3DEDA

C-terminal domain of probable hemolysin from chromobacterium violaceum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of C-terminal domain of Probable hemolysin from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Membrane protein
molecule keywords Probable hemolysin
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3dedA00
1E8HA 5FXEA 5AE3A 1F0XA 5FXPA 1FFVC 3PM9A 2PLSA 3KJMA 1DIQA 1FO4A 3W8ZA 1I19A 2R2ZA 3LAEA 1N5WC 4JAYA 1AHZA 5G5HB 4MLAA 2QKNA 3SR6B 1WYGA 1AHUA 1VDVA 1JRPA 1E8GA 1E0YA 3S1EA 3ETRB 1WVFA 4ML8A 4BBYA 1N60C 5AE2A 2VFVA 2QPMA 1MBBA 1FIQB 1AHVA 1W1QA 4BC9A 1JROA 2AXRA 2VAOA 3W8WA 2P13A 2BVFA 4HG0A 2PLIA 3NVZB 1N62C 1N61C 1W1KA 3S1FA 1W1JA 2R8DA 1W1RA 2O3GA 3C0PA 5ADZA 5HQXA 2P4PA 2VFTA 1DIIA 4JB1A 5HMRA 2EXRA 2E3TA 5AE1A 4OALA 1W1LA 1MBTA 3DQ0A 5G5GB 1UXYA 2W3RA 2P3HA 2YVSA 5FXFA 2Q85A 1FFUC 2W3SA 2W55A 1E8FA 3I99A 1W1SA 3W8XA 3S1CA 2GQUA 3EUB3 4PYTA 4ZOHB 1VAOA 3NVYB 5FXDA 4BCAA 1ZR6A 1WVEA 2VFSA 3S1DA 3NRZB 1DZNA 1QLUA 2OAIA 2RK5A 1W1OA 2I0KA 3AN1A 3NVVB 1HSKA 2MBRA 3TX1A 4O95A 3LLBA 2BVHA 3AMZA 2VFUA 3AM9A 5HHZA 2BVGA 4BC7A 2GQTA 1N63C 3NS1B 1ZXIC 2NQWA 2VFRA 3B9JB 3HRDC 3JS8A 2Q4WA 3NVWB 3BW7A 1V97A 1RM6B 3DEDA 2W54A 1QLTA 1SB3B 1T3QC 1W1MA 4XLOA 1N5XA
chains in the Genus database with same CATH superfamily
1E8HA 5FXEA 5AE3A 1F0XA 5FXPA 1FFVC 3PM9A 3FW9A 2PLSA 3PQBA 3KJMA 1DIQA 1FO4A 3W8ZA 1I19A 2R2ZA 3LAEA 1N5WC 4PVJA 4PVKA 4JAYA 1AHZA 5G5HB 4MLAA 5K8EA 2QKNA 3SR6B 1WYGA 1AHUA 1VDVA 1JRPA 5AWVA 1E8GA 1E0YA 2IPIA 3ETRB 3S1EA 1WVFA 4ML8A 4BBYA 4PWCA 1N60C 5L6FA 5AE2A 2VFVA 3FW7A 2QPMA 5I1WA 1MBBA 3D2JA 1FIQB 1AHVA 5D79A 1W1QA 3VTEA 4BC9A 1JROA 2AXRA 2VAOA 3W8WA 5L6GA 2P13A 2BVFA 4HG0A 3RJAA 2PLIA 3NVZB 1N62C 2Y08A 2Y3RA 1N61C 1W1KA 3POPA 3S1FA 1W1JA 2R8DA 1W1RA 2O3GA 3C0PA 5ADZA 2Y3SA 5HQXA 2P4PA 2VFTA 1DIIA 4JB1A 4PVEA 5HMRA 3HSUA 2EXRA 2E3TA 3RJ8A 5AE1A 4OALA 1W1LA 1MBTA 3DQ0A 5G5GB 1UXYA 2W3RA 2P3HA 2YVSA 5FXFA 2Q85A 1FFUC 2UUUA 4PZFA 2W3SA 3D2HA 2W55A 1E8FA 4EC3A 3I99A 1W1SA 3W8XA 3S1CA 2GQUA 3EUB3 4PYTA 4ZOHB 1VAOA 3NVYB 5FXDA 4BCAA 1ZR6A 3GSYA 1WVEA 2VFSA 4PVHA 3S1DA 3NRZB 1DZNA 2WDWA 5I1VA 1QLUA 2OAIA 2RK5A 4PWBA 2UUVA 1W1OA 2I0KA 2Y4GA 3AN1A 1HSKA 3NVVB 2MBRA 3TX1A 4O95A 3LLBA 2BVHA 3AMZA 2VFUA 3D2DA 3AM9A 5HHZA 2BVGA 4BC7A 2GQTA 1N63C 3NS1B 1ZXIC 3FWAA 4DNSA 3TSJA 4UD8A 2NQWA 2VFRA 3B9JB 3HRDC 3JS8A 2Q4WA 3TSHA 3NVWB 3BW7A 1V97A 1RM6B 3FW8A 3DEDA 2W54A 1QLTA 1SB3B 1T3QC 1W1MA 4XLOA 1N5XA
