3DEFA

Crystal structure of toc33 from arabidopsis thaliana, dimerization deficient mutant r130a
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
243
Chain Sequence
REWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYAVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPLVKAITDVATNQRKAIHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
publication title On the significance of Toc-GTPase homodimers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 87
structure length 243
sequence length 245
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3defA00
4OHXA 2WAYA 2OCPA 4P31A 1HY3A 3BH6A 4NBSA 1HV8A 3FMOB 4F7WA 2VP6A 1I4TD 5FPTA 2ZRKA 3RRNA 1E3MA 1R8QA 2IYRA 4ZPXA 2ERXA 2HT1A 5FPSA 2JLZA 2R6DA 4RVCA 4KODA 3SZRA 3U44B 3ZD7A 5K8TA 1R0WA 3GJ8A 1WBDA 1IBRA 1NVVQ 1OFTA 2LCFA 2QM7A 4EPVA 4TSFD 1P60A 3VNVA 1ZC3A 2RGCA 3A1SA 3REFA 1MT0A 2VLIA 1GZSA 3WXMA 5BYJA 3GP8A 2QI9C 2QMEA 4LHXA 2ZE6A 3QF4A 4KVGA 2F3RA 2AX4A 4GOJA 3LAWA 2FSHA 2WJJA 5CJPA 2C96A 2ZI4A 3AVPA 3OE7A 5DO9A 2ZRGA 5J47A 1VKJA 4QXAA 3P26A 1WF3A 1M7GA 3IKJA 1RRPA 3B82A 1B23P 3L8ZA 2H8KA 5J4YA 1G6OA 3Q5EA 3W6OA 3PUVA 4RZXA 3GFPA 5DYIA 4ZV4A 1QDEA 2BC9A 1XBTA 1XCMA 4Q00A 3ZYCA 3QEOA 2OO7A 4JLBA 1GWNA 1EFRD 3BAFA 4DLTA 3QKSA 3ZZUA 2IS4A 2QY9A 2PT7A 4F4IA 2D4HA 4I1SA 4D81A 3N5CA 5TXGA 1VTKA 2IYVA 1DAIA 4QBGB 3WMGA 4UNRA 4HDQB 5EE9A 3FE2A 1M7BA 4BFTA 4JLNA 4YONB 1N6HA 3SYKA 4GSYA 4OK5A 3X1DA 2PEZA 4EJSA 1RJ9A 2OZEA 3GCGA 1YZGA 3CRVA 1GUAA 1XP8A 3IBYA 3PIRA 1S96A 2ZIAA 3VX4A 3EA5A 1ANKA 4IFEA 1OYYA 1OIWA 3QVUA 1PLKA 2J9RA 2ZREA 5BN5A 4D26A 4DUGD 5JI2E 2J59A 3KQLA 1RIFA 5TDHA 4MGIR 5GJVC 1N6OA 1K5DA 3PEUA 4IXNA 4LV6A 4WA7A 3W8NA 1W36D 1D2MA 4LOAA 1T0JB 3B8HA 4AURA 2O8DA 5FR1A 2QORA 4HUQB 1W4AA 4M4SA 1E9DA 2EYQA 3CF6R 4TMZA 4BRWA 421PA 1G8PA 2BKEA 4QBFA 1K5GA 4JZKA 5FFMA 4OQLA 4P4SA 4US1R 3I62A 4TMKA 2FZLA 3CBQA 1TF7A 5IK2A 2DFTA 3LVQE 5CYOA 1P4SA 2HUPA 3LBHA 4AYWA 4NHOA 4XTRA 4DVGA 2QL6A 2GXSA 1HH4A 4TLBA 4OYHA 3LA6A 3CR8A 3HR7A 3ZIAA 1EG7A 4Q1EA 5FTKA 2EFEB 2IWRA 4A36A 3KX2A 4S35A 3U2QA 4MKHA 2ZYVX 3FTQA 2YHSA 3GD7A 1GL9B 2BMDA 2F1IA 4H1UA 4NCJA 4XSGA 5HTKA 4D4JA 1P72A 2BWJA 1AS0A 4KV9A 1UKYA 2GVDC 1P2VA 5J40A 4YMVA 1G64A 2DWQA 3KL4A 4K8OA 4R7ZA 3K0AA 1Z2CA 1IN6A 1JXMA 2JASA 2ZAMA 5G53C 2QN6A 4M1YA 3SI7A 2YKGA 5IF9A 2G83A 4JS0A 4Q4JB 3FGNA 4YMUA 2FX3A 3PITA 4LSGA 1YQTA 3RC3A 1E2FA 1ZC4A 3GEHA 2SHKA 4DJTA 1VMAA 2N46A 3ADBA 3ICQB 1KK3A 2DCUA 3JZMA 2PJZA 3THWA 3LWNA 4PX9A 1GL7A 2A5YB 3B1XA 4M22A 4RSGA 1UBCA 2G0TA 2OEPA 4I81A 4BLPA 2JLQA 2RGGA 5BN3A 5FOWA 4PAMA 1OSNA 5G3ZA 3KKNA 2HLDA 1FP6A 3QKSB 3LV8A 3B78A 3X1YA 5JWOA 2PEYA 3Q7PA 3OE7D 3O8DA 3W8RA 1US8A 4Q9JA 1CS4C 1YRAA 1Z06A 2E9SA 1CRQA 2MMGA 4JBWA 1A1VA 1KDOA 1S1MA 2HCJB 4UKDA 3TVTA 3U7FB 1KSHA 5DI3A 4A0FA 3SQXA 4Q02A 3WBKA 2VRWA 3U4QA 1E94E 2RHDA 1Z0FA 3PFIA 1KSJA 1BMFD 1XMVA 3QKRB 3W3ZB 1OXXK 3GJ4A 2FV8A 1YR6A 4LYFA 4NDZA 4B3BA 4HDOB 3AKDA 5FOXA 3WHKA 1J8YF 1JQJC 4A15A 2AFHE 2XB2A 1DARA 5CLLA 1MOZA 5EQTA 1XXHA 4DEXA 1ZP6A 3GEIA 3TW4A 3WMFA 4GMDA 5FUVA 1YR9A 3LNCA 2ZS7A 1LF0A 1LB1B 2YV5A 1R5BA 2VHCA 4QGGA 2ZJAA 3KXLA 1XJQA 1JEDA 4M1OA 2AK2A 4C2UA 4NYIR 3K53A 5CIWA 2V55B 4TQUS 3LD9A 3X1ZA 4IVQA 4A0HA 1FW6A 1KTVA 5AUPB 1D5CA 1NG9A 4JLVA 3BK7A 5FTJA 1RRCA 1ZM9A 4TYYA 2UKDA 1E1QA 1HE8B 1GILA 2ZSEA 3A36A 1FMJA 5DN6A 1XB2A 4XIGS 3MD0A 2AR7A 1F3OA 3R9WA 1LFDB 2C5LA 5A4JA 4TTRA 3A37A 1XWIA 2HYDA 3UXMA 1L4UA 1NKSA 2GAAA 3HYTA 3CX7A 4B6FA 4A8JC 4OHZA 4NCHA 3VFDA 3RS0A 2CE7A 3VHLB 3TSZA 1U90A 4NP6A 2E1RA 4BASA 3C5CA 3AF0A 2IS1A 4YMWA 2HXSA 2IEZA 1JR3E 1XEWX 1VCIA 1IXSB 4XD7A 1TUEA 3K0AB 2ORVA 1KJYA 2D7CA 4PTLA 5JFGA 2QAJA 3GJ5A 2XOKA 3UPUA 1E2IA 4TMTA 2EWVA 2OLJA 3CUEF 1OT3A 1LVGA 4B2PA 3SEAA 2XSZA 3MWKA 4Q1BA 2QP4A 4XTCS 3OZXA 4JMPA 4C0BA 4LJAA 2V1UA 4UNPA 2JLVA 4KFRA 4LYHA 1XEFA 4HLUC 1NMZA 2A30A 4YDHB 2A3RA 1E2DA 4W5WA 2H16A 3CR7A 1OE0A 4RD6A 4M1MA 4RCZA 1E2EA 4Q01A 1JJ7A 3A1UA 4Q4HA 4MUBA 4MRVA 1X8JA 1E9RA 2O0KA 2WMNB 3I92A 2QM8A 4RZ2A 5CITA 2WWXA 5FUWA 5EXTA 1HTWA 3QXXA 1NBME 4ZIRB 3B7GA 5FH9A 1ZW6A 1NLYA 1XFAA 5DI3B 4B33A 2D7DA 1E9FA 1Q22A 1XTIA 1K8RA 4Q5IA 1II0A 3I73A 3QF7A 3W3AA 1Q1QA 2DFLA 2ZYWX 2WPDA 4PXAA 2NO7A 4DLUA 2RKOA 5TY0A 1K6MA 2J87A 2NO0A 3KUCA 4E03A 2QT1A 5JSZA 5L8VA 2ZSBA 2IYSA 4HDCA 4D0LB 1MRSA 2GEDA 3B1VA 1T0HB 