3DE8A

Crystal structure of a dimeric cytochrome cb562 assembly induced by copper coordination
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Control of protein oligomerization symmetry by metal coordination: C2 and C3 symmetrical assemblies through Cu(II) and Ni(II) coordination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3de8A00
5B3IA 3IQ5A 1CGNA 5AGFA 3HNJA 3M4CA 3TOLA 5JSLA 4WGYA 5JLIA 2YLIA 3L1MA 1YZCA 1E83A 3NMIA 4JEAA 3TOMA 4D4XA 2YLGA 4CDVA 2CCYA 4JKVA 4N4WA 3C62A 5JP7A 2BC5A 2XLOA 2XL8A 1BBHA 4IB4A 1M6TA 1NBBA 4NC3A 3HNIA 4JEBA 1CPQA 1LM3B 3QVYA 3DE9A 4N6HA 2YKZA 3DE8A 4CX9A 1A7VA 256BA 4WGZA 3FOPA 4L6RA 2YLDA 4IARA 3ZQYA 4D4NA 4CDYA 3QW0A 2XLHA 2YL7A 3M15A 2XM4A 3FOOA 3IQ6A 3ZTZA 5JS5A 1GQAA 1CGOA 3HNKA 1E84A 3QW1A 3C63A 1MQVA 4IAQA 5JRAA 3HNLA 1YYXA 2YL0A 1S05A 4U9EA 4CJOA 1YZAA 1APCA 5JVEA 1CPRA 2XLEA 4CDAA 2XLVA 3NMKA 3NMJA 2XLMA 3ZWIA 4ER9A 3VRCA 3ZTMA 1QQ3A 2XLDA 3M79A 2YL1A 4CJGA 2XLWA 4EIYA 5JT4A 2J8WA 3U8PA 2XL6A 2YL3A 4CIPA 3QVZA 2QLAA 3M4BA 1E85A 4ULVA 3ZQVA 4U9DA 1JAFA 1QPUA 1RCPA 5JUAA 1EKYA 1E86A 4JE9A 2J9BA 2XM0A 1YYJA
chains in the Genus database with same CATH superfamily
1H9GA 4ONSA 4MQ9F 1U6HA 2LFDA 2A69F 1YA7O 4XPXA 3RYLA 5B3IA 5L3QA 4MS2A 2Q9CA 3IQ5A 5KYUB 4XPWA 3LNRA 3M4CA 4G78A 1RXQA 1DOVA 1Q0DA 1WWPA 3NKDA 1FMWA 3F46A 2YLIA 3SZRA 5JLIA 1YA9A 3U2LA 3KYIA 3WHNA 1YZCA 4E17A 2Y3DA 5L0IA 5L0CA 4RDAA 4JEAA 2WB7A 2HV6A 4A2NB 2AP3A 2W4BA 3EFOA 5HSWA 3LLIA 4K1OA 3T9OA 3JTLO 1HMOA 1T9KA 4XEVA 4KI2A 3RVZA 1Z3IX 4CDVA 1VK5A 4HFKB 4OIPF 4JKVA 2B0JA 2A6EF 1EQ1A 3AQCA 1AEPA 2HJ3A 3C62A 3O10A 4FAPB 2A1DD 3G4ZA 4IRUA 1H9TA 2CW0F 1V55C 4IAOA 2R9RB 1NZEA 1BBHA 4YL0A 1M57C 2EIKC 2OG2A 3SP1A 3ZG1A 2VH3A 4YK5A 4KC9A 1M6TA 3LS1A 5DVWA 4N6HA 2Z15A 2J46A 3B71A 4OD5A 2Q3TA 4I44A 4JRZA 1MMAA 3UMIA 4Z9JA 3DE8A 2EILC 2OQMA 3C7JA 4YT4A 1T5OA 1OCZC 4U5BE 2R7XA 3U0CA 3UGPA 256BA 4WGZA 4LLEA 4IARA 4OD4A 3ZQYA 1NG1A 4F4BA 4CDYA 3AG1C 3VYWA 2M4EA 3DJUB 2XLHA 3DI5A 4N6CA 2LQGA 3M15A 1LI5A 2EINC 2EPNA 1T6QA 4ULWA 5COGA 3K6BA 2XM4A 1M2VB 2IXMA 1GQAA 3BEHA 1N1CA 1TKNA 2AU5A 4O79A 3C8ZA 3HNKA 4KBLA 5DLJA 1E84A 5KYWA 5KYWB 2L81A 2F22A 4AX2A 1QLEC 1ZHTA 1YZAA 2ZPAA 2EPKX 1APCA 1WASA 1LE4A 2IXNA 1RKCA 3B29A 3LJBA 3NYMA 2VASA 3R2PA 5KYUA 1LPEA 1HW1A 3V7OA 2QY9A 3HKKA 4BJ5C 1FFTC 4QI0A 3MYFA 2ETSA 1T6UA 1ZW3A 3JYHA 4I1OB 3NMKA 1G5ZA 1Y4CA 4U5CE 5A6BA 4ER9A 2G3VA 2IM8A 1HE1A 4PJMA 3NDBB 1K05A 2PP4A 4ANJA 3EJNA 4IWBA 3TJ5A 2ICWG 3S28A 2AWYA 1QQ3A 3ZTMA 2R7TA 1FFHA 2A6HF 1NFNA 2ZXRA 1I5NA 2RSEB 3GWNA 3M79A 3MX3A 3Q6MA 4HEAJ 4IJJA 2WL8A 1D0YA 4O6YA 4PFPA 2WZFA 4FESA 4PFOA 4BJ5A 2CNWD 2HS5A 4H54A 4LDRA 3ZDLA 2DI3A 1BR1A 1NSGB 3L8JA 3S29A 3W8HA 3BRJA 2XSEA 1HW2A 3FXHA 2OU6A 2YL3A 2NUPB 3UR3C 3QVZA 4P9TA 1KU2A 5DQTA 3FMSA 4ULVA 1OR3A 4A4AA 