3DEDA

C-terminal domain of probable hemolysin from chromobacterium violaceum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of C-terminal domain of Probable hemolysin from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Membrane protein
molecule keywords Probable hemolysin
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3dedA00
2I0KA 3W8ZA 3NS1B 1QLTA 2BVGA 3S1FA 3AM9A 2YVSA 2R8DA 3TX1A 2VFTA 1N5WC 1E8GA 1N60C 2VFRA 4OALA 5FXFA 1F0XA 2AXRA 2VFSA 1N5XA 2W55A 2MBRA 3AMZA 2VFVA 1W1QA 1MBTA 4ZOHB 1N62C 1T3QC 1DIIA 2W54A 2VAOA 3DEDA 1FO4A 3DQ0A 1W1MA 1WVFA 4BC7A 5FXDA 3HRDC 1AHVA 4BBYA 1SB3B 4ML8A 1JRPA 1N63C 3S1EA 1W1RA 5FXPA 3I99A 5AE3A 3NRZB 1W1LA 3AN1A 1DZNA 1FFVC 3C0PA 2VFUA 3EUB3 1FIQB 1UXYA 3B9JB 3PM9A 2BVFA 4HG0A 1E8FA 2Q85A 2W3RA 2E3TA 1VDVA 4BCAA 4BC9A 4O95A 4MLAA 2Q4WA 3BW7A 3S1DA 3NVYB 1AHZA 1FFUC 1VAOA 1HSKA 1WVEA 3ETRB 5AE1A 2QKNA 1I19A 2P4PA 2RK5A 1ZR6A 3LAEA 5HQXA 1QLUA 2BVHA 3NVVB 2GQTA 1E8HA 3W8WA 2PLIA 5G5GB 3LLBA 3SR6B 1RM6B 5G5HB 2P3HA 1AHUA 2O3GA 1MBBA 1E0YA 2R2ZA 2W3SA 2NQWA 1W1OA 3W8XA 3JS8A 3KJMA 3NVZB 4XLOA 1WYGA 2P13A 2EXRA 4JAYA 4PYTA 1V97A 1W1SA 3NVWB 1N61C 2QPMA 3S1CA 1W1JA 5HMRA 5ADZA 1W1KA 5AE2A 5FXEA 1DIQA 2PLSA 1JROA 2OAIA 2GQUA 5HHZA 4JB1A 1ZXIC
chains in the Genus database with same CATH superfamily
2I0KA 3D2DA 3NS1B 3W8ZA 3TSJA 1QLTA 2BVGA 3S1FA 4EC3A 3AM9A 2YVSA 2R8DA 3TX1A 5I1WA 3VTEA 2VFTA 1N5WC 1E8GA 1N60C 3RJAA 3FW8A 2VFRA 4OALA 5FXFA 2Y3SA 1F0XA 2AXRA 2VFSA 1N5XA 2W55A 2MBRA 3AMZA 2VFVA 1W1QA 1MBTA 2Y4GA 2WDWA 4ZOHB 1N62C 1T3QC 1DIIA 2W54A 2VAOA 3DEDA 3FWAA 2UUUA 1FO4A 3DQ0A 1W1MA 1WVFA 4BC7A 5FXDA 3HRDC 1AHVA 4BBYA 1SB3B 4ML8A 1JRPA 1N63C 3S1EA 1W1RA 5FXPA 3I99A 5AE3A 3NRZB 1W1LA 2IPIA 3AN1A 2UUVA 1DZNA 5I1VA 1FFVC 3C0PA 2VFUA 3EUB3 1FIQB 1UXYA 3B9JB 3PM9A 2BVFA 4HG0A 1E8FA 3FW9A 2Q85A 2W3RA 2E3TA 1VDVA 4BCAA 5L6FA 4PZFA 4BC9A 4O95A 4MLAA 3RJ8A 2Q4WA 2Y08A 3BW7A 3S1DA 3NVYB 2Y3RA 1AHZA 1FFUC 1VAOA 1HSKA 1WVEA 3PQBA 3ETRB 5D79A 5L6GA 5AE1A 2QKNA 1I19A 2P4PA 2RK5A 3GSYA 1ZR6A 3LAEA 3D2HA 5HQXA 1QLUA 2BVHA 3NVVB 3FW7A 2GQTA 1E8HA 3W8WA 2PLIA 5G5GB 3POPA 3LLBA 3SR6B 3HSUA 1RM6B 5G5HB 2P3HA 1AHUA 2O3GA 1MBBA 1E0YA 2R2ZA 2W3SA 2NQWA 1W1OA 4UD8A 3D2JA 3W8XA 3JS8A 3KJMA 3NVZB 4XLOA 5K8EA 4DNSA 4PVKA 1WYGA 2P13A 2EXRA 4JAYA 4PYTA 1V97A 1W1SA 3NVWB 5AWVA 1N61C 2QPMA 3TSHA 1W1JA 4PWCA 3S1CA 5HMRA 5ADZA 1W1KA 5AE2A 5FXEA 4PVEA 1DIQA 2PLSA 1JROA 2OAIA 4PVHA 2GQUA 4PVJA 5HHZA 4PWBA 4JB1A 1ZXIC
