3G5AA 4MINA 4TSFD 3VR5D 1C3EA 1DL5A 1ZNXA 4BWVA 1Y5MA 3B2QA 4IJQA 4TLAA 1Q7CA 4HF7A 3FBTA 4GRDA 3AMVA 1KARA 4MDYA 3S68A 4XFKA 1CQJA 3SVZA 3VU3A 5C7LO 4KWEA 4PZAA 5KYNA 3G9ZA 4R8MA 5CT4A 4OI0A 3WG9A 1U0BB 1GTG1 3LRPA 3UANA 2ASEA 1ISJA 1WPRA 2WKRA 3C5WP 4IFBA 3U3JA 3SBDA 2P7IA 4YAGA 4KMSA 2EFYA 1YIOA 4L4YA 1F8GA 2ONZA 3EEBA 3EOAI 4EFMA 1J0DA 1E1CB 1NQVA 2D2EA 2ZUCA 3NHYA 4HEA6 2GRAA 3GCZA 4NG4A 1Q17A 3DO5A 4ZDKA 2GWHA 4M8KA 4NONA 4IHJA 4AJIA 4IJ5A 4MW4A 5K3EA 4ZKEA 2JBWA 2FZ4A 3VDMA 3PQ8A 1GZDA 4INJA 2GFHA 4ID9A 3RSZA 2B4RO 1TD9A 4HCJA 2VKTA 4OXQA 4R51A 2CLHB 5HIMA 3SEQA 2YCLA 4RTNA 1KJ9A 2C2KA 3HFSA 4K87A 1SQGA 1KKUA 2AVNA 2YQ4A 1C7RA 3VZQA 4ML3A 2F1JA 3TSCA 3HNPA 5GOTA 3U1VA 3HZRA 1XPRA 4CQNA 2J5QA 1E7MA 4C4PA 5FYDA 4OSOA 1J5PA 2OBXA 4K9OA 2IHUA 2O2JA 3M3HA 2P4QA 3ONDA 4O4LA 1M2HA 1SU4A 2AVDA 4PG4A 3I6YA 6AT1A 1DMRA 1REQB 2QM3A 1U31A 4AJOA 1B0ZA 1M3SA 1VB3A 1S8FA 1Y5RA 3L1IA 3OX2A 4QC2A 2IRWA 2P2ZA 5CVUA 5HWSA 1XPUA 4A0GA 1LFAA 2BM1A 5HUQA 1IBSA 2X8AA 1JR6A 2OG1A 5IJZA 1CY0A 2H2DA 4FKBA 4JT4A 4BB9A 3EGWA 3R3VA 2C4KA 5TX7A 4EKEA 5CPBA 5CD1A 1FPQA 1WZEA 2WSBA 5ALFA 1DRVA 3VPCA 5BNFA 1O6CA 2FOLA 5KINB 1C8VB 2HLDD 4ZMRA 2F3RA 5KOJB 1OH8A 1EE9A 2N0SA 4ONEA 2ODAA 5FUBA 3U39A 3PXXA 3Q15C 5CIQA 3RYFA 5BYAA 2FP4A 4OGGA 1N0HA 1RWNA 2A1UA 2H5EA 2C95A 3HXTA 1Z73A 3A3YA 2XE4A 4NBSA 4IHKA 4YS6A 3HUTA 1QCDA 1QF7A 4H3KB 1GCGA 1QGAA 3AFNA 1UFRA 3EG9B 3ROPA 4F5WA 4UUQA 2L82A 3PNPA 4P22A 4YP5A 1W59A 5CFLA 1J2JA 2FXVA 1E79D 1K5DA 4DDWA 2XCQA 2XCUA 5U4XA 3RRFA 2ZTUA 3OZDA 4F96A 2R8XA 2EP5A 3EZLA 1JHOA 2NNLD 1EWVA 1OWNA 2Q3FA 4H7HA 4R3WA 1NL3A 5EE0A 1K3FA 3ANMA 1J00A 1XDSA 2A0FA 1ISGA 1XCGB 2FEXA 3AKYA 1G0NA 1V47A 3T3DA 2HB6A 1U6KA 1O1YA 2V6JA 2LRHA 2C42A 2GBLC 2WIDA 5C81A 2FGKA 4IDFA 3ZGOA 1NFRA 5T8KA 1WW8A 1M2VB 1G3UA 5KOYA 1XALA 2Q1XA 1UP7A 3EIUA 4ZOAA 3KTAA 3U16A 5IUNC 1HOXA 2VTKA 1KZYC 1IZ0A 3Q85A 3SF8B 2ODPA 5KHOC 3EUWA 3DFKA 5TSDA 5HF5A 1GTRA 2WSMA 2ZSJA 2IGBA 3LSTA 4IX1A 3PS9A 4LOAA 5E38A 2VHYA 1I2MA 3Q9SA 3V2GA 3X1JA 3LO5A 1Y7IA 4Y6QA 1B0PA 4WUVA 4DN6A 3LLMA 2XGJA 4AMZA 5KNDA 3S7ZA 1ANKA 1JB9A 2OZLB 2V3VA 1ONNA 2GCGA 2PZAA 3BM5A 3C8DA 3NBYC 4JSTA 4JUIA 4AROA 4UHJA 1PZXA 2IEIA 5JSZA 3QMVA 4EKGA 1MLDA 3QWFA 5H4GA 3EVZA 3ZY6A 4ZJPA 4AZSA 2B9VA 3OIWA 2F3QA 3QYPA 5FOWA 1S02A 2XTAA 4M4SA 3G7NA 3O75A 4QOGA 3WGLA 4POAA 1U7TA 2AX3A 3L1KA 3KG2A 3CKMA 4F91B 1TAQA 1VA5A 2B83A 2XWQA 5KNBA 3ELDA 1UMCA 5CYOA 5J63A 5GM1A 1AF7A 1QHEA 4PN3A 4YCMA 4YDQA 3UMFA 4RDHA 4YP6A 3OMXA 5THKA 1DADA 1BCRA 2CXXA 1LB1B 3KT8A 3RBXA 3MB8A 1JG7A 3CX7A 4Q9AA 4KV7A 1JSCA 1T3LA 4HN2A 4LJLA 1KZ6A 4Q02A 3SWWA 3T94A 3FUUA 4R5MA 1DOHA 2G08A 2WHXA 5IAJA 3ZQ6A 4URFA 4BFLA 4DMHA 2H4HA 3HLKA 1TUEA 3DAOA 4I4NA 5K4HA 1EHYA 4CMBA 4DLWA 4W6ZA 1G60A 5EI5A 1Q21A 1WTAA 4GLJA 4UTRA 1A1VA 5GADl 4UOQA 2C3MA 2VTEA 4YV2A 4NECA 3QLVA 4YR7A 2I6GA 2VZ8A 5IK2D 4K0KB 4FYKA 