4U9DA 3AGTA 1JAFA 4K7BA 1VMAA 2IOQA 4I3MA 5A69A 1TWHA 1Q0GA 2HV7A 2D5RB 2GAQA 1MMGA 3T6JA 4OIOF 1J8YF 2FGYA 3G4XA 1TWGA 5D91A 2LCHA 4B6IA 4BPMA 4MVUA 4MW8A 3A9CA 1LS4A 1AUEA 3L8IA 5F5FA 3M1CB 3PHF2 4WABA 3AOUA 3HNJA 1DOWA 2LK4A 3EG9B 1LIHA 3U8VA 5KYYB 4MNDA 4BEMJ 3SXMA 3POVA 1OCCC 1XZPA 3LEOA 4MVRA 4N06A 1E83A 1M2VA 2OKUA 1OR2A 1FR0A 4C3BA 2ZXWC 3I4UA 5L0GA 3EH2A 3O6XA 2NSFA 5E3AA 1LKXA 1YARO 4W8PA 1T01A 2CCYA 4GQHA 2J45A 3US6A 3GANA 4XQ1A 1RKEA 3TK0A 2CYDA 2P0NA 1OCOC 2HSQA 1RMVA 4C7OB 4FWVA 2R7SA 3KYJA 4JC7A 4PACA 4Z9HA 5K0IA 5DS4A 3CQZA 2J0XA 1TFKB 1WGWA 2YVKA 1JPJA 2NUTB 1ZHYA 4UDVA 1NBBA 2CNWA 2DB4A 1QKRA 1T6IA 1G8XA 3L0IA 3NG1A 1CPQA 3CAXA 3RVYA 3ABLC 3DE9A 4AL1A 2KGOA 3WAQA 5BQHA 3EPVA 1FMVA 1Z6AA 2YKZA 3ABMC 3X1OA 2EPLX 4Z9IA 3DMDA 4CX9A 4JW1A 1SR2A 5E33A 4EHPA 2GA0A 4RD9A 3ASNC 2HMZA 4U5DE 3SYNA 2W45A 4YWQA 5A6KA 3ASOC 2OJED 1SMYF 3FOPA 4G7HF 2YLDA 2R7UA 2YZSA 3MLGA 2GWWA 2HFIA 1MMNA 4JCHA 1D1AA 4HFFB 2M64A 4NTFA 1OKKD 3LAYA 3FDQA 2EPOA 2QUPA 2MWQA 3RFYA 1I4YA 4J32B 3MFNA 5AC5A 3J06A 1ZHZA 3IQ6A 4MVOA 2L7AA 3ZTZA 1FTSA 3GWLA 5F5HA 2L6HA 3QW1A 4J7YA 3AG2C 3HTKC 1RJ9B 2O9XA 3LESA 1TFOB 2QTVA 5E3CA 2EIJC 1M56C 4GEHA 2BL2A 2Q00A 4H4KC 3DM5A 1NFOA 3JSZA 5D92A 4BEJA 4DVZA 2L6GA 5B1BC 3EG9A 3FAPB 3GODA 2DYRC 2D4UA 2V26A 2VCBA 1D1CA 2J7PA 3EHNA 3I5QA 4QI2A 4JTAB 2KYHA 3L34A 2XLMA 1VYKA 2QE9A 2H7VC 1OXKA 1D1BA 4XPYA 3JT1A 5B3SC 5IY5C 3U3BA 3VRCA 4P9FA 5GPGB 2FAPB 5L0JA 3KH2A 1YDIA 3RF3A 1VYIA 1OW7A 2HKVA 1UFBA 4LERA 5KYXB 2XLWA 1O5HA 2MHRA 4MVMA 2ZD9A 3N0TA 4Q7CA 4C7OA 2UUIA 1TWCA 3G50A 5BQGA 3T6BA 2J8WA 4MTFA 1V4AA 3DWWA 3U8PA 1I4ZA 3Q7LA 4CIPA 2I15A 2R7WA 5BUOA 1E85A 2R7QA 4YL1A 3RKOF 2XXAB 4JURI 2NUTA 4E7ZA 2HZ8A 3SXKA 3X2QC 3TULA 1QSPA 5EGYA 1KNYA 4YT5A 4DBRA 2J9UA 2XL4A 1R4TA 4P6IC 4CBEA 5JUAA 1E86A 1UG7A 2IXOA 3GEHA 1H6GA 1OKKA 3E9VA 3F47A 4K0DA 2X51A 1B68A 3JSEO 3FAJA 3MBGA 3C8GB 1GGQA 2L9JA 1EA8A 1JMWA 1XZQA 3GORA 1Z63A 1F1MA 3K66A 4RBNA 1D0XA 4O6MA 2OEXA 5F28E 1NLXA 2PX0A 3B0VC 1CGNA 3ITFA 5AGFA 4CS7A 3RQEA 2VB6A 2PFDA 3ABKC 3TOLA 1VB5A 3ZSUA 1D0ZA 5JSLA 4BG0A 5FCLA 4C3EA 4G0HA 3C8GD 3V5XA 1CGME 3L1MA 4YJWA 3PDMP 1IW7F 3DKAA 4OIRF 1LS1A 1ORYA 3NMIA 2J0WA 1OW6A 2Q7RA 2X0CA 4MTGA 1G4US 3EGDB 3U9MA 3B0UX 2WVQA 3IQTA 4FX5A 1L7CA 3JRMO 4D4XA 1TQGA 1RJ9A 1QVXA 4MVZA 3RH3A 4BJ6C 4DVYP 3W4YA 2YLGA 4M63A 1GM5A 1E2XA 2LIGA 2A0BA 2L6FA 3EZHA 4EBJA 3OWTA 4X0RA 4ZLCA 1XWJA 5A6AA 1OW8A 3DAFA 3EQLF 3LNMB 3EHMA 5COMA 2GFHA 5JP7A 2XLOA 1ZYRF 3V5YA 2R05A 4IB4A 2KC3A 2ZXOA 2VCAA 2XS8A 3K7DA 4KNVA 3K1IC 3W2WA 2JPUA 5DS6A 4BJ6A 4NC3A 2OJQA 2HSBA 4JEBA 1LM3B 2A68F 4AK9A 3K33A 4U5FE 3ATPA 3WG7C 1FNTc 2P6VA 1WN0A 1JOGA 3DAGA 4JTDB 3DD7A 1JR8A 4NQFA 1A7VA 4MW3A 2H7OA 2WZLA 1HY5A 5KYXA 4LDQA 2W4MA 3RIPA 3ZIBA 1VLSA 3H65A 2PF4E 1BDJB 3NRHA 3S27A 1A7DA 