chains in the Genus database with same CATH topology
2I0KA 3D2DA 3NS1B 3W8ZA 3TSJA 1QLTA 2BVGA 3S1FA 4EC3A 3AM9A 2YVSA 2R8DA 3TX1A 5I1WA 3VTEA 2VFTA 1N5WC 1E8GA 1N60C 3RJAA 3FW8A 2VFRA 4OALA 5FXFA 2Y3SA 1F0XA 2AXRA 2VFSA 1N5XA 2W55A 2MBRA 3AMZA 2VFVA 1W1QA 1MBTA 2Y4GA 2WDWA 4ZOHB 1N62C 1T3QC 1DIIA 2W54A 2VAOA 3DEDA 3FWAA 2UUUA 1FO4A 3DQ0A 1W1MA 1WVFA 4BC7A 5FXDA 3HRDC 1AHVA 4BBYA 1SB3B 4ML8A 1JRPA 1N63C 3S1EA 1W1RA 5FXPA 3I99A 5AE3A 3NRZB 1W1LA 2IPIA 3AN1A 2UUVA 1DZNA 5I1VA 1FFVC 3C0PA 2VFUA 3EUB3 1FIQB 1UXYA 3B9JB 3PM9A 2BVFA 4HG0A 1E8FA 3FW9A 2Q85A 2W3RA 2E3TA 1VDVA 4BCAA 5L6FA 4PZFA 4BC9A 4O95A 4MLAA 3RJ8A 2Q4WA 2Y08A 3BW7A 3S1DA 3NVYB 2Y3RA 1AHZA 1FFUC 1VAOA 1HSKA 1WVEA 3PQBA 3ETRB 5D79A 5L6GA 5AE1A 2QKNA 1I19A 2P4PA 2RK5A 3GSYA 1ZR6A 3LAEA 3D2HA 5HQXA 1QLUA 2BVHA 3NVVB 3FW7A 2GQTA 1E8HA 3W8WA 2PLIA 5G5GB 3POPA 3LLBA 3SR6B 3HSUA 1RM6B 5G5HB 2P3HA 1AHUA 2O3GA 1MBBA 1E0YA 2R2ZA 2W3SA 2NQWA 1W1OA 4UD8A 3D2JA 3W8XA 3JS8A 3KJMA 3NVZB 4XLOA 5K8EA 4DNSA 4PVKA 1WYGA 2P13A 2EXRA 4JAYA 4PYTA 1V97A 1W1SA 3NVWB 5AWVA 1N61C 2QPMA 3TSHA 1W1JA 4PWCA 3S1CA 5HMRA 5ADZA 1W1KA 5AE2A 5FXEA 4PVEA 1DIQA 2PLSA 1JROA 2OAIA 4PVHA 2GQUA 4PVJA 5HHZA 4PWBA 4JB1A 1ZXIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0K A;  3W8Z A;  3NS1 B;  1QLT A;  2BVG A;  3S1F A;  3AM9 A;  2YVS A;  2R8D A;  3TX1 A;  2VFT A;  1N5W C;  1E8G A;  1N60 C;  2VFR A;  4OAL A;  5FXF A;  1F0X A;  2AXR A;  2VFS A;  1N5X A;  2W55 A;  2MBR A;  3AMZ A;  2VFV A;  1W1Q A;  1MBT A;  4ZOH B;  1N62 C;  1T3Q C;  1DII A;  2W54 A;  2VAO A;  3DED A;  1FO4 A;  3DQ0 A;  1W1M A;  1WVF A;  4BC7 A;  5FXD A;  3HRD C;  1AHV A;  4BBY A;  1SB3 B;  4ML8 A;  1JRP A;  1N63 C;  3S1E A;  1W1R A;  5FXP A;  3I99 A;  5AE3 A;  3NRZ B;  1W1L A;  3AN1 A;  1DZN A;  1FFV C;  3C0P A;  2VFU A;  3EUB 3;  1FIQ B;  1UXY A;  3B9J B;  3PM9 A;  2BVF A;  4HG0 A;  1E8F