2AI2A 1GNLA 2VZ9A 4KAAA 4BE4A 1A50B 3KQTA 2IV3A 4L4XA 5AW7A 2NZYA 3AF2A 2IEDA 1SURA 3G88A 3A6DA 3DD1A 2D7CA 2DR2A 3T15A 2GF2A 2GLXA 2G25A 1JNXX 2AN4A 2YWBA 4I4TB 4UTPA 1UAAA 2QI9C 2FMHA 3PNLA 4EI7A 4DR6B 2QM8A 2AFIB 2R7LA 4ILKA 4DUYB 3LF1A 1SBQA 4EZEA 3A32A 5IBPA 5LXTA 3DV9A 4II3A 3TIIA 3QNMA 1N0VC 4LRWA 3MG9A 1OV4A 5FADA 5AW4A 1K8ZB 4H59A 5H16A 4JI6B 3VV2A 2D6FA 5EIHA 1PBTA 3AFGA 3RC2A 4K9NA 4QPPA 5CIYA 4DLUA 3OSUA 3UJCA 1DX6A 4MP6A 2J3IA 1BEZA 5MF6A 5T7BA 4F3YA 2WIKA 1U9YA 1FJ2A 3JATB 2H1VA 3VYUB 1G5TA 4YCSA 3B8HA 4GKAA 5K4AA 2JAHA 1OGJA 3FKSA 1QU3A 4RQAA 5KMGB 1U2RA 1KK3A 4XGIA 2COEA 2AOVA 3HB5X 4B4VA 2CXQA 4W5WA 1JG1A 3OHPA 1TQDA 3EG5A 2ZU6A 1TK9A 3GPIA 3KJZA 3DLBA 5KSZA 3QF4B 4MMYB 1SBNE 3T3PB 2FPKA 2OP0A 3THWA 1M6WA 2JIDA 2XNDA 2IT1A 2Z5GA 1E2LA 4OXYA 1UWVA 3OHSX 3B9BA 3M70A 1ULAA 4WADA 1MEEA 2PBRA 1Z3IX 2XE8A 3UJ3X 1KP2A 2PS0A 2HQRA 1YGYA 2OXRA 4YASA 3BMOB 1NOKA 1UEJA 4O08A 2CEAA 4Y7CA 3RV3A 4TQAA 4P4TA 1YJ5A 3BH6A 3QTBA 4Y6OA 2I0FA 1W75A 1GUFA 1Y63A 2XQJA 4D56A 2D1RA 1GQSA 1RM0A 2XNKA 3DDNA 3LX8A 3CX4A 3MOSA 4XDZA 5IN5A 3SR3A 3E15A 3CXRA 5ED0A 1E69A 2Y4OA 4KE9A 3ZZMA 2R9VA 2UVPA 3GBSA 1VJTA 1AK2A 1JS1X 1VLVA 4YUVA 4DLYA 3PR1A 1RBYA 1U8UA 2EWVA 2AJ8A 3ESYA 4L08A 3ETCA 5DDIP 3KDAA 3MJ4A 2Y2UA 2JI4A 1OHHD 1U0NA 4MPPA 4W8OA 3S2GA 3DUWA 3G17A 4S1TA 3VISA 4UXIA 2O8CB 2EKPA 2OK8A 3EIQA 4Q4DA 2R8YA 2VLBA 1DRJA 3AI3A 4PYOA 3TYXA 1K6IA 1WSAA 2ZTVA 1Q57A 5K8CA 3ANXA 4ZYZA 1TJ4A 3F4KA 3SXPA 4TXJA 3HKEB 1N2EA 3NOXA 3S40A 4EFKA 2DJ5A 4X97A 3AM4A 1PQ4A 3IHTA 2QZ4A 4HAYA 3SYMA 1WETA 1G7RA 3BQNB 2CVFA 4R4JA 3C8MA 1X7ZB 2DR3A 5EJ9A 5FTKA 1AQNA 1MO5A 1ZVMA 3IKJA 2VYCA 1VP3A 3A9UA 2R00C 2IH5A 1T1IA 5T6MA 1B6RA 1YIDA 4ND7A 3BJIC 5B1SA 4IG9A 3B6IA 4KTTE 2B4YA 5SZIA 1TUBA 1WLSA 2H16A 2P3QA 4DIEA 3LI2A 3H16A 2XTJA 5E7MA 4A15A 3F5SA 1EGMB 2ID4A 3IHWA 3QM1A 4P3PA 4TS1A 1OA1A 2DBYA 3KKKA 4XWYA 3X1DA 2BFBA 2FF5A 1H1DA 2B6HA 4Y2HA 1JDBC 5FJJA 2NPFA 2WSSD 4BTEA 4BP1A 2AKAB 2I8AA 3Q6IA 1SPBS 3UBTA 3R6LA 4HWTA 2Y93A 3T1HB 5C1IA 1FMLA 2C7PA 5JXJA 3WLEA 5HZGA 1FTNA 3OQJA 1PR1A 4RQTA 3LKVA 3DMNA 3QW2A 5EZYF 2EFDB 5DN6A 3CLKA 5BR4A 1Q0TA 1KOJA 5F1YA 2ZSAA 2XYHA 1Y1TA 5FI5A 1IPHA 4YWHA 1FNBA 3IEKA 5K8IA 3IE1A 1G7TA 3OQ1A 3SICE 3TVTA 1A2BA 1SCIA 3HRHA 4LE1A 1V6AA 3RC7A 5I4BA 1T26A 1O94A 3GG9A 2BLLA 2LIVA 5JRDS 4KODA 2OKCA 2PXHA 1FU8A 2CNOA 2Q5CA 2HU5A 1F14A 3OPYI 1Z33A 4N9WA 4OLBA 3GCDA 1U02A 2CJFA 4JI0B 2QRPA 4RWZA 4PX5A 2WQ6A 1ZL2A 4FHDA 4LGCA 1GGKA 1OLUB 1BX1A 3O4HA 2OMEA 3F46A 3FTFA 4IIBA 5FUXA 3RC8A 2XDWA 3N2YA 5CLHA 2ID7A 1KNQA 3EPKA 1Z5PA 1PSWA 3ABIA 1CJBA 3PL5A 2FWMX 1UMKA 5IPFA 2O8DB 4JYBA 5EPEA 3ADCA 2XUQA 4LC0A 3F2IA 4IF6A 3P0JA 3UK0A 1A69A 1VPVA 4BCDA 9MHTA 5D84A 3EA5A 2PQ2A 2R1UA 3F6YA 4LMAA 4O59O 1NUHA 4CV2A 4ETIA 5K6RA 3QE4A 4TTAA 3OT5A 4RY8A 2JLVA 1ADCA 3E1KA 1CIPA 2YX1A 4B9AA 4C5AA 5LYJB 5CFRA 1S1MA 2IHJA 5IDXA 1XTPA 