3DEFA

Crystal structure of toc33 from arabidopsis thaliana, dimerization deficient mutant r130a
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
243
Chain Sequence
REWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYAVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPLVKAITDVATNQRKAIHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
publication title On the significance of Toc-GTPase homodimers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 87
structure length 243
sequence length 245
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3defA00
3BBPA 5CYOA 3ZIAD 3EASA 4G5OA 2EU8A 2WBLC 3DEFA 2Q3HA 5D3MB 1CULC 3S1AB 1DO0A 2JLRA 4M22A 3NC0C 4Q03A 4QHYA 4Q4HB 3FMFA 3KZ1E 4D81A 3TBKA 2WOOA 4R9UC 2AD1A 4B43A 3BXZA 1DADA 3C15C 3THYA 2G3YA 3FFBA 3NBZC 2JGNA 2KWIA 1Q1BA 4EQ6A 2EFGA 1XTSA 4PXAA 4B34A 4TYYA 1SKYB 2VHQA 1L4YA 1AS2A 4EPTA 3QKUA 4TQ9A 2XJ4A 1UAAA 1HEIA 2EWVA 1U98A 3GLIA 1GKYA 2D62A 5FOWA 2LKDA 4YMTA 3AVXA 3QQ5A 2BC9A 1E2QA 5L3SA 4OK3A 2QM7A 1Z28A 4AC9A 4ZDWA 4BPBA 4NU0A 2VO1A 1VTKA 3MWKA 4IEEA 4NCHA 4R98A 3ND9A 3KQKA 2Q3FA 2CVHA 2RGNC 4JIMA 5FL7D 3BGWA 1KI9A 1ZC3A 1EFUA 3SR0A 1T6NA 4K81B 2FH5B 3AP1A 1E69A 4JLAA 3DPUA 1TMKA 2JA1A 3BFKA 2DBYA 1MRSA 2QI9C 3WMFA 2XB2A 1GL9B 2VF8A 1KSGA 4G5RA 4ZKDA 4QGGA 4WZ6A 1F2UA 4BEBA 1XNJA 5AJXA 1ZD8A 2CHGA 3RC8A 2D4HA 2XXAB 2O8CA 1WF3A 4DSUA 3BFXA 3KTAA 2XTMA 3UPUA 3U3MA 1D9ZA 2VBCA 3MWJA 4BFSA 3O8DA 4TT3A 2RGNA 4ZPXA 2P0EA 2O8EA 4E07A 5CLQA 1HY3A 1KO5A 1G6HA 2V7QD 4PFSA 1DAGA 3SJAA 4F92B 4JT2A 1KSHA 3C7KA 1P6XA 3OF5A 1M1YE 2H16A 1XJ0A 1NY6A 3LLUA 1N0WA 1XJQA 3KQLA 1B0UA 4DCTA 3LX8A 1GRNA 1VCNA 2D7DA 4XWKA 3Q85A 1RIFA 1KSFX 1WE2A 3OEED 3X1WA 2B7CA 1Z5ZA 2CK3D 4K46A 1KK2A 2CLCX 4MKGA 1W46A 3R9XA 2OM2A 1YHNA 3RSOA 4A0RA 2XNDA 4X8OA 4P33A 3AGQA 1S96A 2Y8EA 5KNBA 3K9LA 1XPRA 1W7AA 3B1XA 1Q21A 2JIZA 2ZREA 4KBGA 4XOIA 5K8TA 5K8LA 3VNVA 3Q7QA 3OAAD 3IEVA 5UKDA 1S2MA 2QBYA 4IEIA 2QMEA 2ZRGA 1KMHB 4ACBA 5DI3B 2H7VA 5JZVA 3PEVA 4XH9B 2JLXA 3AKYA 3NEYA 4PO1A 4C2UA 4M8NE 2IXGA 2AD5A 5EZ6B 5J4YA 2ZU6A 4L8GA 2IYRA 3H1TA 2ZXUA 5EE3A 3P32A 3T15A 3OHMA 1DO2A 4QBHA 1OXUA 3FMOB 4UNPA 2VP9A 4OL0A 4FCWA 4DDWA 1D9XA 4DB4A 1N2CE 1AGRA 3KJEA 3QE0A 1ZIPA 3CM0A 1XFAA 5B2ZA 4Q4JA 2RH5A 4RKFA 1II9A 1W0JD 2XAUA 2N42A 5KYKA 2JJ2A 3AVPA 4OI4A 3MWYW 2C03A 2NO9A 1G7TA 2XEXA 4G3XA 1T4GA 1U0JA 3QEJA 1CS4C 1GNPA 2CE7A 3PG5A 4OJKA 1RJ9A 2G9NA 1W5SA 5TARA 1AIPA 3KKMA 2IF2A 1JALA 1Q57A 4PQRA 4LPSA 4QM6A 2C2HA 5JI3E 2ZI4A 3FHTA 4P4SB 1CP2A 1XMJA 3LLMA 1OH5A 1NN3A 1VHLA 3UIEA 4HI0E 1JECA 3AVOA 3MAAC 3LWNA 2NPIA 2MSDB 5HE8A 4B2PA 2ZS9A 1JXOA 1VG9B 5B57C 3K9HA 4WIAA 2FSIA 3SNHA 3ZQ6A 5K8UA 1W4AA 3T5GA 2BMFA 2ZRNA 1Q1EA 4MYHA 5FOXA 2AHOA 2NO0A 1M74A 2HLDA 1E98A 1QBKC 3FTQA 2YHSA 2VHUA 3KB1A 1F6BA 5AR1A 3BORA 4CEIA 1WP9A 2O52A 2XJ9A 1R8QA 2BMDA 4DB2A 1UADA 1Z83A 1QHNA 4LI0A 3KXKA 4KYIB 2QNRA 4BFWA 4ASUA 1F2TA 2QUZA 3U7GA 3CKLA 2IW3A 2PZFA 4TTPA 4Q66C 2WMNB 2J87A 1VDZA 2FPKA 3H86A 2IYXA 3I8SA 4TL7A 3VR6A 4RKEA 3CUEF 1KHTA 1LNZA 3RWOA 4NCIA 4OYHA 5B64A 4MDFA 2NO7A 4BLQA 4WXRA 3A6PC 1NBMD 4LBYA 4PZLA 2PLRA 4JT4A 4HAUA 1E94E 4Y0VA 1COWD 4I81A 2GETA 4A0HA 1DS6A 4KODA 3EWAA 4GT1A 4TQAA 2C77A 1PUJA 1G41A 2BBWA 2J0QA 3I4LA 2CNWD 4NONA 5L8VA 2CCGA 3CX7A 1S4QA 2CCKA 4XVUA 1GOTA 3PITA 4IFEA 1B23P 1FNMA 4PPGA 4TMWA 2YWFA 4JBYA 4LC1A 4CF7A 4P4TA 3FKSA 1VG1A 3EPHA 1XXHE 2WWIA 4URWR 2FMXA 2ZR0A 3TIFA 1W49A 2PMKA 4AWXA 2ZM5A 1Z3IX 1G21E 4QBIA 2GXQA 2WPDD 4LJ4A 1E9CA 3U44A 4DDTA 3X2SA 4F93B 5BWMA 2PEZA 2REXB 3B85A 1NVXQ 1KMQA 3K0FB 4I1UA 3GD7A 2QTHA 621PA 3BB3A 1XD2B 2VP0A 4LYHA 4B2LA 1RYHA 1NY5A 3AVWA 1R7RA 4DCNA 4HLUA 2F3TA 1UBEA 3VX3A 3RLFA 4B75A 1LB1B 1P61B 4NCJA 5KDDA 3KUDA 4LBZA 3SBEA 2GEUA 1FTSA 2R6DA 3QKSA 2CBZA 3EWSA 4N3NA 1TQDA 4HB4A 2F1HA 3A1WA 4BLSA 4ZDJA 1ZJ6A 2REOA 4NYIQ 1WRBA 4JKIA 1RRFA 2GJ8A 2GEDA 2J0SA 3GJ6A 1BO6A 1UBGA 1GILA 1NG1A 1EFRA 2UVQA 3M6AA 3WHLA 1KI8A 4JYBA 2AN9A 4B74A 5FBWB 1A1VA 1OB5A 4LYJA 4GP7A 4BZPA 4HATA 5E4FA 1XF9A 3RRNA 2F43B 3TAUA 4UJ5A 4HAWA 2GXUA 2GZDA 4DEXA 3SS8A 2VIIA 1KI1A 5D3MA 4XTRA 3L0SA 2AXPA 2ZYUX 4WAUA 3QSYA 4UQOA 3GFPA 2KJQA 3EW9A 1L2TA 3FPAA 5E7JA 4Q4HA 4Q21A 3W5IA 3PEUA 2ZRAA 2BBOA 1HT1E 1N6RA 1X1RA 1CTQA 4AKHA 1OH7A 3X1DA 2IEYA 1XPOA 3HJNA 3KXLA 3OIWA 3VU9A 2ZRIA 2ZJYA 2ZYWX 3GFOA 5DISB 3GJ3A 1Z22A 2ORVA 2QN6A 1G64A 4V0KA 4FIDA 3W6OA 5FH9A 5M04A 4PHGA 3ICQB 1TUIA 2IXFA 4GMXA 5JJKA 2ZYTX 2PL3A 2Z0MA 1G6OA 2QQEA 4QM7A 1E1RD 2GZHA 3GEHA 3LDAA 5BN5A 3GLHE 2IS6A 5FL7A 2BVNA 3DMNA 4LUCA 4DLVA 1G3IA 3SBDA 3AUYA 4M0LA 1EX7A 1PLJA 3WRYC 1ZP6A 2ZE5A 3NC1C 2OLJA 1KAGA 4LDJA 3RABA 1JQLB 2RAPA 1Z29A 3EAQA 1QHXA 4TMZA 2P5SA 4ZIRB 3K0AB 1G5RA 4PX9A 3CLVA 4Z8YA 3E5HA 3H84A 5G53C 5FUVA 4Z8XA 1G18A 4FMDF 2MMCA 3AF2A 3IBGA 4BFVA 2O8FA 3E2IA 5GVSA 1OYWA 2RCNA 1Z6AA 5KSOA 1KY3A 4JLBA 2W6ID 1N3BA 4PR0A 4ZKEA 2X8AA 1BYIA 1OIXA 2ZSAA 2B92A 2NZJA 2C98A 3AEZA 4E03A 3WHKA 1ZUIA 2PBRA 2G77B 2ZS7A 3WBJA 4XWAA 3HDTA 3U7EB 3WRXC 3IPXA 1NSTA 3T61A 2WKQA 4C0JA 5KPJA 1E9EA 3OEEA 1G20E 6Q21A 2FZ4A 3A4LA 1FPMA 1JXMA 