3W8IA 3V5ZA 3H2UA 4EUKB 3K1IA 1H7IA 2OOCA 4O7GA 3Q6NA 1PD0A 2P1AA 1WTYA 2WVOA 1FAPB 1Z5ZA 3QW0A 2C04A 2XRHA 2XXAA 1IZMA 2VC9A 2Y3BA 2YQYA 3RW0A 2P61A 3FOOA 1YAUO 3FHDA 2P7VA 4JCZA 1YJGA 3SEOA 2BE5F 2OCCC 4CS8C 2QNLA 5JRAA 3A11A 4DOZA 5A6JA 1SYQA 1YYXA 3CEXA 3KL4A 2J9WA 1S05A 3TJ6A 5TJ5E 1PD1A 4U9EA 3R7CA 4JJGA 2AVKA 3JCUQ 3TQOA 5JVEA 2KQ9A 4AE4B 2W9YA 3GEIA 4E0HA 4CIHA 1BZ4A 4CDAA 2XLVA 1Y6DA 2OEVA 4DRHB 4LLCA 4CS8A 1WOLA 3GM3A 4YL3A 2NUPA 3OEOA 1ZU5A 4CSAC 1TWAA 2IBFA 3EGDA 1C17M 3HJCA 2GDCA 3LLKA 4NTAA 4DXWA 2ASRA 4PJNA 5T3TA 3DM9B 2V3CC 2LP4A 2XLDA 1OCRC 1Z23A 3QZCA 5CI9A 2YL1A 4ZLDA 2PX3A 4QDLA 3S90A 1OQCA 5JT4A 3KKBA 3IHUA 3NYJA 1NU7D 2XL6A 4CS9C 3VAYA 2QLAA 5DS5A 1K40A 4CSAA 2KSFA 3C18A 3PMRA 3UMHA 2YWAA 3CZ6A 3LEVA 4NTBA 3VM6A 4DJ9A 3NKEA 4HE8D 1GS9A 1SZIA 2CDQA 4PJLA 3DXJF 5BQIA 1RCPA 2A0UA 2R03A 4O6NA 5KYYA 2AWCA 5A6BD 1VLTA 3WODF 2Q9AA 3ECSA 4YT2A 1ZVZA 2XM0A 1YYJA 4EBBA 4EKWA 3EGXB 3AG3C 2I8BA 3HLZA 3U3FA 4CS9A 4Q5SF 2WVNA 4U5HA 1LI7A 3U9JA 3U5SA 4XLPF 3O39A 1MMDA 3GM2A 3S84A 1V74B 2NPUA 2YHSA 4Q4ZF 2G3KA 3EH1A 4WGYA 4WJ0A 3UMKA 4PJJA 4U5GA 1ZHXA 4I1MA 4PK4A 5FZTA 1ZW2A 4R32A 4BJTA 4JTCB 3TOMA 4E7SA 3IEEA 1PCXA 1EI7A 2E87A 1C02A 2KW3C 3DJNB 4OIQF 1ZHWA 3JRTA 4E18A 3MYIA 3K1HA 2NSGA 4N4WA 1J8MF 4BJ1A 1ZU4A 1U89A 4XLNF 4EBKA 1VOMA 3ZC4A 1HMDA 2BC5A 2YRFA 4U5EE 4AE4A 3FVYA 2XL8A 4XTKA 3T6GB 5CI8A 3B0PA 3I5PA 3AJMA 2WZGA 1R5ID 4J30B 5B1AC 1YVIA 2NG1A 3NYLA 3OA1A 3HNIA 4OINF 3QVYA 1Q0FA 2Y3HA 3CSKA 1O87A 3RQFA 1RKEB 3GM1A 5COFA 4IGGA 3VF0A 1ZZPA 1LE2A 2KNHA 5T1DB 5T3WA 3SXYA 2JX0A 3UGOA 3S9OA 2TMVP 1C03A 1JRAA 2DGJA 3DZAA 4MTOA 2HUJA 4JJFA 3KPHA 1OXBA 4L6RA 3KMIA 2LD6A 4D4NA 3U2MA 2UUHA 2HJMA 2H8AA 1LVKA 5L0HA 1BR2A 2C03A 3H2VA 2YL7A 3SNHA 4MVSA 3LS0A 4G7OF 2R7RA 2CGEA 4XEFA 5AC4A 2Y39A 1YLMA 3JZ0A 3UNGC 1M2OA 2R7VA 1ORSC 1Q0KA 3TD7A 2PNOA 4PR9A 5JS5A 2LFFA 4AL0A 1VTMP 1A7EA 3B9QA 1CGOA 3EFOB 1BR4A 2KK1A 1MQVA 3AG4C 3C63A 3Q7GA 2VCCA 4IAQA 3HNLA 1SF8A 3EGXA 1G4WR 1V54C 2YL0A 2B0HA 2EIMC 2DYSC 3GEEA 3IPMO 2JD3A 4NY3A 2Q4FA 4XEKA 1A41A 1W2WA 4LACB 4CJOA 4YN0B 4J7TA 4E0IA 1HE9A 1S7ZA 4JVSA 2Y3GA 2Y69C 2YEVA 1ORJA 3AQBA 4KNWA 2IYLD 1K04A 1CPRA 5L0FA 2XLEA 4XWJA 4DBQA 1U0BB 1MNDA 1NU9C 4C3DA 4G7ZF 5EK0A 3QTHA 2XS1A 3NMJA 3T4RA 1KTMA 3JYYA 4EWCA 3ZWIA 1O3UA 5E2QA 1ST6A 1WATA 1L3PA 1PV3A 5CIVA 3O55A 3ZVRA 1MNEA 4YT8A 2IXPA 2Q9BA 3E70C 4JIOA 5EHHA 2FFHA 4CJGA 2ZXPA 2EPMX 3PCVA 5HV9A 2HMQA 3S0XA 2J9VA 1AVOB 2H7BA 4EIYA 1TR2A 4DRIB 2RD9A 4LDKA 5L3VA 1A0BA 3SXZA 3C8GA 2R25A 2R02A 3RQGA 3EZIA 4MVQA 5DQZA 2LSEA 3M4BA 2KJGA 3N24A 3QMKA 5L0DA 3IQCA 3ZQVA 1QZXA 2R7OA 4JZAA 4NCQA 4DRJB 2PBEA 5KYNA 1QPUA 3W2VA 3AGUA 2MYSA 2J7PD 2G62A 1EKYA 4JE9A 4GYTA 2J9BA 3N2ZB 4W8KA 1Z7Qc 1Q0MA 3LUTB 1JPNA
chains in the Genus database with same CATH topology