3F2VA 3LYHA 3PRKE 4LHXA 5BR8B 3PX7A 3P0EA 2JJMA 4BE9A 3D4BA 4L95C 1HG0A 2YCBA 3KXDA 8ADHA 3BBLA 3TCKA 4BB6A 2FZLA 4K8RB 5IAEA 1VA4A 2DKNA 1Z4JA 3IFSA 3E9QA 2OZVA 3L8DA 5CGZA 4FILA 4ZT4A 1PUIA 2D8AA 4KPUB 2Y71A 1NUSA 4FEGA 4XPZA 2ZSIA 5D01A 3RIMA 3TX6A 4UM8B 4LE2A 2N47A 5FTLA 3GRKA 3HS3A 3OLQA 5K09A 1H05A 3MS7A 2VXCA 1C0PA 2RHCA 3ZE8A 5HIKA 4HNAB 3DCNA 2HUNA 3A4YA 1IZYA 4K9LA 4ECAA 1H1TA 2EQ5A 4ZYLA 4DKJA 1ZM9A 4HG2A 2WP0A 1NVDA 4K6CA 5CMLA 1VLQA 2B7BA 2QQEA 4YJGB 1Z7YA 2W2LA 4WFKA 2HRCA 2DM6A 3Q8MA 4TL6A 4UE2A 5EQTA 4HZUA 1GG9A 4H08A 5JS7A 1X42A 3F7NA 3RJTA 2F3UA 4V0KA 3WY9A 3CXUA 5I8PA 1I4OA 4O1MA 4L22A 3ILHA 4XFDA 2FVYA 1SIUA 1FFBA 3L6RA 1YVUA 3AK4A 3PV0A 4M7WA 5HYVA 2IH2A 1B0UA 4K28A 3IA7A 5TMPA 2NNWB 5ER9A 3QVGA 3WMXA 3H83A 3QXJA 1G9SA 1DRKA 2RE8A 5BMOA 7MDHA 5JYDA 4DCJA 2FMTA 1RKBA 3QOFA 2YS7A 2KHZA 3CM0A 1OGIA 2OT3B 4KSBA 3V5NA 1KTIA 1NOJA 2HF2A 1HZZA 4NYIQ 1NI4B 2NUTB 5BN4B 4AJLA 1QH1A 4UOEA 3DAGA 5IBRA 3ZCUA 2V54A 2VJYA 4IX9A 4WECA 3UGKA 4F2PA 4TKUA 4L8GA 3HYNA 4U63A 3S6JA 1DRWA 1R3DA 4MPRA 3VYRB 1VYVA 4XLZA 1ZIOA 2F9FA 4X62B 3GUVA 1TTTA 3I9JA 3RU2A 3ABZA 3VKGA 4NPHA 1VPTA 3BB1A 2WABA 1CJTC 1CG6A 1SVSA 3V9AA 4G85A 3DTYA 3C6MA 4YXFA 4UNNA 5ECGC 2H18A 3WL6A 3MGAA 4DJAA 1XCLA 2HL6A 4MO2A 2P9TA 2BJHA 4HDKB 4R8KA 3LCMA 5FUVA 5T8KC 3UV7A 1XFAA 5JI3E 1F2DA 4UVEA 3WLHA 1VMEA 1WNTA 2Q41A 3ZQJA 4IJMA 4RMNA 4F84A 2XZOA 4E21A 2I4NA 3AW9A 1OFIA 3Q0EA 2CWDA 2SCUB 5EZQA 2NU7A 2CZQA 5BQFA 5AM1A 4ZQEA 2GD1O 2HWWA 3FAKA 3R77A 4C3UA 1GPJA 2IS6A 1QK5A 1RI4A 1MRSA 3O3NB 5KU7A 5K3OA 1AKWA 1UDRA 3R5SA 4MQ5A 1OI4A 3BDIA 1KERA 3ZK9A 4JLNA 3STTA 4QVKA 1P0QA 3ZYCA 1HDGO 1VL2A 3D0KA 3JQ7B 4E31A 4R98A 3SP1A 2AI1A 1VSUA 4BNDB 1RXYA 5LYJF 1I1NA 5JXWA 1ILWA 3F49S 3FBWA 4NBTA 1TAUA 3DDWA 4E30A 4KACA 1GAXA 5CVJA 2GXSA 4YECA 4BRZA 1KYYA 3C85A 1R0KA 3WDSA 3I9V1 4BKUA 2RMKA 5ULLA 2R8RA 1TL7C 3P94A 4C5CA 1J1IA 1FUKA 4HAIA 1AQ6A 4PIMA 1TVEA 3HBFA 2R5FA 2VDOB 1N2JA 3LV8A 1ODFA 4CCSA 5C46F 1IEWA 3AYXB 4IEIA 1L5RA 4JI1B 2CV0A 4AUMA 3TB6A 3SIRA 3HCBA 5BW8A 4QU5A 3F71A 1ABFA 1T5BA 3KUUA 1M6HA 1YKGA 2R79A 1L9KA 2YC2C 3FF4A 3CCBA 3PXCX 4MRPA 1YKFA 4B8ZA 4EI9A 4CT5A 1G20E 2L0XA 3CW8X 3IOMA 4FFVA 5KVAA 1SN7A 3TPFA 2CFCA 2P3LA 2QQ0A 2QLMA 3AJ8A 3FFXA 5CNKA 2Q3EA 4Z8XA 1W48A 3KZNA 4ARZA 1X2BA 2XD4A 1NI3A 1LSJA 4V0SA 2VDPB 1AZLA 3Q7IA 2DPHA 3MERA 1FYXA 3RVPA 1NNEA 3KETA 5KYWB 2CHUA 3G5TA 4G0YA 1ZVQA 1L4HA 5AHRA 3H2BA 3WNVA 3AIOA 2O8VA 1J7KA 1QKKA 2GCIA 3HI4A 1DX9A 3GVCA 1I2BA 1G21E 5JROA 1YUNA 4G8JA 3MWJA 2LVBA 4PLVA 2OYSA 3P52A 2ODQA 1KH3A 2P2NA 3BA1A 4OQQA 6LDHA 2DETA 3K0HA 4DYDA 1L5SA 2O59A 4Y0VA 2W6CX 3WRVA 5A6SA 2OOKA 3X2EA 1HLGA 5FOXA 3THOA 4YNBA 5KTYA 1YBHA 2PT6A 4IDOA 2HU2A 2SHKA 3GP5A 3IDSA 1T9DA 2G8NA 1R0XA 3H5AA 4RESA 4ZVOA 3KLMX 5ADUS 1PHRA 3G0IA 4UTVA 3ANSA 3AF3A 2YH2A 2FHPA 3ZWBA 4XVHA 3BCSA 5B3LA 1SXPA 3S55A 1W36C 4DR7B 4B3CA 