3DE8A

Crystal structure of a dimeric cytochrome cb562 assembly induced by copper coordination
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Control of protein oligomerization symmetry by metal coordination: C2 and C3 symmetrical assemblies through Cu(II) and Ni(II) coordination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3de8A00
3VRCA 2XLMA 2XL6A 3C62A 1CPRA 3NMKA 3TOMA 2CCYA 1MQVA 3M4CA 3ZQVA 1E83A 2XLDA 1YZAA 3QW1A 2YL1A 3QVYA 2XM4A 2XL8A 3QVZA 5JLIA 1JAFA 5AGFA 1E84A 1EKYA 2J8WA 2YLIA 2YLGA 3L1MA 5JSLA 4ER9A 1M6TA 1NBBA 256BA 5JRAA 4L6RA 4JKVA 3FOOA 3M79A 3IQ6A 1E86A 3ZWIA 3HNLA 3M4BA 1E85A 4IB4A 4IAQA 2BC5A 4IARA 3ZTMA 1QQ3A 2YL3A 1BBHA 2J9BA 4ULVA 4EIYA 1APCA 5JUAA 4CJGA 2YL0A 2XLOA 2XM0A 4U9DA 1GQAA 2XLWA 4N4WA 4U9EA 4WGYA 1LM3B 5JS5A 3M15A 4CX9A 2XLVA 3IQ5A 2YKZA 2XLEA 1YYXA 5JP7A 4D4NA 3C63A 1YYJA 2QLAA 3HNJA 3U8PA 4D4XA 3ZTZA 3FOPA 1CGOA 4JEAA 4NC3A 4CDAA 4CIPA 2YL7A 4JEBA 4WGZA 1CGNA 4JE9A 1CPQA 1RCPA 4CJOA 4CDVA 1S05A 2YLDA 3DE9A 4N6HA 3ZQYA 3HNKA 3NMIA 3DE8A 5JT4A 5JVEA 3NMJA 1YZCA 3TOLA 5B3IA 1A7VA 2XLHA 4CDYA 3QW0A 1QPUA 3HNIA
chains in the Genus database with same CATH superfamily
1SZIA 4LLEA 1YLMA 3C62A 3GWNA 2EILC 1OW6A 2EIMC 1T9KA 3C18A 4PR9A 1NSGB 2KW3C 2YEVA 3AOUA 5L0CA 4AL1A 3ZQVA 1E83A 4CSAC 1PD1A 1YZAA 4EUKB 2PF4E 4JTDB 3QW1A 4RDAA 5BQIA 4YT8A 1SR2A 3QVYA 3SP1A 1SMYF 4KNWA 3C8GD 5AC5A 3GANA 5B1BC 3T9OA 4JZAA 3WHNA 3B0VC 5B1AC 5JLIA 1VB5A 3JCUQ 1Z23A 1JMWA 2EPLX 2IOQA 4HEAJ 5AGFA 2YLIA 4PJMA 2A68F 3FHDA 3L1MA 4MW8A 3ITFA 1LI5A 2TMVP 3KYIA 1U0BB 2LIGA 2DYSC 1HE1A 3JRTA 1H9GA 4IGGA 1Z7Qc 5DS5A 3M79A 3IQ6A 4XEFA 2E87A 2F22A 2X0CA 4JJFA 4BPMA 2V3CC 2XRHA 2KNHA 3LEOA 4JIOA 2R7WA 1LIHA 4IARA 1TKNA 3E9VA 1BBHA 4P6IC 4GEHA 4YT5A 5KYXB 1TFOB 3FMSA 3ASNC 4HE8D 2Q9AA 4EIYA 4MW3A 2GDCA 4K0DA 3CQZA 5E3CA 1ZHZA 4PFOA 3SXYA 1MNDA 2IXPA 2Q7RA 4J7YA 1D1AA 3LUTB 3M1CB 4N06A 4Z9JA 3Q7GA 3TD7A 1WATA 2YL0A 2XM0A 1HY5A 3ATPA 3U0CA 2R7UA 3EG9B 4O79A 2CW0F 4MVOA 3V5XA 3TQOA 3SXZA 3OWTA 3FDQA 4EKWA 4HFKB 4BJ5A 1RMVA 1ZZPA 2ZXOA 3LLKA 2A0UA 4QI0A 4U9EA 5JS5A 3L8JA 4RD9A 1T01A 1VMAA 2XSEA 3VYWA 3AQBA 1NZEA 1XWJA 3CAXA 4GQHA 1KNYA 2L6FA 3RW0A 3LEVA 4E17A 4CS8C 2XLEA 3ABMC 4U5HA 1G8XA 1TWGA 1MMAA 1YYJA 2QLAA 3NKDA 3S28A 3DXJF 1D0XA 1PD0A 5KYWB 2UUIA 1Z63A 3G50A 3R2PA 3BEHA 4LDRA 5T3WA 1FMWA 2WL8A 2Q00A 3NYMA 1EQ1A 1U89A 1SYQA 3JSZA 3LAYA 3S0XA 4CDAA 1ZHYA 3DAGA 3O39A 4LACB 2ZXWC 1T5OA 1C03A 2HSQA 1BZ4A 2YL7A 2J7PA 1IW7F 1RJ9B 1M2VB 1RKEB 2FFHA 2J46A 2W45A 1H7IA 3I5QA 4PK4A 2GFHA 1A0BA 3LS1A 4JJGA 3RKOF 4X0RA 3EQLF 3G4ZA 4KI2A 1VLSA 1CPQA 4FX5A 1ZHXA 2OEXA 2OQMA 4GYTA 3GWLA 1LI7A 4CJOA 2CYDA 4OINF 4DRHB 2W4MA 3LNMB 4ZLDA 1GS9A 2WZGA 5A6BD 5KYXA 2J0XA 1FR0A 2YLDA 3S90A 5BQHA 1DOVA 1Z3IX 3HNKA 3NMIA 2L7AA 4P9FA 1A7EA 3ABKC 3B9QA 