chains in the Genus database with same CATH topology
1E8HA 5FXEA 5AE3A 1F0XA 5FXPA 1FFVC 3PM9A 3FW9A 2PLSA 3PQBA 3KJMA 1DIQA 1FO4A 3W8ZA 1I19A 2R2ZA 3LAEA 1N5WC 4PVJA 4PVKA 4JAYA 1AHZA 5G5HB 4MLAA 5K8EA 2QKNA 3SR6B 1WYGA 1AHUA 1VDVA 1JRPA 5AWVA 1E8GA 1E0YA 2IPIA 3ETRB 3S1EA 1WVFA 4ML8A 4BBYA 4PWCA 1N60C 5L6FA 5AE2A 2VFVA 3FW7A 2QPMA 5I1WA 1MBBA 3D2JA 1FIQB 1AHVA 5D79A 1W1QA 3VTEA 4BC9A 1JROA 2AXRA 2VAOA 3W8WA 5L6GA 2P13A 2BVFA 4HG0A 3RJAA 2PLIA 3NVZB 1N62C 2Y08A 2Y3RA 1N61C 1W1KA 3POPA 3S1FA 1W1JA 2R8DA 1W1RA 2O3GA 3C0PA 5ADZA 2Y3SA 5HQXA 2P4PA 2VFTA 1DIIA 4JB1A 4PVEA 5HMRA 3HSUA 2EXRA 2E3TA 3RJ8A 5AE1A 4OALA 1W1LA 1MBTA 3DQ0A 5G5GB 1UXYA 2W3RA 2P3HA 2YVSA 5FXFA 2Q85A 1FFUC 2UUUA 4PZFA 2W3SA 3D2HA 2W55A 1E8FA 4EC3A 3I99A 1W1SA 3W8XA 3S1CA 2GQUA 3EUB3 4PYTA 4ZOHB 1VAOA 3NVYB 5FXDA 4BCAA 1ZR6A 3GSYA 1WVEA 2VFSA 4PVHA 3S1DA 3NRZB 1DZNA 2WDWA 5I1VA 1QLUA 2OAIA 2RK5A 4PWBA 2UUVA 1W1OA 2I0KA 2Y4GA 3AN1A 1HSKA 3NVVB 2MBRA 3TX1A 4O95A 3LLBA 2BVHA 3AMZA 2VFUA 3D2DA 3AM9A 5HHZA 2BVGA 4BC7A 2GQTA 1N63C 3NS1B 1ZXIC 3FWAA 4DNSA 3TSJA 4UD8A 2NQWA 2VFRA 3B9JB 3HRDC 3JS8A 2Q4WA 3TSHA 3NVWB 3BW7A 1V97A 1RM6B 3FW8A 3DEDA 2W54A 1QLTA 1SB3B 1T3QC 1W1MA 4XLOA 1N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8H A;  5FXE A;  5AE3 A;  1F0X A;  5FXP A;  1FFV C;  3PM9 A;  2PLS A;  3KJM A;  1DIQ A;  1FO4 A;  3W8Z A;  1I19 A;  2R2Z A;  3LAE A;  1N5W C;  4JAY A;  1AHZ A;  5G5H B;  4MLA A;  2QKN A;  3SR6 B;  1WYG A;  1AHU A;  1VDV A;  1JRP A;  1E8G A;  1E0Y A;  3S1E A;  3ETR B;  1WVF A;  4ML8 A;  4BBY A;  1N60 C;  5AE2 A;  2VFV A;  2QPM A;  1MBB A;  1FIQ B;  1AHV A;  1W1Q A;  4BC9 A;  1JRO A;  2AXR A;  2VAO A;  3W8W A;  2P13 A;  2BVF A;  4HG0 A;  2PLI A;  3NVZ B;  1N62 C;  1N61 C;  1W1K A;  3S1F A;  1W1J A;  2R8D A;  1W1R A;  2O3G A;  3C0P A;  5ADZ A;  5HQX A;  2P4P A;  2VFT A;  1DII A;  4JB1 A;  5HMR