3DEDA

C-terminal domain of probable hemolysin from chromobacterium violaceum
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable hemolysin
publication title Crystal structure of C-terminal domain of Probable hemolysin from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Membrane protein
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3dedA00
1AHZA 4ML8A 4ZOHB 1E8HA 1T3QC 1W1MA 3I99A 2Q85A 1W1OA 5HQXA 3SR6B 1MBBA 4PYTA 4BC9A 5FXPA 2BVGA 4BBYA 2W54A 3NVYB 1AHVA 1FFVC 2EXRA 2PLSA 3W8WA 5HHZA 1SB3B 4BCAA 3DEDA 2I0KA 2E3TA 1N61C 3W8ZA 2BVFA 5FXDA 1DIIA 3NRZB 3TX1A 1FIQB 1WVEA 3NVVB 3LAEA 3HRDC 3LLBA 4JB1A 3S1CA 1W1JA 1UXYA 1W1KA 2QPMA 4MLAA 1DIQA 2AXRA 1QLUA 3C0PA 3KJMA 5AE1A 1HSKA 5FXFA 2VFRA 1QLTA 1DZNA 1I19A 1MBTA 2MBRA 1FFUC 2VFSA 5AE2A 1ZXIC 1VAOA 2VFUA 1N5XA 5G5HB 2PLIA 2W55A 3ETRB 1N63C 3BW7A 4BC7A 3B9JB 3AN1A 2W3SA 3S1FA 1FO4A 2OAIA 1RM6B 2P3HA 2P13A 2W3RA 2R8DA 1W1RA 1N5WC 4XLOA 1JROA 3NVWB 5ADZA 1N62C 3S1DA 2VFVA 1F0XA 5G5GB 1W1QA 4JAYA 1V97A 1VDVA 1WVFA 2GQTA 1E8FA 1E0YA 5HMRA 1ZR6A 3S1EA 1JRPA 4OALA 3PM9A 3NS1B 2VFTA 2Q4WA 2BVHA 1AHUA 3DQ0A 4O95A 2VAOA 5AE3A 2NQWA 1W1LA 2GQUA 3AM9A 1W1SA 4HG0A 2O3GA 2R2ZA 3NVZB 3AMZA 2QKNA 2P4PA 2YVSA 5FXEA 3EUB3 3W8XA 3JS8A 1WYGA 2RK5A 1E8GA 1N60C
chains in the Genus database with same CATH superfamily
1AHZA 4ML8A 4ZOHB 1E8HA 4EC3A 5L6FA 1T3QC 1W1MA 3I99A 2Q85A 1W1OA 5HQXA 3TSHA 3SR6B 4PVEA 1MBBA 4PYTA 4BC9A 5FXPA 2BVGA 3D2JA 4PVHA 2W54A 4BBYA 3NVYB 1AHVA 3RJAA 1FFVC 2EXRA 2PLSA 4PVJA 3W8WA 5HHZA 1SB3B 3FWAA 4BCAA 3FW7A 3DEDA 2I0KA 2E3TA 1N61C 3W8ZA 2Y3SA 2BVFA 5D79A 5FXDA 1DIIA 3NRZB 3FW8A 3TX1A 1FIQB 1WVEA 3HSUA 3NVVB 3LAEA 3HRDC 3LLBA 4JB1A 3S1CA 1W1JA 1UXYA 1W1KA 2QPMA 3GSYA 4MLAA 1DIQA 2AXRA 1QLUA 3C0PA 3KJMA 5AE1A 4DNSA 1HSKA 2UUVA 5FXFA 2VFRA 1QLTA 1DZNA 1I19A 1MBTA 2MBRA 1FFUC 2VFSA 4PVKA 1ZXIC 5AE2A 1VAOA 2Y4GA 2VFUA 1N5XA 5G5HB 2PLIA 2W55A 3ETRB 1N63C 3BW7A 4BC7A 3B9JB 3AN1A 2W3SA 3S1FA 1FO4A 3FW9A 2OAIA 1RM6B 2P3HA 4PWCA 3D2DA 2P13A 2W3RA 2Y08A 2R8DA 1W1RA 1N5WC 4XLOA 3VTEA 1JROA 3NVWB 5ADZA 1N62C 3S1DA 2VFVA 5I1WA 1F0XA 2WDWA 5G5GB 1W1QA 4JAYA 3PQBA 1V97A 1VDVA 1WVFA 2GQTA 1E8FA 4UD8A 3D2HA 1E0YA 4PZFA 2IPIA 2Y3RA 4PWBA 5HMRA 1ZR6A 3S1EA 1JRPA 4OALA 3PM9A 3NS1B 2VFTA 3TSJA 2Q4WA 2BVHA 1AHUA 3DQ0A 4O95A 2VAOA 5AE3A 2NQWA 1W1LA 2UUUA 2GQUA 5K8EA 3AM9A 5AWVA 3RJ8A 1W1SA 4HG0A 2O3GA 2R2ZA 3NVZB 3AMZA 5I1VA 2QKNA 2P4PA 2YVSA 5FXEA 3EUB3 3W8XA 3JS8A 5L6GA 1WYGA 3POPA 2RK5A 1E8GA 1N60C