5B3IA 3IQ5A 1CGNA 5AGFA 3HNJA 3M4CA 3TOLA 5JSLA 4WGYA 5JLIA 2YLIA 3L1MA 1YZCA 1E83A 3NMIA 4JEAA 3TOMA 4D4XA 2YLGA 4CDVA 2CCYA 4JKVA 4N4WA 3C62A 5JP7A 2BC5A 2XLOA 2XL8A 1BBHA 4IB4A 1M6TA 1NBBA 4NC3A 3HNIA 4JEBA 1CPQA 1LM3B 3QVYA 3DE9A 4N6HA 2YKZA 3DE8A 4CX9A 1A7VA 256BA 4WGZA 3FOPA 4L6RA 2YLDA 4IARA 3ZQYA 4D4NA 4CDYA 3QW0A 2XLHA 2YL7A 3M15A 2XM4A 3FOOA 3IQ6A 3ZTZA 5JS5A 1GQAA 1CGOA 3HNKA 1E84A 3QW1A 3C63A 1MQVA 4IAQA 5JRAA 3HNLA 1YYXA 2YL0A 1S05A 4U9EA 4CJOA 1YZAA 1APCA 5JVEA 1CPRA 2XLEA 4CDAA 2XLVA 3NMKA 3NMJA 2XLMA 3ZWIA 4ER9A 3VRCA 3ZTMA 1QQ3A 2XLDA 3M79A 2YL1A 4CJGA 2XLWA 4EIYA 5JT4A 2J8WA 3U8PA 2XL6A 2YL3A 4CIPA 3QVZA 2QLAA 3M4BA 1E85A 4ULVA 3ZQVA 4U9DA 1JAFA 1QPUA 1RCPA 5JUAA 1EKYA 1E86A 4JE9A 2J9BA 2XM0A 1YYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  3IQ5 A;  1CGN A;  5AGF A;  3HNJ A;  3M4C A;  3TOL A;  5JSL A;  4WGY A;  5JLI A;  2YLI A;  3L1M A;  1YZC A;  1E83 A;  3NMI A;  4JEA A;  3TOM A;  4D4X A;  2YLG A;  4CDV A;  2CCY A;  4JKV A;  4N4W A;  3C62 A;  5JP7 A;  2BC5 A;  2XLO A;  2XL8 A;  1BBH A;  4IB4 A;  1M6T A;  1NBB A;  4NC3 A;  3HNI A;  4JEB A;  1CPQ A;  1LM3 B;  3QVY A;  3DE9 A;  4N6H A;  2YKZ A;  3DE8 A;  4CX9 A;  1A7V A;  256B A;  4WGZ A;  3FOP A;  4L6R A;  2YLD A;  4IAR A;  3ZQY A;  4D4N A;  4CDY A;  3QW0 A;  2XLH A;  2YL7 A;  3M15 A;  2XM4 A;  3FOO A;  3IQ6 A;  3ZTZ A;  5JS5 A;  1GQA A;  1CGO A;  3HNK A;  1E84 A;  3QW1 A;  3C63 A;  1MQV A;  4IAQ A;  5JRA A;  3HNL A;  1YYX A;  2YL0 A;  1S05 A;  4U9E A;  4CJO A;  1YZA A;  1APC A;  5JVE A;  1CPR A;  2XLE A;  4CDA A;  2XLV A;  3NMK A;  3NMJ A;  2XLM A;  3ZWI A;  4ER9 A;  3VRC A;  3ZTM A;  1QQ3 A;  2XLD A;  3M79 A;  2YL1 A;  4CJG A;  2XLW A;  4EIY A;  5JT4 A;  2J8W A;  3U8P A;  2XL6 A;  2YL3 A;  4CIP A;  3QVZ A;  2QLA A;  3M4B A;  1E85 A;  4ULV A;  3ZQV A;  4U9D A;  1JAF A;  1QPU A;  1RCP A;  5JUA A;  1EKY A;  1E86 A;  4JE9 A;  2J9B A;  2XM0 A;  1YYJ A; 
#chains in the Genus database with same CATH topology
 1H9G A;  4ONS A;  4MQ9 F;  1U6H A;  2LFD A;  2A69 F;  1YA7 O;  4XPX A;  3RYL A;  5B3I A;  5L3Q A;  4MS2 A;  2Q9C A;  3IQ5 A;  5KYU B;  4XPW A;  3LNR A;  3M4C A;  4G78 A;  1RXQ A;  1DOV A;  1Q0D A;  1WWP A;  3NKD A;  1FMW A;  3F46 A;  2YLI A;  3SZR A;  5JLI A;  1YA9 A;  3U2L A;  3KYI A;  3WHN A;  1YZC A;  4E17 A;  2Y3D A;  5L0I A;  5L0C A;  4RDA A;  4JEA A;  2WB7 A;  2HV6 A;  4A2N B;  2AP3 A;  2W4B A;  3EFO A;  5HSW A;  3LLI A;  4K1O A;  3T9O A;  3JTL O;  1HMO A;  1T9K A;  4XEV A;  4KI2 A;  3RVZ A;  1Z3I X;  4CDV A;  1VK5 A;  4HFK B;  4OIP F;  4JKV A;  2B0J A;  2A6E F;  1EQ1 A;  3AQC A;  1AEP A;  2HJ3 A;  3C62 A;  3O10 A;  4FAP B;  2A1D D;  3G4Z A;  4IRU A;  1H9T A;  2CW0 F;  1V55 C;  4IAO A;  2R9R B;  1NZE A;  1BBH A;  4YL0 A;  1M57 C;  2EIK C;  2OG2 A;  