2YMPA 1ZXLA 4F3NA 2D00A 1V6CA 2R7AA 2FW8A 2VAXA 1A5AB 3C4JA 3OZFA 4O2AB 1WWKA 2OCGA 3QYAA 1GVHA 2E7ZA 1RCTE 2OCYC 4MUHA 5AK5A 3WSVA 4F4HA 1KNXA 1BYIA 1P9NA 1V4NA 2BGTA 2FWRA 3NPMA 3N5KA 5FO1A 5HCUA 1QHSA 2X1LA 3MWYW 4K6MA 4L6IA 4MRMA 2R7KA 2V4MA 3VPXA 4BO3A 3I9MA 3OJOA 4DLAA 2Z57A 3CH4B 3INYA 5B58T 3ROFA 3BBPA 2WU3A 4LRQA 1WMAA 4YP7A 4OXXA 4QPNA 1TFUA 4MVJE 3Q7EA 4NCIA 4P7FA 4PRZA 3PJEA 5KNDD 4X94A 1SUIA 5IAAA 3K0FB 4AWXA 1G55A 4E2XA 1KWKA 2OCAA 3KVNA 4MDHA 4AF6A 5A9SA 2NSDA 5HJ5A 3VNVA 2WWWA 5C8XA 1UBGA 3ZDCA 4KITB 3LGSA 1Z2CA 4OXRA 1O5IA 3C41J 4ER3A 1GWNA 2HHAA 1J0AA 3RROA 5JSFA 1CUXA 3CPSA 1FYWA 4MQEA 4YCJA 3WYFA 3X0DA 3D6HA 3RIYA 4A6DA 4RTLA 4V1CA 3DPIA 1C8LA 3C1OA 2VDWA 1ZONA 4KXLA 3ZV7A 1R6AA 1C9NA 2CEKA 3CURA 4LMBA 2PUAA 1Z2PX 5KNBD 2QI9F 3BTOA 1CUEA 2VKQA 4FZRA 5BYKA 5K45A 2ZYWX 3MJRA 2X58A 1RM3A 5K8TA 1AJEA 1B1AA 3QUBA 4JSYA 3JAKA 2Q5IA 3T41A 1Z0DA 2JFQA 4ZCQA 1JXQA 3QTLA 3K05A 3VX3A 3M6UA 3A6PC 4HK4A 2FN4A 1XZFA 1V3VA 2KPOA 3EXG1 4MUGA 4XYGA 3RVNA 5HRAA 1YGPA 5ECYA 1F4PA 4LY0A 4LXTA 4RA6B 4TVKA 3EIFA 3M3DA 4C29A 5KC8A 4IVNA 1OWPA 1HLPA 3EVGA 3UWKA 5CFZA 2P68A 2H1SA 4XR4A 2QSJA 1QUEA 1AN0A 2BDTA 1XGKA 1QRUA 4TZ0A 3GJ0A 1NXTA 4QDKA 2DG2A 2A9KA 3FDZA 3Q3VA 4Y2TA 3FPKA 3I34X 3UUGA 1DT3A 2VJCA 2Z1DA 4FFNA 2BSAA 4RHTA 1W1UA 4HAUA 1FIUA 1NQTA 2AV6A 2VWPA 1CJKC 1YK0A 4M21A 4Z0PA 2HMUA 3GNLA 4UZEA 5TT1A 3RHTA 1E2FA 4J7UA 4EHJA 3G1TA 4PC7A 4CV0A 4ZHSA 4LNAA 1ZSYA 4W1SA 4LYHA 1WB5A 4J3JA 4Q37A 3O5AA 2QT1A 4F1KA 3FPEA 4Q9HA 4NK5A 5ALJA 1GQFA 4EF4A 1DWPA 1Z5UA 1WKBA 1IN7A 3G0GA 1W49A 2G06A 4Y2QA 1Z7GA 1IC6A 4ZI2A 2QJRA 4N5MA 2B69A 4B80A 1GTSA 3O95A 3RJ5A 3RVBA 1JJBA 1TA0A 1W36D 4UDYX 5H80A 1KQNA 2O1XA 1MC4A 3NHLA 4IHJB 2OHFA 3BIFA 2HBYA 3PFKA 4H0NA 3JASA 4PXYA 5IZCA 1M67A 2IUUA 5IXYA 1SHJA 3P8ZA 5JYCA 2WKSA 1IMOA 1RBQA 1PU2A 4IJKA 4UHHA 2ONJA 4YA6A 4WLVA 3OZUA 4ENWA 1EEHA 3FKSD 4EFNA 1EQ2A 3EIOA 1TKAA 2HBRA 4MLCA 4YRZA 1ZJWA 1X1TA 1DC6A 1H6DA 3B7PA 2WE8A 2TYSB 4OHUA 1BMQA 2OY0A 2E5FA 1RC8A 4YUYA 2K2WA 4DIFA 3W0LB 4FHZA 1DBIA 1O94C 2CWWA 2PRKA 1T9GS 4BCCA 3ESAA 2RGEA 2GAIA 4P92A 3MLEA 4UHCA 2XNDD 5FTJA 5EHXA 2XZPA 2REQA 4MI9A 4XASA 1KSGA 3T7CA 1THMA 3UCEA 1UBTS 3ZV4A 3LQRA 1USUA 4CMEA 5FAKA 1ZN2A 2C3UA 3RS4A 5BSHA 1ZM4A 4HDRB 4GU5A 3KJHA 2CLCX 4R7ZA 3P9NA 3UT5A 4ZAFA 2QVXX 3LX5A 3W9SA 1GXSA 2ENWA 3JV7A 2H9IA 1KY3A 2VWHA 4GR9A 2EEPA 4IUCS 4BAGA 4E6PA 2V0NA 3LVQE 3P9RA 1ESEA 4ZTUB 5DCUA 1TLTA 4RDXA 3OFVA 3P0IA 5H0IA 4CQMD 3L7KA 3HDTA 1IY2A 3NB0A 1FLAA 4HB4A 4BO0A 4ALNA 2QRHA 1EPUA 4EATA 1DS6A 2BN4A 4PZUA 4LXHA 6ADHA 2ZUDA 3NH9A 1ZKMA 3RYFB 2RHOA 1C8BA 2A1UB 3VDQA 3VI4B 3KVOA 5FA6A 1IVSA 1JPUA 2PDAA 4RZXA 4W5OA 4QPJC 5JBNA 1P2BA 5BSWA 1X1EA 4BV8A 3D3QA 4TYNA 2VR1A 1LUAA 3ESXA 3W2FA 3FMFA 4NBNA 4ZYVA 4AY5A 2CXTA 1OLSB 4U8HA 4GLLA 4Z4QA 4M9UA 3ZUGA 1IXRC 1Z47A 2C54A 2P0EA 3E9NA 3MC1A 3TMKA 1MJGM 3IV7A 4KE8A 4AYWA 