2W00A 4BFTA 2JLVA 2GILA 3FFAA 4ARZB 1CKEA 3OFND 4BRUA 5EE5B 4KFRA 4LGMA 4HUTA 5F9FA 3ZVMA 4D80A 1GG2A 1NG9A 4GPTA 4IDNA 2ZSEA 4RZXA 1SKQA 2W58A 1E2MA 3VHXA 1UDXA 4CT5A 1ZUNB 3QXSA 4NP6A 1PV4A 4JLOA 1CR0A 1FP6A 1FMLA 2IUTA 2PCLA 1KMHA 3B5JA 3T35A 4FCTA 1ELOA 1VYUA 4TQUS 2IS1A 1L4UA 1KK0A 3R20A 4URYR 4D0NA 3B9PA 3O8CA 3CIOA 3GQBA 3RS5A 5HPYB 1JJ7A 4LRWA 3THWA 5IDVA 1OSNA 4QXAA 1KDTA 2WIAA 1OYYA 4AG5A 5FR2A 4Q4LA 4HAZA 1M7GA 1G5PA 4HAVA 1TPZA 4MKHA 1GP2A 5LB2A 5L3QB 3Q7PA 1UEIA 3ONWA 4CEJA 3NH6A 1G3MA 2GESA 3SU8A 1W0JA 3QENA 4E22A 2XZLA 3QKRB 2EW1A 4B32A 4HDQB 4US1R 4HB2A 4ZCMA 4Q9LA 1DG3A 1IHUA 2F1RA 3U3JA 4TL9A 1OJLA 3RC3A 2O0KA 4JLNA 4M9XA 3DKVA 2QM8A 4GRAA 1IQPA 4KI0A 4C30A 3THXA 2BOVA 2YOFA 5SZIA 1Z0FA 4PZZA 4WZAE 3VR4A 1W36B 1W36D 3A8TA 2IBMA 4DJTA 1F60A 1KI7A 2VSXA 5DYIA 1JR3D 2IS2A 3FDIA 4M4SA 1OB2A 1OF1A 3KUCA 1R2QA 3PCRB 3TQCA 4US2R 4BLTA 1BOFA 3EC2A 2ZANA 4NMMA 3T34A 4TN1A 5HR5A 4RJLA 2YOHA 4OHXA 3LRPA 3QXJA 2GCPA 3TAHA 2KBEA 4HLCA 4LJ5A 1N6IA 2RGDA 5CB8A 4CEHB 3QG5A 3MD0A 2A3RA 1Q0UA 2QGNA 5FBLB 2PX3A 3JVUA 3E1SA 1P9NA 2VL7A 3CF0A 3LW7A 3PUWA 2OFXA 3SOPA 1OE0A 4RFSB 1DAFA 4FMDB 2RKOA 3IBYA 4ESVA 5FPTA 2RGCA 3RYTC 3H4MA 1Z6YA 3ZQJA 1WXQA 5TMPA 1BYUA 2FFAA 4TTRA 3DDCA 1TEVA 2D06A 1NJFA 2WOJA 3CW2A 3I1FA 2HCJB 3BH0A 1EGAA 3VNUA 3D31A 3HYTA 2ATXA 1SXJE 3L8ZA 4C0SA 3AF4A 2A5YB 1EWRA 4NE2A 3TUIC 5IK2D 4RY2A 4TTQA 1MT0A 4HUQA 4C3ZA 5JFGA 4NKRA 3CX8A 3J81k 4IOLA 4QKQA 4M1OA 2LWIA 3TQFA 3W8RA 4QL3A 2ZJAA 1JAIA 3TMKA 5DHAA 3IUYA 2XOKD 1NBMA 1HYQA 1SVMA 3I92A 4B73A 4PO9A 2DYKA 3AV0B 2QP3A 2ZITA 2R6CA 3SYNA 1OXTA 1UKVY 4QHSA 5CYPA 2N46A 2QY9A 1XCPA 1T0HB 2J5XA 1NMZA 4D26A 2GJKA 4F38A 1ZM9A 2ATVA 3AKEA 3VX4A 3ECCA 1MABB 3OIUA 3SHWA 1ZNYA 1WA5A 2QAGC 4MRRA 3GLFE 5EXSA 5DYGA 5JSZB 4LHXA 5GJWC 3QUSA 3LY5A 4XD7A 1TQ4A 1ZMXA 4TYQA 2ANBA 2HF8A 4FMCF 4B3XA 4P3YA 4CIDA 4KV9A 1GVNB 2BBTA 3KL4A 1K6MA 3N5CA 4YMWA 3K09C 3SQXA 1HE8B 2VEDA 1KKLA 4TLCA 1GSIA 2A30A 3AB3A 1QVRA 1XD2A 2BIFA 3OESA 3P4YA 3ZYCA 1RYFA 1JR6A 1OXXK 3K70C 4U00A 1R0XA 2BWJA 2V6IA 4HDOB 5KO2A 4IRUB 4PTLA 4IOMA 3L0IB 1CU1A 5CLLA 5JS8A 3K70B 3K70D 4LX0A 1IOZA 4A92A 4LC0A 3T06B 4ZI2A 5FBVB 3RAPR 1U94A 4CRWB 1LTQA 5F3WB 3VMFA 3ZLJA 2P6NA 3KJGA 1E9BA 1YZQA 2ZU0C 3DVLA 3L0PA 4DLRA 3DKPA 3K0CC 5CM9C 2GA8A 3TK1A 4UKDA 3T1QA 4Q1BA 2ZAMA 3GLGB 1II8A 5KPDA 2GAOA 2IEZA 2GJ9A 1VIAA 1GDDA 2X2EA 3X1XA 4UXIA 4QBFA 3EA0A 4BASA 4ZI3A 2QMOA 2EFDB 3WNDA 4WZBE 5KUTA 2Z5FA 2Z4RA 1YKSA 2R9VA 3QF4B 5C1BA 1ZCBA 1J90A 1CIPA 3QVVA 4I4LA 2YKGA 3U4QB 4KXFB 1E2JA 3K0CA 1NN0A 2R62A 1YZKA 1ONBA 5E7IA 4KITB 1G8FA 4BZXA 1ZM2A 2G6BA 1E2LA 3NDPA 1TTTA 4MH0R 4Q1DA 2IHBA 5FTJA 4LPKA 3GLHB 4F91B 2VHJA 1Q3TA 1QZXA 2E9SA 1UKZA 3L2OB 2P3SA 4DVGA 3KKOA 3B9QA 5IF9A 1KOFA 1RKBA 1N6HA 2AWNA 4YMVA 5CITA 4PHTA 1IBRA 1NIPA 1W4RA 4RD0A 4IKEA 3TE6A 4AIIA 2ZEJA 4XJXA 4MRNA 2ZJ5A 3ZZTA 1T5LA 1QVAA 3DM5A 1Z0JA 3VR3A 2VH5R 3CZQA 1UBFA 2KSQA 3PUXA 4B3DA 2XGJA 4R2IA 4EKDA 4LJYA 4G1UC 1KI6B 4WXPA 1TX4B 1V5WA 4JLJA 5B30A 2V8OA 1QHGA 4JS0A 1ESMA 2O8DA 1P60A 1SVSA 1VHTA 2X19A 5F9HA 4C0HA 1P9WA 2RGXA 3N2IA 5TVKA 1UEJA 2YINC 1KGDA 3HPQA 4AYXA 2R44A 2R6GA 2ZPTX 4MUBA 1XWIA 2SHKA 1X86B 4JJKA 3FGNA 1E1RA 1G4AE 3MCAA 1H8HD 1SZPA 2LCFA 1GNQA 3B1YA 1ZM4A 2QEQA 3F3YA 3NEJA 4G5GA 2AX4A 1AZTA 2WJJA 3WYFA 2ZSBA 2CLDX 2AFHE 4IOKA 1GWNA 3FVQA 3SHFA 2OG2A 3SN6A 1FL9A 1SVOA 5EP1A 2D2EA 5AK0A 1XX6A 4GNKA 3AF3A 3U61B 1II0A 1S9DA 2ERXA 2HXYA 4AK9A 1ZINA 2VHCA 1HE1C 1E6CA 4FMCB 3CBQA 4NCNA 4BFZA 5LD2B 4DLSA 4JSYA 3GEEA 4OQLA 4HLDA 3CPEA 3PJRA 1AN0A 1ZUHA 2ORIA 3ZVRA 4DZZA 4BLRA 4MDEA 1DPFA 3F0TA 4LYFA 5JCZA 4C0LA 4JL6A 2WWWA 1S0UA 2J3EA 4LJ8A 5IRCD 1UKYA 3TVDA 3DO6A 2G0NA 5JBQA 2DWOA 1OH8A 1N5LA 2XSZD 4L5BA 4EJSA 2O8BB 2GWHA 1I4LD 1Z6GA 3SJBA 2P2LA 1E1QD 2W6IA 2ZUDA 5DN6D 5FPKA 3LXRA 1OXVA 3FE2A 4QC2A 3GLIE 4M1YA 3MGCA 4L9WA 2F55A 2VP6A 3I61A 3CF6R 5LBIA 2QU8A 2PJRA 3AVVA 3VR5A 3D8BA 3NG1A 2D3WA 1ZC4A 2V6JA 2WVJA 5DE3A 1XTJA 1ZD9A 2KB0A 3ETLA 2WWGA 4BECA 3I73A 1FQKA 3CF2A 1FUKA 1W5TA 5GADl 2JLSA 2V1XA 3G82C 2UZ3A 2Q9BA 1HURA 1YRBA 5FPSA 1GIAA 3VTKA 1UF9A 1FNNA 3TH5A 1E0SA 4LYAA 4FI3C 2HJGA 4BUJA 1Z0AA 2YOGA 1W1WA 4DKXA 1EFTA 4TL6A 2JLZA 2IYYA 2W2TA 4EPWA 3CX6A 4LV8B 1SVWA 4DCVA 5GVRA 2QRZA 1Y63A 1CJTC 2IWHA 4MKIA 5HZKA 1PLKA 1Q3HA 2WSSD 3EPKA 3EXAA 1N0VC 2QE7D 1HQYE 2C99A 5C4MA 5CB6A 2DFLA 1G7CA 1OW3B 2A2ZA 1NLFA 4RCYA 2NGRA 2IYTA 1XEXA 5HKKD 4GOJA 1E3MA 3NBXX 2KI5A 1YR9A 3IIJA 3FMIA 4LOAA 1P72A 3U7FB 2P6RA 1LS1A 1DTSA 1E2GA 1DAMA 2OAP1 3HU3A 3NXSA 5L3VA 4Q1FA 2VPPA 3JZMA 4DRZA 5JWRA 2BM1A 4DC9A 5FUYA 1JPNA 1W0KA 4D0LB 1GUAA 4KLZA 5AJYA 4C0KA 2C04A 5AJVB 3LO5A 1KJYA 4L4UA 2O8CB 4KFSA 2DB3A 1WDTA 2WICA 1U0HC 2IWRA 4DLXA 1AGPA 4M9QA 3RDPA 2JEOA 4QNRA 4PC3A 1MR3F 4J0QA 4TMTA 1JR3A 3NIBA 1KAOA 1SXJD 1SXJB 1CJKC 2YWGA 2L0XA 4NPHA 4Q02A 1R5BA 4AKIA 4A4DA 4HB0A 1XZQA 3AVYA 1ZCAA 4AKEA 1S1CA 1KK3A 4JLKA 4ZDIA 5EP3A 3SZRA 3U3RA 1RFLA 2FN4A 3B7GA 1EWQA 3MWLA 3QNUA 4QOSA 3ZZUA 2JDID 1GRRA 2QTFA 2BHRA 5J4VA 4DLUA 4GZLA 2XITA 2EVWX 2GDJA 5J4HA 4RZUA 1MOZA 3Q5EA 4R7ZA 2Q6TA 