5JVEA 2L6HA 1QKRA 2XLHA 1WOLA 3EHNA 1Q0DA 3FXHA 4XPWA 3RIPA 3UMKA 3O6XA 2KJGA 1OKKD 4MVZA 3QW0A 3TK0A 4YT4A 3HNIA 1Q0GA 3TJ6A 2FAPB 1ORSC 2NUPB 5B3IA 3S84A 1PV3A 3GM2A 4EBJA 1I4ZA 2XL6A 4BJ1A 1CPRA 3X2QC 2ZD9A 2L81A 4LLCA 4F4BA 4E18A 1TWCA 2CCYA 5B3SC 3DMDA 3M4CA 2HMZA 2XLDA 1WASA 2PBEA 3EPVA 4KBLA 1WTYA 2AP3A 2Y39A 1ZW2A 3RVZA 1HMDA 1BR2A 1LS4A 1BDJB 3WG7C 4XPXA 5D92A 2CGEA 3JSEO 3KMIA 4NCQA 5L0IA 2MWQA 3QVZA 3V5ZA 3AJMA 4CBEA 3SYNA 2B0HA 1WGWA 4FWVA 1B68A 2YLGA 2R7QA 1FTSA 1ZVZA 3PMRA 3UMIA 4MVRA 1M6TA 3DAFA 4CIHA 3O55A 2YVKA 3OEOA 5KYWA 1NU7D 3EJNA 4ANJA 2AWYA 2OJQA 2QE9A 1JRAA 3M4BA 1BR4A 3ABLC 1RJ9A 1M2VA 1RKEA 4U5FE 4B6IA 4XTKA 4G78A 1QQ3A 2WZFA 1JPJA 4MVQA 1F1MA 2J9BA 2OCCC 2R7RA 3RYLA 2D4UA 5EGYA 2IXMA 3JTLO 3U2LA 3VF0A 1OR2A 3VAYA 1FAPB 5COMA 3U2MA 2HZ8A 1GGQA 3QZCA 4OIPF 5A6JA 3IEEA 1NG1A 2LD6A 4PJLA 2O9XA 3GM1A 2WZLA 5DS4A 2IM8A 3HLZA 4KNVA 1H9TA 4CJGA 4I1OB 4YJWA 2X51A 3JRMO 5GPGB 3X1OA 2EPMX 1OCRC 1LS1A 1YDIA 4J30B 1HW1A 4U5GA 1RKCA 3B0UX 4U9DA 3U8VA 1V4AA 2IXNA 2XLWA 1LE4A 4MVSA 2B0JA 5CI9A 2NUPA 2XS8A 4OIRF 3RQGA 4MNDA 1YA7O 3F46A 3DI5A 3EHMA 2EPKX 4WGYA 4W8KA 3U3FA 1ZU4A 1H6GA 2VCAA 1TFKB 4NQFA 2PNOA 1C02A 2EPOA 3ASOC 2I8BA 1CGME 2HV6A 2NPUA 5A69A 2M4EA 1Y4CA 4QI2A 3N2ZB 2H7VC 1YYXA 3GORA 5DLJA 2J9WA 3HNJA 4JCHA 4JTCB 2W9YA 1D0YA 4D4XA 1S7ZA 2CNWA 3AQCA 1G4WR 3FOPA 4C3EA 3F47A 2H8AA 1W2WA 1VK5A 4RBNA 2ZXPA 4YL0A 3ZC4A 2LK4A 1NU9C 3C7JA 4UDVA 3IQTA 3SZRA 4MVUA 1OCCC 4DBQA 1TWHA 3JT1A 4OD4A 4JVSA 4NTFA 3L34A 4MVMA 2KGOA 1RXQA 4XPYA 5EK0A 4IRUA 4AE4B 4I3MA 2DI3A 4Q5SF 1LPEA 3MYIA 2QY9A 4XQ1A 4BEJA 3K1IC 3WODF 1A41A 1K04A 2ASRA 3L0IA 1E2XA 1I5NA 2OEVA 3BRJA 3CZ6A 2NSFA 1S05A 5E2QA 1L7CA 2RSEB 3PCVA 5TJ5E 3I4UA 3K7DA 4MTOA 3Q6MA 3ZG1A 3GEHA 3B0PA 2J0WA 4E7ZA 1VYKA 2OJED 3TOLA 3Q7LA 4DRIB 4DOZA 2G3VA 1VYIA 5HV9A 4U5BE 4ULWA 4YN0B 4DXWA 2DGJA 1QPUA 1ZHTA 5F5FA 3MBGA 4I44A 2Y3BA 3VRCA 2R05A 2A6EF 4H54A 4C7OB 3NMKA 1M56C 2NUTB 1Q0FA 4PACA 2DYRC 2RD9A 1MQVA 2VCCA 2IBFA 4YK5A 2KK1A 3JYYA 3RQFA 1OXBA 3T6BA 2ICWG 3US6A 5E3AA 2YL1A 4YL3A 3RVYA 2XM4A 2Y3DA 4XEKA 1SF8A 1JR8A 3LJBA 3AG4C 4G0HA 4IWBA 4CSAA 1YJGA 1AEPA 1M57C 3EZIA 3EZHA 3C8GB 3S29A 5DQTA 4I1MA 5FCLA 1E84A 1VTMP 1M2OA 3UR3C 2J8WA 3UGPA 2J7PD 3GEIA 4OIOF 5BUOA 1JOGA 1Y6DA 2R7XA 3NRHA 4ER9A 1YARO 3RQEA 4YL1A 5JRAA 4Z9IA 4JKVA 2VB6A 5E33A 1D1BA 3UMHA 4AX2A 3NDBB 1ZU5A 2R7TA 2XL4A 3I5PA 3AGTA 3K1HA 3CEXA 2NSGA 1OKKA 1E85A 3EFOB 4IB4A 4MTFA 2BC5A 1G5ZA 2HMQA 2VC9A 3JZ0A 2YL3A 5KYYB 4IAOA 3W2WA 1TR2A 4AE4A 2EIJC 2I15A 2VCBA 4OD5A 4EWCA 5L0FA 1KTMA 4ULVA 1EA8A 3T6JA 3PHF2 1OR3A 2OU6A 1LVKA 1OCZC 3ZVRA 2R7OA 1QSPA 2QTVA 3H2UA 4LDQA 3U5SA 3MFNA 1V55C 1YAUO 2AVKA 3NYJA 5JUAA 4JURI 3ECSA 1KU2A 3EGDB 1ZW3A 4WABA 3SEOA 2D5RB 3SXMA 1MMDA 5L0HA 5AC4A 4U5CE 2XLOA 3G4XA 5CI8A 2G3KA 3RFYA 