chains in the Genus database with same CATH topology
1AHZA 4ML8A 4ZOHB 1E8HA 4EC3A 5L6FA 1T3QC 1W1MA 3I99A 2Q85A 1W1OA 5HQXA 3TSHA 3SR6B 4PVEA 1MBBA 4PYTA 4BC9A 5FXPA 2BVGA 3D2JA 4PVHA 2W54A 4BBYA 3NVYB 1AHVA 3RJAA 1FFVC 2EXRA 2PLSA 4PVJA 3W8WA 5HHZA 1SB3B 3FWAA 4BCAA 3FW7A 3DEDA 2I0KA 2E3TA 1N61C 3W8ZA 2Y3SA 2BVFA 5D79A 5FXDA 1DIIA 3NRZB 3FW8A 3TX1A 1FIQB 1WVEA 3HSUA 3NVVB 3LAEA 3HRDC 3LLBA 4JB1A 3S1CA 1W1JA 1UXYA 1W1KA 2QPMA 3GSYA 4MLAA 1DIQA 2AXRA 1QLUA 3C0PA 3KJMA 5AE1A 4DNSA 1HSKA 2UUVA 5FXFA 2VFRA 1QLTA 1DZNA 1I19A 1MBTA 2MBRA 1FFUC 2VFSA 4PVKA 1ZXIC 5AE2A 1VAOA 2Y4GA 2VFUA 1N5XA 5G5HB 2PLIA 2W55A 3ETRB 1N63C 3BW7A 4BC7A 3B9JB 3AN1A 2W3SA 3S1FA 1FO4A 3FW9A 2OAIA 1RM6B 2P3HA 4PWCA 3D2DA 2P13A 2W3RA 2Y08A 2R8DA 1W1RA 1N5WC 4XLOA 3VTEA 1JROA 3NVWB 5ADZA 1N62C 3S1DA 2VFVA 5I1WA 1F0XA 2WDWA 5G5GB 1W1QA 4JAYA 3PQBA 1V97A 1VDVA 1WVFA 2GQTA 1E8FA 4UD8A 3D2HA 1E0YA 4PZFA 2IPIA 2Y3RA 4PWBA 5HMRA 1ZR6A 3S1EA 1JRPA 4OALA 3PM9A 3NS1B 2VFTA 3TSJA 2Q4WA 2BVHA 1AHUA 3DQ0A 4O95A 2VAOA 5AE3A 2NQWA 1W1LA 2UUUA 2GQUA 5K8EA 3AM9A 5AWVA 3RJ8A 1W1SA 4HG0A 2O3GA 2R2ZA 3NVZB 3AMZA 5I1VA 2QKNA 2P4PA 2YVSA 5FXEA 3EUB3 3W8XA 3JS8A 5L6GA 1WYGA 3POPA 2RK5A 1E8GA 1N60C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHZ A;  4ML8 A;  4ZOH B;  1E8H A;  1T3Q C;  1W1M A;  3I99 A;  2Q85 A;  1W1O A;  5HQX A;  3SR6 B;  1MBB A;  4PYT A;  4BC9 A;  5FXP A;  2BVG A;  4BBY A;  2W54 A;  3NVY B;  1AHV A;  1FFV C;  2EXR A;  2PLS A;  3W8W A;  5HHZ A;  1SB3 B;  4BCA A;  3DED A;  2I0K A;  2E3T A;  1N61 C;  3W8Z A;  2BVF A;  5FXD A;  1DII A;  3NRZ B;  3TX1 A;  1FIQ B;  1WVE A;  3NVV B;  3LAE A;  3HRD C;  3LLB A;  4JB1 A;  3S1C A;  1W1J A;  1UXY A;  1W1K A;  2QPM A;  4MLA A;  1DIQ A;  2AXR A;  1QLU A;  3C0P A;  3KJM A;  5AE1 A;  1HSK A;  5FXF A;  2VFR A;  1QLT A;  1DZN A;  1I19 A;  1MBT A;  2MBR A;  1FFU C;  2VFS A;  