4W5HA 3GLFE 1G7CA 2IXEA 1NN5A 2KBFA 3ZZ0A 2VHJA 3VX3A 1LY1A 1NRJB 3P4YA 4DC9A 4JSYA 2OBNA 2VBCA 1Z0AA 2ORWA 1FX0B 1AGPA 5J4KA 3EZ7A 2NO1A 4PHGA 1G20E 4GBMA 3G82C 3GQBA 4RD1A 3D8BA 3WHLA 4PZYA 3VQTA 4US0R 2HCBA 1E2JA 4C0SA 1N6RA 4B75A 2QP9X 1OFUX 2JLWA 4TZ0A 4IRUB 1KK1A 3Q9LA 3QJYA 2XXAA 2ZRIA 3TAHA 1S8FA 1GFIA 4TYPA 4I1VA 4N0DA 2WKPA 4B43A 1I2DA 1XTQA 2OUKA 4OI1A 2BHRA 3RWMB 2ZUCA 4RCYA 3RYTC 2ANBA 3QXHA 4URZR 4HUTA 2WICA 2ONJA 1E1QD 3U3MA 2YWGA 3IQWA 3ETLA 2Y8EA 2GF0A 3QBVA 2QGNA 4S2EA 5AR1A 3HP1A 1G3IA 3NTUA 4JL6A 3DOFA 1XJ0A 2CNWA 3MWJA 3VU9A 4Y0VA 5DN6D 4LHVA 2WTUA 1E9SA 2O8FA 3K0FB 4JVMA 2MSCB 2QU8A 2NO6A 5KSPA 5AK0A 4GNKA 3AH8A 3LFUA 3PQCA 4FXPA 1UM8A 1GVNB 4L8GA 3TMKA 1A82A 1FNNA 3I1FA 1E9AA 2A5GA 4Q1CA 4L15A 4JLJA 3L2OB 4A8JA 3C14C 1N6NA 2QG6A 1ZD8A 4IOMA 2IWHA 2W83A 3AGPA 3GEEA 1W47A 1VG0B 3KKPA 1Z0DA 1ZCAA 2KB0A 1KK0A 1G4AE 4E07A 3RS7A 4EQ6A 4XD7D 5FTNA 3FHTA 2D74A 3KQHA 1GITA 4M1TA 4XH9B 2VHTA 2NIPA 2XOKD 1QG2A 2VP0A 4W9MC 1LW7A 2AN9A 2BM0A 3H84A 4OHVA 4KSBA 5JRJA 2X2EA 1PLJA 3ADKA 1U98A 3NBFA 1KO1A 2JAQA 5FOSA 3KQKA 3DMNA 4URUR 4KFSA 4C30A 2R6AA 1IXZA 1JR3A 1FNMA 2CL6X 3KFXA 3M0EA 2FPMA 2WJVA 1XEXA 2CBZA 4HLUA 2R62A 1XRJA 2OILA 4ZDJA 1NVWQ 3IILA 1IN5A 4OHYA 4DIDA 1CR1A 1E2PA 4DLXA 4CEHA 2VIIA 4ESVA 1YJ5A 5JEEA 3MJRA 4PC7A 2ZTSA 2H18A 4JJZA 4V0ME 2ZJYA 2ONKA 1ESNA 4PQRA 5J5CA 4EPWA 4LJ9A 3E1SA 2BDTA 2QP3A 2C03A 3UMFA 4P4UA 2YYZA 5FI0B 4F93B 5KHOC 1IOZA 4HAXA 3NXSA 3UMRA 4ASUD 1GP2A 3ONWA 1XTKA 2CJWB 1U81A 3NVAA 1COWA 2IF2A 1AZTA 2XTZA 4X8MA 2UZIR 1GNPA 2ZRHA 5DISB 3T12A 1NBMA 2KWIA 3A4LA 1GM5A 2YOFA 1Q12A 3IPXA 2G88A 3PEYA 1BYUA 2NO9A 2J3EA 1TEVA 3QQ5A 1M6NA 1W44A 1NVVR 4KVAA 2ZJ5A 1KI4A 3DPUA 2WWIA 3BJIC 3DO6A 3QXSA 3LLUA 3NDBB 1W36C 4BLSA 1KO7A 3V00A 3OIWA 4BECA 3W6NA 1R0XA 2A5FA 4TWZA 3EWSA 1GRRA 2W2TA 721PA 1IONA 2O8FB 2YWEA 2KI5A 2H7VA 2AXPA 5AUOB 4DB4A 1SKQA 5EE5B 1LNZA 3WNDA 3TSWA 4F4JA 3CRMA 1SVIA 3TK1A 5F9FA 2WJYA 1R7RA 1DTSA 4G5QA 1II8A 2GAOA 5JCPA 3EZ9A 4DB2A 3B13B 3KJGA 4HZUA 4AYTA 1Z07A 2D2EA 4TL7A 4ERNA 2NGRA 4GZLA 6Q21A 5J4VA 3QUSA 4LC1A 4UJ3A 2WAXA 5AJYA 2IYLD 1VIYA 4EFMA 3SQWA 3PUYA 3B9QA 2ECKA 1Q3HA 1R4AA 3TNFA 1I2MA 4BFSA 1PV4A 2PT5A 4KFTA 1W1WA 5CB8A 1JECA 1ETUA 2QMHA 2YVUA 1EK0A 1N5JA 3MWLA 2J41A 2PZGA 3LW7A 4JT2A 2XJ4A 3EPHA 4YC7A 1UFQA 3AVWA 2FNAA 3SHWA 5DNYB 2RGBA 4KYUA 2ZI6A 4Q1AA 5FR2A 4F91B 2B7CA 3F0TA 4IHQA 1F2TA 5D3MA 5C4GB 1WP9A 1G8HA 1ZBDA 2ZXUA 2X8AA 1Q21A 4HB2A 4RJLA 1FUKA 1YHNA 4TSFA 1WRBA 1XEXB 2N1BA 2OBMA 4HAUA 2CCGA 1SQ5A 1D9ZA 2NG1A 2JJ8A 4ITRC 4PSVA 4GMXA 4CEHB 1VG8A 1G4UR 2E87A 2ZPTX 3TIFA 1ZM3A 2EU8A 4TMVA 4Q03A 3PUWA 1F2UA 1T91A 2V6IA 4J0QA 1EX6A 3DEFA 2QQ0A 2VEDA 4XSHA 5CM8B 5FL7D 4B3FX 4Q1FA 8OHMA 1RKBA 5JRZA 2FPLA 1BOFA 1ESMA 1UBGA 1OLOA 3H86A 1XTJA 2ZI3A 3ZVRA 2PCLA 3T1OA 1FL9A 5FL3A 2P6UA 3U3JA 1S1CA 4OBEA 1E6CA 2YNMA 3R7WB 1EFRA 3F8TA 2D06A 4MH0R 5JEDA 2Q9CA 3BXZA 2JDIA 4FCTA 4DLSA 1ZJ6A 5L3SA 2GCOB 1NLZA 3EZ6A 2G1KA 1PJRA 4AG6A 1E2KA 3DZ8A 4TN1A 3KJIA 1S3GA 2EYUA 4MDEA 2IYZA 2QBYB 1TU4A 2FDCA 1COWD 1DAEA 3U5ZB 1FUUA 2UVQA 3FYHA 2RMKA 2Z4RA 3BFVA 2G9NA 2Z5FA 5F3WB 2PCJA 3P20A 4DDVA 3GLFB 1OH8A 1LS1A 1X86B 4X8LA 2QAGB 3IBGA 1E0KA 3SU8A 4ARZB 3NKVA 3UG7A 1KI8A 4DUGA 1UDXA 4MDFA 3OIVA 2CL7X 4PO8A 1OHHD 1XMJA 1LTQA 1VECA 2GNOA 2EQBA 4LDJA 3IDQA 1RE0A 2PX3A 4TLCA 3UK6A 1OXUA 3UATA 4DHEA 3EA0A 3GLHE 4QJ5A 4CT4B 3SJAA 1IHUA 2GEVA 2R2AA 3KQUA 1XTSA 4LV8B 1G8FA 2I3BA 2YINC 2CHQA 1KDRA 3U3RA 1RVDA 3BORA 3K70D 1MR3F 2C9CA 2V7QA 2X2FA 4FWIB 3ADCA 2AL7A 2CCKA 2IT1A 1M8PA 4JKIA 3HYRA 2JJ1D 4NE2A 2D3WA 3OIUA 2F3TA 5JMTA 2MSDB 1XPUA 1XNJA 2X1VA 4A92A 1H8EA 1Q44A 1TTTA 2HYIC 1XD8A 1JXOA 5HZKA 2RGNC 1OFHA 1KKMA 2XZPA 4B35A 1D6JA 1D2EA 2AWNA 5KDDA 1KI2A 1KAOA 1J8MF 4IOLA 4GDFA 1M74A 4GRAA 2CDNA 3K0SA 2X19A 3U60B 3A1TA 4LBZA 4GOXA 1KMHA 4EAQA 2XNSA 2CLCX 4JLMA 3IO3A 2J7PA 1E2LA 3ZZTA 2ZJBA 5EZ5A 3AVOA 3B1WA 2XTNA 2V1XA 4JL8A 1CJMA 1YZTA 2ZROA 4JVLA 5KSYA 2JIZD 1CJUC 2REBA 2AKYA 1NN0A 3AVYA 3CH5A 1UPTA 1WBBA 2OM2A 2BV3A 1YZKA 1MRNA 2EW1A 2PZEA 1BS1A 3NBZC 4AC9A 4LYAA 4A0GA 4PZLA 2ASEA 3CF2A 1TF2A 4LX0A 5KNCA 3CM0A 3R9XA 4OQFA 3DKVA 1XXHE 1H8HD 1ZU4A 5L3SB 3MAAC 2IUTA 2WWYA 4KI0A 5DSZA 2GWHA 5LDDC 4KBGA 4Q4AA 1LV7A 2VHUA 3OFND 4IDOA 3FB4A 4Q47A 4DCNA 1BMFA 3QKTA 4ACBA 4OI0A 4QNMA 1ZM7A 2WSSA 4C0QC 1J99A 