A;  2Q85 A;  2W3R A;  2E3T A;  1VDV A;  4BCA A;  4BC9 A;  4O95 A;  4MLA A;  2Q4W A;  3BW7 A;  3S1D A;  3NVY B;  1AHZ A;  1FFU C;  1VAO A;  1HSK A;  1WVE A;  3ETR B;  5AE1 A;  2QKN A;  1I19 A;  2P4P A;  2RK5 A;  1ZR6 A;  3LAE A;  5HQX A;  1QLU A;  2BVH A;  3NVV B;  2GQT A;  1E8H A;  3W8W A;  2PLI A;  5G5G B;  3LLB A;  3SR6 B;  1RM6 B;  5G5H B;  2P3H A;  1AHU A;  2O3G A;  1MBB A;  1E0Y A;  2R2Z A;  2W3S A;  2NQW A;  1W1O A;  3W8X A;  3JS8 A;  3KJM A;  3NVZ B;  4XLO A;  1WYG A;  2P13 A;  2EXR A;  4JAY A;  4PYT A;  1V97 A;  1W1S A;  3NVW B;  1N61 C;  2QPM A;  3S1C A;  1W1J A;  5HMR A;  5ADZ A;  1W1K A;  5AE2 A;  5FXE A;  1DIQ A;  2PLS A;  1JRO A;  2OAI A;  2GQU A;  5HHZ A;  4JB1 A;  1ZXI C; 
#chains in the Genus database with same CATH topology
 2I0K A;  3D2D A;  3NS1 B;  3W8Z A;  3TSJ A;  1QLT A;  2BVG A;  3S1F A;  4EC3 A;  3AM9 A;  2YVS A;  2R8D A;  3TX1 A;  5I1W A;  3VTE A;  2VFT A;  1N5W C;  1E8G A;  1N60 C;  3RJA A;  3FW8 A;  2VFR A;  4OAL A;  5FXF A;  2Y3S A;  1F0X A;  2AXR A;  2VFS A;  1N5X A;  2W55 A;  2MBR A;  3AMZ A;  2VFV A;  1W1Q A;  1MBT A;  2Y4G A;  2WDW A;  4ZOH B;  1N62 C;  1T3Q C;  1DII A;  2W54 A;  2VAO A;  3DED A;  3FWA A;  2UUU A;  1FO4 A;  3DQ0 A;  1W1M A;  1WVF A;  4BC7 A;  5FXD A;  3HRD C;  1AHV A;  4BBY A;  1SB3 B;  4ML8 A;  1JRP A;  1N63 C;  3S1E A;  1W1R A;  5FXP A;  3I99 A;  5AE3 A;  3NRZ B;  1W1L A;  2IPI A;  3AN1 A;  2UUV A;  1DZN A;  5I1V A;  1FFV C;  3C0P A;  2VFU A;  3EUB 3;  1FIQ B;  1UXY A;  3B9J B;  3PM9 A;  2BVF A;  4HG0 A;  1E8F A;  3FW9 A;  2Q85 A;  2W3R A;  2E3T A;  1VDV A;  4BCA A;  5L6F A;  4PZF A;  4BC9 A;  4O95 A;  4MLA A;  3RJ8 A;  2Q4W A;  2Y08 A;  3BW7 A;  3S1D A;  3NVY B;  2Y3R A;  1AHZ A;  1FFU C;  1VAO A;  1HSK A;  1WVE A;  3PQB A;  3ETR B;  5D79 A;  5L6G A;  5AE1 A;  2QKN A;  1I19 A;  2P4P A;  2RK5 A;  3GSY A;  1ZR6 A;  3LAE A;  3D2H A;  5HQX A;  1QLU A;  2BVH A;  3NVV B;  3FW7 A;  2GQT A;  1E8H A;  3W8W A;  2PLI A;  5G5G B;  3POP A;  3LLB A;  3SR6 B;  3HSU A;  1RM6 B;  5G5H B;  2P3H A;  1AHU A;  2O3G A;  1MBB A;  1E0Y A;  2R2Z A;  2W3S A;  2NQW A;  1W1O A;  4UD8 A;  3D2J A;  3W8X A;  3JS8 A;  3KJM A;  3NVZ B;  