5AE2 A;  1ZXI C;  1VAO A;  2VFU A;  1N5X A;  5G5H B;  2PLI A;  2W55 A;  3ETR B;  1N63 C;  3BW7 A;  4BC7 A;  3B9J B;  3AN1 A;  2W3S A;  3S1F A;  1FO4 A;  2OAI A;  1RM6 B;  2P3H A;  2P13 A;  2W3R A;  2R8D A;  1W1R A;  1N5W C;  4XLO A;  1JRO A;  3NVW B;  5ADZ A;  1N62 C;  3S1D A;  2VFV A;  1F0X A;  5G5G B;  1W1Q A;  4JAY A;  1V97 A;  1VDV A;  1WVF A;  2GQT A;  1E8F A;  1E0Y A;  5HMR A;  1ZR6 A;  3S1E A;  1JRP A;  4OAL A;  3PM9 A;  3NS1 B;  2VFT A;  2Q4W A;  2BVH A;  1AHU A;  3DQ0 A;  4O95 A;  2VAO A;  5AE3 A;  2NQW A;  1W1L A;  2GQU A;  3AM9 A;  1W1S A;  4HG0 A;  2O3G A;  2R2Z A;  3NVZ B;  3AMZ A;  2QKN A;  2P4P A;  2YVS A;  5FXE A;  3EUB 3;  3W8X A;  3JS8 A;  1WYG A;  2RK5 A;  1E8G A;  1N60 C; 
#chains in the Genus database with same CATH topology
 1AHZ A;  4ML8 A;  4ZOH B;  1E8H A;  4EC3 A;  5L6F A;  1T3Q C;  1W1M A;  3I99 A;  2Q85 A;  1W1O A;  5HQX A;  3TSH A;  3SR6 B;  4PVE A;  1MBB A;  4PYT A;  4BC9 A;  5FXP A;  2BVG A;  3D2J A;  4PVH A;  2W54 A;  4BBY A;  3NVY B;  1AHV A;  3RJA A;  1FFV C;  2EXR A;  2PLS A;  4PVJ A;  3W8W A;  5HHZ A;  1SB3 B;  3FWA A;  4BCA A;  3FW7 A;  3DED A;  2I0K A;  2E3T A;  1N61 C;  3W8Z A;  2Y3S A;  2BVF A;  5D79 A;  5FXD A;  1DII A;  3NRZ B;  3FW8 A;  3TX1 A;  1FIQ B;  1WVE A;  3HSU A;  3NVV B;  3LAE A;  3HRD C;  3LLB A;  4JB1 A;  3S1C A;  1W1J A;  1UXY A;  1W1K A;  2QPM A;  3GSY A;  4MLA A;  1DIQ A;  2AXR A;  1QLU A;  3C0P A;  3KJM A;  5AE1 A;  4DNS A;  1HSK A;  2UUV A;  5FXF A;  2VFR A;  1QLT A;  1DZN A;  1I19 A;  1MBT A;  2MBR A;  1FFU C;  2VFS A;  4PVK A;  1ZXI C;  5AE2 A;  1VAO A;  2Y4G A;  2VFU A;  1N5X A;  5G5H B;  2PLI A;  2W55 A;  3ETR B;  1N63 C;  3BW7 A;  4BC7 A;  3B9J B;  3AN1 A;  2W3S A;  3S1F A;  1FO4 A;  3FW9 A;  2OAI A;  1RM6 B;  2P3H A;  4PWC A;  3D2D A;  2P13 A;  2W3R A;  2Y08 A;  2R8D A;  1W1R A;  1N5W C;  4XLO A;  3VTE A;  1JRO A;  3NVW B;  5ADZ A;  1N62 C;  3S1D A;  2VFV A;  5I1W A;  1F0X A;  2WDW A;  5G5G B;  1W1Q A;  4JAY A;  3PQB A;  1V97 A;  1VDV A;  1WVF A;  2GQT A;  1E8F A;  4UD8 A;  3D2H A;  1E0Y A;  4PZF A;  2IPI A;  2Y3R A;  4PWB A;  5HMR A;  1ZR6 A;  3S1E A;  1JRP A;  4OAL A;  3PM9 A;  3NS1 B;  2VFT A;  