1S2MA 2QTHA 2JDID 4F4CA 1KI3A 3NIBA 1SVKA 3GLIA 3IPYA 5IDVA 4MRNA 1ZAKA 3GJ7A 4LY6A 4Y0AA 1TU3A 2O5VA 2P65A 2OAP1 2JLSA 4GZMA 3SDZA 3PR1A 2QGZA 2VP9A 4U00A 2Z0MA 1SKYE 1E98A 2ZRDA 2ZRMA 4ZI3A 3RWOA 4HYYA 1BIFA 1TADA 2QT0A 3SN6A 1FQKA 3BBPA 1N0WA 2VPPA 4FINA 2QROA 1VCOA 3LW8A 5IT5A 1SVSA 1XD2A 3C16C 3LX5A 5GVSA 4AG5A 1WMSA 4OJKA 1FZQA 2FFQA 2ZSDA 4RD2A 3A8TA 4BFUA 5C2JB 5KOYA 4Q7MB 1XDBA 4MRSA 3A1VA 1Z0KA 4FIDA 3LBIA 4HSEA 5FBRB 4DSNA 4LJ7A 4E22A 5JLJA 5JCZA 5KDOA 5GJBA 4BFYA 4EPTA 1QHYA 4AIIA 4HZIA 1AS3A 1N6LA 1B0UA 1UKEA 2ZS9A 4R2HA 1D9XA 5FOTA 4IDQA 3TR0A 2VSOA 3RRZA 4QFMA 3FKSD 1XMIA 2Q9BA 4PO9A 1M7HA 3BB3A 3CPEA 5AJVB 3SYLA 3KKMA 1KI6B 4P32A 5GADl 1T3HA 1R5NA 1ZU5A 2YWFA 5KYKA 2V7QD 3S1AA 3A4MA 4PPQA 1BO6A 3VAAA 1OYWA 5H68A 4HAZA 4A2PA 2J0VA 3BRWD 1Q20A 1H8ED 4BZXA 2CCJA 1AJEA 2NPFA 1ODFA 3RSOA 1GSIA 4IEIA 1NL3A 3BC1A 4PAOA 3GLHA 1XEWY 1R8SA 1S9HA 2RGNA 3CB4A 3QKUA 4RD4A 2W0MA 3LXRA 4PZZA 3EZ2A 3OEEA 4LWZA 1W5SA 5K8UA 4UJ5A 4G1UC 4CEJA 3C7KA 3QOFA 1FTSA 2HEIA 5KPDA 3SBEA 5AWFC 2J7PD 3CZPA 2RAPA 4HAWA 3QF4B 2GZHA 2IC5A 3IQXA 1A5TA 2CMKA 2IK8A 3F3YA 1IN7A 5CLQA 4A4DA 1IN8A 2FSIA 3F5FA 4CDGA 4QM7A 5KO2A 2GJ9A 2WVJA 4BFWA 5B64A 2ERYA 4PPNA 2YOHA 3I5YA 2NQ2C 2CVHA 4MYHA 1Y3AA 1NN3A 2IEYA 4G5OA 4BEJA 1Z6TA 1IQPA 4CVNA 4Q9IA 4XVUA 1E4YA 2IS2A 3CX8A 1Z47A 2GJAA 2ZANA 4M8NE 4ON9A 3TH5A 2PLRA 2B8TA 2YWHA 2GBLC 2ZETA 2F1JA 4GOKA 1W48A 1KNXA 1E2HA 1VYUA 1DAHA 3B1ZA 2FN4A 3IIJA 1EFCA 3FMFA 1ZCBA 1SHKA 3L0PA 1N2CE 1MO5A 3CKLA 1OIVA 3BS4A 2PMDA 4UXIA 5G41A 4KLZA 2AD5A 3X1XA 3EWAA 2WSSD 1P9NA 3X2SA 5LD2B 3CONA 1P2SA 1QHIA 4EJSB 1RJ9B 4FMDF 4BE7B 2VSFA 5E4FA 3AP3A 2MSEB 1Z0JA 4CGZA 3KB1A 5JZVA 2Q6TA 4U7DA 1ZIOA 3B1YA 2BM1A 1OXVA 2WJHA 2F55A 3B6EA 4QBIA 3AF2A 4QBHA 4URWR 1HYQA 3OEHD 4IKEA 3EG5A 1DVRA 3RSLA 2O8DB 2AKAB 3RAPR 4QGFA 1HE1C 2HF8A 1QVRA 2VA8A 2OCAA 3DMDA 4NCKA 3SS8A 3DZDA 2PH1A 5DLQC 3T61A 4M21A 2H1LA 4P4SB 4Q19A 5EP3A 3PV0A 4ZDWA 4DLZA 1E9EA 3BB1A 2QMOA 1SVWA 2ZR7A 3KZ1E 1CRPA 3HR8A 1KK2A 2R9VA 1ZUHA 2OT3B 4JBXA 4ZO4A 4FN5A 1U0HC 3GLHB 4BFVA 4WVFA 3I4LA 4LHZA 4Q48A 5KDLA 1P73A 4BPBA 3CPHA 3FVQA 4XWAA 3L82B 5JI3E 1ZM2A 3DHWC 1QHHA 1DS6A 2AHOA 3UWKA 2WMOB 5EZ6B 3V4FA 5JS7A 3RS4A 2O8EA 4LPKA 5SZKB 2ZRCA 1D8TA 1SGWA 4Q9LA 3NHBA 2BCGY 5KU1A 4MGYR 5HE9A 3SOPA 2B6HA 4R71A 5AUQA 1GG2A 3BD9A 4QM6A 2DYKA 3OEED 4Z8YA 2JLRA 3PEVA 1TQDA 3THWB 4O25A 4FMBB 1U8AA 5J4HA 4KCGA 1MO6A 3P4XA 1RC8A 1XZPA 2IYTA 3MCAA 2ZEJA 5HE8A 2IHBA 2XTMA 5EXSA 3WRYC 3ZVNA 1AIPA 2C99A 5TVKA 1AGRA 1OH7A 2ZE8A 2W00A 4JSTA 1US8B 1P62B 4OKSA 5JJLA 3Q85A 1OW3B 2BBTA 2KE5A 3IGFA 3TUIC 4AKGA 1KZGB 3MRSA 4PC2A 5DH9A 1UADA 5E7IA 3AM1A 3FDIA 3CW2A 1GAJA 2BOVA 3U4QB 4Q66C 1E9BA 4RFSA 1VYVA 3MFYA 2KJQA 3DM9B 2J0UA 4PC1A 3TVDA 4PSKA 2IXGA 3HPRA 4XOIA 4ASUA 3K1JA 2J7KA 2WKRA 1NSTA 1TPZA 2GBLA 5ANRB 3IIMA 1XXHB 3ASYA 3CNNA 2GJSA 1AZSC 5TMPA 3K9NA 3D31A 4PQYA 2EVWX 4C0HA 1U94A 3D7MA 2NOAA 4D4LA 4DRZA 2ATVA 1JI0A 2GEUA 2GVZC 3U7EB 1UBEA 1E4VA 2IYWA 1VYTA 1DELA 3ND8A 4NYJQ 4M2LA 3GLGE 1OKKA 2A78A 3HU1A 4RFVA 2ZM5A 1XX6A 2CLSA 1TF5A 2V6JA 2R6FA 3CH4B 5L3VA 4FI3C 1U99A 2GCNA 5GJCA 1G7TA 4JLDA 4A1FA 3T5DA 1GNRA 3LH5A 4TTPA 3A6PC 1Z63A 3DM5A 5BQ5A 2R8RA 3NBYC 4TYWA 4FMDB 4ZCMA 3K70C 1SKYB 2IHYA 2W2XA 2QPOA 1S4QA 1GKUB 1Z2AA 2YOGA 3NEYA 4LYJA 1TQ2A 4NZYA 2C2HA 2JCSA 2O0JA 5G40A 1YZNA 4PHHA 1SVMA 5FBLB 1TMKA 1NVXQ 2H17A 2Z6VA 3C8UA 3KKQA 2FA9A 5KSOA 2O0HA 2YJTD 2VHQA 3M1IA 1A7JA 3SNHA 5E7MA 5AJXA 3I32A 3MUFA 1HT2E 4TZ6A 2EFHB 1ZD9A 1GNQA 1RYFA 3R9IA 1MO4A 3DL0A 2R65A 5JWRA 2BJVA 1E32A 4Z51A 4MITA 4D6PA 1NY5A 1TUIA 2BEJA 4LJ8A 1N6KA 2WJGA 2GXAA 3ICEA 3TUZC 5AJZA 3FMPB 2LKDA 4ILEA 1IY2A 1JAIA 4A9AA 4RZ3A 3IEUA 2FE4A 1A2BA 4C4PA 3O8BA 2P0EA 2ZYTX 4PFSA 1MABA 3PEWA 1VDZA 4Z1MA 2ZJOA 4JYCA 4LGMA 4V0LA 4D25A 1UKZA 2GZAA 3THOA 4FCWA 2FWRA 1V5WA 4YLGA 4Q4HB 1U9IA 1QHNA 3SJCA 2VL7A 3H0KA 3MMPA 3QE0A 3AF1A 3HPQA 3SJBA 1N5KA 2IW3A 4MYTA 1NN1A 1W0JA 2ZE5A 3JZAA 5FL7A 3I8SA 1D2NA 1A2KC 2D62A 1CF4A 2JLUA 5DGXA 4JL5A 2J0UB 3EAQA 3I8XA 1F5NA 5TV2A 4URVR 1YRBA 4BWYA 4D4MA 4DLWA 1IY1A 2DWPA 1SXJD 5JSZB 2EFGA 3QEJA 4IDHA 4B44A 2ZRJA 2WWGA 3K09A 3KTAA 3H4MA 4DT1A 3N2IA 1VG1A 4Q7KA 4MQBA 1DAKA 1QG4A 3QNUA 1OFIA 3T1VA 1ZUNB 1SVOA 4C7OA 4UNSA 5E7JA 2QTVB 5BW8A 5P21A 5EP2A 2DB3A 5FUYA 2F43A 4TL8A 4LHYA 3RANA 4B3DA 1CR4A 