4XLO A;  5K8E A;  4DNS A;  4PVK A;  1WYG A;  2P13 A;  2EXR A;  4JAY A;  4PYT A;  1V97 A;  1W1S A;  3NVW B;  5AWV A;  1N61 C;  2QPM A;  3TSH A;  1W1J A;  4PWC A;  3S1C A;  5HMR A;  5ADZ A;  1W1K A;  5AE2 A;  5FXE A;  4PVE A;  1DIQ A;  2PLS A;  1JRO A;  2OAI A;  4PVH A;  2GQU A;  4PVJ A;  5HHZ A;  4PWB A;  4JB1 A;  1ZXI C; 
#chains in the Genus database with same CATH homology
 2I0K A;  3D2D A;  3NS1 B;  3W8Z A;  3TSJ A;  1QLT A;  2BVG A;  3S1F A;  4EC3 A;  3AM9 A;  2YVS A;  2R8D A;  3TX1 A;  5I1W A;  3VTE A;  2VFT A;  1N5W C;  1E8G A;  1N60 C;  3RJA A;  3FW8 A;  2VFR A;  4OAL A;  5FXF A;  2Y3S A;  1F0X A;  2AXR A;  2VFS A;  1N5X A;  2W55 A;  2MBR A;  3AMZ A;  2VFV A;  1W1Q A;  1MBT A;  2Y4G A;  2WDW A;  4ZOH B;  1N62 C;  1T3Q C;  1DII A;  2W54 A;  2VAO A;  3DED A;  3FWA A;  2UUU A;  1FO4 A;  3DQ0 A;  1W1M A;  1WVF A;  4BC7 A;  5FXD A;  3HRD C;  1AHV A;  4BBY A;  1SB3 B;  4ML8 A;  1JRP A;  1N63 C;  3S1E A;  1W1R A;  5FXP A;  3I99 A;  5AE3 A;  3NRZ B;  1W1L A;  2IPI A;  3AN1 A;  2UUV A;  1DZN A;  5I1V A;  1FFV C;  3C0P A;  2VFU A;  3EUB 3;  1FIQ B;  1UXY A;  3B9J B;  3PM9 A;  2BVF A;  4HG0 A;  1E8F A;  3FW9 A;  2Q85 A;  2W3R A;  2E3T A;  1VDV A;  4BCA A;  5L6F A;  4PZF A;  4BC9 A;  4O95 A;  4MLA A;  3RJ8 A;  2Q4W A;  2Y08 A;  3BW7 A;  3S1D A;  3NVY B;  2Y3R A;  1AHZ A;  1FFU C;  1VAO A;  1HSK A;  1WVE A;  3PQB A;  3ETR B;  5D79 A;  5L6G A;  5AE1 A;  2QKN A;  1I19 A;  2P4P A;  2RK5 A;  3GSY A;  1ZR6 A;  3LAE A;  3D2H A;  5HQX A;  1QLU A;  2BVH A;  3NVV B;  3FW7 A;  2GQT A;  1E8H A;  3W8W A;  2PLI A;  5G5G B;  3POP A;  3LLB A;  3SR6 B;  3HSU A;  1RM6 B;  5G5H B;  2P3H A;  1AHU A;  2O3G A;  1MBB A;  1E0Y A;  2R2Z A;  2W3S A;  2NQW A;  1W1O A;  4UD8 A;  3D2J A;  3W8X A;  3JS8 A;  3KJM A;  3NVZ B;  4XLO A;  5K8E A;  4DNS A;  4PVK A;  1WYG A;  2P13 A;  2EXR A;  4JAY A;  4PYT A;  1V97 A;  1W1S A;  3NVW B;  5AWV A;  1N61 C;  2QPM A;  3TSH A;  1W1J A;  4PWC A;  3S1C A;  5HMR A;  5ADZ A;  1W1K A;  5AE2 A;  5FXE A;  4PVE A;  1DIQ A;  2PLS A;  1JRO A;  2OAI A;  4PVH A;  2GQU A;  4PVJ A;  5HHZ A;  4PWB A;  4JB1 A;  1ZXI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...