4FXPA 4PZYA 1FX0A 2WTUA 4AURA 1E4VA 4PC6A 4RFSA 1E79D 1IY2A 1E9FA 4C2TA 2QT1A 1S3GA 1XEFA 3QXHA 1MH1A 2CLSA 2FFHA 4IJMA 1EG7A 4PHHA 4PO8A 3U2QA 2XTZA 1T91A 4Q4AB 2PT7A 1CXZA 3GLFB 3ADKA 2ZR7A 1NNEA 5FUWA 5C2JB 1N6LA 1XXHA 5E3HA 4Q9HA 3EIQA 2W2VA 5FOSA 4EDHA 4BFXA 5IK2A 4Q5IA 2CL7X 2WMOB 1E96A 1QHHB 2DFTA 1YE8A 1RZ3A 5AUPB 1PVOA 5AUOB 1XEWX 421PA 2KBFA 4X8HA 3T1TA 4LY6A 3ADDA 3IGFA 4G01B 2GF0A 4V0ME 2CL0X 2B8TA 3SFVA 2OBLA 2VQSA 1JPJA 4Q48A 4TYNA 4DLTA 2A5JA 3CNOA 3V4RA 5HTKA 4C4PA 4ZV4A 3Q72A 3CRMA 3FWYA 3PENA 1G19A 2IYVA 2J0UB 2FPMA 4A2WA 1ZU4A 1KI4A 4HLUC 2H17A 1GFIA 3AF1A 1GNRA 1SVIA 3QXCA 3E70C 3IHLA 2OO7A 1G3RA 2UZIR 1ZRHA 2CJWB 3WP0A 3AVQA 1R4AA 3Q9LA 1C9KA 2AWOA 5H1YA 3SQWA 1JEDA 5FPYA 5D3QA 3O47A 2OUKA 1VECA 4GSYA 3SDZA 4AD8A 2HEIA 2RHMA 3WP1B 2CVFA 5CK4A 4YMSA 1XZPA 1OFIA 1YZLA 1P62B 1X1SA 5CDFA 4EPRA 821PA 4AKGA 4S35A 3I62A 5JJIA 1MV5A 2WAXA 3AF0A 4TYWA 2F7SA 2YVUA 1H8ED 2OBNA 4O3MA 3MJRA 2W83A 2NTYC 4Z1MD 3RRZA 1DAHA 1Z07A 521PA 1CR4A 4JSTA 4JVNA 3P20A 1R0YA 4ACAA 1WBDA 2ZUBA 1D6JA 3O8RA 1U8ZA 2FE4A 1R5NA 3PIRA 4DT1B 3DMDA 4A8JA 2FOLA 3WMEA 1YRAA 3FHCB 2GCOB 2YWEA 4OHVA 1K5GA 1OLOA 4DSOA 1YZNA 3LV8A 4QNMA 2QSYA 1UJ2A 1YZTA 2AKAB 3ZIAA 2ECKA 2ZJOA 2G1KA 1CRQA 1W2HA 2XNSA 3JVVA 3IO3A 2BDTA 1EX6A 3PV0A 1F48A 3S1AA 4OQXA 2JLWA 4DLYA 4IHQA 3UWOA 4OQFA 1UM8A 4XSGA 4EPYA 3HR8A 2QQ0A 3N2EA 1U9IA 2XZPA 3GLGE 4IDQA 4EPXA 1TADA 2J9RA 5KOYA 3G0HA 1ESNA 1GAJA 3AKCA 4ITRC 3A1TA 4GOXA 5TV2A 5FL3A 4D4JA 3JZAA 1G7SA 2ZR9A 3TW4A 4OI0A 1E2KA 1KDPA 2BJVA 4OHYA 1VG8A 3IHWA 4JLVA 5A4JA 4OKSA 5CIQA 3R8CA 2JCSA 1OIWA 4MGIR 2EWWA 1UFQA 4OJQA 3BE4A 3BFVA 3WXMA 2IYSA 1FP7A 2OBMA 4URVR 3I8XA 3THYB 1UKEA 1M8PA 1E2NA 2CE2X 2FGJA 1E2IA 3QF7A 3DOEA 2OXRA 4EQ6B 2ZRKA 3RANA 1IAQA 4JJZA 3C16C 3IPYA 1HV8A 1A82A 2O5VA 3VKWA 2F1JA 1DBSA 1N25A 3HWSA 1YR6A 2RGAA 3LBIA 3WYGA 2NOAA 2IYQA 1MO5A 1H8HA 2ONKA 1I4TD 1CJVC 1L7VC 4DUGD 2IYZA 3GLIB 3GJXC 4L15A 4DSTA 3K9NA 3G5UA 1JEEA 4UNSA 5FPHA 5AJWA 3I72A 4ILEA 2H1LA 5L3SB 3EX7C 4XSHA 2ZE6A 2ERYA 2OSBA 5TXGA 4KYUA 1NL3A 2C95A 2XB4A 4GMDA 1AS0A 2ZI3A 4JYCA 5EE0A 2NO6A 1W47A 2W6JD 4HAYA 3W3ZB 2OFOA 2XXAA 1JI0A 2WIBA 3K9GA 1G3QA 2WWFA 3AUXA 4GZMA 1P73A 2GBLA 1QG2A 3IILA 4JBXA 2OESA 4M1MA 1QG4A 3U3KA 4O2LA 1IXZA 1KK1A 2ODNA 2OEPA 3P27A 4FCVA 4N0EA 1XD9A 3VKGA 1G8GA 2V7QA 2RB4A 2ZRJA 1AKEA 4MGKR 3UMSA 1RRCA 4DDVA 4QG7A 1E1QA 2OCBA 3KTAB 1BKDR 2AR7A 1MRNA 2W2XA 3SYKA 3ADCA 4N1AA 2ZE8A 4TT3D 3Q3JB 3NVAA 2WKPA 3LQRA 4LZZA 4QJ4A 2O8EB 2PZEA 2J41A 2ZJ2A 5JI2E 2VRWA 3KQUA 2X2FA 3MLEA 2CK3A 2HYDA 1WQ1R 1XDBA 3RRMA 2QP4A 4QRHA 1XCGB 1IY0A 3AKDA 1FMJA 1GRQA 5DO9A 5EE9A 2F9MA 5FUXA 3KDSE 3ZDQA 3F5FA 2WWHA 2AK2A 3LD9A 4HLQB 4XVQA 3UG6A 1XBTA 3V00A 1CJUC 3OAAA 3BK7A 4KFTA 1E9AA 1JAHA 1P3JA 3IO5A 2ZI6A 2GTPA 1SVKA 5BW8A 4E5UA 5DI3A 3LBHA 1A2KC 2V3CC 3OE7D 1GL6A 2XNDD 1OFTA 1T3SA 4Z51A 5J5CA 2NQ2C 2GF9A 4PC2A 4MRVA 3GMTA 1NF3A 5F98A 1IN4A 3BB4A 4G5SA 3TR5A 1J2JA 2IYUA 5JMTA 2QBYB 3A58B 2W0MA 4B3CA 1N6OA 2F6RA 5HKKA 4A1FA 5IHPA 1PLLA 3GFTA 5EXPA 3UATA 3RVBA 1XB2A 1NVWQ 4DHEA 3EA5A 1XTRA 4Q7LA 2QROA 2ZS8A 3KFXA 2OAQ1 2DHRA 1SVLA 5J47A 4B3FX 3OIYA 1TF7A 1DELA 1DVRA 2ZETA 3QKTA 1YJ5A 4PANA 4KBFA 1A2BA 3W8NA 5DNYB 3ZVNA 1E0KA 1HT2E 3CNNA 4Q01A 4XVRA 4CZ2A 2A5GA 2EFEB 4P4SA 3SE0A 5LDDC 2QZ4A 2FF7A 3VR1A 3KKPA 1OKKD 4PHFA 3CR8A 4URXR 1AQUA 4TZ0A 1AZSC 1D5CA 4HB3A 2REBA 3BH7A 1XPUA 2OE2A 3DZDA 1QF9A 1RJ9B 5C46F 4U7DA 2FJUA 1KY2A 2XTNA 3Q8XB 4IXMA 4A82A 3UANA 1E2DA 4Q19A 4DBLC 3D6TB 1RRGA 3NH9A 4C0QC 2JDIA 2C5LA 4KO8A 5FOTA 2VSFA 3GJ4A 2GJAA 3T1VA 4PQFA 3RRYA 1TU4A 5H8WA 2PX0A 2MSEB 121PA 4RD2A 4A15A 4PSAA 3WY9A 3RS7A 2R2AA 4UNNA 4E09A 1ZW6A 2FNAA 3IDQA 3CWQA 1VYTA 5EJEA 3B2EA 4Q1EA 1Z6TA 3CRRA 1C4OA 1G1MA 1WBBA 4JL5A 4O2RA 1E0AA 4LHYA 4M1KA 2OXCA 1YZUA 3FHOA 4MYTA 721PA 3SEAA 1P7CA 4MGYR 4EIWA 4YXWD 1CLUA 2C78A 3MJHA 2RGEA 3IQXA 5LB4A 2OT3B 1E0JA 4Q7JB 1D2EA 1MO3A 4KSBA 4IXNA 4TLBA 3C14C 4WBSA 1COWA 1KDOA 1XMIA 1LVGA 3GJ7A 3HYRA 5EXXA 4I1OA 2CNWA 1Z08A 2R65A 2H8KA 4JMPA 1XTQA 1KJWA 5AUNB 4ESHA 5B58C 2GEVA 4HZUB 3CZPA 2J0UA 5JS7A 2QP9X 4TLDA 4LCBA 1FQJA 5DLQC 2C9OA 4A2PA 3BWDD 1NVVR 3BB1A 1KDRA 1KSJA 2EFHB 1G8PA 4D82A 2FFBA 4QBGB 1QRAA 5JWHA 1Q12A 2RGGA 3C5HA 3L8YA 1CBUA 1E2PA 1EFHA 3R7WB 4BEJA 5JRZA 2WPDA 3K0SA 4U5XA 2IHYA 1KO4A 1TQ2A 3BJIC 4Q00A 1Z0IA 2ZRFA 3IQWA 3K0FA 5C4GB 1TQ6A 1VMAA 1Z47A 1TF5A 4IOJA 3FKSD 4YDHB 3EPLA 2Q3MA 4KCGA 2H18A 3SJCA 2QAJA 1S8FA 3HU1A 1IN5A 1QDEA 3PFIA 1F3OA 1XEWY 2YJTD 2IS4A 2VTKA 1DEKA 1OFUX 3T1OA 3ZGXA 2ZRCA 4QGFA 4TMXA 3U44B 3A4MA 1J8YF 2ZRHA 3KKQA 5CJ2A 2EFCB 1KZ7B 2GRJA 4Z1MA 3VR2A 1M34E 4PAOA 1KO1A 5G40A 5BQ5A 3OZXA 221PA 4DCSA 4DWJA 4HAXA 4CGZA 1NMXA 3A1UA 4K8OA 4BLPA 4UNRA 3B82A 5JCPA 1BMFD 3QKSB 4RZ2A 5TY0A 4TSFD 2FSGA 3VKHA 1TU3A 2WZQA 1ZM7A 1OHHD 3A1SA 3H2YA 1IN8A 1P2TA 3KJIA 1U0LA 4B71A 1AQYA 2FGKA 4M2LA 4EFLA 4P0TA 5A0FA 2F43A 4OHZA 4CW7A 1WCV1 4UJ3A 2CHQA 4NZYA 2JJ1D 4RD4A 2E1RA 2YC4C 3W6NA 1NVUQ 3U5ZB 1ZVQA 1P2UA 4R71A 4H9GA 4JVSB 3TUZC 3C41J 4UXHA 1FUUA 2JASA 2OLKA 1OIVA 5AWFC 2HXSA 2X1VA 3PUYA 