2R96A 2CUTA 1CIVA 2O0HA 2QTVB 4G9BA 3BYZA 3U61B 5LQCA 1VGVA 3R6GA 3HJHA 2ZBGA 4WNYA 2OB1A 2QX8A 3PHIA 5MGNA 3THXB 1Y7LA 4MMXB 3DR3A 3UG6A 5HFAA 1JDTA 1CULC 2W2KA 1AUPA 1HL3A 4DDTA 3OQNA 3HXMA 5IVPA 4OHVA 1U3WA 2CL5A 1HBJA 1PHPA 4ND8B 2I8LA 1LW7A 5DCWA 5F4BA 5LJLA 4H7KA 2I7TA 3MS2A 4MWGA 4G25A 1H2HA 1P18A 2B4AA 1JALA 4I55A 1H85A 2PFKA 4Q1BA 4DBLC 3QWBA 5AXDA 4EB0A 4YP0A 2BMWA 4NZOA 5EVJA 3IAS6 3TTYA 3E4DA 1FCJA 3H5WA 2Q6VA 1QFMA 2CT8A 4CLXA 3D3WB 1EXMA 1XL1A 2C2XA 1ZBDA 4V24A 3NVKI 1YS4A 2WF6A 1G2IA 1Q92A 2ZWPA 3GLRA 4IHJF 1HYEA 4MR9B 1CUCA 1E2IA 4NENB 4RCVA 2ZLBA 4BDTA 5DN6D 2GAJA 3H1PA 3IILA 3I39X 4RIHA 2IX9A 3KEGA 4ENPA 2HIHA 2D59A 1Y8RA 1TKBA 2Q6TA 3DF7A 4K26A 4MS1A 1J9ZA 4A27A 5LD2B 2G1AA 2IOYA 4RZ2A 1JZTA 1QYXA 2GTPA 2UVDA 4EKDA 3ZJ5A 2VK8A 4YK7A 4BRUA 1O94D 1E2MA 4BVBA 1TLLA 2YQ5A 1CY6A 2QTTA 2PAFA 3GRCA 3AESB 3V1MA 5GP1A 1UMCB 1N1DA 2AD5A 4A36A 1HE3A 1LQ2A 3Q3IA 2QP9X 4J0HA 2QTMA 4LBZA 3S70A 4A6PA 1GQ2A 5J1TB 1JU9A 4MKXA 2BTOA 1MU0A 3HYTA 4H15A 1ZM2A 2BFAA 2PJZA 2OD7A 4OLJA 1VXRA 2Y0BA 4IWXA 3L93A 2PL1A 1MX1A 4A5SA 2EKZA 3ZWPA 1LQUA 2OSVA 1Q1QA 3GEGA 1JR3D 2C5AA 2PU7A 3S2FA 4XYEA 3DMFA 4UUBA 4Z2YA 3ZXIA 4CIDA 3AU8A 5EHQA 4RZQA 1RYHA 3A3PA 3C14C 2ZT7A 3DMDA 3NV7A 4R69A 1SKMA 3G8AA 4RK6A 5F5NA 4CKXA 3LP8A 3PUJA 4UCXA 1GKUB 3IXLA 4J76A 2AG0A 3NDIA 4MIYA 3FKJA 4X3OA 2C8JA 5JSYA 1B8OA 5LZ8A 1ZZGA 4L51A 3ZE0B 1C9KA 2IYQA 1ZGBA 2HJSA 2VJNA 2MDTA 2NP7A 1J5XA 2YJ6A 4PLHA 1UC9A 2AR0A 4ZC1A 3VC7A 1RD4A 1LC0A 4YRTA 4MA5A 4B35A 1YRAA 1IOVA 4G09A 2BD0A 1KHHA 3TS1A 4PGGA 3SF0A 2IYZA 1F6DA 1GGEA 4DPLA 3COVA 5FCDA 3T54A 4X7RA 1IK6A 1ODCA 2C4NA 4UVIA 4NBLA 1NBHA 4CMJA 4W5NA 4R1OA 3HY4A 3ZDBA 4PSAA 1W35A 1YI1A 2V58A 3CO5A 4MROA 2ES4A 4U7HA 2WB4A 1N4AA 3IQXA 3FHLA 5IXJA 1DCTA 4EA9A 4TV8A 1I32A 2LR0A 5HIIA 4AZVA 5MN5A 4CEJA 1VECA 2FOIA 4GX0A 1KOFA 3FNEA 1W36B 1VB5A 4B71A 4HQ6A 4D4MA 1F0YA 2JFPA 1H42A 1IIBA 3HP4A 1U1CA 5DB4A 3UH1A 7REQA 3FOFC 1VGRA 3DFUA 3GRVA 1E3DA 3TB4A 1XJQA 2CLMB 2W2LD 3CPEA 1NY5A 3F3KA 4NI5A 4PSVA 4WASA 2WF5A 5LC1A 3TLZA 1I1HA 4WJKB 1NAIA 4D4KA 2Z9BA 1SU7A 5EEGA 2UV8A 2QGFA 4QQFA 3IOYA 4WK2B 2VPTA 2CXNA 1E5DA 4DIKA 3I76A 1NP7A 2W98A 2IYAA 4WN9A 1FMFA 5HVNA 1QFSA 2GYYA 3G85A 3HDJA 4FHCA 3FY4A 2LUOA 1V8PA 4NCHA 1DIOB 3R8FA 3M4ZA 3HMQA 2QTZA 1GJRA 4H1UA 2X0FA 3U26A 2QYHA 1FFXA 3GEBA 4XM1A 5GWXA 1CUUA 2NTEA 1L1EA 2QN7A 4DQVA 2ODEA 4GNRA 1P4SA 3FMGA 4CN9A 4BVKA 1F7UA 1E7YA 1SFRA 3A2MA 2QLLA 3DEHA 2OFFA 4C0HA 5FEMA 1L0BA 4CXMA 1W47A 4PHFA 4FR2A 4HPJB 1M0EA 4HQRA 3D8UA 3L0OA 3H1AA 1XVVA 1I14A 2P9CA 4CQMB 4Y9UA 3RTGA 1PK7A 2MYPA 3R7WB 1BQEA 1RRMA 4OQLA 2Y1KA 1CZHA 3DDOA 3EODA 3GMSA 4YDRA 1SG6A 1K8XB 1QE0A 3Q2OA 2AK3A 2JF0A 3CZ4A 1I7DA 4JB8A 4J75A 3ABOB 3H2KA 4FNOA 4LE0A 2MYNA 3QE0A 2YJTD 1ULZA 2GAFA 3I37X 3RWBA 1U04A 1BGXT 2AQKA 4TMVA 4DM7A 4PAMA 4JI5B 4KQXA 4B3GA 4R2KA 1NX9A 4I8IA 4DZZA 1PDVA 2PL5A 