3TSJ A;  2Q4W A;  2BVH A;  1AHU A;  3DQ0 A;  4O95 A;  2VAO A;  5AE3 A;  2NQW A;  1W1L A;  2UUU A;  2GQU A;  5K8E A;  3AM9 A;  5AWV A;  3RJ8 A;  1W1S A;  4HG0 A;  2O3G A;  2R2Z A;  3NVZ B;  3AMZ A;  5I1V A;  2QKN A;  2P4P A;  2YVS A;  5FXE A;  3EUB 3;  3W8X A;  3JS8 A;  5L6G A;  1WYG A;  3POP A;  2RK5 A;  1E8G A;  1N60 C; 
#chains in the Genus database with same CATH homology
 1AHZ A;  4ML8 A;  4ZOH B;  1E8H A;  4EC3 A;  5L6F A;  1T3Q C;  1W1M A;  3I99 A;  2Q85 A;  1W1O A;  5HQX A;  3TSH A;  3SR6 B;  4PVE A;  1MBB A;  4PYT A;  4BC9 A;  5FXP A;  2BVG A;  3D2J A;  4PVH A;  2W54 A;  4BBY A;  3NVY B;  1AHV A;  3RJA A;  1FFV C;  2EXR A;  2PLS A;  4PVJ A;  3W8W A;  5HHZ A;  1SB3 B;  3FWA A;  4BCA A;  3FW7 A;  3DED A;  2I0K A;  2E3T A;  1N61 C;  3W8Z A;  2Y3S A;  2BVF A;  5D79 A;  5FXD A;  1DII A;  3NRZ B;  3FW8 A;  3TX1 A;  1FIQ B;  1WVE A;  3HSU A;  3NVV B;  3LAE A;  3HRD C;  3LLB A;  4JB1 A;  3S1C A;  1W1J A;  1UXY A;  1W1K A;  2QPM A;  3GSY A;  4MLA A;  1DIQ A;  2AXR A;  1QLU A;  3C0P A;  3KJM A;  5AE1 A;  4DNS A;  1HSK A;  2UUV A;  5FXF A;  2VFR A;  1QLT A;  1DZN A;  1I19 A;  1MBT A;  2MBR A;  1FFU C;  2VFS A;  4PVK A;  1ZXI C;  5AE2 A;  1VAO A;  2Y4G A;  2VFU A;  1N5X A;  5G5H B;  2PLI A;  2W55 A;  3ETR B;  1N63 C;  3BW7 A;  4BC7 A;  3B9J B;  3AN1 A;  2W3S A;  3S1F A;  1FO4 A;  3FW9 A;  2OAI A;  1RM6 B;  2P3H A;  4PWC A;  3D2D A;  2P13 A;  2W3R A;  2Y08 A;  2R8D A;  1W1R A;  1N5W C;  4XLO A;  3VTE A;  1JRO A;  3NVW B;  5ADZ A;  1N62 C;  3S1D A;  2VFV A;  5I1W A;  1F0X A;  2WDW A;  5G5G B;  1W1Q A;  4JAY A;  3PQB A;  1V97 A;  1VDV A;  1WVF A;  2GQT A;  1E8F A;  4UD8 A;  3D2H A;  1E0Y A;  4PZF A;  2IPI A;  2Y3R A;  4PWB A;  5HMR A;  1ZR6 A;  3S1E A;  1JRP A;  4OAL A;  3PM9 A;  3NS1 B;  2VFT A;  3TSJ A;  2Q4W A;  2BVH A;  1AHU A;  3DQ0 A;  4O95 A;  2VAO A;  5AE3 A;  2NQW A;  1W1L A;  2UUU A;  2GQU A;  5K8E A;  3AM9 A;  5AWV A;  3RJ8 A;  1W1S A;  4HG0 A;  2O3G A;  2R2Z A;  3NVZ B;  3AMZ A;  5I1V A;  2QKN A;  2P4P A;  2YVS A;  5FXE A;  3EUB 3;  3W8X A;  3JS8 A;  5L6G A;  1WYG A;  3POP A;  2RK5 A;  1E8G A;  1N60 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...