1NVUQ 2PMKA 4W5JA 1SULA 1Z3IX 3TSOA 1VHLA 5CK5A 5EXXA 2IF0A 4WZ6A 4MGKR 3R8CA 3SE0A 2XXAB 3K9HA 1I4LD 1JEEA 2QQEA 1GRNA 3ECCA 1OPXA 5TB5A 4QKQA 1PZNA 4IOKA 4XVQA 1Q0UA 1KNQA 2GCPA 3LVRE 4OI2A 5LBIA 2A5DA 1QBKC 1OKKD 3H1TA 1QRAA 4WIAA 3NDPA 3T1QA 4TT3D 5KPJA 3AVUA 1OHHA 3N70A 5FUXA 3CPJB 2Q3FA 2W0SA 4LJ4A 4TLAA 1DBSA 3MSXA 1GOTA 2IYYA 1E79A 2QRNA 3SHFA 3VU9B 3U6BA 1O3YA 4PHFA 4IW3B 4RD0A 1FPMA 2HV8A 2RGAA 5FPHA 4BLQA 4DXAA 3ZQJA 4B71A 1Z83A 1RRGA 2O52A 3C5HA 4OHWA 2F1RA 2H57A 4DDWA 5HZHA 3NWJA 1F60A 5A5GA 2LKCA 3GLGA 4KU4A 2OHFA 3R20A 4M9XA 2V3CC 2JJ1A 4A8JB 5FOVA 3O8CA 2VTKA 5K8IA 4AKHA 2XNDD 1ZRHA 4JKYA 3AF3A 1W4CA 2F7SA 2OAQ1 1T8TA 3OAAD 4IXMA 4N0EA 3WBJA 2NZ8A 2ZS8A 4EQ6B 2WSMA 1XMSA 2QPAA 3FMIA 4IFBA 5ELXA 3K0CC 4DZZA 1VHTA 2PBRA 4RY2A 4KLNA 4Z54A 4D0GA 1RW4A 3QXJA 2D2FA 1E2QA 1AA9A 1UBFA 4BLRA 3THYA 2VO1A 4MA4A 1Z08A 2JIZA 3P27A 3I5XA 2ZAOA 2J46A 2W6IA 2BVNA 2IL1A 1E0AA 3ZS9A 1EWRA 4Z1MD 4PC3A 4A6XA 1U2RA 1NIJA 4LZZA 2IA5A 3VHXA 1MV5A 2ANCA 1XF9A 2ZE7A 1G7SA 1O87A 1KSGA 3VR1A 2J0SA 4LBYA 3FFBA 3GLIE 5FTLA 2BMFA 5EE3A 1H8HA 4QHSA 5HCIA 1W0JD 3Q5DA 1JAHA 3CRQA 5DIFA 2JLYA 2WOJA 5L3QA 2V54A 3ZGXA 5JECA 5EE0A 3PENA 2DFNA 3AGQA 3OFNA 3KQNA 1WE2A 4KAXA 2F6RA 3TLXA 3AVXA 1T3LA 2NMVA 1R10A 1IJFA 1NP6A 4LV5B 1I4DD 2I1VB 4LUCA 5EP4A 2ODEA 1W2HA 4DDUA 2XZOA 2FOLA 2QA5A 3U3KA 5JJKA 4LJ6A 4FMCF 2ZRNA 1NMYA 3U44A 3KFVA 4EFNA 1W7AA 4YXWD 2ZUBA 1KZ7B 3FWYA 4ZDIA 4W7SA 4N1AA 4TMXA 3PXGA 1F48A 1OH6A 1KJWA 2FF7A 2ZVQX 4B74A 2GDJA 3HDTA 1GRQA 1UEJA 2OG2A 1L4YA 4GP7A 3ZQ6A 2FZ4A 4HI0E 3GFOA 3NH9A 3RABA 1YZUA 2G0NA 1G3QA 4AYXA 1TAGA 3AVVA 1E0JA 4QGAA 2VH5R 2DY1A 2H5EA 4B48A 1N5LA 1U8YA 3K70B 1GKYA 1II8B 3EW9A 2I4IA 4HZUB 2C9YA 1MO3A 3GLGB 1QHGA 1E2GA 3JVUA 2DFKB 4CIDA 3UANA 1S9DA 1Q1ZA 1KJZA 1E79D 2P67A 3VR4A 1C9KA 2FH5B 3SC3A 2W58A 2C95A 2CK3D 2RGXA 1IJEA 1VPLA 1KGDA 3FKSA 3UWOA 4MYUA 3TW8B 1YU9A 4DSOA 4LHWA 4D82A 1XJCA 3SJZA 4DCSA 3WYFA 1M1YE 4TYQA 1TX4B 1OIXA 1E99A 2ZU6A 3ZD6A 2P3SA 3AEZA 3VMFA 4BZQA 2FG5A 2Z43A 4G3XA 3KUDA 1NG1A 3C15C 2CHVA 2NPIA 2ZJ8A 1R6BX 4FCVA 1G19A 2ZI5A 1F2TB 5D3MB 1EESA 4EPXA 3VKGA 1XPRA 2NTYC 3P1JA 1KIMA 1GIAA 1TNDA 3VR6A 1CXZA 4FWTA 3EPJA 3K0CA 4LPSA 1EFTA 2X77A 1UAAA 1CU1A 2B21A 4NCNA 2BKUA 1PVOA 1W0KD 1NJGA 5L3RA 1C4OA 5B30A 5C4MA 1M34E 1XCPA 1OF1A 1HT1E 1YKSA 4OQNA 1N3BA 1T9HA 3T5GA 4HUQA 2EFDB 5H8WA 1KO5A 3SR0A 4I1OA 2C9OA 1IXRC 1L7VC 2HXYA 4M0LA 5CDFA 1F2UB 2W6ID 3K9LA 4AWXA 3FHOA 5HKKA 3NC0C 3R8FA 3IIKA 3QSYA 4PHTA 1NIPA 2A5JA 5HPYB 2IXFA 1UKVY 3Q8XB 2KBEA 2OV2A 3HJNA 1NF3A 1G9XA 3HU3A 1Z6XA 2VP5A 3AKEA 4NMMA 4UNNA 1KI7A 1W4BA 4HLQB 5B58C 2ORIA 3VR3A 1RFLA 4YMSA 3WNBA 4D80A 4URXR 2YC4C 1OB5A 4LC0A 5JWHA 5HCNA 1V43A 2XAUA 4HAYA 4UNQA 3LO5A 4M9SA 1P7CA 2WWHA 1KY3A 2Q3HA 1OV4A 1LS6A 1TQ4A 1WXQA 1Y63A 4HLDA 1XTRA 1JQLB 1AN0A 2ZI7A 2OXCA 5K8LA 3I61A 4G0NA 4II7A 2ZRFA 1X1RA 3KB2A 5JHHB 1DAMA 2F9LA 4Q4JA 4LJ5A 1G6HA 1DO0A 2OFWA 1NKTA 3AF4A 5JS8A 3ZS8A 2BCJQ 3O8RA 4PO1A 4BRUA 2DR3A 1VCMA 4V0NA 3RC8A 2HJVA 2CLDX 4JIMA 1CEEA 2ODWA 2ZR0A 2QZ4A 2GESA 2XEXA 1YR7A 3EZFA 2OFXA 2QUZA 5LB4A 5AUNB 3E70C 5F9HA 1DADA 4GT1A 4P4TA 5C1BA 4FMCB 3BIFA 5KNDA 1W36B 5GVRA 1ZD1A 1JNYA 3OEHA 4ZI2A 4BLTA 5C46F 1UF9A 1CJKC 3U7GA 1KI9A 3K9GA 4IDPA 2XX3A 2G3YA 1DG1G 3PUZA 4E5UA 2GK7A 3AKCA 2BMEA 2Q21A 3G0HA 1MKYA 4TTQA 3LX8A 2FGJA 1N0UA 4B3XA 3AP2A 1UJ2A 1NY6A 1PUJA 2XITA 3MLEA 4JYBA 1KI1A 3QKRA 4KBFA 1T8UA 2V8OA 3EIQA 3REGA 1G7RA 3T06B 3O47A 1DE0A 4NYMQ 4KXFB 2WKQA 1EX7A 1EGAA 1VCNA 2BIFA 1X6VA 4PPGA 2ATXA 3B60A 2IS6A 2P6NA 3LRPA 3ND9A 1JALA 3TUJC 5EP1A 1OXTA 2WBLC 1ZYUA 2VF8A 5DHFA 1EXMA 2TMKA 4HAVA 2J5XA 1KMHB 4EDHA 4KITB 3RS2A 3L0OA 4NYJR 2FFHA 3B9PA 2RH5A 1SXJE 4IVPA 1J7KA 4U5XA 3AQ4A 4Q9KA 1G8YA 5H70A 1T6NA 4DWJA 4ABYA 1E69A 5DYGA 3MG9A 1T5IA 1G8GA 3PCRB 1N5IA 3NBXX 3KJHA 3BOSA 5BYKA 1YZQA 1Q57A 1TQ6A 4LCBA 1G18A 4BUJA 1J70A 1YZLA 4DIEA 1P2UA 2W6JD 1BH2A 2ZUDA 1SXJC 3CWQA 4DLRA 1G5PA 2YC2C 4K46A 3PVSA 1ZNYA 3U7HB 3SBDA 1KO8A 4O2LA 4I99A 1XU4A 5HKKD 4CZ2A 4LI0A 3FPAA 3WYGA 2ZRPA 4O0MA 1G3UA 4Q4AB 1KHTA 2RCNA 3AVTA 2GTPA 3VKWA 3UIEA 4DKXA 2DPXA 2IUUA 4RKFA 1P9WA 1N6PA 1QF9A 2FEMA 5E3HA 4DDTA 3NH6A 1JJVA 2C04A 3G5UA 3MJHA 4GPTA 4KHZA 2AFIE 1CULC 3OESA 4G5GA 4Z8XA 4RKEA 4BFZA 2OLKA 4QL3A 5LB2A 4B6EA 4LK2A 1S0UA 2CE2X 1NNEA 3L8YA 4UQOA 3WMEA 1G16A 3GLIB 