3ZS8A 2QG6A 1AKYA 2DFNA 1U8AA 1ZNZA 1J99A 1Z2CA 2JAQA 3R9WA 2I1QA 3ND8A 3KQHA 1IXSB 1OH6A 2FZLA 2IF0A 1RC8A 3MUFA 4HEJA 2GJSA 1YZGA 1TF2A 4F7WA 1FW6A 4YQFA 3K0EA 1RPZA 2OZEA 3H0KA 1T0JB 1M2OB 4QGHA 4QJ3A 4DCUA 1NLZA 5FBQB 3WMGA 3UMRA 4Q9IA 4P4UA 4D4KA 4BFYA 4Y0AA 5FTLA 4DLWA 3U3OA 2F9LA 2IYLD 4B44A 5A5GA 3RWMB 3VU9B 1SHZA 1C1YA 5FI0B 2I1VB 1X8KA 1DAKA 2C96A 2ZRDA 2BKEA 2G88A 4RD6A 4JVMA 4DUGA 1VCOA 4YLGA 3QEOA 5P21A 4EJSC 3ASYA 2J59A 2IL1A 1P75A 3D3QA 5J4LA 1OT3A 2OILA 3CO5A 1JQJC 4A36A 3ZVLA 2CMKA 3BAFA 1R6BX 3LBNA 3EZ2A 4FMBB 1DAIA 3SJZA 3VHLB 2W6JA 5EP4A 5KSPA 4LBWA 3GPLA 4GBMA 2HUPA 3K0AA 3OEHD 5CM8B 2IUUA 1T8UA 4PAQA 2FPLA 2B7BA 1ANKA 1E9SA 2J1LA 4A6XA 1FTNA 3L0OA 4TMVA 3T12A 3D7MA 1JBKA 3HP1A 1ODFA 2K5UA 2I4IA 4Q1AA 3EC1A 1G5TA 2NPFA 2N1BA 3ZS9A 4EFNA 2O0HA 5KDOA 5FTNA 2C9YA 4A0GA 1KI3A 2JLQA 5EE1A 1RE0A 2O8FB 4MQBA 1CEEA 5AUQA 3WBKA 1Z06A 4OI1A 2YWHA 4C9BA 1E2HA 1P2VA 3CWZA 4CYMA 4ARZA 3OFNA 3TLXA 3PEWA 2J7PD 4OK5A 4KSCA 1PZNA 3B8HA 4DLZA 1EXMA 3LVQE 2PJZA 5E7MA 3A4NA 3K53A 1G291 3TSWA 4B3BA 4Q9JA 3QBVA 1T3HA 4V0OA 2OHFA 2GZAA 4MITA 5G41A 4Q18A 1ZNWA 4LWZA 1PJRA 3M1IA 1W44A 3R8FA 1Q1QA 5KSYA 1QHSA 4RD1A 3PQCA 1W2GA 3OE7A 3KJHA 1HH4A 4MUAA 2V9PA 3KFVA 4IDHA 4LJ6A 1CR1A 2OCPA 3QVUA 2QMUA 4Q7MB 2ZRLA 1Z0KA 2IXEA 3IKJA 3UWKA 2GK6A 4D2IA 3PUZA 4DEYA 1T5IA 2Z43A 3BC1A 2GVDC 1W36C 1G16A 2NMVA 4W5JA 5L3QA 3GEIA 5CIWA 3SI7A 1P4SA 3M4YA 5SZJA 2WWYA 1GTVA 1DG1G 1VG0B 4PQYA 4B6EA 3KKNA 2PLFA 3QKRA 4B2IA 1ZIOA 5FOUA 3KB2A 3MMPA 1W4CA 4NHOA 4OI2A 4F4IA 3UKDA 3THWB 2QL6A 4G5QA 5CK5A 1HUQA 2G0TA 1G8HA 4C0BA 2ZJZA 2IT1A 2QTVB 4KLNA 4X8LA 4L9SA 1M7BA 1M6NA 2C8VA 3DM9B 3PR1A 3BH6A 4A0FA 5EZ5A 1P5ZB 2OCYC 1R8SA 2ONJA 1ZBDA 4OQMA 2YYZA 3EARA 4CEJB 4A9AA 4NCKA 1I4DD 2J46A 3RHFA 3CNLA 3B1WA 5DH9A 3REFA 1VKJA 3I5XA 3FYHA 1OKKA 1IN6A 5TB5A 1E99A 1GZSA 2IA5A 2OFWA 4OK6A 5DI9A 1LF5A 2QGZA 3TRFA 2P65A 3B6EA 3U7HB 1IM2A 5IT5A 1Z63A 3CRQA 1HQCA 2JJ8A 3U60B 5HCIA 1US8B 4IVQA 1VPLA 1I2DA 4G0NA 4BLOA 2KE5A 1AK2A 3THXB 4CEHA 4A2QA 2WV9A 4AYTA 1I2MA 1XU4A 2AXNA 3L82B 4LHVA 3REGA 1NSFA 1K5DA 4IFBA 4JKYA 2V55B 1J70A 4V0MA 1TL7C 2BBSA 4O25A 4FWIB 3BD9A 3C8UA 3A37A 2WJHA 2V4ZA 3LXXA 3QPVA 2AKYA 1KTVA 1Q20A 1ZM3A 3L43A 3PUVA 5J40A 1WB9A 1TEXA 2W0SA 2GKSA 2TMKA 3X1YA 5SZHB 1R10A 2DCUA 3M0EA 1Z2AA 2ZI7A 4PSVA 2GCNA 3AQ4A 4NYJR 4B33A 3LX5A 5KU1A 2B6HA 2FSHA 4JZKA 3K1JA 3T5DA 3QJYA 3BS4A 1SULA 4TZ6A 3ASZA 2HDNB 4P32A 4YXWA 4AG6A 1MO4A 1T3LA 4IVRA 1W4BA 4QHTA 3DL0A 2GK7A 2XOKA 2DY1A 2ZQ5A 4RCZA 1NKTA 2BCGY 5KNCA 4NYJQ 1YQTA 3TSOA 2BCJQ 3U6BA 1JR3E 2VP2A 3BRWD 2YC2C 2XZOA 2BKUA 2RHDA 5H70A 1R5OA 2CCJA 2FFQA 2ZAOA 3TUJC 4C7OB 1W48A 5J4KA 1ETUA 4HUQB 1Z8FA 2DWQA 3CPJB 4BFUA 2BM0A 5KDLA 4HZUA 4BRWA 1CR2A 1MABA 2EYQA 3X1ZA 2Q9CA 3NBFA 5DHFA 4CT4B 2PZGA 3A1VA 1R0ZA 5BYJA 5JSZA 1IJFA 2VYFA 4UNQA 1KI2A 1UBCA 2CDNA 2D7CA 3PVSA 5HCNA 5JWOA 2DPXA 2V1UA 2WJVA 3PEYA 2JLUA 5FOVA 4QGAA 1XD8A 3AM1A 1KKMA 4F4CA 1D8TA 3R7WA 5LPNA 3RSLA 1IXRC 1KO8A 2ZUCA 3IEUA 4EAQA 1IY1A 1XTKA 2ORWA 1TNDA 1DOAA 5BN4A 4A8JC 2A5DA 4LJAA 2ZI9A 3B1VA 4JBWA 4XD7D 5ANRB 2FEMA 1Z0DA 4B76A 1X8LA 2VHTA 3Q5DA 1D2NA 1G4UR 4FW9A 4IDOA 4NL4H 3FOZA 1N6PA 2F1IA 3OIVA 4WW0A 4N0DA 8OHMA 5BYKA 2ODWA 1AS3A 3CRVA 4LV6A 3WNBA 4NYIR 5DSZA 5FR1A 5JLJA 5GJCA 4MYCA 1JJVA 1Q1ZA 4YONB 3GLGA 2QAGB 1MKYA 2QA5A 5EUQB 3CH5A 1DARA 1BMFA 4ERNA 1U9IC 1GL7A 1IN7A 2NZ8A 4TSFA 3TR0A 2IX3A 1OHHA 1Z6XA 4DIDA 3P4XA 2CL6X 3QF4A 2FEOA 4M21A 4Q1CA 4B48A 3AP2A 4BQSA 5EXTA 2JLYA 5F2EA 4C0AC 2WJIA 2WM9B 3U4QA 2H92A 3GJ5A 1II8B 1U90A 3AVUA 2JJ1A 3RNLA 3N70A 4W7SA 4HYYA 2QT0A 4POAA 1MO6A 3NTUA 1Y3AA 5AJZA 1N0UA 1ZU5A 2WAYA 4I1VA 1N6KA 3IIKA 1EESA 3ADBA 1ZD1A 4LJ9A 4M1SA 4WOPA 5BN3A 4MYUA 5JECA 1DAEA 1SGWA 1E2EA 3GLHA 5CDFE 1Q22A 4M9SA 4TWZA 4AYWA 4BWYA 2R6FA 3U6KA 1NJGA 5EP2A 3FKQA 1S3SA 1XMSA 2XX3A 4NH0A 4D25A 2Q9AA 5FTMA 1BIFA 3GCGA 4LJ7A 3SFZA 2BV3A 2AFIE 1O3YA 1XTIA 4V0NA 4TLAA 1E4YA 1ZYUA 3V4FA 2J7KA 4FWTA 2A78A 3B13B 1KI6A 1CF4A 1A4RA 1LY1A 1N5IA 4YMUA 1BH2A 4YC7A 1N5KA 2QPOA 4KU4A 4ZCLA 3MFYA 5JEDA 4AY2A 1SHKA 2ZTSA 4X8MA 1YU9A 5FBRB 2A7QA 1Q44A 1OPXA 4CVNA 2Q21A 4B3GA 3WYAA 1N5JA 5LD2C 3TNFA 3KX2A 1AM4D 1NI3A 4W5WA 2GBLC 1G7RA 4LHWA 1GKUB 4ZIRA 1IONA 2D2FA 4BGDA 2B21A 2ZVQX 1KNXA 1XMVA 2A5FA 4KFUA 1XCMA 2HYIC 5GJBA 2QENA 2MMGA 4M9ZA 5H68A 1GM5A 3TGPA 4GDFA 2O8DB 2QORA 2PT5A 1K8RA 2NIPA 1GITA 2ANCA 3VFDA 2A9KA 5EQTA 1LF0A 3QY0A 2GXSA 1GKIA 2AL7A 3HPRA 1TUEA 2CEAA 2Z83A 2WSMA 2OV2A 3QOFA 5TDHA 1HA3A 4XIGS 3OEHA 3WNCA 5KNDA 1CJMA 3F8TA 2FDCA 1BS1A 1P9RA 3LQQA 1SKYE 2VA8A 2ZIAA 2ZSFA 3QXXA 1F2UB 4P31A 3ZZ0A 2I3BA 3NHAA 3GJ8A 2XSZA 3P1JA 2O8BA 4JLMA 2NG1A 4D6PA 4D4LA 2LKCA 2WJGA 1ZAKA 3CPHA 2ZE7A 5DN6A 1XJCA 1XP8A 2H5EA 4IW3B 4S2EA 1AJEA 3EZ6A 3O8BA 1UPTA 2VLIA 5DIFA 4FN5A 1VCIA 3QPWA 3GP8A 3NHBA 3W6PA 2MSCB 5G3YA 1LS6A 3LW8A 1H65A 4QJ5A 3TKLA 5ELXA 3PXGA 4EJSB 3MRSA 1LW7A 2FX3A 3EIHA 4U02A 1KJZA 2FG5A 3BIFA 4DDUA 2GAAA 2ZYVX 1NRJB 3LVRE 4IDPA 2D74A 2BMEA 2YV5A 5E95A 4OHWA 2UKDA 3SC3A 1A5TA 2FA9A 4QFMA 2J7PA 5SZKB 2CHVA 2NO1A 3QG1A 4US0R 5JHGB 4EFMA 