4BJ5C 3CSKA 3AG3C 2R7VA 2P61A 1GQAA 1A7DA 3GEEA 3FAJA 4CS7A 4E0HA 1D1CA 1YA9A 2CDQA 2WB7A 3B29A 3HJCA 2NG1A 4K1OA 4C7OA 3AG1C 5L0DA 1Q0MA 2NUTA 2OG2A 4BJTA 4E0IA 1MMGA 2H7BA 2KQ9A 3FVYA 2XLVA 5L3VA 1LKXA 2M64A 4A2NB 1NFNA 3H65A 1J8MF 2EPNA 5JP7A 2Y69C 1OQCA 2PFDA 2R03A 4KC9A 3ZTZA 3C8GA 4CS8A 3V7OA 3W8HA 5DQZA 1OXKA 2C03A 1FFTC 2GA0A 2MHRA 4JEAA 2P7VA 1MMNA 2HUJA 2J45A 1HE9A 3A9CA 4NC3A 3RH3A 4CIPA 3EH1A 1LE2A 4PJNA 2LFDA 1Z5ZA 1FFHA 4O6NA 1CGNA 4OIQF 2BE5F 5F28E 1L3PA 4E7SA 1OCOC 2LSEA 2R25A 1NFOA 2QUPA 2HFIA 2P6VA 3EFOA 1QLEC 3DKAA 4G7ZF 3VM6A 4MS2A 5K0IA 4O6MA 2G62A 3S27A 5KYYA 4CDVA 3N24A 4U5DE 4ZLCA 2LFFA 3DE9A 3WAQA 3DWWA 1ORYA 1ST6A 3LS0A 2YHSA 4H4KC 5CIVA 4XLPF 2AWCA 2WVQA 3ZQYA 3ZSUA 2A6HF 1T6IA 4QDLA 3U9JA 3W4YA 1O3UA 5FZTA 2XXAB 4J32B 3DE8A 4PFPA 4JTAB 3NMJA 1YZCA 2HS5A 2R9RB 3KYJA 4Z9HA 1A7VA 1GM5A 3EGDA 3NKEA 2P1AA 4AK9A 4BJ6C 5T1DB 1D0ZA 2Q3TA 4EHPA 3MYFA 1U6HA 4MTGA 2XLMA 3A11A 2J9VA 3LNRA 2R02A 2UUHA 2BL2A 4FESA 4JCZA 2VASA 1PCXA 2PX0A 1EI7A 3TOMA 3L8IA 2PP4A 2Z15A 3JYHA 1R5ID 3H2VA 3AG2C 2A69F 2GAQA 2VH3A 3MLGA 4JRZA 3NG1A 4MQ9F 2IYLD 1QVXA 3AGUA 3SXKA 2A1DD 2CNWD 4W8PA 2Q9BA 2QNLA 4CS9C 1UFBA 3DM5A 2XL8A 2Y3HA 1VLTA 3DD7A 2OOCA 1K40A 4JW1A 1WN0A 4NTBA 3B71A 1JAFA 2HJ3A 2J9UA 3KL4A 3T6GB 1EKYA 1NLXA 3EGXB 3EH2A 3Q6NA 1N1CA 1XZQA 3QTHA 2V26A 5JSLA 4A4AA 4AL0A 4WJ0A 5EHHA 1NBBA 256BA 3RF3A 4L6RA 3MX3A 4O7GA 1DOWA 3FOOA 4HFFB 2JPUA 2W4BA 1OW7A 3E70C 5T3TA 5F5HA 3N0TA 4XEVA 4DRJB 4DVZA 1E86A 5KYUB 2R7SA 3ZWIA 3HNLA 5COFA 2ETSA 3U3BA 4DVYP 1QZXA 1T6QA 4IAQA 5DVWA 3ZTMA 2KYHA 4NTAA 3T4RA 3UGOA 4BEMJ 4O6YA 2FGYA 3DJNB 4XWJA 4BG0A 4FAPB 3QMKA 4IJJA 2YQYA 3O10A 5L0JA 2WVOA 3LESA 3W8IA 2JD3A 1O87A 2Y3GA 2KC3A 2LQGA 3K6BA 4DBRA 2HJMA 1ZHWA 2OKUA 1APCA 1ORJA 4LDKA 3IPMO 4G7OF 5A6BA 1V74B 3K66A 4ONSA 2EINC 4Q4ZF 4C3DA 4C3BA 2XXAA 2AU5A 3IQCA 4N6CA 5A6KA 1AVOB 2LCHA 3TJ5A 2MYSA 3LLIA 1Q0KA 3KPHA 4NY3A 3U9MA 5KYNA 2L6GA 2Q9CA 2KSFA 4N4WA 5D91A 2Q4FA 1R4TA 1LM3B 3FAPB 3S9OA 1OW8A 3M15A 4U5EE 3SNHA 4CX9A 3J06A 3IQ5A 2HV7A 2C04A 3TULA 5IY5C 1WWPA 2YKZA 3GM3A 2DB4A 2WVNA 4D4NA 1T6UA 2ZPAA 3C63A 4K7BA 3U8PA 2IXOA 3DZAA 3POVA 3UNGC 2YRFA 2HSBA 1CGOA 3IHUA 1V54C 3R7CA 3EGXA 2EIKC 3KKBA 4Q7CA 5L0GA 4YT2A 5A6AA 4PJJA 1TWAA 3DJUB 4JEBA 5DS6A 1G4US 4WGZA 4YWQA 4R32A 2LP4A 4BJ6A 3EG9A 1TQGA 1FNTc 2H7OA 4LERA 3PDMP 3NYLA 4JE9A 5HSWA 1RCPA 4JC7A 5KYUA 1I4YA 2L9JA 3GODA 3K33A 2A0BA 2YZSA 1FMVA 1JPNA 1Z6AA 3C8ZA 1MNEA 5COGA 3ZDLA 4EBBA 1HW2A 4P9TA 5BQGA 2PX3A 1BR1A 5L3QA 3W2VA 4XLNF 2YWAA 4M63A 3K1IA 2XS1A 4CS9A 1YVIA 3HKKA 4N6HA 3HTKC 1UG7A 3V5YA 1IZMA 2HKVA 4J7TA 3KH2A 1VOMA 1ZYRF 5JT4A 1XZPA 2P0NA 1AUEA 4EBKA 2ZXRA 4CDYA 4G7HF 1C17M 1J8YF 1K05A 3DM9B 2JX0A 1O5HA 4DJ9A 3ZIBA 1HMOA 3OA1A 2GWWA
chains in the Genus database with same CATH topology