3SFVA 3ZDQA 4P33A 3TRFA 4PAQA 1DAFA 2VF7A 5FPYA 3QY0A 4JLOA 1E96A 1JBKA 3CRRA 4F92B 2O8CA 1AK2A 4AKIA 4D0NA 1IAQA 3DOEA 2PLFA 4BGDA 2HF9A 5DE3A 2GJKA 1IN4A 1XD2B 4ZCLA 1AKYA 1P2TA 3VR5A 4OK6A 621PA 1OB2A 3KDSE 2CEAA 1GDDA 3WP0A 2CL0X 1Z6GA 2C78A 2JGNA 4ZIRA 1CJTC 1C1YA 1SVLA 1ELOA 5EUQB 2GXUA 3VNUA 5FBQB 2DBYA 2GHIA 4JLPA 2ZJZA 2OFOA 1FTNA 1NSFA 4B34A 4B76A 4DCTA 1DEKA 4YMTA 2I1QA 1KOFA 4Q18A 3ZJYA 2FGKA 3EIHA 1P5ZB 4BQSA 4OL0A 1WQ1R 2C8VA 3Q3JB 3ZH9B 1JR6A 1KSFX 2VYFA 2ZRLA 3IHWA 5FBVB 1KY2A 4BLOA 5G3YA 4JJKA 3W6PA 4U02A 1H65A 2A9KA 4JVSB 2IYUA 1HQCA 4OI4A 4R2IA 1FX0A 4PR0A 1DAGA 3LY5A 3S1AB 5CYPA 3WY9A 2VP4A 4EKDA 1ZMXA 4H1VA 3FHCB 3ZLJA 3CO5A 4G5SA 2KSQA 2ODNA 4CW7A 2AK3A 3UG6A 1AKEA 3I3SR 1BYIA 4PQFA 2FMXA 4RZUA 3TKLA 3IEVA 4YDSA 4NH0A 4ZKDA 4DEYA 3QPUA 2IYXA 1YR8A 4G01B 1R5OA 2WIAA 3QG5A 4KJZA 4FD2A 4NPHA 5A0FA 4O2RA 2CXXA 4TL6A 5TARA 5E95A 4EUNA 4CEJB 3LDAA 2ZSAA 1UDWA 5J4LA 1W5TA 3EC1A 4IVRA 4CT5A 2AD1A 3I72A 4TMWA 3EARA 1R0YA 1S3SA 1U9IC 1HURA 4PSAA 2A7QA 2WV9A 1E2NA 1Z8FA 1E2MA 1T4GA 3CF0A 2Q9AA 5CK4A 2C77A 2JLXA 3NC1C 1Z5ZA 2XB4A 3K0FA 4WBSA 3TE6A 1HEIA 5IK2D 3ADDA 2WZQA 3D6TB 2GA8A 4TLEA 4B73A 2G77B 3OIYA 1QZXA 5B2ZA 1Q1EA 1W49A 4AKEA 5EJEA 4O3MA 1ZM4A 2MMCA 3ZIAD 3BERA 1CP2A 4JLAA 1G5TA 1GKIA 1SXJA 3K09C 4WZAE 3PG5A 2V4ZA 4B2IA 2AWOA 5D3QA 4KYIB 1QHXA 3Q7QA 4HLCA 1AS2A 1WA5A 2PX0A 3QVVA 3LXXA 4CEIA 4L4UA 2B92A 2P5SA 3EXAA 4B3CA 1OJLA 2ZR9A 3VTKA 1QVAA 3A58B 4Q7LA 2O8CB 3ASZA 1R2QA 3QPWA 1NMXA 2J45A 4HB0A 4LBWA 2R44A 3ZVMA 4X8HA 1G291 4XWOA 2J1LA 1HA3A 2WM9B 3NHAA 3KXIA 2GILA 4X8OA 4KO8A 1QHSA 3TGPA 1LF5A 4OQXA 4WOPA 3CZQA 4ZCIA 3EPLA 4IJMA 4NTZA 1P3JA 1DOAA 3AB3A 3AKYA 1JPJA 4HB3A 2QNRA 3V9PA 3W90A 4A0RA 4TT3A 3GPLA 2HLDD 3A1WA 3N2EA 5F2EA 5JHGB 1KYIA 5JBQA 3KXKA 3QI2A 3FOZA 3T15A 1VIAA 2FFBA 4GP6A 5EUMA 4M9ZA 1W46A 1T5LA 1TEXA 3IO5A 3BFXA 2ZYUX 1VG9B 3LQRA 1P75A 2K5UA 3T1TA 2RB4A 3FFAA 3MGCA 3RRMA 3ZVLA 3RHFA 5CB6A 1YVDA 3VKHA 5KTYA 3TR5A 5FOUA 3AUXA 2ZJ2A 3T35A 5C18A 3V4RA 2BMJA 4POAA 4A6PA 4XWKA 2ZI9A 4AD8A 4HATA 2BJWA 2DWOA 2G1JA 2CJWA 2P5TB 1XD9A 3L0SA 1EFHA 2XGJA 3IHLA 3HU2A 1G5RA 2G6BA 2XNDA 4QC2A 3PUXA 4IEEA 4FW9A 4AK9A 4DLYA 2RGDA 4UXHA 2QAGC 3UMSA 3OAAA 4C9BA 4N3NA 1XPOA 2DHRA 1Q3TA 2P6RA 1QHHB 1HQYE 5GJWC 2IYQA 1PLLA 2O8EB 2OE2A 3P32A 1M2OB 1IY0A 4PC6A 4WW0A 1E0SA 1E9CA 2QE7A 5F98A 5DHAA 3CIOA 4AI6A 2XZLA 3GJXC 1BKDR 2QEQA 3GJ0A 3GJ3A 4NKRA 2ZU0C 3RRYA 2GETA 4KFUA 1CJVC 3SFZA 4H9GA 4Q9HA 2FU5C 3AV0B 3EC2A 4C0LA 2EFCB 1ZUIA 3BB4A 3L43A 5KUTA 4DCVA 3T34A 2GRJA 1SXJB 4QJ4A 4C3ZA 4P3YA 3A4NA 4MKGA 1G41A 3H2YA 2A2ZA 4HEJA 2Q0HA 1Z6YA 4B3GA 4TL9A 2GF9A 1KDPA 1YE8A 2JATA 4CEIB 1ZIPA 4MRRA 4RFSB 2BBSA 4DBLC 1CTQA 4M1WA 3X1WA 3AUYA 4PANA 3SYNA 1J90A 4B2LA 4MGZR 3CNLA 3GFTA 2CVFA 1Z29A 1Z0IA 4BFXA 3EASA 1P6XA 2XSZD 3BH0A 5SZHB 5M04A 3QG1A 2QTFA 3CNOA 2OBLA 1SZPA 2VSXA 3W34A 1SHZA 4TQ9A 4NYIQ 2ZQ5A 2ZVPX 4YXWA 2ODBA 3K8YA 4L16A 4LRWA 4NONA 2UZ3A 5BXQC 4NU0A 1L8QA 4WXRA 3OF5A 3AP1A 2JJ2A 1CR2A 2REOA 2WIBA 2GK6A 3M6AA 2Z83A 2WWWA 1CKEA 2OESA 5CIQA 2IX3A 4ESHA 2B8WA 2IUSA 3LQQA 5LPNA 4Q7JB 3THXA 3TBKA 4ACAA 1JB1A 2WPDD 3JVVA 3EX7C 3GMTA 3M4YA 821PA 1Z22A 4EFLA 2WWFA 4QHTA 1ZVQA 3BFKA 2BEKA 3LLMA 4NCIA 4P0TA 5UKDA 3R7WA 5SZJA 4V0KA 1DG3A 3GJ6A 2CK3A 4ZKEA 4A82A 3KJEA 2GCOA 5EXPA 1EFUA 3WP1B 4B47A 1CBUA 2VP2A 2ZSFA 2O8BA 2R6CA 4QNRA 4R9UC 4C0AC 1G3RA 1HUQA 3UKDA 2OCBA 2RHMA 2FJUA 3CX6A 1E1RA 1OH5A 2QBYA 1G21E 3DKPA 4MRPA 4A2WA 4M9QA 4V0OA 4JBYA 4EPYA 1FP7A 1WDTA 5KSZA 1N6IA 1CIPA 2PL3A 5CDFE 5HR5A 4CRWB 1T3SA 2FSFA 3GLFA 1KDTA 3BH7A 1FQJA 3B85A 1NLFA 1P61B 1Q1BA 2QAGA 1IM2A 5IRCD 5BWMA 1II9A 1MABB 4I1UA 4ARZA 2FPKA 2GZDA 4NL4H 2P2LA 3QPVA 3NG1A 1RZ3A 2WJIA 4F38A 1JPNA 4CYMA 3PJRA 3BE4A 2QE7D 3RS5A 3OHMA 4CF7A 1W0KA 4ZDKA 2JA1A 1MH1A 5EE1A 1FOEB 4WZBE 2GKSA 4L9WA 1ZNZA 2CNWD 4MKFA 3BGWA 3FKQA 2HT6A 4UXJA 1TL7C 1GTVA 2JEOA 3RNLA 1ONBA 1U0LA 2AXNA 4Q1DA 4OJQA 1ZNWA 3HWSA 1A4RA 2ZRBA 4I4LA 4JLKA 2BBWA 2PZFA 2NZJA 4E09A 3MWYW 3KTAB 4R98A 4RD3A 3VR2A 3W5IA 4DT1B 1DO2A 1OXSC 4MUAA 2CHGA 4NYMR 3E5HA 3BWDD 5FBWB 4C0KA 1FFHA 1G3MA 4K81B 4IDNA 4QOSA 3QENA 4C7OB 2Z4SA 3U61B 4URYR 1ZNXA 4DLVA 2J0QA 1CR0A 2REXB 2H92A 2L0XA 5CM9C 4BZPA 4LJYA 4YQFA 2F43B 1AM4D 3U6KA 5FTMA 4BEBA 1XCGB 1X3SA 4V03A 4XJXA 221PA 5B57C 4C0JA 2PJRA 2FFAA 5SZIA 2OSBA 4LBVA 