3SP1 A;  3ZG1 A;  2VH3 A;  4YK5 A;  4KC9 A;  1M6T A;  3LS1 A;  5DVW A;  4N6H A;  2Z15 A;  2J46 A;  3B71 A;  4OD5 A;  2Q3T A;  4I44 A;  4JRZ A;  1MMA A;  3UMI A;  4Z9J A;  3DE8 A;  2EIL C;  2OQM A;  3C7J A;  4YT4 A;  1T5O A;  1OCZ C;  4U5B E;  2R7X A;  3U0C A;  3UGP A;  256B A;  4WGZ A;  4LLE A;  4IAR A;  4OD4 A;  3ZQY A;  1NG1 A;  4F4B A;  4CDY A;  3AG1 C;  3VYW A;  2M4E A;  3DJU B;  2XLH A;  3DI5 A;  4N6C A;  2LQG A;  3M15 A;  1LI5 A;  2EIN C;  2EPN A;  1T6Q A;  4ULW A;  5COG A;  3K6B A;  2XM4 A;  1M2V B;  2IXM A;  1GQA A;  3BEH A;  1N1C A;  1TKN A;  2AU5 A;  4O79 A;  3C8Z A;  3HNK A;  4KBL A;  5DLJ A;  1E84 A;  5KYW A;  5KYW B;  2L81 A;  2F22 A;  4AX2 A;  1QLE C;  1ZHT A;  1YZA A;  2ZPA A;  2EPK X;  1APC A;  1WAS A;  1LE4 A;  2IXN A;  1RKC A;  3B29 A;  3LJB A;  3NYM A;  2VAS A;  3R2P A;  5KYU A;  1LPE A;  1HW1 A;  3V7O A;  2QY9 A;  3HKK A;  4BJ5 C;  1FFT C;  4QI0 A;  3MYF A;  2ETS A;  1T6U A;  1ZW3 A;  3JYH A;  4I1O B;  3NMK A;  1G5Z A;  1Y4C A;  4U5C E;  5A6B A;  4ER9 A;  2G3V A;  2IM8 A;  1HE1 A;  4PJM A;  3NDB B;  1K05 A;  2PP4 A;  4ANJ A;  3EJN A;  4IWB A;  3TJ5 A;  2ICW G;  3S28 A;  2AWY A;  1QQ3 A;  3ZTM A;  2R7T A;  1FFH A;  2A6H F;  1NFN A;  2ZXR A;  1I5N A;  2RSE B;  3GWN A;  3M79 A;  3MX3 A;  3Q6M A;  4HEA J;  4IJJ A;  2WL8 A;  1D0Y A;  4O6Y A;  4PFP A;  2WZF A;  4FES A;  4PFO A;  4BJ5 A;  2CNW D;  2HS5 A;  4H54 A;  4LDR A;  3ZDL A;  2DI3 A;  1BR1 A;  1NSG B;  3L8J A;  3S29 A;  3W8H A;  3BRJ A;  2XSE A;  1HW2 A;  3FXH A;  2OU6 A;  2YL3 A;  2NUP B;  3UR3 C;  3QVZ A;  4P9T A;  1KU2 A;  5DQT A;  3FMS A;  4ULV A;  1OR3 A;  4A4A A;  4U9D A;  3AGT A;  1JAF A;  4K7B A;  1VMA A;  2IOQ A;  4I3M A;  5A69 A;  1TWH A;  1Q0G A;  2HV7 A;  2D5R B;  2GAQ A;  1MMG A;  3T6J A;  4OIO F;  1J8Y F;  2FGY A;  3G4X A;  1TWG A;  5D91 A;  2LCH A;  4B6I A;  4BPM A;  4MVU A;  4MW8 A;  3A9C A;  1LS4 A;  1AUE A;  3L8I A;  5F5F A;  3M1C B;  3PHF 2;  4WAB A;  3AOU A;  3HNJ A;  1DOW A;  2LK4 A;  3EG9 B;  1LIH A;  3U8V A;  5KYY B;  4MND A;  4BEM J;  3SXM A;  3POV A;  1OCC C;  1XZP A;  3LEO A;  4MVR A;  4N06 A;  1E83 A;  1M2V A;  2OKU A;  1OR2 A;  1FR0 A;  4C3B A;  2ZXW C;  3I4U A;  5L0G A;  3EH2 A;  3O6X A;  2NSF A;  5E3A A;  1LKX A;  1YAR O;  4W8P A;  1T01 A;  2CCY A;  4GQH A;  2J45 A;  3US6 A;  3GAN A;  4XQ1 A;  1RKE A;  3TK0 A;  2CYD A;  2P0N A;  1OCO C;  2HSQ A;  1RMV A;  4C7O B;  4FWV A;  2R7S A;  3KYJ A;  4JC7 A;  4PAC A;  4Z9H A;  5K0I A;  5DS4 A;  3CQZ A;  2J0X A;  1TFK B;  1WGW A;  2YVK A;  1JPJ A;  2NUT B;  1ZHY A;  4UDV A;  1NBB A;  2CNW A;  2DB4 A;  1QKR A;  1T6I A;  1G8X A;  3L0I A;  3NG1 A;  1CPQ A;  3CAX A;  3RVY A;  3ABL C;  3DE9 A;  4AL1 A;  2KGO A;  3WAQ A;  5BQH A;  3EPV A;  1FMV A;  1Z6A A;  2YKZ A;  3ABM C;  3X1O A;  2EPL X;  4Z9I A;  