3GLUA 5IABA 3WNQA 5F12A 4DQLA 1FU7A 3RG2A 1J8YF 4YV7A 2XUPA 1B8UA 1OIWA 4MVWA 3WSWA 2KLBA 3EE6A 4KXVA 3CUEF 3CZMA 3ZU6A 3L0PA 1UKAA 1UM9A 5AT1A 2H07A 4MHSA 2X2OA 4YRGA 2CFIA 2F43A 2I54A 4O4HA 4PRKA 3IP6A 3QVUA 4Q1VA 1G3IA 2JH3A 2Q9BA 2VT7A 4NZ9A 1W34A 1Z16A 2DFLA 5KKAA 2VJAA 3RVDA 3PHCA 2BFWA 4LEIA 4B31A 1NUTA 3AEKA 3H5NA 3TGWA 3F90A 4RY0A 4KH0A 5G0TA 5TIIA 5AKKA 1HMPA 3R76A 2G04A 3GAAA 4MUFA 2XKKA 4EGFA 1QIMA 1TUBB 1YRQA 3BILA 4DQ0A 2V96A 3P1JA 4DMFA 2IX3A 4CM6A 3KQKA 3FXAA 3I5AA 4OQMA 3VYTB 4B87A 2WSIA 3UTDA 4BOYA 2NVUA 4XIFA 3Q2KA 2PFGA 2ADOA 3VVBA 4NWIA 2NAFA 1YQDA 2C94A 2ZJYA 1WU8A 3KDSE 2PWYA 4G89A 4K86A 4G84A 1FU4A 4OHOA 5LXTF 5AXCA 4F21A 2QXUA 1XKQA 1T34A 3PE3A 1TRKA 2RAFA 3DNFA 1UDBA 2IQ5A 1FVXA 1XTSA 3VR6A 1XRSB 1ORWA 3S99A 3F1KA 3FR8A 4M87A 7MHTA 4QXPA 3CZ9A 1KO7A 1LTKA 1C30B 2P6PA 1N3YA 1XEWY 2BISA 2QX6A 3HFRA 2RIRA 3DV0A 3GVPA 3O2JA 3R75A 4B45A 5ITZA 3RRNA 2R3SA 1QVZA 5BWOA 4XW2A 3K6JA 4ZDWA 4DAEA 1ZLYA 2ZETA 4KXFB 1LJUA 1V5WA 2O8FA 3GZNA 1H4VB 2IV7A 2CMDA 3H65A 3N8KA 4OJTA 4GKBA 4WOPA 3AR4A 3GVIA 4LWOA 2XJ9A 2PVPA 1DBVO 4BIIA 4E7PA 3TM4A 5BWCA 4I50B 2GSWA 3T34A 4PZ9A 2O0MA 1KFKB 3H3XA 1N75A 2W8BA 4D0RA 4TV9A 3ZDYB 5KHLB 2SBTA 3RYHA 4K9QA 5A4FS 4UNSA 3V8QA 3FCXA 4JB0A 2PJRA 3L06A 1DEOA 3JWIA 4EQZA 4P7GA 1J9GA 1KBZA 5F2OA 1KYXA 1WCV1 3LP6A 3P2KA 5G4KB 1WRBA 5GONB 4JEMA 4ZD6A 3S1AA 3V55A 3H9JA 1FJGB 4U5XA 5IJ0A 4PZZA 3ZU5A 2XB2A 2HY7A 2HPVA 3DCIA 1MO2A 5DBFA 3VH2A 2EBHX 3E7PA 3ICPA 5IZCC 4JKIA 5IVHA 2IYFA 2BW0A 1BDMA 4OD0A 4Y1RB 2Z6AA 2VQ6A 1RLIA 4EAAA 4GSKA 5DNCA 4XJXA 2H4YA 2JGFA 2GVDC 3IPAA 2OV6A 3K2IA 3PNQA 1EFVB 5CLIA 3T4PA 2FAXA 3MCUA 3KB6A 2IP1A 1ITZA 1R0CA 2WA2A 1TEZA 4JBLA 1VHTA 1QCYA 2H17A 2RGBA 3V00A 4V0LA 2AUMA 3H84A 1ZESA 1ZGZA 3DNPA 4PU0A 4AXXA 4TL7A 1MVLA 1DAPA 5L40A 5BXQC 3TUIC 4M22A 5TMDA 3N2EA 1V5IA 4BYMA 4CMEC 1XXLA 2C5GA 2NG1A 4QVGA 5C3MA 1MHTA 4I6JA 1Y34E 3L04A 2YVLA 1D03A 4TWRA 1DFGA 3H2YA 4LF5B 1NRIA 2SNIE 5A4DA 3HC7A 1P7CA 2V9ZA 1BEEA 4RJIA 3LFTA 1MZVA 3EEIA 5C4MA 2A0KA 4OA5A 4EUSA 3IAHA 4Z86A 3EMDA 3KD3A 1V5EA 3OJXA 1U8YA 3SC2A 2J4FA 2Q2VA 3AR8A 1OXMA 3FB1A 5K3FA 5CX1B 1VMKA 1X7YA 3D8RA 3DQQA 2ZXFA 4ZICA 3IBCA 4HWPA 4EL0A 3HDGA 4YRNA 3O7WA 5H83A 2QP3A 4UBKA 3E22B 2WY2D 3WK4A 3ZCTA 4BP8A 3D31A 1L7XA 2AHRA 3IYLW 4PQEA 4KX5A 1TLFA 2HM7A 1A7UA 1M6NA 4CN8A 16PKA 1KPHA 4A2QA 1Z22A 5DHRA 5ICCA 1MOQA 3I6QA 4MEJA 5EHNA 3C74A 3OA0A 3CIOA 4NC9A 5FWAA 3UHPA 2A0WA 3P9QA 1WDKA 4KR9A 4CKWB 3AR3A 3PT9A 2L2QA 1QYWA 5JHGB 4TKUB 4DTIA 4MHTA 2Q8QA 2EFEB 1QFZA 1V3QE 2JGJA 2PX8A 5KJEA 5KJ1A 3CPJB 1XDWA 3RS0A 4RD6A 5KWVA 1DKMA 3O8BA 3QFSA 3OPXA 4LDAA 5A4JA 5LQJA 3EQ6A 2VNJA 3A9RA 3D3KA 3FTNA 3B7WA 4AUKA 1UANA 1RWKA 2Z0MA 1X86B 1W2WB 1ZGHA 1P9RA 2GJKA 2LDBA 4YEDA 5L7YA 5TXGA 3SFZA 4WOBA 3FOEC 4L2IB 1YDHA 3IJEB 2GS9A 4DBVO 1AKTA 2BONA 5B2EA 1C7ZA 1MQAA 3IGFA 4QJIA 2Z8YM 2E87A 1BMTA 3KKEA 2X22A 