A;  2EXR A;  2E3T A;  5AE1 A;  4OAL A;  1W1L A;  1MBT A;  3DQ0 A;  5G5G B;  1UXY A;  2W3R A;  2P3H A;  2YVS A;  5FXF A;  2Q85 A;  1FFU C;  2W3S A;  2W55 A;  1E8F A;  3I99 A;  1W1S A;  3W8X A;  3S1C A;  2GQU A;  3EUB 3;  4PYT A;  4ZOH B;  1VAO A;  3NVY B;  5FXD A;  4BCA A;  1ZR6 A;  1WVE A;  2VFS A;  3S1D A;  3NRZ B;  1DZN A;  1QLU A;  2OAI A;  2RK5 A;  1W1O A;  2I0K A;  3AN1 A;  3NVV B;  1HSK A;  2MBR A;  3TX1 A;  4O95 A;  3LLB A;  2BVH A;  3AMZ A;  2VFU A;  3AM9 A;  5HHZ A;  2BVG A;  4BC7 A;  2GQT A;  1N63 C;  3NS1 B;  1ZXI C;  2NQW A;  2VFR A;  3B9J B;  3HRD C;  3JS8 A;  2Q4W A;  3NVW B;  3BW7 A;  1V97 A;  1RM6 B;  3DED A;  2W54 A;  1QLT A;  1SB3 B;  1T3Q C;  1W1M A;  4XLO A;  1N5X A; 
#chains in the Genus database with same CATH topology
 1E8H A;  5FXE A;  5AE3 A;  1F0X A;  5FXP A;  1FFV C;  3PM9 A;  3FW9 A;  2PLS A;  3PQB A;  3KJM A;  1DIQ A;  1FO4 A;  3W8Z A;  1I19 A;  2R2Z A;  3LAE A;  1N5W C;  4PVJ A;  4PVK A;  4JAY A;  1AHZ A;  5G5H B;  4MLA A;  5K8E A;  2QKN A;  3SR6 B;  1WYG A;  1AHU A;  1VDV A;  1JRP A;  5AWV A;  1E8G A;  1E0Y A;  2IPI A;  3ETR B;  3S1E A;  1WVF A;  4ML8 A;  4BBY A;  4PWC A;  1N60 C;  5L6F A;  5AE2 A;  2VFV A;  3FW7 A;  2QPM A;  5I1W A;  1MBB A;  3D2J A;  1FIQ B;  1AHV A;  5D79 A;  1W1Q A;  3VTE A;  4BC9 A;  1JRO A;  2AXR A;  2VAO A;  3W8W A;  5L6G A;  2P13 A;  2BVF A;  4HG0 A;  3RJA A;  2PLI A;  3NVZ B;  1N62 C;  2Y08 A;  2Y3R A;  1N61 C;  1W1K A;  3POP A;  3S1F A;  1W1J A;  2R8D A;  1W1R A;  2O3G A;  3C0P A;  5ADZ A;  2Y3S A;  5HQX A;  2P4P A;  2VFT A;  1DII A;  4JB1 A;  4PVE A;  5HMR A;  3HSU A;  2EXR A;  2E3T A;  3RJ8 A;  5AE1 A;  4OAL A;  1W1L A;  1MBT A;  3DQ0 A;  5G5G B;  1UXY A;  2W3R A;  2P3H A;  2YVS A;  5FXF A;  2Q85 A;  1FFU C;  2UUU A;  4PZF A;  2W3S A;  3D2H A;  2W55 A;  1E8F A;  4EC3 A;  3I99 A;  1W1S A;  3W8X A;  3S1C A;  2GQU A;  3EUB 3;  4PYT A;  4ZOH B;  1VAO A;  3NVY B;  5FXD A;  4BCA A;  1ZR6 A;  3GSY A;  1WVE A;  2VFS A;  4PVH A;  3S1D A;  3NRZ B;  1DZN A;  2WDW A;  5I1V A;  1QLU A;  2OAI A;  2RK5 A;  4PWB A;  2UUV A;  1W1O A;  2I0K A;  2Y4G A;  3AN1 A;  1HSK A;  3NVV B;  2MBR A;  3TX1 A;  4O95 A;  3LLB A;  