3DMD A;  4CX9 A;  4JW1 A;  1SR2 A;  5E33 A;  4EHP A;  2GA0 A;  4RD9 A;  3ASN C;  2HMZ A;  4U5D E;  3SYN A;  2W45 A;  4YWQ A;  5A6K A;  3ASO C;  2OJE D;  1SMY F;  3FOP A;  4G7H F;  2YLD A;  2R7U A;  2YZS A;  3MLG A;  2GWW A;  2HFI A;  1MMN A;  4JCH A;  1D1A A;  4HFF B;  2M64 A;  4NTF A;  1OKK D;  3LAY A;  3FDQ A;  2EPO A;  2QUP A;  2MWQ A;  3RFY A;  1I4Y A;  4J32 B;  3MFN A;  5AC5 A;  3J06 A;  1ZHZ A;  3IQ6 A;  4MVO A;  2L7A A;  3ZTZ A;  1FTS A;  3GWL A;  5F5H A;  2L6H A;  3QW1 A;  4J7Y A;  3AG2 C;  3HTK C;  1RJ9 B;  2O9X A;  3LES A;  1TFO B;  2QTV A;  5E3C A;  2EIJ C;  1M56 C;  4GEH A;  2BL2 A;  2Q00 A;  4H4K C;  3DM5 A;  1NFO A;  3JSZ A;  5D92 A;  4BEJ A;  4DVZ A;  2L6G A;  5B1B C;  3EG9 A;  3FAP B;  3GOD A;  2DYR C;  2D4U A;  2V26 A;  2VCB A;  1D1C A;  2J7P A;  3EHN A;  3I5Q A;  4QI2 A;  4JTA B;  2KYH A;  3L34 A;  2XLM A;  1VYK A;  2QE9 A;  2H7V C;  1OXK A;  1D1B A;  4XPY A;  3JT1 A;  5B3S C;  5IY5 C;  3U3B A;  3VRC A;  4P9F A;  5GPG B;  2FAP B;  5L0J A;  3KH2 A;  1YDI A;  3RF3 A;  1VYI A;  1OW7 A;  2HKV A;  1UFB A;  4LER A;  5KYX B;  2XLW A;  1O5H A;  2MHR A;  4MVM A;  2ZD9 A;  3N0T A;  4Q7C A;  4C7O A;  2UUI A;  1TWC A;  3G50 A;  5BQG A;  3T6B A;  2J8W A;  4MTF A;  1V4A A;  3DWW A;  3U8P A;  1I4Z A;  3Q7L A;  4CIP A;  2I15 A;  2R7W A;  5BUO A;  1E85 A;  2R7Q A;  4YL1 A;  3RKO F;  2XXA B;  4JUR I;  2NUT A;  4E7Z A;  2HZ8 A;  3SXK A;  3X2Q C;  3TUL A;  1QSP A;  5EGY A;  1KNY A;  4YT5 A;  4DBR A;  2J9U A;  2XL4 A;  1R4T A;  4P6I C;  4CBE A;  5JUA A;  1E86 A;  1UG7 A;  2IXO A;  3GEH A;  1H6G A;  1OKK A;  3E9V A;  3F47 A;  4K0D A;  2X51 A;  1B68 A;  3JSE O;  3FAJ A;  3MBG A;  3C8G B;  1GGQ A;  2L9J A;  1EA8 A;  1JMW A;  1XZQ A;  3GOR A;  1Z63 A;  1F1M A;  3K66 A;  4RBN A;  1D0X A;  4O6M A;  2OEX A;  5F28 E;  1NLX A;  2PX0 A;  3B0V C;  1CGN A;  3ITF A;  5AGF A;  4CS7 A;  3RQE A;  2VB6 A;  2PFD A;  3ABK C;  3TOL A;  1VB5 A;  3ZSU A;  1D0Z A;  5JSL A;  4BG0 A;  5FCL A;  4C3E A;  4G0H A;  3C8G D;  3V5X A;  1CGM E;  3L1M A;  4YJW A;  3PDM P;  1IW7 F;  3DKA A;  4OIR F;  1LS1 A;  1ORY A;  3NMI A;  2J0W A;  1OW6 A;  2Q7R A;  2X0C A;  4MTG A;  1G4U S;  3EGD B;  3U9M A;  3B0U X;  2WVQ A;  3IQT A;  4FX5 A;  1L7C A;  3JRM O;  4D4X A;  1TQG A;  1RJ9 A;  1QVX A;  4MVZ A;  3RH3 A;  4BJ6 C;  4DVY P;  3W4Y A;  2YLG A;  4M63 A;  1GM5 A;  1E2X A;  2LIG A;  2A0B A;  2L6F A;  3EZH A;  4EBJ A;  3OWT A;  4X0R A;  4ZLC A;  1XWJ A;  5A6A A;  1OW8 A;  3DAF A;  3EQL F;  3LNM B;  3EHM A;  5COM A;  2GFH A;  5JP7 A;  2XLO A;  1ZYR F;  3V5Y A;  2R05 A;  4IB4 A;  2KC3 A;  2ZXO A;  2VCA A;  2XS8 A;  3K7D A;  4KNV A;  3K1I C;  3W2W A;  2JPU A;  5DS6 A;  4BJ6 A;  4NC3 A;  2OJQ A;  2HSB A;  4JEB A;  1LM3 B;  2A68 F;  4AK9 A;  3K33 A;  4U5F E;  3ATP A;  3WG7 C;  1FNT c;  