3NEJA 1Z6AA 2QSYA 4DSTA 4KSCA 4B32A 4L5BA 4V02A 3W9YA 4A2QA 3L0IB 1JR3D 3THXB 1WCV1 3RDPA 4AY2A 3CLVA 4Q21A 3EIEA 1W4RA 2LWIA 4DSUA 5DI9A 2ZITA 121PA 2C98A 4OQMA 2F1HA 1KKLA 3RS3A 1RPZA 1P9RA 3QXCA 4TYNA 2JJ2D 4M1SA 1L2TA 2RGEA 2FSGA 5BN4A 4QJ3A 1Z28A 2N42A 4EIWA 1KAGA 3AVQA 4GFDA 4WAUA 2O8BB 1KMQA 4D2IA 4GL2A 1NJFA 1RYHA 2XJ9A 1X8KA 1UEIA 4M1KA 1X1SA 5FI1B 2EWWA 1U0JA 1G17A 2OXRA 4JT4A 2GJ8A 4OK3A 2YZ2A 1G1MA 1N25A 2OCYC 4TLDA 5LD2C 2V9PA 2GXQA 4EJSC 3IUYA 3B2EA 3C4JA 4V0MA 521PA 2QSZA 1NBMD 1N0VC 2QMUA 1ZINA 2VQSA 4QHYA 4XVRA 3U3OA 2QENA 3RVBA 1X8LA 3KKOA 5JJIA 4QG7A 3DVLA 4IOJA 4QRHA 1E1RD 5CJ2A 1J2JA 1WB9A 4MYCA 3Q72A 3LBNA 3WNCA 1U8ZA 2W2VA 2FEOA 4C2TA 3THYB 1R0ZA 3QBTA 3RLFA 2R6GA 2Q3MA 1NI3A 2B7BA 4HB4A 1F6BA 3K0EA 3TAUA 3EPKA 5KNBA 1RRFA 2HDNB 5IHPA 1FMLA 1XZQA 4GI7A 4D4KA 4QGHA 3J81k 1GL6A 3WRXC 2IBMA 1AQYA 4M53A 4US2R 4EPRA 2ZRAA 4G5RA 2F9MA 2QPTA 4JVNA 2W6JA 4PPFA 3CRW1 2WHXA 1KO4A 3QIAA 5AJWA 3TJZA 2QRZA 1EWQA 4L9SA 3TQCA 1AQUA 1DPFA 1CLUA 2WOOA 3W5JA 4DCUA 1W2GA 3E2IA 3B5JA 5FPKA 5H1YA 5L3QB 2BBOA 1KI6A 3DDCA 4MKIA 3TQFA 4WXPA 3C41J 4Q4LA 3WYAA 3D3QA 3CWZA 1PUIA 4TQAA 2HJGA
chains in the Genus database with same CATH superfamily
3AW9A 2I1LA 4FDTA 3AHEA 4D8WA 5KQRA 3TLKA 4NBSA 1C9EA 2JAUA 3AK4A 4R7GA 4D9BA 1HV8A 3VR2D 4BCCA 1U28C 3UJ7A 3RO7A 2O3SA 3RLIA 1OGJA 5FX2A 1XJ5A 4U0KA 4DV6B 2ZRKA 5SYMA 1E3MA 4FCCA 3ANXA 2XMSA 1IRXA 4QEKA 3AZQA 4NS4A 4R1MA 2JLZA 3ZKWA 4EI7A 4OKNA 2R1ZA 5HKOA 3FPFA 3HCNA 4UHFA 1R16A 4XIYA 4DCCA 3ELUA 1R0WA 2Q7OE 3WIBA 3PC8A 4RY8A 5HF8A 3ZE6A 4CLOB 1WBDA 2JRLA 3CT6A 2IZ6A 4M0KA 3L4KA 2X3FA 4EPVA 1P60A 3VNVA 3IL2A 3OJ0A 3KKEA 3OWOA 1MT0A 4FK8A 2BGMA 3Q7RA 5AQ1A 1JHVA 5JT1A 5BVGA 1GG8A 3OHSX 1SQGA 1C30A 2KHZA 2ZE6A 2F3RA 1JBEA 3QF4A 4QGSA 5LP1A 4JWTA 3BMQA 3EVGA 5JAMA 5JZOA 4TXJA 1UPCA 5DO9A 4ZGWA 1CUZA 1JHYA 2PLNA 2ZRGA 1VKJA 2EL7A 1NR5A 4QXAA 5CNKA 2WABA 5E6RA 3H1FA 1ZKDA 4GQBA 5IH7A 1B6SA 2QSJA 4UBJA 4U6QA 3F3KA 1N7IA 1SEPA 3L8ZA 3O9VA 4R6WA 4WKBA 2FJ0A 4F04A 4ZHQB 2VJMB 1ACJA 4RZXA 5DYIA 1TCBA 2R8XA 2BC9A 3QA3E 1DKPA 5F5NA 3WKEA 5ALNA 1T0BA 2VT6A 4ER0A 4IDCA 5H3CA 3QEOA 3VVBA 2BFCA 3GZ4A 1EFRD 4INAA 5AM4A 3BAFA 1JSZA 3IJ5A 3ZZUA 4PGHA 2QY9A 1G0OA 1H2RS 3Q9UA 4IZIA 4F4IA 4QU0A 1A8IA 2WFZA 3N5CA 5JC1A 4PICA 4XIJA 4I3HA 3L0DA 1C9YA 1UM9B 3FZGA 4NNJA 3L7NA 3TB6A 4GI5A 3UAGA 5EE9A 1XMXA 2N0SA 1CG6A 3U0VA 1P1KA 1RCUA 4MHOA 4IWNA 4YGXB 2QRGA 4B3JA 4P36A 3BN3A 3MJVA 4ZCPA 4CL8A 5F7OA 1FRVA 3Q40A 1KKUA 4RA6B 4YONB 5IDYA 3T4UA 5BPHA 3VYUB 3PHCA 1MB9A 2XOXA 3X1DA 4F9GA 3L6DA 2FHSA 1FYVA 3JALB 1KPGA 1GUAA 3G59A 3IBYA 3PIRA 2QMQA 1R74A 3FSGA 1S96A 3VX4A 3DYVA 5EERA 3M83A 1TLTA 4IFEA 1NUTA 4ML3A 1QWSA 3SX4A 4YJ2F 5BN5A 2GEJA 4KR6A 4DUGD 1YXMA 2J59A 1K8ZB 1RIFA 4OO3A 4ZEVA 2UXBB 3K1TA 5KVCA 1NQWA 3FVWA 3VPCA 5C5CA 2C3OA 3QX7A 1FTYA 1K5DA 1PDOA 4IXNA 4LV6A 5CXSA 1G21B 3SZLA 3D1JA 1D2MA 3IBTA 1T0JB 4KE9A 5K3SA 4OAPA 4BQQA 4FB4A 5IDWA 1Y8QB 4GD3Q 5KCMA 1E9DA 3CF6R 4FLMA 4DTIA 4BRWA 2KYRA 2EF1A 1VP9A 4AN4A 2VQ6A 5HJ2A 2E4WA 3HYSA 1EA5A 1ISSA 1J4AA 2PHZA 3B8EA 3LVQE 2GGSA 1P4SA 5AHXA 3NYWA 4NHOA 1VE6A 4DVGA 1U3VA 5JZSA 4NCAA 1UKBA 1ZOSA 2JH9A 2XDQB 4PINA 5HGXA 5DTRA 3BTSA 3ADOA 2D2XA 3HR7A 5DTMA 3TMYA 3OPVA 1F14A 4JP2A 3JQ7A 4EGQA 3PQ7A 2V7UA 5FTKA 3FNHA 1GV1A 2PBZA 2B9VA 3IOYA 2IWRA 2Q1WA 4Q9NA 5FHQA 2ZYVX 1LGYA 4FOPA 4V3BA 3FTQA 2ZBVA 2J09A 3W7VA 3EDYA 3GD7A 5HTKA 2QI9F 3DS8A 4Y2JA 3TSAA 1P72A 1VKNA 2BWJA 4KV9A 4ABTA 2GVDC 3VSDA 1U2GA 2I7VA 5J40A 3BXPA 2I78A 1G64A 5KNBH 2DWQA 1N5RA 3PNPA 2PT6A 3K0AA 1PWXA 1ISMA 5G4LA 3UEOA 4DA6A 5G53C 5BVGB 3TINA 3BGOS 3TXYA 3UMVA 3WNVA 4Y9TA 4M46A 4PWZA 4DQUA 2NYAA 2HA2A 3B5EA 1LH0A 3IUQA 3TX6A 1YQTA 1SG6A 2ZUWA 2PN1A 3U4IA 4JQYA 3RC3A 1ZC4A 3GEHA 2EBHX 3P9PA 5GZ3A 3FCCA 2N46A 3ADBA 1UZUA 2J3QA 1E7WA 1H85A 3BL6A 1A4UA 2CJFA 2P69A 2PJZA 1KZHA 3THWA 3B1XA 1CVRA 4JGBA 3RUFA 4BVJA 4KXMA 4BVGA 2G0TA 4I81A 1Y5NA 4BLPA 2JLQA 2RGGA 4GI2A 2BGGA 1T15A 1VSBA 3I12A 2HLDA 4E46A 3KUUA 3LV8A 4FJ2A 4H6PA 5KYUA 3SK0A 4CMJA 1DJOA 5KX5B 3OU6A 1NA5A 2AMVA 4IWXA 1QYIA 1WXEA 1YRAA 2MMGA 1A8UA 1CRQA 3R0XA 4JBWA 5EQJB 5HUQA 5KJFA 1A1VA 1S1MA 2OKCA 4HS9A 5DK6A 2R0QC 3U7FB 1KSHA 1L5FA 3AFNA 2WNHA 3GAAA 1WETA 3SQXA 1UXJA 4U2BA 3PFIA 2EX1A 1VA5A 1M5UA 2OO5C 4GYKA 2WZDA 1F9EA 1A9SA 1KH1A 3WWOA 4BRSA 1NULA 2FV8A 