2R6AA 1G17A 4Q47A 1L8QA 2ZVPX 4IVPA 1X3SA 4I99A 2WWXA 1U81A 4PPQA 3EIEA 4YDSA 2FWRA 4NDZA 4R2HA 3ZH9B 4V03A 2H57A 1S9HA 4FD2A 2WSSA 4LV5B 3NWJA 1FOEB 4DIEA 2QE7A 4PPFA 4NTZA 3B60A 2JIZD 2Z6VA 3HR7A 2BEKA 3AGPA 1G9XA 2ZRPA 4GOKA 1J8MF 1NKSA 2ASEA 3RS4A 3I3SR 5G3ZA 3UG7A 1AA9A 2ZI5A 3I5YA 1LV7A 1TAGA 4RD3A 3THOA 1SXJC 3LNCA 1NLYA 1E9RA 2ZRBA 4H1UA 4GL2A 1RVDA 2YZ2A 2YNMA 4KVGA 1D2MA 2FU5C 1KO7A 3MSXA 4RZ3A 2AK3A 2HT1A 5JRJA 3RS3A 3A36A 1XEXB 2BEJA 4M53A 2BMJA 1V43A 3BOSA 3LH5A 3TVTA 4Q4JB 2HJVA 2QMHA 4GI7A 3ZD7A 2J0VA 4UXJA 4MRPA 2ODBA 3CRW1 3VAAA 4DXAA 3QIAA 1JNYA 1DE0A 3QBTA 4NBSA 5KHOC 3TJZA 4LBVA 3EZFA 3RS2A 3AH8A 1YR7A 2JJ2D 3CH4B 2EYUA 2PH1A 4JVLA 4KVAA 4LK2A 3TW8B 5FTKA 2ODEA 5BXQC 1G3UA 2IK8A 3CR7A 1SXJA 3VQTA 3EZ9A 2WKRA 3FMPB 4CDGA 1YR8A 2PCJA 5L3RA 4PC1A 2JATA 1F5NA 1W0KD 4M1WA 3QI2A 4W9MC 1E9DA 5KTYA 4MRSA 1R0WA 4EUNA 2VF7A 2HF9A 1KIMA 3UMFA 2G83A 4RFVA 1US8A 2Z4SA 2ZJBA 2GNOA 2OCAA 2EQBA 3DZ8A 3UXMA 5K8IA 2HCBA 4PPNA 1QHYA 3P26A 5KSZA 3EZ7A 2F3RA 1O87A 2GHIA 4NYMR 1VCMA 2BJWA 5HE9A 4W5HA 1HTWA 4PSKA 2Q0HA 2X77A 1E79A 4Q9KA 5DGXA 1NP6A 2VP4A 3W90A 4MGZR 2HT6A 2O0JA 3W5JA 3DHWC 2HLDD 4Q4AA 4Z54A 1M7HA 4NYMQ 3GLFA 2GXAA 4F4JA 1EFCA 5FI1B 5GJVC 4JLPA 4CEIB 1S1MA 1FX0B 3ZJYA 3EPJA 1RW4A 2DR3A 1NN5A 1QHHA 2G1JA 2QPAA 1J7KA 3V9PA 4BE7B 1RRPA 1U8YA 3KQNA 1U99A 1F2TB 4ASUD 2FV8A 4JL8A 4ZCIA 2P67A 2RMKA 3LAWA 1X6VA 4OBEA 2P5TB 1E32A 4PC7A 4FINA 2PEYA 4MKFA 1XXHB 3ZD6A 3NBYC 4M1TA 3MG9A 2P6UA 4XTCS 3AP3A 2E87A 1QHIA 5HZHA 2GVZC 4C7OA 4BZQA 4HZIA 4Q7KA 1JB1A 3RS0A 3W9YA 3R9IA 1SQ5A 5C18A 4AI6A 2B8WA 3LA6A 2DFKB 3EG5A 1FZQA 4A6PA 5JJLA 2R8RA 1XRJA 2CJWA 4TL8A 2J45A 4RSGA 4B47A 2VSOA 4B6FA 3C4JA 4EPVA 2IYWA 3CB4A 1CRPA 2WHXA 4OQNA 1NVVQ 1OFHA 2PMDA 1YVDA 3AVTA 4PAMA 3W3AA 4URZR 3KXIA 2V54A 1T8TA 4ZO4A 3UK6A 4RVCA 2ZSDA 1T9HA 3TSZA 1FFHA 1LFDB 3IIMA 3NKVA 1IJEA 1H8EA 5JHHB 1KNQA 4V0LA 1X8JA 4H1VA 1UDWA 2WJYA 4TMKA 1NMYA 4TYPA 3C5CA 4V02A 1G8YA 3K8YA 4TLEA 1NBME 1PUIA 4D4MA 3DOFA 3I32A 5JEEA 4ABYA 4ZDKA 1U2RA 3W34A 2DWPA 2IUSA 3ICEA 3B1ZA 4XWOA 2CXXA 1VIYA 3B78A 3QPUA 4DT1A 1A7JA 2QAGA 3BERA 4I1SA 3CONA 3LFUA 1KZGB 2ZROA 1VYVA 2GCOA 2RGBA 4JLDA 4KAXA 4KHZA 4WVFA 4B35A 3HU2A 4GFDA 1OXSC 4D0GA 5CJPA 4O0MA 4DSNA 2IC5A 2QRNA 5FFMA 2ZJ8A 2QSZA 3K09A 4MA4A 1OV4A 1EFRD 2VP5A 2QPTA 4URUR 4L16A 3GJ0A 1KYIA 4WA7A 3FB4A 1ZNXA 2HV8A 4II7A 3NDBB 4A8JB 1EK0A 1NIJA 1NN1A 4HDCA 2C9CA 1P2SA 2ZRMA 5EUMA 2FSFA 3SYLA 1WMSA 4KJZA 1E2FA 1N6NA 4LHZA 4ON9A 4GP6A 4HSEA 4LSGA
chains in the Genus database with same CATH superfamily
1ENPA 2H9IA 1B6RA 2AMJA 3UXHA 1MCZA 3D3WA 3EASA 1IVSA 2X15A 2BYTA 3FLBA 2ORYA 2Q3HA 2QRGA 3LUBA 4ZA2A 5EHIA 5ER6A 5CB4A 3QKWA 2V7WA 4PLGA 4U6QA 1Q0PA 1G5QA 3LFHA 4M22A 5KNLA 4ZHQF 4Q03A 4BJ1A 4S04A 2BT4A 6AT1A 4D81A 3ZDCA 1HQDA 2WOOA 4B43A 3RJZA 3O7MA 3D7NA 1DJPA 1TEZA 2AZXA 2HUNA 4LOIA 4DL9A 2OGZA 2JIBA 3AV3A 4PXAA 3TZ6A 2O5CA 2R8OA 3WBBA 1PGPA 5FO1A 2NU8B 3NHRA 1L4YA 3D81A 1Q1AA 4YJDA 1UAAA 1HEIA 4Q1VA 4LDNA 2VATA 4A6DA 3GLIA 1MAVA 2H4HA 3EGOA 5AKIA 3MELA 3ENQA 2H6EA 2RH9B 3GK3A 2P2NA 2RI6A 5L3SA 1M8JA 4HGQA 2YBDA 4QPZA 3H04A 3H9BA 1Z28A 3I9JA 1FFXA 4EARA 1XCBA 5AJUA 5JAIA 4W5TA 3FPKA 4N3CA 3PD7A 1FDVA 1TLTA 1J7JA 4YP6A 4GG1A 4IEEA 2FUG6 3A1EA 2QLJA 4ZN6A 4IIHA 5LIRA 1HYEA 3BGWA 3OPYB 4CCYB 4L4RA 1TIPA 1EFDN 1EFUA 3R3ZA 5ARBA 4K81B 3IA7A 1ONPA 2JFXA 3BHJA 1GYPA 1MRZA 2CZCA 2UZ1B 2M6KA 2VQFB 1EHIA 2I7DA 3WMFA 3FFXA 2QVCA 4N7MA 2B83A 2NUAB 1GR1A 2CJYA 3HHEA 3RIGA 4G09A 3D54D 3LGAA 1F2UA 1L5ZA 4PTYA 1ORVA 1XNJA 3PQ4A 5AJXA 1I5RA 3KD2A 5DTQA 5HVNA 1KH1A 1ZD8A 3NYRA 2XXAB 1OWPA 2IV2X 1WF3A 3ZIUA 4CM6A 3BFXA 2XTMA 3ELWA 3FVWA 2I9PA 1D9ZA 2VBCA 4QWMA 4BFSA 1KE1A 1UFRA 3W06A 4PPYA 1RPAA 2P6MA 4F71A 1ZR4A 3JQQA 3NV7A 4F21A 4ZPXA 4DNQA 1QOQB 4E07A 1FVFA 4YP1A 3ZV6A 3Q9NA 5C35A 4GZ6A 1G6HA 4LVUA 2V7QD 4PY2A 3CW8X 2NWQA 1P1RA 3LM8A 1P6XA 1U8EA 1ZLXA 2B4RO 5JNVA 3OF5A 2F8MA 3OUZA 1N7HA 1PAUA 5B36A 1W73A 1V7QA 5CLJA 2QDXA 4K9DA 1UIMA 3MGKA 2RJ3A 4EG0A 3KQLA 1B0UA 2BE7A 1KJQA 3VU8A 1CY8A 3LX8A 4KWCA 4XYLA 4F9FA 2AZDA 2RGUA 2CXNA 3O82A 5L53A 3HB5X 3OEED 1KSFX 2AC2A 4X71A 3FROA 4EG7A 1NU6A 2FW7A 2WU0A 4XZ3A 2C1ZA 3DKIA 2DAPA 4MQEB 2CLCX 4ESOA 1POXA 4HUJA 3VZQA 2OM2A 3F6SA 1JSRA 3CV3A 3RSOA 4WY5A 2BP7A 2OV4A 4H7IA 5CDSA 2ZQYA 4Z4CA 1HTBA 2EJVA 3F6BX 3ODPA 3TW6A 4YFVA 3UGJA 1Q21A 1G0NA 2JIZA 5DNCA 5K8LA 3VV3A 3Q7QA 3I3OA 2HHHB 3ONVA 3LOQA 1S2MA 3LQYA 3WE7A 2QBYA 4ITUA 4ZVQA 2AI3A 2NP7A 3L8MA 3DMHA 1CS0A 4X97A 3VDXA 1SCKA 2H7VA 5DI3B 2IXTA 4LA4A 4OL9A 1RWOA 4XH9B 2ZTUA 1STOA 3G9ZA 4XGKA 2B99A 2AD5A 3C7DB 5EZ6B 3B2NA 5J4YA 2Z6AA 1PEAA 2JD0A 2ZBDA 3R7FA 3AUUA 3SF0A 1VFNA 4AZVA 2ZXUA 3T15A 1YV9A 4E2XA 2WJZB 1UFOA 2D2IA 3KUXA 3M9LA 4TPKA 1SHUX 2W11A 1NQOA 2W5UA 1WQ3A 1HXHA 4Z0HO 2R7MA 5CVTA 4LXXA 4JI8B 4RC9A 3WLLA 3BFPA 2J5KA 2CLFB 4QAQA 5EN4A 1TPYA 5K0EA 4KQ6A 1AKTA 4EBBA 1IY9A 3M1YA 5LP1A 4LRYA 2VDMB 5KYKA 1S2OA 4ZODA 2XEXA 1JWBB 1T4GA 3QEJA 4FHEA 1DKLA 4EG8A 3K5WA 3NGMA 4OJKA 4L4YA 5KB3A 3VGPA 1SC6A 2R60A 1T2CA 4MVJP 4JBHA 3ZU3A 4PQRA 1Q57A 3SQDA 4TX1A 3A2MA 