2BVH A;  3AMZ A;  2VFU A;  3D2D A;  3AM9 A;  5HHZ A;  2BVG A;  4BC7 A;  2GQT A;  1N63 C;  3NS1 B;  1ZXI C;  3FWA A;  4DNS A;  3TSJ A;  4UD8 A;  2NQW A;  2VFR A;  3B9J B;  3HRD C;  3JS8 A;  2Q4W A;  3TSH A;  3NVW B;  3BW7 A;  1V97 A;  1RM6 B;  3FW8 A;  3DED A;  2W54 A;  1QLT A;  1SB3 B;  1T3Q C;  1W1M A;  4XLO A;  1N5X A; 
#chains in the Genus database with same CATH homology
 1E8H A;  5FXE A;  5AE3 A;  1F0X A;  5FXP A;  1FFV C;  3PM9 A;  3FW9 A;  2PLS A;  3PQB A;  3KJM A;  1DIQ A;  1FO4 A;  3W8Z A;  1I19 A;  2R2Z A;  3LAE A;  1N5W C;  4PVJ A;  4PVK A;  4JAY A;  1AHZ A;  5G5H B;  4MLA A;  5K8E A;  2QKN A;  3SR6 B;  1WYG A;  1AHU A;  1VDV A;  1JRP A;  5AWV A;  1E8G A;  1E0Y A;  2IPI A;  3ETR B;  3S1E A;  1WVF A;  4ML8 A;  4BBY A;  4PWC A;  1N60 C;  5L6F A;  5AE2 A;  2VFV A;  3FW7 A;  2QPM A;  5I1W A;  1MBB A;  3D2J A;  1FIQ B;  1AHV A;  5D79 A;  1W1Q A;  3VTE A;  4BC9 A;  1JRO A;  2AXR A;  2VAO A;  3W8W A;  5L6G A;  2P13 A;  2BVF A;  4HG0 A;  3RJA A;  2PLI A;  3NVZ B;  1N62 C;  2Y08 A;  2Y3R A;  1N61 C;  1W1K A;  3POP A;  3S1F A;  1W1J A;  2R8D A;  1W1R A;  2O3G A;  3C0P A;  5ADZ A;  2Y3S A;  5HQX A;  2P4P A;  2VFT A;  1DII A;  4JB1 A;  4PVE A;  5HMR A;  3HSU A;  2EXR A;  2E3T A;  3RJ8 A;  5AE1 A;  4OAL A;  1W1L A;  1MBT A;  3DQ0 A;  5G5G B;  1UXY A;  2W3R A;  2P3H A;  2YVS A;  5FXF A;  2Q85 A;  1FFU C;  2UUU A;  4PZF A;  2W3S A;  3D2H A;  2W55 A;  1E8F A;  4EC3 A;  3I99 A;  1W1S A;  3W8X A;  3S1C A;  2GQU A;  3EUB 3;  4PYT A;  4ZOH B;  1VAO A;  3NVY B;  5FXD A;  4BCA A;  1ZR6 A;  3GSY A;  1WVE A;  2VFS A;  4PVH A;  3S1D A;  3NRZ B;  1DZN A;  2WDW A;  5I1V A;  1QLU A;  2OAI A;  2RK5 A;  4PWB A;  2UUV A;  1W1O A;  2I0K A;  2Y4G A;  3AN1 A;  1HSK A;  3NVV B;  2MBR A;  3TX1 A;  4O95 A;  3LLB A;  2BVH A;  3AMZ A;  2VFU A;  3D2D A;  3AM9 A;  5HHZ A;  2BVG A;  4BC7 A;  2GQT A;  1N63 C;  3NS1 B;  1ZXI C;  3FWA A;  4DNS A;  3TSJ A;  4UD8 A;  2NQW A;  2VFR A;  3B9J B;  3HRD C;  3JS8 A;  2Q4W A;  3TSH A;  3NVW B;  3BW7 A;  1V97 A;  1RM6 B;  3FW8 A;  3DED A;  2W54 A;  1QLT A;  1SB3 B;  1T3Q C;  1W1M A;  4XLO A;  1N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...