3VRCA 2XLMA 2XL6A 3C62A 1CPRA 3NMKA 3TOMA 2CCYA 1MQVA 3M4CA 3ZQVA 1E83A 2XLDA 1YZAA 3QW1A 2YL1A 3QVYA 2XM4A 2XL8A 3QVZA 5JLIA 1JAFA 5AGFA 1E84A 1EKYA 2J8WA 2YLIA 2YLGA 3L1MA 5JSLA 4ER9A 1M6TA 1NBBA 256BA 5JRAA 4L6RA 4JKVA 3FOOA 3M79A 3IQ6A 1E86A 3ZWIA 3HNLA 3M4BA 1E85A 4IB4A 4IAQA 2BC5A 4IARA 3ZTMA 1QQ3A 2YL3A 1BBHA 2J9BA 4ULVA 4EIYA 1APCA 5JUAA 4CJGA 2YL0A 2XLOA 2XM0A 4U9DA 1GQAA 2XLWA 4N4WA 4U9EA 4WGYA 1LM3B 5JS5A 3M15A 4CX9A 2XLVA 3IQ5A 2YKZA 2XLEA 1YYXA 5JP7A 4D4NA 3C63A 1YYJA 2QLAA 3HNJA 3U8PA 4D4XA 3ZTZA 3FOPA 1CGOA 4JEAA 4NC3A 4CDAA 4CIPA 2YL7A 4JEBA 4WGZA 1CGNA 4JE9A 1CPQA 1RCPA 4CJOA 4CDVA 1S05A 2YLDA 3DE9A 4N6HA 3ZQYA 3HNKA 3NMIA 3DE8A 5JT4A 5JVEA 3NMJA 1YZCA 3TOLA 5B3IA 1A7VA 2XLHA 4CDYA 3QW0A 1QPUA 3HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRC A;  2XLM A;  2XL6 A;  3C62 A;  1CPR A;  3NMK A;  3TOM A;  2CCY A;  1MQV A;  3M4C A;  3ZQV A;  1E83 A;  2XLD A;  1YZA A;  3QW1 A;  2YL1 A;  3QVY A;  2XM4 A;  2XL8 A;  3QVZ A;  5JLI A;  1JAF A;  5AGF A;  1E84 A;  1EKY A;  2J8W A;  2YLI A;  2YLG A;  3L1M A;  5JSL A;  4ER9 A;  1M6T A;  1NBB A;  256B A;  5JRA A;  4L6R A;  4JKV A;  3FOO A;  3M79 A;  3IQ6 A;  1E86 A;  3ZWI A;  3HNL A;  3M4B A;  1E85 A;  4IB4 A;  4IAQ A;  2BC5 A;  4IAR A;  3ZTM A;  1QQ3 A;  2YL3 A;  1BBH A;  2J9B A;  4ULV A;  4EIY A;  1APC A;  5JUA A;  4CJG A;  2YL0 A;  2XLO A;  2XM0 A;  4U9D A;  1GQA A;  2XLW A;  4N4W A;  4U9E A;  4WGY A;  1LM3 B;  5JS5 A;  3M15 A;  4CX9 A;  2XLV A;  3IQ5 A;  2YKZ A;  2XLE A;  1YYX A;  5JP7 A;  4D4N A;  3C63 A;  1YYJ A;  2QLA A;  3HNJ A;  3U8P A;  4D4X A;  3ZTZ A;  3FOP A;  1CGO A;  4JEA A;  4NC3 A;  4CDA A;  4CIP A;  2YL7 A;  4JEB A;  4WGZ A;  1CGN A;  4JE9 A;  1CPQ A;  1RCP A;  4CJO A;  4CDV A;  1S05 A;  2YLD A;  3DE9 A;  4N6H A;  3ZQY A;  3HNK A;  3NMI A;  3DE8 A;  5JT4 A;  5JVE A;  3NMJ A;  1YZC A;  3TOL A;  5B3I A;  1A7V A;  2XLH A;  4CDY A;  3QW0 A;  1QPU A;  3HNI A; 
#chains in the Genus database with same CATH topology
 1SZI A;  4LLE A;  1YLM A;  3C62 A;  3GWN A;  2EIL C;  1OW6 A;  2EIM C;  1T9K A;  3C18 A;  4PR9 A;  1NSG B;  2KW3 C;  2YEV A;  3AOU A;  5L0C A;  4AL1 A;  3ZQV A;  1E83 A;  4CSA C;  1PD1 A;  1YZA A;  4EUK B;  2PF4 E;  4JTD B;  3QW1 A;  4RDA A;  5BQI A;  4YT8 A;  1SR2 A;  3QVY A;  3SP1 A;  1SMY F;  4KNW A;  3C8G D;  5AC5 A;  3GAN A;  5B1B C;  3T9O A;  4JZA A;  3WHN A;  3B0V C;  5B1A C;  5JLI A;  1VB5 A;  3JCU Q;  1Z23 A;  1JMW A;  2EPL X;  2IOQ A;  4HEA J;  5AGF A;  2YLI A;  4PJM A;  2A68 F;  3FHD A;  3L1M A;  4MW8 A;  3ITF A;  1LI5 A;  2TMV P;  3KYI A;  1U0B B;  2LIG A;  2DYS C;  1HE1 A;  3JRT A;  1H9G A;  4IGG A;  1Z7Q c;  5DS5 A;  3M79 A;  3IQ6 A;  4XEF A;  2E87 A;  2F22 A;  2X0C A;  4JJF A;  4BPM A;  2V3C C;  2XRH A;  2KNH A;  3LEO A;  4JIO A;  2R7W