1V5FA 2HSJA 2PIAA 5IRCD 1U0EA 4M8NE 4PCAA 1LBSA 1PX2A 1XXHA 2P9GA 2V7QA 4I50F 4IDBA 4J3NA 4BBZA 1IPEA 5BUSA 2I91A 1SOVA 2NU9A 1SOAA 2NU7B 2HLPA 4MVJI 2O0LA 2VRWA 5EZ6B 3W5AA 4LF4B 4WOJA 2VNSA 2W4QA 3C3BA 4X20A 3HUDA 3V8BA 1J24A 3NC4A 1Q7TA 1WMEA 2OKGA 3YASA 4FIDA 3R0IA 4MV0A 3EXIB 5GONF 2ZOSA 3CF4A 4U0JA 1YJBA 4JI3B 1XZCA 4UU7A 3J81k 2J3DA 5I3CA 4ESVA 1T8YA 1BWQA 4G5YA 1VBKA 3QKWA 2QF7A 1NSFA 3TZCA 1U94A 2DQZA 3CRMA 3DOEA 2ANCA 1OX6A 4J91A 4TMFA 1NJ5A 3BGSA 1CR4A 4B79A 2IXEA 1TNDA 2HHJA 3MWEA 3OO0A 4K7JA 5KQPA 5TEWA 2I6QA 5TGZA 1Y7PA 2AN3A 2IY8A 5U9CA 1OZHA 3W6UA 2B1RA 2JVIA 2NP6A 2VRBA 4H17A 3OJ0A 4KO2S 5IUKC 2GNAA 3L01A 1EX7A 1N3LA 3DHYA 3OOYA 4N8EA 4ZODA 2A4KA 1SKYE 4QGAA 3D8BA 3R0XA 4CFYA 1DTEA 1YB4A 2PMEA 4QGGA 4JVNA 4MW7A 1XJCA 4ZOQI 1OXUA 4H3SA 1R6BX 4ZT2A 4DKXA 4R01A 5B7NA 5IT4A 4KSYA 3H8VA 4A8JB 4MRVA 1E98A 4RS4A 2Y2VA 3MTBA 1MIOA 4L7QA 4ARZB 4ND3A 3EPLA 5DLEA 2E4AA 1Z7WA 2YV2A 3O1IC 3K35A 2A92A 4QEDA 1UADA 2I66A 5AUOB 1PCXA 2W0SA 3IUMA 1MR3F 1DHTA 1FXSA 2C5HA 2GZAA 2ZB3A 3L6EA 4IDHA 4MITA 4RK4A 1ZEJA 4ITRC 1FFYA 4INOA 1HE5A 2COUA 3PI6A 4UAGA 5ICSA 2HGZA 3EJ6A 3MSXA 4TMYA 1PKEA 4AQYB 5H8WA 1XKXA 2JG3A 3LFHA 2QTRA 1Q16A 2GF0A 3AJRA 4GKVA 2QVZX 4KR0A 3GN1A 2QLNA 1YVPA 3HJRA 4L5CA 2ZS9A 5LDHA 1EM8B 2JA2A 1SQ6A 3HA3A 2C7BA 4Q9LA 5CYFA 3PU6A 1XJ5A 3K72B 4KPGA 4GM4A 4CNBA 4E09A 4PGAA 4UU1A 3NLLA 2E37A 1YFKA 2GA9A 2HN9A 3NALA 5GJBA 3LH5A 4IM7A 3WDMA 4OH1A 3CRZA 1P2DA 2EKQA 1U8CB 1VHDA 2X9NA 1FFEA 4KQGA 5U4QA 1FVFA 4BKRA 3K9NA 2FW6A 2WJGA 1KTVA 3GGGA 4HFNA 1UFQA 4J2OA 1TTQB 4YCBA 3FPHA 1UFVA 2P6MA 4OU5A 5FBRB 2H06A 3GQBB 2PZBA 2AWOA 3BK1A 3GDWA 3BTUA 3G2IA 3NX4A 1T5LA 3Q6MA 3CV3A 4FD3A 4MRMB 1Z12A 3AH8A 4RF5A 2CGEA 4TMXA 4A6XA 1W93A 4A2PA 4Q9DA 2CXUA 2V7WA 3LK6A 3RJZA 3PTZA 3WGJA 3C1TA 3E61A 3I01A 3W2HA 1USGA 2G5TA 2WMOB 1ZN7A 3EA4A 3EUFA 3DOUA 1TZ2A 1KH2A 1VL1A 3UHFA 2Z1MA 5CH3A 2FZEA 4DCNA 4F06A 3DW1X 5A9SB 3Q3GE 2G80A 2IZ1A 4BNFA 5LBIA 3SKXA 3CU5A 5THXA 3FPFA 5E3JA 3IUSA 1QIDA 1GFZA 2WWFA 1GL9B 4HFMA 3C3XA 4QU8A 5LWHA 1TM2A 4EG1A 2RHDA 5DNYB 1E2BA 2VDWB 4BNUA 4PPFA 2LNDA 2PX5A 1CRZA 5JANA 1XU7A 4AUNA 2I2WA 1LI5A 2GARA 3FE2A 3JQ8B 1JKFA 2PXCA 4GE3A 1G5PA 3CLHA 4QEZA 4YMWA 5BVHA 1L7DA 3T8YA 1U0JA 3M3PA 3T5AA 4DQXA 1R2QA 1Y6ZA 3EZNA 4Y2RA 1N92A 1OI7A 3HKDB 1PD0A 4ZXFA 1IONA 2D1FA 5A3QA 5J47A 2JDIA 3EEQA 3Q5DA 4HB3A 2RCYA 4XKJA 3NYWA 2FJPA 5GVSA 2DTXA 4DSZA 2VK2A 1ZI9A 5I5GA 2P2CA 4ZC8A 2A3NA 2Q29A 3MJDA 2HRDA 1QOPB 4NMXB 4H7JA 4RSRA 1O6FA 4Q4AA 3T3NA 2VDQB 3L7JA 1GLNA 4OAPA 1C0IA 1USWA 1VHJA 5JU6A 2WLTA 4PHGA 1OVMA 4YRLA 2BMJA 2X9QA 5KC9A 1BJTA 2LIPA 3G0BA 4L73A 4NL4H 5L3VA 3T1TA 4ISBA 4QASA 3LY9A 2X4DA 3HN7A 4FT2A 1DQRA 3BX1A 4CF5A 1VMAA 3E27A 3AHIA 3B38A 1PYDA 3W5CA 5DFAA 4B2YA 1I7QB 1Z9BA 1F3OA 1CS0B 1PK8A 3H17A 5EIBC 2D0OB 1TQHA 2OYRA 3WWPA 3TNLA 4PG8A 3UMGA 2XGMA 3ZS9A 3GDHA 4U02A 4CQLA 2FK7A 