2P6V A;  1WN0 A;  1JOG A;  3DAG A;  4JTD B;  3DD7 A;  1JR8 A;  4NQF A;  1A7V A;  4MW3 A;  2H7O A;  2WZL A;  1HY5 A;  5KYX A;  4LDQ A;  2W4M A;  3RIP A;  3ZIB A;  1VLS A;  3H65 A;  2PF4 E;  1BDJ B;  3NRH A;  3S27 A;  1A7D A;  3W8I A;  3V5Z A;  3H2U A;  4EUK B;  3K1I A;  1H7I A;  2OOC A;  4O7G A;  3Q6N A;  1PD0 A;  2P1A A;  1WTY A;  2WVO A;  1FAP B;  1Z5Z A;  3QW0 A;  2C04 A;  2XRH A;  2XXA A;  1IZM A;  2VC9 A;  2Y3B A;  2YQY A;  3RW0 A;  2P61 A;  3FOO A;  1YAU O;  3FHD A;  2P7V A;  4JCZ A;  1YJG A;  3SEO A;  2BE5 F;  2OCC C;  4CS8 C;  2QNL A;  5JRA A;  3A11 A;  4DOZ A;  5A6J A;  1SYQ A;  1YYX A;  3CEX A;  3KL4 A;  2J9W A;  1S05 A;  3TJ6 A;  5TJ5 E;  1PD1 A;  4U9E A;  3R7C A;  4JJG A;  2AVK A;  3JCU Q;  3TQO A;  5JVE A;  2KQ9 A;  4AE4 B;  2W9Y A;  3GEI A;  4E0H A;  4CIH A;  1BZ4 A;  4CDA A;  2XLV A;  1Y6D A;  2OEV A;  4DRH B;  4LLC A;  4CS8 A;  1WOL A;  3GM3 A;  4YL3 A;  2NUP A;  3OEO A;  1ZU5 A;  4CSA C;  1TWA A;  2IBF A;  3EGD A;  1C17 M;  3HJC A;  2GDC A;  3LLK A;  4NTA A;  4DXW A;  2ASR A;  4PJN A;  5T3T A;  3DM9 B;  2V3C C;  2LP4 A;  2XLD A;  1OCR C;  1Z23 A;  3QZC A;  5CI9 A;  2YL1 A;  4ZLD A;  2PX3 A;  4QDL A;  3S90 A;  1OQC A;  5JT4 A;  3KKB A;  3IHU A;  3NYJ A;  1NU7 D;  2XL6 A;  4CS9 C;  3VAY A;  2QLA A;  5DS5 A;  1K40 A;  4CSA A;  2KSF A;  3C18 A;  3PMR A;  3UMH A;  2YWA A;  3CZ6 A;  3LEV A;  4NTB A;  3VM6 A;  4DJ9 A;  3NKE A;  4HE8 D;  1GS9 A;  1SZI A;  2CDQ A;  4PJL A;  3DXJ F;  5BQI A;  1RCP A;  2A0U A;  2R03 A;  4O6N A;  5KYY A;  2AWC A;  5A6B D;  1VLT A;  3WOD F;  2Q9A A;  3ECS A;  4YT2 A;  1ZVZ A;  2XM0 A;  1YYJ A;  4EBB A;  4EKW A;  3EGX B;  3AG3 C;  2I8B A;  3HLZ A;  3U3F A;  4CS9 A;  4Q5S F;  2WVN A;  4U5H A;  1LI7 A;  3U9J A;  3U5S A;  4XLP F;  3O39 A;  1MMD A;  3GM2 A;  3S84 A;  1V74 B;  2NPU A;  2YHS A;  4Q4Z F;  2G3K A;  3EH1 A;  4WGY A;  4WJ0 A;  3UMK A;  4PJJ A;  4U5G A;  1ZHX A;  4I1M A;  4PK4 A;  5FZT A;  1ZW2 A;  4R32 A;  4BJT A;  4JTC B;  3TOM A;  4E7S A;  3IEE A;  1PCX A;  1EI7 A;  2E87 A;  1C02 A;  2KW3 C;  3DJN B;  4OIQ F;  1ZHW A;  3JRT A;  4E18 A;  3MYI A;  3K1H A;  2NSG A;  4N4W A;  1J8M F;  4BJ1 A;  1ZU4 A;  1U89 A;  4XLN F;  4EBK A;  1VOM A;  3ZC4 A;  1HMD A;  2BC5 A;  2YRF A;  4U5E E;  4AE4 A;  3FVY A;  2XL8 A;  4XTK A;  3T6G B;  5CI8 A;  3B0P A;  3I5P A;  3AJM A;  2WZG A;  1R5I D;  4J30 B;  5B1A C;  1YVI A;  2NG1 A;  3NYL A;  3OA1 A;  3HNI A;  4OIN F;  3QVY A;  1Q0F A;  2Y3H A;  3CSK A;  1O87 A;  3RQF A;  1RKE B;  3GM1 A;  5COF A;  4IGG A;  3VF0 A;  1ZZP A;  1LE2 A;  2KNH A;  5T1D B;  5T3W A;  3SXY A;  2JX0 A;  3UGO A;  3S9O A;  2TMV P;  1C03 A;  1JRA A;  2DGJ A;  3DZA A;  4MTO A;  2HUJ A;  4JJF A;  3KPH A;  1OXB A;  4L6R A;  3KMI A;  2LD6 A;  4D4N A;  3U2M A;  2UUH A;  2HJM A;  2H8A A;  1LVK