A;  1LIH A;  4IAR A;  1TKN A;  3E9V A;  1BBH A;  4P6I C;  4GEH A;  4YT5 A;  5KYX B;  1TFO B;  3FMS A;  3ASN C;  4HE8 D;  2Q9A A;  4EIY A;  4MW3 A;  2GDC A;  4K0D A;  3CQZ A;  5E3C A;  1ZHZ A;  4PFO A;  3SXY A;  1MND A;  2IXP A;  2Q7R A;  4J7Y A;  1D1A A;  3LUT B;  3M1C B;  4N06 A;  4Z9J A;  3Q7G A;  3TD7 A;  1WAT A;  2YL0 A;  2XM0 A;  1HY5 A;  3ATP A;  3U0C A;  2R7U A;  3EG9 B;  4O79 A;  2CW0 F;  4MVO A;  3V5X A;  3TQO A;  3SXZ A;  3OWT A;  3FDQ A;  4EKW A;  4HFK B;  4BJ5 A;  1RMV A;  1ZZP A;  2ZXO A;  3LLK A;  2A0U A;  4QI0 A;  4U9E A;  5JS5 A;  3L8J A;  4RD9 A;  1T01 A;  1VMA A;  2XSE A;  3VYW A;  3AQB A;  1NZE A;  1XWJ A;  3CAX A;  4GQH A;  1KNY A;  2L6F A;  3RW0 A;  3LEV A;  4E17 A;  4CS8 C;  2XLE A;  3ABM C;  4U5H A;  1G8X A;  1TWG A;  1MMA A;  1YYJ A;  2QLA A;  3NKD A;  3S28 A;  3DXJ F;  1D0X A;  1PD0 A;  5KYW B;  2UUI A;  1Z63 A;  3G50 A;  3R2P A;  3BEH A;  4LDR A;  5T3W A;  1FMW A;  2WL8 A;  2Q00 A;  3NYM A;  1EQ1 A;  1U89 A;  1SYQ A;  3JSZ A;  3LAY A;  3S0X A;  4CDA A;  1ZHY A;  3DAG A;  3O39 A;  4LAC B;  2ZXW C;  1T5O A;  1C03 A;  2HSQ A;  1BZ4 A;  2YL7 A;  2J7P A;  1IW7 F;  1RJ9 B;  1M2V B;  1RKE B;  2FFH A;  2J46 A;  2W45 A;  1H7I A;  3I5Q A;  4PK4 A;  2GFH A;  1A0B A;  3LS1 A;  4JJG A;  3RKO F;  4X0R A;  3EQL F;  3G4Z A;  4KI2 A;  1VLS A;  1CPQ A;  4FX5 A;  1ZHX A;  2OEX A;  2OQM A;  4GYT A;  3GWL A;  1LI7 A;  4CJO A;  2CYD A;  4OIN F;  4DRH B;  2W4M A;  3LNM B;  4ZLD A;  1GS9 A;  2WZG A;  5A6B D;  5KYX A;  2J0X A;  1FR0 A;  2YLD A;  3S90 A;  5BQH A;  1DOV A;  1Z3I X;  3HNK A;  3NMI A;  2L7A A;  4P9F A;  1A7E A;  3ABK C;  3B9Q A;  5JVE A;  2L6H A;  1QKR A;  2XLH A;  1WOL A;  3EHN A;  1Q0D A;  3FXH A;  4XPW A;  3RIP A;  3UMK A;  3O6X A;  2KJG A;  1OKK D;  4MVZ A;  3QW0 A;  3TK0 A;  4YT4 A;  3HNI A;  1Q0G A;  3TJ6 A;  2FAP B;  1ORS C;  2NUP B;  5B3I A;  3S84 A;  1PV3 A;  3GM2 A;  4EBJ A;  1I4Z A;  2XL6 A;  4BJ1 A;  1CPR A;  3X2Q C;  2ZD9 A;  2L81 A;  4LLC A;  4F4B A;  4E18 A;  1TWC A;  2CCY A;  5B3S C;  3DMD A;  3M4C A;  2HMZ A;  2XLD A;  1WAS A;  2PBE A;  3EPV A;  4KBL A;  1WTY A;  2AP3 A;  2Y39 A;  1ZW2 A;  3RVZ A;  1HMD A;  1BR2 A;  1LS4 A;  1BDJ B;  3WG7 C;  4XPX A;  5D92 A;  2CGE A;  3JSE O;  3KMI A;  4NCQ A;  5L0I A;  2MWQ A;  3QVZ A;  3V5Z A;  3AJM A;  4CBE A;  3SYN A;  2B0H A;  1WGW A;  4FWV A;  1B68 A;  2YLG A;  2R7Q A;  1FTS A;  1ZVZ A;  3PMR A;  3UMI A;  4MVR A;  1M6T A;  3DAF A;  4CIH A;  3O55 A;  2YVK A;  3OEO A;  5KYW A;  1NU7 D;  3EJN A;  4ANJ A;  2AWY A;  2OJQ A;  2QE9 A;  1JRA A;  3M4B A;  1BR4 A;  3ABL C;  1RJ9 A;  1M2V A;  1RKE A;  4U5F E;  4B6I A;  4XTK A;  4G78 A;  1QQ3 A;  2WZF A;  1JPJ A;  4MVQ A;  1F1M A;  2J9B A;  2OCC C;  2R7R A;  3RYL A;  2D4U A;  5EGY A;  2IXM A;  3JTL O;  3U2L A;  3VF0 A;  1OR2 