2VDNB 2F3SA 3GUUA 4Q4JA 4AUEA 4GGMX 1VI2A 3ROEA 1QFYA 3T1YB 4BGDA 4NNOA 1L4NA 2QT0A 4J6EA 3T1QA 4R16A 3UHOA 3M6WA 1CB0A 1OBFO 4CI9A 4YRRA 5ANRB 2OXIA 4HPWA 3VDNB 4C4XA 3BRWA 4V0OA 1UWCA 1UKYA 4FCVA 4CMGA 1XVIA 4QT4A 4BMVA 3W78A 2TECE 3D5TA 3GXOA 1ZC3A 5GZ6A 2PZGA 3P2MA 3SFTA 1C3OA 1SUDA 4ZRNA 1SRRA 4IZOA 3KZKA 3K1TA 5L9AA 4KIUA 2Q8NA 2PL3A 3QHAA 5IC4A 1BC5A 2WDZA 3NHUA 3RRYA 4L8YA 1VKOA 3ITNA 1XMSA 3CKYA 3L43A 1PJ4A 4ZAZA 3EAGA 1AY0A 1IVYA 4GUAA 5JR3A 1GPDG 2ZG6A 4Y6RA 3IESA 3KQQA 2O5RA 1I8TA 1TTHA 2HIGA 3PCXA 1ZW1A 3N0TA 4LDQA 2IOQA 2XWBF 2PCJA 5IJWA 2UYOA 4DZRA 1FJXA 3H5IA 2NPOA 4RCZA 5KTKA 1OTYA 1ZUWA 4Q3EA 1T0UA 2PUHA 3MOGA 1GXSB 3UT5B 4EITA 2J7KA 3U3KA 3HUEA 4NICA 5AKXA 3P71T 1MENA 2ECQA 2A7XA 4AY6A 1OGYA 2PLFA 5BSGA 3UB2A 3QE9Y 3I5UA 5M2QA 1XTQA 4G4JA 4N6OA 2J45A 5IT5A 1QF9A 3NRCA 1DUSA 2DBRA 4AULA 4DEYA 5SV2A 3PC7A 4YMHA 4TLLB 8ABPA 1A7JA 4K9KA 4YJ3A 1F2UA 1TIKA 1NT4A 2XMRA 5BSMA 5AW3A 4ZV9A 3GV0A 5AW0A 4P3NA 5BN3B 3AP3A 5CNMA 1GADO 4MQFB 1E6EA 3H9EO 4H7IA 4N5LA 4U9UA 5ITSA 2QPLA 1NC1A 1PGJA 2HZBA 2B1GA 4RVOA 5DNEA 5FWYA 1KJNA 4KQCA 1KFJB 1KFCB 5EQJB 4NZYA 2ZI6A 5JEDA 3E9CA 3SX0A 3OEHA 3OM1A 1BU8A 1OVGA 2OZEA 5CH5A 4KWTA 5EP1A 3LQ1A 3CR3C 3P4XA 5C32A 3K9QO 4XRGA 3HXOA 4BNJA 1YULA 4K40A 3N53A 3U4CA 3KOYA 1Z06A 3LRTA 4FS3A 4V0ME 2BEVA 4XQ9A 3CH7A 3NOOA 2VT3A 4I7EA 1IZ7A 2BGKA 3IR7A 5EIBD 3OCUA 4PTZA 3OIVA 3ZBUA 1T4DA 1IQRA 4PWYA 3X2SA 4D9BA 4AW9A 4XWGA 1O9BA 1VKHA 3FF1A 5EKUA 3SX2A 1BXZA 3VPFA 4UOZA 3ZVMA 5DHTA 3ZLJA 3HY3A 3VMFA 1UEXC 3KSZO 4I55B 2HZ7A 1N0IA 1TJ3A 1F5NA 5EE1A 3A14A 4EF6A 4F60A 4IF4A 4D3SA 1T2EA 3LBFA 2XB8A 2CNWD 2UYHA 3EF0A 2UVQA 4UMDA 2FUG1 1K86A 2XA9A 3C43A 3DULA 1DPFA 3EPHA 1HURA 1EZZA 3A1TA 1POXA 4XIIA 2VLIA 5EN4A 3ZEIA 3ZY4A 1F9AA 2QLBA 4RXTA 5CT5A 5EKTA 3VR6D 3WGYA 2IITA 4OK3A 1XZHA 5C1BA 3D5EA 5CJPA 3DMYA 2AE1A 1SUEA 3CBGA 4MS1B 5AM0A 2IU4A 3ONEA 2VRNA 3DYIA 3W8DA 3ZPXA 1UBSB 1I4WA 1TPYA 1XTKA 3N5CA 2NZ8A 4TGLA 1CD5A 1HZJA 4EWLA 1RTKA 5JS6A 1XR3A 4PXSA 5AI5A 3P2OA 5IU6A 3QVXA 1WULS 1ULSA 3TLAA 4ODIA 2GRJA 1X8KA 4ZCTA 3KSUA 2Q1YA 1XRLA 4CLEA 5KB3A 3CNOA 3O94A 2EX1A 4X95A 4IIUA 4QO7A 3S5JA 1CXZA 1V48A 4IEEA 4YV0A 1GTZA 2DJIA 3F6RA 4U3JA 1K6EA 3JSAA 1P74A 2B20A 4L16A 1T8WA 5DBGA 4IBOA 2XWJI 4LYYA 3U0VA 4OI2A 1OFHA 3ZWWA 1YFLA 1PV1A 3B6KA 1L4BA 1Z0UA 2BDUA 2POQX 3GEMA 3LCUA 2C4VA 3LUAA 4GPTA 5AH0A 3ZWVA 3ASZA 1M2OA 3IURA 4PO3X 4RDIA 1DJQA 5HQTA 2GXUA 4GL4A 1UWLA 2Y1LA 3PVCA 5EJEA 3HJCA 1NOIA 2HDNB 3LFUA 4S04A 5JC8A 1ZJYA 2FWIA 2VP2A 5LUBA 2HA6A 1DRUA 3OF2A 4BGIA 1KEEA 4G5HA 4FYWA 4HB2A 3TR6A 2UDPA 1NN1A 3E7WA 1N5KA 4R1UA 4I3GA 2FMFA 3D1LA 4WLOA 3ZY3A 3JXEA 3TQQA 3ETNA 4QICA 4JU9A 1R6VA 4DC1A 1JBEA 4CEHA 1F38A 4MW6A 4NMWA 1K92A 3FZEA 4WNIA 1RPZA 3WS7A 4DA9A 4I2VA 1CZRA 1U65A 5EJAA 3OPQA 1ZN9A 3DZ8A 4Q82A 2Z8ZA 4HNSA 4FIZA 1QQ7A 4F2HA 4KQKA 2YHBA 3FGPA 4G5RA 1S0UA 4Y2SA 3CN9A 4MUYA