A;  5L0H A;  1BR2 A;  2C03 A;  3H2V A;  2YL7 A;  3SNH A;  4MVS A;  3LS0 A;  4G7O F;  2R7R A;  2CGE A;  4XEF A;  5AC4 A;  2Y39 A;  1YLM A;  3JZ0 A;  3UNG C;  1M2O A;  2R7V A;  1ORS C;  1Q0K A;  3TD7 A;  2PNO A;  4PR9 A;  5JS5 A;  2LFF A;  4AL0 A;  1VTM P;  1A7E A;  3B9Q A;  1CGO A;  3EFO B;  1BR4 A;  2KK1 A;  1MQV A;  3AG4 C;  3C63 A;  3Q7G A;  2VCC A;  4IAQ A;  3HNL A;  1SF8 A;  3EGX A;  1G4W R;  1V54 C;  2YL0 A;  2B0H A;  2EIM C;  2DYS C;  3GEE A;  3IPM O;  2JD3 A;  4NY3 A;  2Q4F A;  4XEK A;  1A41 A;  1W2W A;  4LAC B;  4CJO A;  4YN0 B;  4J7T A;  4E0I A;  1HE9 A;  1S7Z A;  4JVS A;  2Y3G A;  2Y69 C;  2YEV A;  1ORJ A;  3AQB A;  4KNW A;  2IYL D;  1K04 A;  1CPR A;  5L0F A;  2XLE A;  4XWJ A;  4DBQ A;  1U0B B;  1MND A;  1NU9 C;  4C3D A;  4G7Z F;  5EK0 A;  3QTH A;  2XS1 A;  3NMJ A;  3T4R A;  1KTM A;  3JYY A;  4EWC A;  3ZWI A;  1O3U A;  5E2Q A;  1ST6 A;  1WAT A;  1L3P A;  1PV3 A;  5CIV A;  3O55 A;  3ZVR A;  1MNE A;  4YT8 A;  2IXP A;  2Q9B A;  3E70 C;  4JIO A;  5EHH A;  2FFH A;  4CJG A;  2ZXP A;  2EPM X;  3PCV A;  5HV9 A;  2HMQ A;  3S0X A;  2J9V A;  1AVO B;  2H7B A;  4EIY A;  1TR2 A;  4DRI B;  2RD9 A;  4LDK A;  5L3V A;  1A0B A;  3SXZ A;  3C8G A;  2R25 A;  2R02 A;  3RQG A;  3EZI A;  4MVQ A;  5DQZ A;  2LSE A;  3M4B A;  2KJG A;  3N24 A;  3QMK A;  5L0D A;  3IQC A;  3ZQV A;  1QZX A;  2R7O A;  4JZA A;  4NCQ A;  4DRJ B;  2PBE A;  5KYN A;  1QPU A;  3W2V A;  3AGU A;  2MYS A;  2J7P D;  2G62 A;  1EKY A;  4JE9 A;  4GYT A;  2J9B A;  3N2Z B;  4W8K A;  1Z7Q c;  1Q0M A;  3LUT B;  1JPN A; 
#chains in the Genus database with same CATH homology
 5B3I A;  3IQ5 A;  1CGN A;  5AGF A;  3HNJ A;  3M4C A;  3TOL A;  5JSL A;  4WGY A;  5JLI A;  2YLI A;  3L1M A;  1YZC A;  1E83 A;  3NMI A;  4JEA A;  3TOM A;  4D4X A;  2YLG A;  4CDV A;  2CCY A;  4JKV A;  4N4W A;  3C62 A;  5JP7 A;  2BC5 A;  2XLO A;  2XL8 A;  1BBH A;  4IB4 A;  1M6T A;  1NBB A;  4NC3 A;  3HNI A;  4JEB A;  1CPQ A;  1LM3 B;  3QVY A;  3DE9 A;  4N6H A;  2YKZ A;  3DE8 A;  4CX9 A;  1A7V A;  256B A;  4WGZ A;  3FOP A;  4L6R A;  2YLD A;  4IAR A;  3ZQY A;  4D4N A;  4CDY A;  3QW0 A;  2XLH A;  2YL7 A;  3M15 A;  2XM4 A;  3FOO A;  3IQ6 A;  3ZTZ A;  5JS5 A;  1GQA A;  1CGO A;  3HNK A;  1E84 A;  3QW1 A;  3C63 A;  1MQV A;  4IAQ A;  5JRA A;  3HNL A;  1YYX A;  2YL0 A;  1S05 A;  4U9E A;  4CJO A;  1YZA A;  1APC A;  5JVE A;  1CPR A;  2XLE A;  4CDA A;  2XLV A;  3NMK A;  3NMJ A;  2XLM A;  3ZWI A;  4ER9 A;  3VRC A;  3ZTM A;  1QQ3 A;  2XLD A;  3M79 A;  2YL1 A;  4CJG A;  2XLW A;  4EIY A;  5JT4 A;  2J8W A;  3U8P A;  2XL6 A;  2YL3 A;  4CIP A;  3QVZ A;  2QLA A;  3M4B A;  1E85 A;  4ULV A;  3ZQV A;  4U9D A;  1JAF A;  1QPU A;  1RCP A;  5JUA A;  1EKY A;  1E86 A;  4JE9 A;  2J9B A;  2XM0 A;  1YYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...