A;  3VAY A;  1FAP B;  5COM A;  3U2M A;  2HZ8 A;  1GGQ A;  3QZC A;  4OIP F;  5A6J A;  3IEE A;  1NG1 A;  2LD6 A;  4PJL A;  2O9X A;  3GM1 A;  2WZL A;  5DS4 A;  2IM8 A;  3HLZ A;  4KNV A;  1H9T A;  4CJG A;  4I1O B;  4YJW A;  2X51 A;  3JRM O;  5GPG B;  3X1O A;  2EPM X;  1OCR C;  1LS1 A;  1YDI A;  4J30 B;  1HW1 A;  4U5G A;  1RKC A;  3B0U X;  4U9D A;  3U8V A;  1V4A A;  2IXN A;  2XLW A;  1LE4 A;  4MVS A;  2B0J A;  5CI9 A;  2NUP A;  2XS8 A;  4OIR F;  3RQG A;  4MND A;  1YA7 O;  3F46 A;  3DI5 A;  3EHM A;  2EPK X;  4WGY A;  4W8K A;  3U3F A;  1ZU4 A;  1H6G A;  2VCA A;  1TFK B;  4NQF A;  2PNO A;  1C02 A;  2EPO A;  3ASO C;  2I8B A;  1CGM E;  2HV6 A;  2NPU A;  5A69 A;  2M4E A;  1Y4C A;  4QI2 A;  3N2Z B;  2H7V C;  1YYX A;  3GOR A;  5DLJ A;  2J9W A;  3HNJ A;  4JCH A;  4JTC B;  2W9Y A;  1D0Y A;  4D4X A;  1S7Z A;  2CNW A;  3AQC A;  1G4W R;  3FOP A;  4C3E A;  3F47 A;  2H8A A;  1W2W A;  1VK5 A;  4RBN A;  2ZXP A;  4YL0 A;  3ZC4 A;  2LK4 A;  1NU9 C;  3C7J A;  4UDV A;  3IQT A;  3SZR A;  4MVU A;  1OCC C;  4DBQ A;  1TWH A;  3JT1 A;  4OD4 A;  4JVS A;  4NTF A;  3L34 A;  4MVM A;  2KGO A;  1RXQ A;  4XPY A;  5EK0 A;  4IRU A;  4AE4 B;  4I3M A;  2DI3 A;  4Q5S F;  1LPE A;  3MYI A;  2QY9 A;  4XQ1 A;  4BEJ A;  3K1I C;  3WOD F;  1A41 A;  1K04 A;  2ASR A;  3L0I A;  1E2X A;  1I5N A;  2OEV A;  3BRJ A;  3CZ6 A;  2NSF A;  1S05 A;  5E2Q A;  1L7C A;  2RSE B;  3PCV A;  5TJ5 E;  3I4U A;  3K7D A;  4MTO A;  3Q6M A;  3ZG1 A;  3GEH A;  3B0P A;  2J0W A;  4E7Z A;  1VYK A;  2OJE D;  3TOL A;  3Q7L A;  4DRI B;  4DOZ A;  2G3V A;  1VYI A;  5HV9 A;  4U5B E;  4ULW A;  4YN0 B;  4DXW A;  2DGJ A;  1QPU A;  1ZHT A;  5F5F A;  3MBG A;  4I44 A;  2Y3B A;  3VRC A;  2R05 A;  2A6E F;  4H54 A;  4C7O B;  3NMK A;  1M56 C;  2NUT B;  1Q0F A;  4PAC A;  2DYR C;  2RD9 A;  1MQV A;  2VCC A;  2IBF A;  4YK5 A;  2KK1 A;  3JYY A;  3RQF A;  1OXB A;  3T6B A;  2ICW G;  3US6 A;  5E3A A;  2YL1 A;  4YL3 A;  3RVY A;  2XM4 A;  2Y3D A;  4XEK A;  1SF8 A;  1JR8 A;  3LJB A;  3AG4 C;  4G0H A;  4IWB A;  4CSA A;  1YJG A;  1AEP A;  1M57 C;  3EZI A;  3EZH A;  3C8G B;  3S29 A;  5DQT A;  4I1M A;  5FCL A;  1E84 A;  1VTM P;  1M2O A;  3UR3 C;  2J8W A;  3UGP A;  2J7P D;  3GEI A;  4OIO F;  5BUO A;  1JOG A;  1Y6D A;  2R7X A;  3NRH A;  4ER9 A;  1YAR O;  3RQE A;  4YL1 A;  5JRA A;  4Z9I A;  4JKV A;  2VB6 A;  5E33 A;  1D1B A;  3UMH A;  4AX2 A;  3NDB B;  1ZU5 A;  2R7T A;  2XL4 A;  3I5P A;  3AGT A;  3K1H A;  3CEX A;  2NSG A;  1OKK A;  1E85 A;  3EFO B;  4IB4 A;  4MTF A;  2BC5 A;  1G5Z A;  2HMQ A;  2VC9 A;  3JZ0 A;  2YL3 A;  5KYY B;  4IAO A;  3W2W A;  1TR2 A;  4AE4 A;  2EIJ C;  2I15 A;  2VCB A;  4OD5 A;  4EWC A;  5L0F A;  1KTM A;  4ULV A;  1EA8 A;  3T6J A;  3PHF 2;  1OR3 A;  2OU6 A;  1LVK A;  1OCZ C;  3ZVR A;  2R7O A;  1QSP A;  2QTV A;  3H2U A;  4LDQ A;  3U5S A;  3MFN A;  1V55 C;  1YAU O;  2AVK A;  3NYJ A;  5JUA A;  4JUR I;  3ECS A;  1KU2 A;  3EGD B;  1ZW3 A;  4WAB A;  3SEO A;  2D5R B;  3SXM A;  1MMD A;  5L0H A;  5AC4 A;  4U5C E;  2XLO A;  3G4X A;  5CI8 A;  2G3K A;  3RFY A;  4BJ5 C;  3CSK A;  3AG3 C;  2R7V A;  2P61 A;  1GQA A;  1A7D A;  3GEE A;  3FAJ A;  4CS7 A;  4E0H A;  1D1C A;  1YA9 A;  2CDQ A;  2WB7 A;  3B29 A;  3HJC A;  2NG1 A;  4K1O A;  4C7O A;  3AG1 C;  5L0D A;  1Q0M A;  2NUT A;  2OG2 A;  4BJT A;  4E0I A;  1MMG A;  2H7B A;  2KQ9 A;  3FVY A;  2XLV A;  5L3V A;  1LKX A;  2M64 A;  4A2N B;  1NFN A;  3H65 A;  1J8M F;  2EPN A;  5JP7 A;  2Y69 C;  1OQC A;  2PFD A;  2R03 A;  4KC9 A;  3ZTZ A;  3C8G A;  4CS8 A;  3V7O A;  3W8H A;  5DQZ A;  1OXK A;  2C03 A;  1FFT C;  2GA0 A;  2MHR A;  4JEA A;  2P7V A;  1MMN A;  2HUJ A;  2J45 A;  1HE9 A;  3A9C A;  4NC3 A;  3RH3 A;  4CIP A;  3EH1 A;  1LE2 A;  4PJN A;  2LFD A;  1Z5Z A;  1FFH A;  4O6N A;  1CGN A;  4OIQ F;  2BE5 F;  5F28 E;  1L3P A;  4E7S A;  1OCO C;  2LSE A;  2R25 A;  1NFO A;  2QUP A;  2HFI A;  2P6V A;  3EFO A;  1QLE C;  3DKA A;  4G7Z F;  3VM6 A;  4MS2 A;  5K0I A;  4O6M A;  2G62 A;  3S27 A;  5KYY A;  4CDV A;  3N24 A;  4U5D E;  4ZLC A;  2LFF A;  3DE9 A;  3WAQ A;  3DWW A;  1ORY A;  1ST6 A;  3LS0 A;  2YHS A;  4H4K C;  5CIV A;  4XLP F;  2AWC A;  2WVQ A;  3ZQY A;  3ZSU A;  2A6H F;  1T6I A;  4QDL A;  3U9J A;  3W4Y A;  1O3U A;  5FZT A;  2XXA B;  4J32 B;  3DE8 A;  4PFP A;  4JTA B;  3NMJ A;  1YZC A;  2HS5 A;  2R9R B;  3KYJ A;  4Z9H A;  1A7V A;  1GM5 A;  3EGD A;  3NKE A;  2P1A A;  4AK9 A;  4BJ6 C;  5T1D B;  1D0Z A;  2Q3T A;  4EHP A;  3MYF A;  1U6H A;  4MTG A;  2XLM A;  3A11 A;  2J9V A;  3LNR A;  2R02 A;  2UUH A;  2BL2 A;  4FES A;  4JCZ A;  2VAS A;  1PCX A;  2PX0 A;  1EI7 A;  3TOM A;  3L8I A;  2PP4 A;  2Z15 A;  3JYH A;  1R5I D;  3H2V A;  3AG2 C;  2A69 F;  2GAQ A;  2VH3 A;  3MLG A;  4JRZ A;  3NG1 A;  4MQ9 F;  2IYL D;  1QVX A;  3AGU A;  3SXK A;  2A1D D;  2CNW D;  4W8P A;  2Q9B A;  2QNL A;  4CS9 C;  1UFB A;  3DM5 A;  2XL8 A;  2Y3H A;  1VLT A;  3DD7 A;  2OOC A;  1K40 A;  4JW1 A;  1WN0 A;  4NTB A;  3B71 A;  1JAF A;  2HJ3 A;  2J9U A;  3KL4 A;  3T6G B;  1EKY A;  1NLX A;  3EGX B;  3EH2 A;  3Q6N A;  1N1C A;  1XZQ A;  3QTH A;  2V26 A;  5JSL A;  4A4A A;  4AL0 A;  4WJ0 A;  5EHH A;  1NBB A;  256B A;  3RF3 A;  4L6R A;  3MX3 A;  4O7G A;  1DOW A;  3FOO A;  4HFF B;  2JPU A;  2W4B A;  1OW7 A;  3E70 C;  5T3T A;  5F5H A;  3N0T A;  4XEV A;  4DRJ B;  4DVZ A;  1E86 A;  5KYU B;  2R7S A;  3ZWI A;  3HNL A;  5COF A;  2ETS A;  3U3B A;  4DVY P;  1QZX A;  1T6Q A;  4IAQ A;  5DVW A;  3ZTM A;  2KYH A;  4NTA A;  3T4R A;  3UGO A;  4BEM J;  4O6Y A;  2FGY A;  3DJN B;  4XWJ A;  4BG0 A;  4FAP B;  3QMK A;  4IJJ A;  2YQY A;  3O10 A;  5L0J A;  2WVO A;  3LES A;  3W8I A;  2JD3 A;  1O87 A;  2Y3G