3GLUA 4NDZA 3V7NA 4B3BA 4ZREA 1BN7A 3DBHA 5FOXA 3WHKA 3R2JA 1J8YF 1DFGA 2FQQA 2XXBA 2AFHE 2XDWA 3TOCA 3TZHA 5JBIA 3E5MA 1Q11A 1K9VF 1QP8A 3PNYA 4IJUA 4MV3A 4KXXA 1MOZA 3ZBUA 2DLCX 3GEIA 4CIXA 2OBFA 1S02A 1CUFA 3LNCA 2ZS7A 4HX2A 2I34A 4ALLA 4FYHA 3VDQA 5BN5B 3DXXA 2AJDA 4J0GA 3SR4A 4JP1A 1O08A 4NYIR 2V55B 3MWFA 3MPUA 5DBIA 4OX9Y 3NTRA 1FW6A 1M83A 5IAAA 4TYYA 1MZVA 2M98A 3BK7A 3DVQX 3MS4A 1SWVA 1MA3A 3JQ8A 3N07A 3QHAA 5FTJA 3P0JA 4TGLA 2Q5OA 3OQJA 1BQ3A 1O0SA 4IAOA 2ZBFA 5DN6A 5C31A 5B4TA 1XB2A 1XVVA 3I0ZA 3VDMA 1B26A 3MD0A 1K0FA 4E4YA 1DMSA 4TZTA 1T8SA 5DB4A 3KYCA 2C5LA 3STTA 3R9WA 1SEVA 3H2BA 1Q0HA 2HYDA 1GPWB 1JN0A 1L4UA 1KY5A 3LUAA 3UXMA 5JW6A 1ESEA 3HYTA 4ILKA 2IH5A 4OHZA 2Q9UA 2HNBA 3IQGX 1EP1B 1UXHA 4EHFA 4YRCA 3WB9A 5AW8A 3C5CA 3DCYA 2R2GA 3DDHA 4UMDA 5I7VA 3DD1A 4R9VA 4BO1A 1HE5A 1JR3E 1OZGA 1XEWX 2IEZA 3G0IA 1G6KA 1N2JA 1U1CA 2UZ1B 4KGZA 3TPFA 3FBGA 4LFAB 4LZLA 1AK9A 3K0AB 4AN1A 4IINA 4C4OA 5DCUA 5JFGA 5DIZA 3ICVA 4MVJM 3RUIA 1G98A 1RAHA 4M0CA 4V0RA 3TL3A 4EG3A 5LWQA 3CUEF 1OBFO 2BGNA 4MVXA 3W9BA 5LXTA 1LVGA 5TS3A 4PSUA 4E4TA 3SEAA 4E3ZA 2XSZA 3PDCA 3INNA 3E9QA 5AW9A 1QNLA 1YJBA 3OZXA 3Q3VA 1RYZA 1DKLA 2Y66A 3WZMA 4C0BA 5JS2A 2IXAA 1ZCZA 2QE6A 2V1UA 2I7DA 3GJSA 1P1JA 4FZ5A 4JCCA 1TAHA 1HYHA 5AI9A 4LYHA 3OQNA 1XZGA 3AHIA 4UZEA 1H2ZA 2A3NA 4GO1A 3RK1A 1P9LA 4PS0A 4BBPA 3E9NA 1XRRA 1E2DA 4W5WA 1AKUA 3CR7A 1OE0A 1TD1A 2OENG 4I2VA 5KYUB 1DIAA 1EFKA 1ND6A 3BFJA 4RGBA 1CFJA 2YIMA 2FUKA 3JYOA 3LY7A 3N2NA 4MUBA 3WNQA 2MSWA 2W98A 4E51A 1E9RA 1I5OA 2XLCA 3BBLA 5FUWA 4ZIRB 4CKCA 5FH9A 2GHQA 2PQMA 3IAUA 3GZNA 4TXLA 1PF7E 4UDOA 5L6MB 1GPYA 3FIJA 1GPH1 1WXFA 1XKTA 2NM0A 1K8RA 1LPNA 1WXHA 4N6OA 3V8RA 3QF7A 1Q1QA 1N5OX 2DFLA 4P5EA 5CDHA 1K7YA 2NO7A 3D9QX 2Q1TA 1K6MA 2J87A 4YRTA 3TKAA 4HEA6 1MIHA 1KP9A 5L8VA 1L4FA 1Y3FE 3AEQB 2C7VA 1FYDA 2UAGA 2ZCUA 3BJZA 3RBXA 4BFLA 5LJIA 4D0LB 1XO1A 3LOQA 3WK8A 3FJ1A 4O1IA 3ZZ0A 1O97D 3VX3A 3ESAA 3LKZA 1VE3A 4KE7A 4W4TA 2ORWA 3M6MD 2NQTA 3I2KA 4ZOEA 1BGVA 2AOUB 2V5UA 2OB2A 1AGPA 1WP4A 3L8CA 5J4KA 4PHGA 4GBMA 2OWDA 5K0TA 4JB8A 4RD1A 3D8BA 3ZYZA 2FPGA 2PBFA 1NHGA 1U8EA 3WHLA 3OPYI 4GWLA 1RZVA 2BI7A 4MVCA 1E3WA 4B75A 4LF9B 5JARA 4MVJF 3C8ZA 4TZ0A 4IRUB 5B1EA 3ZUGA 3A2KA 1T9AA 3PDIB 4CQLA 3Q11A 3SF0A 5LZ4A 4I1VA 4PYLA 4Z0NA 5K3CA 2OUKA 5JTUA 4OI1A 3LWZA 5FWAA 3SYTA 5FPPA 4KIGA 1GPDG 5DHTA 3EULA 3EFEA 5JO0A 1MT3A 2XOEA 1OT5A 2IEBA 3QXHA 1F5SA 1H1LA 3SVLA 1N7JA 1EZ4A 3JYHA 5EJ4A 1RYMA 1C8BA 2Q3JA 3T7KA 3U3MA 2JFWA 3ETLA 3QBVA 5AR1A 3RYFB 2ZKLA 2RARA 2XYPA 3C1TA 3MLAA 2BSXA 1TKBA 1XJ0A 1XZCA 2PKQP 4JL6A 4OMCA 4Y0VA 3K8QA 3T7SA 3TQRA 5DN6D 4RIGA 3QHQA 3DL2A 5JSUA 2HK6A 2MSCB 4HDSA 4MUHA 5AK0A 3AH8A 4ZVQA 5G2OA 1X0XA 2OBBA 4KQFA 4J76A 3COSA 3Q3EA 2M1ZA 5JMOA 2O2IA 5LJLA 1LPSA 3BGVA 4L95C 2RCYA 1YDWA 4G2TA 4JLJA 2VHYA 2V7PA 1RI4A 1MJ5A 4LMBA 2IWHA 1WDLA 4AG3A 1BE8A 4KWTA 1Z7WA 2W83A 3RUEA 3USZA 4BNLA 4PX2A 1GPUA 1ZCAA 4UUAA 5IBQA 1O54A 2XVMA 1L7MA 5IJAA 4HNAA 1KK0A 1G4AE 1QH1B 3L84A 4I55A 4OLFA 4P98A 4WQMA 4AS1A 4EHLA 3E4DA 5FTNA 1NW8A 3T52A 1IEWA 5F7JA 4I9NA 1GITA 5AM5A 1N1DA 5EHZA 4M1TA 1PJBA 3KQSA 1FU8A 1N8TA 1IVYA 1Z16A 2C8JA 2VHTA 3ZCSA 1U1IA 2AN9A 3M1YA 1UOQA 1NBIA 1VMDA 4TZKA 5FKJA 3KE8A 5GM2A 2JAHA 4KSBA 3UJPA 2QV7A 2X2EA 4AS3A 1WUHS 4QUJA 4BU1A 5JRJA 5JXIA 1X7YB 5U9CA 1J1UA 5IDXA 3V42A 2P6MA 1KO1A 1NQUA 5FOSA 4D7AA 4ZGGA 3MCTA 5F2NA 4KFSA 2WVAA 2HRZA 2R6AA 4ZVNA 5CM2Z 1WCIA 3W8EA 3KFXA 2O2CA 4D9MA 1DT3A 3FVTA 1HTBA 4A1OA 4ALNA 1RQPA 3IMCA 2VS1A 1CY1A 2R62A 2BR5A 4FYWA 2OILA 5CB4B 1NVWQ 3IILA 3O7MA 3GDHA 4K6KA 5JAOA 3TLBA 2RBEA 1E2PA 3DG9A 2VIIA 1LI7A 2PSFA 1YJ5A 2I66A 4OGLA 2C2OA 4BKQA 5JEEA 2WUEA 4IILA 4BATA 1E77A 2H18A 2ZZKA 3CN7A 4PQRA 4V0ME 5J5CA 1UP7A 5IM5A 4EPWA 5HS4A 2FPPB 4ZK2A 3F3SA 1SC4A 3DHYA 3E1SA 4EI2A 3ANLA 2BDTA 2QP3A 5HRAA 3G7UA 3S28A 5SICE 4P4UA 4KIWA 4J9VA 3SFTA 2M32A 1RI2A 2XHEA 2YRFA 2D3TA 3ESCA 1NATA 5C1IA 2OM6A 3UMRA 1E60A 2WYUA 2A9RA 1JVNA 3NVAA 2IF2A 3L5KA 1ZICA 4X65B 2ZIXB 2OHOA 3JYLA 3UENA 3TZLA 3W04A 2WF6A 2I71A 3ANMA 2WYHA 2PU5A 5AJTA 2Q6OA 4U7TB 3MMNA 1YWGO 2KWIA 3A4LA 4ALIA 3MB8A 3TDNA 5ITWA 3PEYA 5A4DA 5B7GA 2P30A 4TWRA 1TEVA 3BCRA 3PS9A 4B4WA 4K9QA 1NVVR 2QT9A 1XCLA 3DAFA 5LLDA 1EFAA 2ZJ5A 1CY6A 1KI4A 3CPSA 4JXXA 3DPUA 4CWAA 1R18A 3CLKA 4WACA 4QFDA 3CLSD 4S1PA 1RJWA 4FFMA 1R0XA 4TWZA 