1P0FA 5DKFA 1YB5A 4HGNA 1B7GO 3KZMA 4OLHA 4KQCA 1SQ6A 1CP2A 5D51S 2FXIA 2FKAA 2ZCVA 5FQOA 5ARDA 1VHLA 5F2NA 3RU3A 4K9PA 3EVTA 1O94C 3KYDA 1GUYA 1I6MA 2JG3A 3AVOA 3LWNA 1JHUA 4WNIA 1YR3A 5HE8A 4RM3A 2ZS9A 1XYYA 3JPYA 3PRJA 5BUZA 3KPUA 3SNHA 2WILA 3V97A 3T5GA 3TRDA 4M3NA 1Q1EA 5JZBA 1WKCA 3QTLA 4E5YA 4LZJA 3PQ8A 3PQEA 1UMBA 3FOWA 3LRTA 3ACCA 3OP1A 4MVJH 2FFRA 1QBKC 5ALKA 3BIXA 2VAWA 1WW3A 2VHUA 3PTLA 3VNSA 3WGJA 3RSSA 3PFKA 4G24A 4KXQA 5MDHA 1U7DA 2L17A 1BVHA 1TM1E 1DJLA 4WY2A 4G0XA 5DK6A 3WZLA 2D54A 1Z83A 1QHNA 3PGMA 3D8HA 3KXKA 3S3TA 3U26A 1AC5A 4EA6A 2QNRA 3P52A 3LC2O 4WTOA 1C81A 5JYEA 1X7XA 1IEWA 1EK2A 4E94A 1TC1A 2I54A 1S8NA 1GD1O 1SD1A 2J32A 5JSUA 4ZEMA 3I5MA 2J87A 3DTYA 3H86A 5B3KA 1U0BB 2IYXA 2VRCA 1HE3A 4Y30A 4PIMA 6GPBA 4EVRA 2H52A 5KINB 2N3ZA 4A1OA 4AJ1A 2CLOB 3M8KA 4NCIA 4MDFA 1UK9A 2NO7A 2NTNA 1GZHB 4PZLA 4WXRA 4BLQA 2PLRA 4JT4A 4U4AA 1GFSA 4HAUA 2NU6B 5DEOA 4AF6A 5DRTA 1E94E 4Y0VA 5IH7A 3H5OA 3OE1A 3UICA 2C31A 2ON6A 5K3SA 1RNLA 4HVLA 2I91A 1U11A 2BGLA 4TS3A 1PUJA 2QD4A 3EUWA 2J0QA 3I4LA 3EXFB 5L8VA 2ZIEA 2E5WA 4QTZA 4XVUA 3O4VA 4Y7CA 1KEZA 2FWJA 1YONA 3UFXB 1B23P 1PJZA 1YZHA 1NNUA 1A69A 3ISJA 4TMWA 2QVXX 1XDWA 4IDCA 4EI9A 1A71A 1FNDA 2Y2UA 3JZIA 3MTJA 3UC9A 1MZVA 2RG1A 1CUBA 4YJHA 1XXHE 3I6BA 4YP5A 3DXZA 2O2YA 3LDFA 5ITVA 5KMGA 4URWR 1Z35A 2FMXA 2ZR0A 1O89A 4KIGA 3UXEA 1GUBA 5YASA 2ZM5A 1E5TA 3L0BA 4MCJA 3D2LA 1FFEA 2FY8A 1EVYA 4P36A 1KVSA 4LJ4A 2GFIA 2V59A 4JMLA 5DX1A 4AT1A 3E3OA 5JAMA 1SC9A 3U44A 1NVXQ 1KMQA 2ONZA 2HQBA 4HNAB 4J0KA 4KQXA 4KO2S 2ENWA 3KE9A 2VP0A 3KAJA 3JD2A 2JIMA 4PYKA 1XLTA 2J9XB 4ARAA 3M82A 3MWDA 1E7YA 1QGDA 1XRSB 4Y2HA 3VX3A 3K32A 4YRMA 1P61B 3LIPA 2XI4A 1E1CB 3AR4A 1KYTA 3KEMA 4HC4A 5HIMA 3PL5A 1R1DA 1ODIA 2C1EA 4OGKA 3GT0A 3AFMA 5AHWA 4ZMSA 4ZDJA 3C6YA 3KSBC 3BJEA 2WSLA 1ODJA 2QD2A 1ZJ6A 4ZGBA 1MQ9A 5BRNA 2VYVD 3CPSA 4Z3DA 2WFLB 3L4BC 4JUCA 4RPHA 5IEBA 4CQMA 2JF0A 2BFEA 1T1SA 2DPGA 3BF8A 2G67A 4JKIA 3IDZA 3LBYA 2J0SA 3NHUA 1CUSA 4JNCA 3S40A 4CMBA 3ADDA 3HBAA 3LGSA 2FWBA 1TYDE 4G4GA 4MUXA 5DHUA 3OCYA 4AWAA 3O1LA 1PCXA 3ETNA 1SRQA 3L9WA 3SX2A 4EB8A 1B41A 1Y7PA 2I2XB 4MEJA 4FJ2A 1AKQA 2AN9A 2QD3A 1XRRA 3D4BA 3LYUA 4H7PA 1OYOA 4QTYA 4GP7A 4AIRA 1C7QA 4HSGA 4HNGA 2FW8A 1YDGA 2JD2A 1DV2A 1RQ2A 3EMVA 2ATEA 4URHA 5HZKA 3T1YB 2VJDA 3OZDA 3HXPA 3ZI4A 5K09A 2AYYA 1JKIA 1IJKA 1FLVA 2O4UX 3N86A 1A97A 2GZDA 2XPCA 4G89A 1PFVA 4S2UA 4WUVA 4YLEA 1H5NA 2B4AA 2B8NA 1HKHA 2AE1A 2EXXA 3OIFA 3FBGA 5KHAA 3IULA 4X7PA 4NNPA 1NXTA 2EHJA 2BR5A 2ZYUX 3DBRA 1ISFA 3P9IA 4WAUA 3GFPA 3ZXYA 4DLNA 4EY7A 5LDHA 1GSHA 1L2TA 1T26A 2IZZA 5E7JA 4Q4HA 3S2SA 1U2QA 1H23A 3T99A 1UT5A 3PX7A 1TO6A 3G13A 4IQ4A 2EFYA 4JP8A 4AMYA 3ZJ4A 1HDOA 4LTMA 1X1RA 4QEDA 1XZNA 3A6JA 1L5OA 4HR7A 3X1DA 4ZJYA 5CU7A 2IEYA 1ORTA 4GW3A 4FONA 4RNDB 4QD3A 3KXLA 2OY0A 4HWTA 3N74A 4I55A 4J7AA 2ZRIA 4LRXA 3TRJA 3HJUA 3IQEA 4J6EA 1JPUA 2ZYWX 2IZ1A 5DISB 3GJ3A 4RIGA 4L74A 4RK4A 1D2GA 3T7IA 1Z34A 2QRQA 1G64A 4V0KA 1AKUA 2WINI 4JBIA 1RXSA 2C83A 2WZBA 1X2BA 2HBZA 3WGKA 2HQ1A 1LFAA 1E58A 3V8RA 3A7DA 1TT7A 4Q39A 2R8EA 1XP5A 4GMXA 4IQFA 3HTXA 3DBLA 1P3DA 2I2CA 4EKEA 1I13A 1CUHA 1UJ6A 4MW6A 3ZLBA 1E1RD 1FA9A 2FKNA 3I37X 3ABZA 3GEHA 3LDAA 5BN5A 3OCVA 3I53A 2Z2XA 4KDFA 2J6HA 5I7OA 5KZMB 2JGMA 4YN3A 2QTGA 4RK6A 8LDHA 2YXLA 1BWRA 4DLVA 4WXMA 5IWCA 4L0DA 4XGQA 1PLJA 1XVTA 1Z4JA 1SHTX 2E2WA 3WRYC 2ZE5A 5EGSA 2FDXA 1P81A 3NC1C 1ZD5A 1KAGA 3WADA 4R54A 5IYZB 2IIBA 4LDJA 4RWZA 3N6VA 4OMCA 2VK8A 1R4MA 3FUVA 3P5SA 3UBMA 6REQA 3WZMA 4KIUA 4F84A 3QZUA 4NMXB 1X94A 1Z75A 4IIXA 2DG2A 3E5HA 3HE3A 2J3KA 1R4NA 3GUUA 1YRHA 4BFVA 1CZRA 1ESZA 3NRJA 2QRVB 4OMFG 2G6TA 1Z6AA 4KN6A 3KZNA 1KQNA 1ZN7A 2Z3WA 2HTFA 3LZDA 3QJGA 1B6GA 4HDSA 3PK0A 3GJQA 4IJQA 3RW9A 3GO4A 3T5PA 1FFBA 4O59O 4JD5A 4UBIA 2J08A 4W6ZA 3NLLA 1PR2A 2NZJA 3KYJB 3ICCA 4QUKA 1D1TA 3JQ8A 1AHIA 1YR1A 2IY7A 3VYWA 4ZK6A 2ZS7A 2ZYDA 4XWAA 4CHTA 4NE9A 2GT1A 1Q16A 5I51A 1H2AS 4ZYVA 1OLSB 2EDCA 5KPJA 1KTIA 1RLUA 3MW8A 3B7WA 4I46A 1DMRA 2GWRA 2FZ4A 3NIGB 5KJFA 3QTBA 2P9FA 5GONF 2JLVA 2GILA 1ISSA 4F3YA 4CUZA 3FMGA 4EWLA 4UUMA 2XQFA 5EE5B 4PN3A 3A6FA 4LGMA 4HUTA 2QLTA 3LP5A 3ER8A 4TWBA 4OSPA 2RC5A 1N1EA 3B6MA 4OHKA 1SIOA 5K0NA 4IDFA 5JH7A 1ILWA 1RI4A 1UDXA 2QX9A 1NJ2A 1OLUA 4CFZA 4Q4CA 4LF9B 4QLAA 4L8VA 2PCLA 3ENZA 2OYCA 3T35A 2OHGA 2JFQA 3BWYA 3EXG2 4FBMA 1VKOA 3WGLA 3WLIA 4BNZA 1L4KA 1ITZA 1L4UA 1LPSA 2JAHA 1L7QA 3C6XA 3ITNA 3K0BA 4URYR 2NM0A 3VTFA 4YAKA 2C3UA 3EN0A 3O8CA 2J07A 4JN6B 2OZVA 2HDHA 1JJ7A 2Y67A 3EEBA 1U65A 4HRXA 4LRWA 2DR2A 2PMBA 1Z4LA 1PRYA 2CMDA 4RL4A 4CV2A 4Q4LA 2YXNA 2OVFA 2G5TA 3ZOKA 3ZZMA 1INLA 4X6YA 2H06A 2Q5EA 5IBCA 3MJDA 3PKZA 5K0BA 1JEQA 4LDRA 4CL0A 2Z6QA 4CEJA 1GU0A 3OSZA 4Z7JA 4EYEA 3OHSX 1C3OB 4HT3B 3O8LA 1H66A 2R7LA 4UE2A 2NV6A 4PU0A 3QKRB 4PG4A 2G7ZA 5HDBB 4C6HA 5AVTA 4HDQB 4J2HA 3KC2A 4OFWA 4G1EB 3OM9A 2GN9A 4XLLA 1BHSA 1DG3A 1ZWLA 2F1RA 3CCBA 2MINA 3U3JA 1J5EB 3ESZA 4TL9A 1OJLA 4I5EA 4BVEA 1JIXA 2HIGA 3AHJA 3K6SB 1ODKA 1VB5A 4TV8B 5F3DA 4FGSA 4OCZA 2D1TA 1E1YA 5SZIA 1Z0FA 2IITA 4PZZA 3WHPA 1W36D 3GZNB 1PBNA 2W6MA 3A8TA 3ONDA 2IGBA 4FQ8A 3GA7A 1E3LA 2P9YA 2X7XA 1J49A 5A4DA 4RS4A 3QVOA 1C5KA 4IJKA 5EJFA 5KEIA 3KWLA 2CVQA 3T34A 2ZANA 4C2AA 3DE1X 4RJLA 2G72A 2FUCA 1ECFA 1VSBA 4H7FA 3Q3GE 3IB6A 2CBGA 2KBEA 4HLCA 3ZCPA 5TQVA 1P4GA 2RDMA 2BN4A 2HQOA 3OOHA 2DCMA 2Q5CA 3G2QA 3WL4A 4BBAA 1AN9A 1Q0UA 4RY8A 2K7ZA 1PO7A 1QP7A 3AUFA 3H1AA 4GXQA 5CVUA 3CF0A 4HRAA 3CLUD 2CW5A 3I34X 3PUWA 4ZXPA 5CVDA 2H1VA 4ZD6A 1DAFA 5AKEA 2Q8NA 1EA7A 3IBYA 5FFNA 5FPTA 4AQDA 1Z6YA 3WIVA 3JASA 5TMPA 1HORA 1NFFA 3OT1A 2F1OA 2P2ZA 5JQWA 4TTRA 3RRFA 1A8IA 1MORA 3P71T 2PE5A 4NHEA 1DBQA 2WOJA 3I1FA 2A0XA 5CA1B 3C3PA 3KVNA 1V4BA 3VNUA 3D31A 1MG0A 3U48A 3CF4G 4CMJA 5K3EA 1SXJE 4R69A 2O2JA 3A4VA 4BLWA 2A5YB 1EWRA 1WDKA 5SYMA 3U9TA 5I4BA 3T0GA 2XGMA 4OKNA 5ALMA 4OXYA 3IQFA 4NAUA 5BW6B 3SOZA 1KHHA 4C3ZA 1AV6A 1AB5A 3NTOA 4LWPA 4NKRA 3MPUA 4M1OA 4N40A 5KTKA 4GQIA 1WB5A 4M49A 4MV1A 1VE7A 5H3LA 5DHAA 2I2AA 3UAXA 2O2HA 5CTJA 3AUKA 1HYQA 5EEHA 1SVMA 3I2GA 1SHLA 4AY5A 2DYKA 3EQ6A 1M72A 4YCJA 4PYRA 4S24A 3GUHA 1KAEA 1SXIA 1E5XA 5B1IA 4BV8A 4L2IA 4AZ3B 1A27A 2GD2A 3S81A 5CYPA 1USIA 2Z56A 4OVKA 2O59A 4EYKA 5B55A 1J23A 2GJKA 2QD5A 3CTPA 1ZM9A 2FWMX 1IUNA 4FR0A 5F21A 4F38A 3OIUA 3BEOA 3I2KA 2YW9A 1TCBA 2PANA 1ZNYA 1WA5A 3KZXA 4KPUA 4RIEA 5CLIA 5LA6A 4AXBA 3KOYA 3DO8A 4KYTA 4P5PA 1P0MA 1W34A 5HUHA 4IMPA 4U2CA 5I7UA 3BQ9A 2ACWA 3RIHA 1TQ4A 3N2KA 3CZ4A 4CIDA 4P3YA 1CHDA 1BH6A 4JJ8A 3B6IA 4TRNA 5B1HA 4GLFA 4CDNA 1CV2A 4IF4A 2FMFA 4JFAA 2A1TS 1T25A 1EH5A 3JWGA 3K09C 1HE8B 1NR7A 4IG4A 4J94A 5AKLA 4D3FA 5I45A 2X13A 3L1KA 3ESDA 5BN4B 4MHTA 3RROA 2NXJA 3F6CA 3PXEA 1TM7E 4MLCA 1TKCA 3D7LA 2V6IA 4HDOB 5KO2A 4ZAYA 1H85A 2P3OA 2WNHA 4PTLA 2BGMA 3L0IB 4XIJA 3OE4A 1N2SA 1C4KA 4LX0A 4Q3OA 3ZXXA 4ETNA 3K70D 3U4GA 3T06B 5B7QA 3ZLJA 1MB3A 2WP8J 4D44A 1XVAA 4CODB 1U5BA 2ZU0C 3OPXA 5TS2A 5KREA 2XNKA 2GA8A 5CM9C 2RHJA 4PEVA 3D6JA 4Q1BA 1RHMA 3CMMA 1ACMA 3JCZA 1FDOA 4H08A 1LKZA 4YCCA 1DU4A 4NIMA 5JO0A 2GJ9A 3AEKB 1CJSA 2X2EA 3X1XA 1CDOA 3EA0A 2F1KA 1M6VB 3FPGA 1IHYA 1YL7A 2EFDB 3HR4A 3UJBA 1WUJS 4DPLA 1KEWA 1J33A 2W70A 4YT2A 4AMBA 2Q0SA 3PD1A 4WN3A 1ZCBA 3DJYA 4ID3A 5BN1A 3NM5A 3UN1A 1QH9A 2R11A 5JZMA 4WBNF 4YPVA 3ANLA 2XMQA 3Q3VA 3RB8A 3OZVA 4CM1A 3LC0A 1RADA 2Y93A 1A5BB 1OTHA 4RF3A 2XCIA 1TKRA 1G8FA 3O4FA 5E7IA 1U2ZA 3RVPA 3TEFA 1PD0A 1TTTA 3VHQA 3PQ3A 4MH0R 4Q1DA 1Z26A 4RABA 1GEGA 5FTJA 1M0WA 1JLHA 3GLHB 4FC7A 4KQEA 3E22A 1E5VA 1L6RA 4TV9F 3GD5A 2VHJA 5ALEA 2IDJA 5DXAA 2WKSA 1UKZA 3L2OB 2P3SA 4TWRA 5IF9A 3UT5B 1IZ9A 2AWNA 2JIDA 2R97A 1H4VB 4YMVA 3GFBA 5CCBA 1RC0A 3CKKA 1NIPA 1W4RA 4IKEA 4Q3CA 3TE6A 3DXXA 4MMXB 3GVPA 3FLAA 3BRCA 1QVAA 4WJZA 1TFRA 1Z0JA 3DM5A 8MHTA 2VH5R 3PZRA 4F3TA 2WYHA 3PUXA 2XGJA 4LF7B 2B5WA 2X0JA 3Q5GA 4OB6A 4EKDA 1BX3A 3MB5A 1FK8A 1KI6B 4NDAA 4Y6LA 5ALWA 3SAJA 1UC4B 3ZHVA 3STWA 2H1CA 3EZXA 3E3AA 1ESMA 2WWRA 2IEGA 1W29A 3QLTA 5DW0A 3OECA 1OX4A 1GZ5A 2XQKA 5MFPA 4C0HA 5F9HA 3UB4A 1K63A 1UEJA 2BGNA 3CEAA 2YINC 1KGDA 2CMHA 3HPQA 3SLKA 4AYXA 5LP6B 2HPVA 2R6GA 1FDWA 2ZPTX 2HCFA 3I9KA 4MUBA 1MOQA 3ZYZA 3FGNA 3OZRA 3FOEC 1T6XA 2PLNA 1SZPA 4G5GA 2O5RA 4I50A 3VNBA 3QELA 3VOSA 1MTOA 3LUCA 1DX4A 2EKPA 5IBQA 5U1PA 4IOKA 5AI0A 4NLLA 3G02A 4E11A 2D2EA 1MX9A 3ZY2A 3L77A 4GNKA 1P45A 4JR1A 3RTGA 4BC0A 3U61B 1DUVG 1II0A 1ZMBA 1QCZA 3D2AA 3HXMA 4UU0A 4BIMA 3I1IA 1TA4A 2VHCA 3BTOA 3S44A 4L4SA 4GSLA 4FMCB 4N5LA 4NCNA 2W6QA 5LD2B 3OC6A 4XPIB 4ZXFA 4EYSA 2GPAA 3KB6A 2I71A 4X7RA 3OQIB 3ZVRA 3GIDA 2PV0A 4MDEA 4QYIA 3HADA 5FLKA 1YS9A 3WFJA 1CZHA 3EZGA 3BVPA 2Y66A 3QXGA 2XB8A 2G5CA 5EYPA 1Z33A 4D9NA 1UBHS 1OH8A 2G1PA 2O8BB 1N5LA 2XSZD 3S2ZA 1NUSA 2GWHA 3ROTA 2ZVJA 4ZU3A 5FPKA 2VSNA 4B83A 1GV1A 5JNWA 4QA9A 4KQKA 2JK1A 2QZPA 4WCFA 3B3JA 3H3JA 4M1YA 1T8PA 2QTBA 2JBWA 4XB2A 3I61A 1D8AA 4WK0B 2QU8A 5LBIA 4BVAA 1IUPA 2PJRA 3VSDA 3ZDAA 1SCAA 4ISBA 1U63A 3D8BA 4OOFA 5TF4A 4ER5A 4CMAA 4PLZA 1HC7A 1ZC4A 1JU3A 4IO0A 2TMGA 4WOCA 4F3CA 3AZOA 3ETLA 1ZD9A 1ENOA 2WWGA 3MIIA 1GN8A 4GE3A 1P7YA 3DOIA 3OJ0A 4TRRA 3CF2A 1WETA 5DSTA 1FUKA 3JQ9A 3TGLA 3G89A 3G82C 2BTEA 1RPTA 1FDRA 1DI0A 2UZ3A 3HN6A 3PPWA 2H2WA 2Q9BA 2X14A 1JEJA 4KGDA 5CX4A 1GIAA 5FPSA 4X64B 1UF9A 1RMTA 2YWXA 3N7AA 3TH5A 1E0SA 3ZWQA 1L3BA 4FI3C 2C9ZA 3FLEA 3P7MA 3AERA 4TL6A 4BVBA 4HNVA 4EPWA 3GRVA 5JNRA 5LKAA 1SVWA 1RC1A 1GNSA 2H5LA 2BTOA 5GVRA 1FJHA 3MHPA 2PPLA 4P84A 1Y63A 1CJTC 1XG5A 3A6HA 4MKIA 4R1QA 2IWHA 3UUWA 1UQTA 4ZHQB 5F33A 3NWBA 4CLOB 1T5DX 4JQZA 4IIFA 5IN5A 1PZGA 4OYLA 1MIOB 3EXEA 2XVMA 1N92A 1PNVA 4ZCSA 4J7XA 3VMMA 3SKVA 1AGNA 3UEOA 2NGRA 3SMQA 5HJ5A 1JFFB 3DHEA 4OA8A 3V5NA 3ZG6A 2WD7B 4KXUA 1YAJA 1UBKS 5HF6A 4BAZA 4CM9D 2I4RA 1E1DA 3RC7A 5HOQA 2GF2A 3MMZA 4V39A 4P58A 5DCLA 3FETA 2H1HA 4NBWA 4WMLA 2JHCA 1H93A 3A7EA 3MTBA 2OAP1 3HU3A 3NXSA 2JANA 1V45E 2VPPA 1FLAA 2HWWA 2VPYA 4MMYB 3RI3A 2BMAA 2P79A 4QEKA 4DC9A 1RXUA 1SG0A 2PXHA 1S6YA 1UPCA 3C8ZA 3FPEA 1GUAA 3KLOA 4KLZA 5T3YA 4X24A 5AJYA 1GTRA 5AJVB 3S0JA 1I5OA 1YCHA 3TNDA 4L4UA 3CMCO 4PS1A 2DB3A 3O4IA 2BDEA 1U0HC 4UAGA 2LDXA 1C3VA 3VPDA 1X7GA 2YUTA 2ZJ1A 3EGWA 2PGLA 4D3ZA 3HDJA 5K0TA 1FFGA 1MR3F 2I65A 4PC3A 1AY0A 3T3DA 