A;  2KC3 A;  2LQG A;  3K6B A;  4DBR A;  2HJM A;  1ZHW A;  2OKU A;  1APC A;  1ORJ A;  4LDK A;  3IPM O;  4G7O F;  5A6B A;  1V74 B;  3K66 A;  4ONS A;  2EIN C;  4Q4Z F;  4C3D A;  4C3B A;  2XXA A;  2AU5 A;  3IQC A;  4N6C A;  5A6K A;  1AVO B;  2LCH A;  3TJ5 A;  2MYS A;  3LLI A;  1Q0K A;  3KPH A;  4NY3 A;  3U9M A;  5KYN A;  2L6G A;  2Q9C A;  2KSF A;  4N4W A;  5D91 A;  2Q4F A;  1R4T A;  1LM3 B;  3FAP B;  3S9O A;  1OW8 A;  3M15 A;  4U5E E;  3SNH A;  4CX9 A;  3J06 A;  3IQ5 A;  2HV7 A;  2C04 A;  3TUL A;  5IY5 C;  1WWP A;  2YKZ A;  3GM3 A;  2DB4 A;  2WVN A;  4D4N A;  1T6U A;  2ZPA A;  3C63 A;  4K7B A;  3U8P A;  2IXO A;  3DZA A;  3POV A;  3UNG C;  2YRF A;  2HSB A;  1CGO A;  3IHU A;  1V54 C;  3R7C A;  3EGX A;  2EIK C;  3KKB A;  4Q7C A;  5L0G A;  4YT2 A;  5A6A A;  4PJJ A;  1TWA A;  3DJU B;  4JEB A;  5DS6 A;  1G4U S;  4WGZ A;  4YWQ A;  4R32 A;  2LP4 A;  4BJ6 A;  3EG9 A;  1TQG A;  1FNT c;  2H7O A;  4LER A;  3PDM P;  3NYL A;  4JE9 A;  5HSW A;  1RCP A;  4JC7 A;  5KYU A;  1I4Y A;  2L9J A;  3GOD A;  3K33 A;  2A0B A;  2YZS A;  1FMV A;  1JPN A;  1Z6A A;  3C8Z A;  1MNE A;  5COG A;  3ZDL A;  4EBB A;  1HW2 A;  4P9T A;  5BQG A;  2PX3 A;  1BR1 A;  5L3Q A;  3W2V A;  4XLN F;  2YWA A;  4M63 A;  3K1I A;  2XS1 A;  4CS9 A;  1YVI A;  3HKK A;  4N6H A;  3HTK C;  1UG7 A;  3V5Y A;  1IZM A;  2HKV A;  4J7T A;  3KH2 A;  1VOM A;  1ZYR F;  5JT4 A;  1XZP A;  2P0N A;  1AUE A;  4EBK A;  2ZXR A;  4CDY A;  4G7H F;  1C17 M;  1J8Y F;  1K05 A;  3DM9 B;  2JX0 A;  1O5H A;  4DJ9 A;  3ZIB A;  1HMO A;  3OA1 A;  2GWW A; 
#chains in the Genus database with same CATH homology
 3VRC A;  2XLM A;  2XL6 A;  3C62 A;  1CPR A;  3NMK A;  3TOM A;  2CCY A;  1MQV A;  3M4C A;  3ZQV A;  1E83 A;  2XLD A;  1YZA A;  3QW1 A;  2YL1 A;  3QVY A;  2XM4 A;  2XL8 A;  3QVZ A;  5JLI A;  1JAF A;  5AGF A;  1E84 A;  1EKY A;  2J8W A;  2YLI A;  2YLG A;  3L1M A;  5JSL A;  4ER9 A;  1M6T A;  1NBB A;  256B A;  5JRA A;  4L6R A;  4JKV A;  3FOO A;  3M79 A;  3IQ6 A;  1E86 A;  3ZWI A;  3HNL A;  3M4B A;  1E85 A;  4IB4 A;  4IAQ A;  2BC5 A;  4IAR A;  3ZTM A;  1QQ3 A;  2YL3 A;  1BBH A;  2J9B A;  4ULV A;  4EIY A;  1APC A;  5JUA A;  4CJG A;  2YL0 A;  2XLO A;  2XM0 A;  4U9D A;  1GQA A;  2XLW A;  4N4W A;  4U9E A;  4WGY A;  1LM3 B;  5JS5 A;  3M15 A;  4CX9 A;  2XLV A;  3IQ5 A;  2YKZ A;  2XLE A;  1YYX A;  5JP7 A;  4D4N A;  3C63 A;  1YYJ A;  2QLA A;  3HNJ A;  3U8P A;  4D4X A;  3ZTZ A;  3FOP A;  1CGO A;  4JEA A;  4NC3 A;  4CDA A;  4CIP A;  2YL7 A;  4JEB A;  4WGZ A;  1CGN A;  4JE9 A;  1CPQ A;  1RCP A;  4CJO A;  4CDV A;  1S05 A;  2YLD A;  3DE9 A;  4N6H A;  3ZQY A;  3HNK A;  3NMI A;  3DE8 A;  5JT4 A;  5JVE A;  3NMJ A;  1YZC A;  3TOL A;  5B3I A;  1A7V A;  2XLH A;  4CDY A;  3QW0 A;  1QPU A;  3HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...