1CFJA 1JR3A 1LPAB 3NIBA 1VC2A 3E9ZA 1K7FB 1SXJD 3LYLA 2YWGA 4Q02A 2L0XA 2WD8A 4BAUA 3DQPA 3WDMA 4YCNA 4AS2A 1MV8A 3M34A 2GHTA 1EE1A 2OXFA 1KK3A 4RV9A 3IAHA 1SU4A 4OA5A 3SZRA 1XXLA 3U3RA 1JQDA 1RFLA 2FN4A 3B7GA 3NP7A 5JZ9A 4I8DA 3GFSA 1VL2A 3QNUA 3KR2A 2QTFA 5J4VA 2R1UA 3DV0B 5AKKA 5KVVA 5EMJA 2EWMA 2ZIFA 2OHOA 3MFQA 3R8XA 4GGPA 3VPBA 3Q7TA 4F7DA 4L1KA 4FN4A 1TIKA 3Q5EA 4R7ZA 4B2YA 3FDFA 4PZYA 4UAUA 2OFFA 4DUYB 1XVVA 2W2NA 3N0WA 5CH3A 2N9UA 4OSOA 2WIKA 3P9KA 1O03A 4RFSA 5G4KB 2JARA 3IQZA 4DMGA 4CKCA 1GLVA 1EG7A 4MB0A 4ZT4A 4G6ZA 5C8ZA 3UENA 2ZDQA 1R0LA 1WXWA 4ID9A 3WB1A 4HXFB 4Q4AB 4IUCS 1E60A 1T5SA 2ZR7A 5JSKA 1TMGE 3EA4A 4QQ8A 5FUWA 5BNFA 5C2JB 2JFYA 5CB4F 4FE3A 4R1NA 2PHZA 3GGPA 1BVYF 3BXPA 3PNSA 3AJ8A 1PSZA 5D7BA 2P91A 2LGJA 4BFXA 4F5WA 2PJDA 4GPZA 4Q5IA 2X6RA 3PGLA 1YE8A 3ZNQA 4B7UA 5TVGA 4QQFA 1FUIA 5SY9A 4PE5B 3NDRA 1ZO8A 1RXVA 3OJXA 4BV9A 4X8HA 3THSA 3TLJA 5B5SA 1WNTA 1Y82A 1ZK0A 1V95A 2VJLA 1DP4A 2FMHA 2ZUUA 3HA7A 2B8TA 4BNWA 1Y6FA 2IH2A 1ZD2P 2VQSA 1WULS 4C78A 4LWQA 4YRJA 4IF6A 3PENA 3N7TA 4FZVA 1K86A 2FPMA 3RVQA 4A2WA 5CAEA 2NTVA 4TVBA 1XLTC 3KOWA 1KDYA 3VC1A 1GFIA 3IOYA 2JKVA 3AF1A 1GNRA 2C4TA 3R76A 1T29A 3IHLA 1WUIS 1RLIA 2OO7A 3G2PA 1LPMA 1U2SA 5HIKA 3PL1A 5CNIA 3C1TA 4G81A 2G04A 2JD1A 3NBAA 4DYVA 3NX4A 4BX8A 2WWTA 1VE5A 1VBNA 3PPXA 3QMMA 2ZK7A 1KQOA 4C7MA 4IXWA 2MIIA 5AJTA 4L07A 4UEQA 5C5DA 4KZKA 2XUQA 4GSYA 5KJ1A 4AD8A 1GPWB 1ZUWA 2W6CX 2RHMA 3L1IA 4NENB 2KM1A 3G3EA 1E77A 4P3KA 4YMSA 1YZLA 2BFDA 4JUBA 4E5DA 1Z5PA 3RYCB 4M89A 4DA6A 3KHUA 4AKGA 4I1RA 4S35A 1UBLS 5JJIA 3Q40A 3GA5A 4UCXA 3EDMA 4FSDA 4LISA 2F7SA 2YVUA 1DC5A 1GVHA 2NUPB 3ZKWB 3S2UA 4QTTB 2NW6A 3AJEA 5EE0A 1PL6A 1KRWA 4HJXA 4O3MA 2KPOA 2IV7A 2NTYC 4HCJA 3PXBA 4CF4A 1QFXA 3KJQA 3IJPA 3RRZA 1OQAA 4LXYA 5DPMA 2O14A 5DULA 2HF7A 2OSVA 2DGDA 3ESBA 4JSTA 4JVNA 1R0YA 4ACAA 4BBJA 2DQYA 4J3NA 2ZUBA 1JSLA 4RH0A 2XZDA 3OTIA 3LPCA 1D6JA 3O8RA 1M10A 1U8ZA 2FE4A 1ESCA 1ZXLA 3A1DA 4DT1B 2B4TO 2I9KA 2HPZA 2D5CA 2I22A 2FOLA 3COJA 2PH3A 1YRWA 4YHBA 4M87A 1W9MA 3HXQA 2OCKA 2GCOB 1T2AA 4NCBA 1M2VA 3UJ7A 4FYHA 3TNLA 1YZNA 5JXWA 1BDIA 3LV8A 1F12A 3RHTA 3E9RA 1GNVA 1YZTA 3SE7A 4Q9AA 1WABA 2AKAB 1J0AA 4HQ0A 2ECKA 2ZJOA 3JQPA 2BISA 4CLRA 1QRUA 5HZMA 1XUOA 2XT0A 3D6NB 3PV0A 2V3WA 3S1AA 1S01A 2VJPA 2PO7A 3WL7A 1Z74A 4AUKA 1H69A 2Y4NA 4R41A 5B58T 4N03A 3CE6A 2GPYA 1M75A 3K2QA 4IHQA 5J9FA 4DLYA 4YK7A 4ZJZA 1A9OA 3UWOA 2Q1XA 3DNMA 5E4TA 5FA5A 4H1TA 2E55A 3VZDA 3PFHA 4REMA 4Q7EA 3H3FA 1U9IA 2XZPA 2IOYA 3FPHA 4LSWA 1Q0LA 2ZRQA 2MU1A 2R25B 3UZUA 3GLGE 1QX4A 2FRDA 4EPXA 1B16A 4R01A 5BVGB 3UMJA 3UA4A 2J9RA 4RTQA 1GAJA 3V4ZA 4JEIA 2ZBGA 4C4AA 4ODIA 4D9HA 4D4JA 1O08A 1D4FA 1YK0A 3GCDA 3TW4A 3VHRA 4YRBA 5IT4A 3S1SA 4OHYA 4IR7A 3IHWA 4C21A 3BMQA 3O1HB 4ETWA 5A4JA 3L92A 3MRVA 3GFQA 4MGIR 5AW7A 2CT8A 1RZVA 2OBMA 1EGVB 4URVR 2I29A 1AT1A 1E2NA 4GECA 2VK2A 2PKXA 1UZNA 2OXRA 1SEVA 3QYPA 1S2LA 1KYVA 1IAQA 4DMHA 4FI3F 4G36A 4RLHA 1T36B 1A82A 3VKWA 4BNUA 5FAKA 3JZDA 3HWSA 1DBSA 3D59A 4RS3A 3DOHA 3I9V1 2W2KA 3O9MA 1Y4ZA 1H8HA 2ONKA 2OV3A 4INAA 5AXCA 1GL3A 2FUNB 1BROA 3ZH2A 4E88A 3SQOA 4QOGA 3K9NA 1I33A 2CNLA 3AZPA 1T9AA 3HEBA 2ERCA 4II2A 3IKTA 1ORWA 3H1PA 1QGAA 4XSHA 2ERYA 3AEUB 3HCDA 4KYUA 4D3YA 4YJ3A 2C95A 3C3WA 4IIBA 4BKUA 4COOA 2BH2A 2NO6A 1W47A 1YA4A 2A57A 4CFSA 3IAXA 2RGYA 5B53A 7ABPA 1Y9EA 2OFOA 2PFGA 5LIPA 2WIBA 5LVAA 3M1LA 1X7WA 3SX0A 2WWFA 3NZEA 4O4IA 1VB3A 4FE4A 3PEFA 2VCEA 1WV1A 3TLBA 4GZMA 2ZB4A 1P73A 1NSYA 4IV0A 3HY3A 5CBKA 4XPZA 3T9FA 1ARZA 2OESA 2XH8A 3CVOA 2G9UA 1KEEA 1KPHA 1QG4A 1VGQA 2B37A 1KK1A 1YRQA 2OEPA 3GJSA 3TDNA 1LK5A 4N3GA 1Q83A 1V5IA 2HQRA 2V7QA 4AWBA 4MGKR 1AKEA 2B78A 2IFTA 2XCQA 5EEGA 5DGDA 2QUJA 4P8RA 4A5SA 4DNFA 1AUPA 1SOWA 7GPBA 3LT5A 4QG7A 2OCBA 1BKDR 3HCOA 1FTWA 1KVTA 1NOIA 3ADCA 5FLEX 4N1AA 4L28A 3Q3JB 2CYBA 2WKPA 3E9QA 4DIFA 1Y3CE 1Y6GA 4QPDA 1JDNA 2AJCA 2PZEA 4M9CA 4DR5B 1USVA 3FNIA 4DV6B 3KQUA 3C6ZA 5GOZA 1WPQA 4U9UA 3MLEA 5LKRA 2WTAA 4JODA 4UM9D 1NF9A 2HYDA 4UE3S 5IBPA 3RRMA 3R3VA 4X95A 2QP4A 1FSPA 1XTVA 1Y6ZA 4MS4B 2GZMA 1XCGB 3ECSA 5FUXA 1BGVA 3F46A 5LYJA 2I2FA 2WWHA 3NXKA 2AK2A 5CH5A 4BCDA 4OAPA 3LD9A 1X80B 4XWYA 2J0EA 2H54A 2HH9A 2VF5X 2AI2A 2XY4A 2WYIA 3KTOA 3Q41A 4JQYA 4PG7A 4RVUA 3TOCA 2CFIA 2J4CA 3AHIA 2ET6A 1E9AA 2LRHA 3GB9A 2OM6A 4MQ4A 1UAGA 3EFOA 3FNRA 4TS4A 5ELMA 4C43A 1W2WB 5KOJB 1Z4NA 1SVKA 4XYGA 1UJNA 3AJRA 3LBHA 3R9XB 4AF7A 1YF3A 3WL6A 3PGJA 2WF6A 4EECA 3OQMA 1CZNA 3EOAI 2PRYA 3C6MA 3NB0A 1GUFA 4GR9A 2NQ2C 3IPCA 1XVUA 1H3FA 3HMKA 2IHKA 1XA3A 2R4UA 3GMTA 4MW0A 5F98A 5BRAA 4X1OA 2Z2ZA 1JSZA 2EJBA 2ONCA 2YRXA 1U3CA 3WTBA 4GUAA 2FPPA 2YIMA 1YA6A 1KYYA 3UATA 4WK6A 3PTZA 1V9LA 4YUVA 1ECPA 4MQUA 2ZS8A 3E27A 5E9AA 2FVYA 2OAQ1 4ZAZA 1SVLA 4BMZA 1AX9A 4FPXA 4TS1A 2Q6OA 2NXNA 3R6LA 4UARA 5D8DA 5B2FA 3K92A 1MAAA 2HIHA 3R3JA 4HHEA 1TTPB 4ZCRA 4YBZA 1OMOA 4H17A 3WR5A 1YJ5A 1A2BA 3W8NA 1N1GA 4FFBB 4MMZB 3WLFA 4CM8B 4B3TB 1PQUA 3QVSA 3NAZA 4XVRA 3O5AA 3QQPA 2EFEB 7YASA 5JZSA 1HOXA 3VR1A 1TUGA 2A14A 2C3OA 1NI5A 4PHFA 3CR8A 4H7KA 4URXR 1EJ6A 4CQJA 4AJ9A 2H63A 1J24A 3I09A