3EWSA 3KZNA 3H1AA 2I62A 4P4GA 4FGSA 4NBNA 721PA 3OTIA 2YWEA 2V03A 2V7GA 4HDSB 2X7JA 2ZTMA 5JSYA 1RPNA 1K8YB 1N0HA 1LNZA 3HU5A 4BVEA 3HKBA 3CRMA 3LP5A 3TK1A 5F9FA 1R7RA 2JFNA 3HXLA 2JS7A 1G20A 4B85A 2VK2A 5JCPA 1K6EA 4HQNA 4HZUA 5I7UA 3S8EA 4AYTA 1RCFA 1VKRA 3NHWA 4ENRA 4TSRA 1LSSA 2OHVA 2R8ZA 1ZZEA 4RZQA 2CLHB 4MR9A 3KKKA 2FEKA 4N0PA 3VPFA 5AJYA 3E9YA 1VSTA 1TE2A 1XVUA 3H2IA 3IUNA 3DE7X 1QFXA 3QU2A 4EY7A 1QJCA 2UUOA 1F9AA 1K1EA 2IH2A 1XI2A 1JKIA 2VPZA 3F6EX 1Z4NA 3HGMA 4MIOA 4PR3A 4I55B 4AIRA 4DLLA 2C31A 2W2LD 1PV4A 2PT5A 3ZX5A 2XA1A 4JSRA 4L3WA 1L4MA 1W1WA 1KL7A 5FI5A 2BKVA 1TOAA 1CCWA 1V2HE 2Z1NA 4OIFA 2AZ4A 3U4GA 2J41A 3NTXA 4M76B 1QGUA 1ZCJA 2QN3A 2VKQA 1QYDA 5JXHA 3AVWA 1MC1A 5EMNA 3UOAB 2E7ZA 1YO6A 4X20A 5B1DA 1EUDB 4AZ3A 1UC5B 1NOKA 2BFEB 4KYUA 4Q1AA 3SEZA 3NGMA 3F0TA 3PL1A 1BE6A 3LFHA 3M4NA 3PC8C 2Q3BA 3I04M 5E9JA 1MHTA 1WY7A 5ERXA 1G8HA 1WCIB 5JG7A 5HIAA 2PZMA 2I3DA 2X8AA 2QUBA 4Y6GB 2PH7A 2VKTA 1PL7A 1YHNA 3JAKA 4N9WA 4RJLA 4BNDA 4HAUA 1BW9A 2CCGA 3ED1A 2X2OA 4QUIA 3H1BA 3NEAA 1J9ZA 3HGQA 2PZ8A 4GMXA 5LQAA 1LD3A 1IQ0A 1VG8A 5DM4A 1WB4A 1G4UR 1DO8A 2CVOA 2E87A 2ZPTX 3QUCA 4RVNA 4X71A 3TIFA 4LY3A 1UPAA 2EU8A 4YRKA 4BNFA 1SCJA 3RG8A 4WECA 1J33A 4FFOA 1F2UA 1T91A 2K4MA 3K8OE 4GS5A 4ZANA 5FL7D 1N2ZA 3UF0A 3VUFA 4RVSA 5F33A 4IL5A 5C32A 1RKBA 3WDKA 2B82A 8OHMA 3MUNA 4AJ9A 3QK7A 5HP4A 3B2QA 5FUBA 3H86A 1XTJA 2ZI3A 3ZVRA 3HJHA 3ZCTA 4GKAA 2J6IA 4X1YB 4D9HA 1B8UA 1RAIA 2B1JA 5FL3A 4Z4FA 3ROMA 3A70A 5ED0A 5HF5A 4OBEA 3P4UA 1KRXA 4R1NA 2OPHA 4MUKA 2D06A 5JEDA 3A1FA 5ENZA 4RMHA 1PR6A 3UVEA 2FI1A 3BXZA 4F3RA 4DLSA 3MA0A 2GYVA 2GCOB 1QIDA 4YLEA 5FYQA 1U6IA 3FAZA 1JNXX 4FGKA 1PJRA 5J23A 4DNPA 4C07A 2AHRA 2QRPA 3KJIA 3KR1A 3NBUA 3SEQA 3O03A 4XYGA 2JPDA 2C1XA 1SH7A 1X8XA 2DMRA 1ZMOA 1DBRA 2ES4A 2NT4A 3EF1A 4FX5A 4LDRA 3ZHZA 1L7PA 2FR0A 1A8SA 3U5ZB 1BJRE 3CUSA 1PL8A 1TIBA 2UVQA 3O83A 2NW6A 3L79A 2XNJA 4YJ3F 4ZYUA 3HUFA 1Y3CE 1E9VA 2W2PA 4LSZA 2G9NA 1Z62A 5DM0A 2WYVA 4DDVA 2QRVB 2IYFA 3SEFA 2QAGB 1AURA 2I4LA 1RD4A 1TKCA 5CG2A 1CV2A 3UA4A 1PO7A 1X7GA 3RIMA 1VLQA 4MDFA 1G20B 1ZLYA 2CL7X 2QD3A 1NNLA 4Y2QA 1OHHD 3SYRA 1QIGA 2I54A 1LTQA 1VECA 2GNOA 2IXDA 3DBVO 3R41A 4CL0A 5I8WA 4E7PA 5GADl 1RE0A 1T5TA 1NW6A 2ORYA 2PX3A 3D81A 4ZYTA 4FONA 5CFZA 2K87A 3C1OA 3PZRA 3Q12A 3EA0A 4F06A 3H9UA 3R6TA 4QJ5A 2Q5FA 3ZHOA 2EZTA 4RPKA 2OVFA 2GEVA 1XTSA 3K73O 2I3BA 5TE9A 1YRQA 3QEAZ 2CHQA 2VJKA 4L57A 2AIRA 3U3ZA 1RVDA 3BORA 3CSDA 3K70D 2CWDA 4G0WA 2JZOA 2G07A 2C9CA 3RF7A 5AHKA 4IKPA 2Q2VA 3UK0A 1G5FA 1T36A 2IELA 3OIUA 1C3EA 3ZOZA 4BWFB 1QTQA 1ZK2A 4B80A 1PDWA 2HPAA 5GP1A 3R0JA 3RB8A 1H8EA 3ZDBA 3HNRA 3TJMA 5HZKA 2RGNC 3FWKA 4ZP1A 2R85A 2DC1A 2H1FA 3IQFA 4DXDA 2XQKA 1D6JA 3HXPA 3OLQA 4O29A 4Q0MA 1YRLA 4B35A 2AWNA 2XYRA 1KI2A 2O5RA 1J8MF 1M2FA 1QRDA 3K9WA 4KAJA 1MB4A 3DZHA 4GRAA 3RFCA 2CDNA 1W52X 2BFAA 3HC7A 3A1TA 1U7TA 1W35A 5DOVA 4CMCA 2JGDA 1J20A 1BW9B 1TA0A 3OLZA 1MX1A 3IO3A 4PONA 4V39A 4YO8A 1NX9A 2OOSA 2R47A 2J7PA 2JIQA 1U0RA 1EBFA 3GAFA 3B1WA 3OIFA 4O4LA 4X3PA 3HZZA 4CLRA 2V1XA 3ZBQA 4HD8A 3WTCA 4PEVA 3QE4A 1MUUA 2FWPA 1HT3A 4JVLA 4LQCA 1UBJS 4ZAWA 5LA6A 2JIZD 3PZBA 2P79A 3HTXA 2GPWA 2BM9A 1E5LA 2FTKE 2G9UA 3GDGA 5F64A 3DL7A 2G9ZA 4MQFB 1KPHA 2F00A 4DADA 4LF7B 1RWOA 1ZJ4A 2EW1A 1GNSA 2L17A 4X1KB 5L53A 4GVLA 2I8LA 4LYAA 4A0GA 1BXRB 4MW5A 3U48A 4BMNA 4YUWA 1WQ4A 4HNHA 3CF2A 1TF2A 1JSRA 1B0PA 1SUSA 4MV4A 3VYTB 3CM0A 3R9XA 4RQTA 2XRZA 2B35A 3DKVA 5BN4B 1XXHE 4AY4A 3UB2A 3MAAC 2IUTA 2BKLA 1QFSA 3I9OA 2JFOA 1O97C 4DXHA 1O6CA 4I4NA 3MELA 3U1VA 3H5NA 4Q4AA 1LV7A 2VHUA 1FFGA 3OFND 4E7OA 4YV1A 3FB4A 3BE6A 4C7VA 4RTNA 4A5SA 1AO3A 3QKTA 1P4GA 1UXKA 3QELA 1PYGA 3RSFA 4C0QC 3PLAE 4N3GA 5BXYA 4MS1B 4MV9A 5IKMA 4EW6A 2ZBPA 3G1TA 1DQSA 2YS7A 4F4CA 1KI3A 2HDWA 2HU8A 3RBZA 1A7KA 3FTPA 1U3GA 1SMKA 3A1EA 3E53A 1R6TA 1ZH2A 3IUJA 4MRNA 3PHJA 4LY6A 4X95A 4Y0AA 4CMGA 4LTMA 1WL8A 5CLFA 4LWOA 4GZMA 4BGUA 1K06A 3OD5A 3NUQA 4H3KB 1GTMA 2Z0MA 4J0HA 4TM8A 1E98A 1XROA 3DAYA 4U00A 5HA5A 4B7ZA 2W8BB 5AHOA 3GDWA 4ZI3A 2QT0A 3AY0A 2RC5A 1Z39A 1Q84A 2VPPA 3I2HA 3EQ7A 2HPZA 1O6BA 2O1WA 1VCOA 3FYUB 1HNZB 4FKBA 1GEEA 4AY6A 2FUCA 5GVSA 3KXDA 5LOVA 4ZU3A 1LDMA 1NT2A 1M2EA 3MJEA 1NVTA 2JI9A 4RD2A 5DDIP 4RIFA 1BD4A 1DLIA 1AD2A 2RHTA 1WU8A 2VCHA 1VL0A 4MRSA 1CUCA 4NG5A 2Q07A 4OU5A 5ES3A 3ZCXA 1ZGAA 4HSEA 2WKWA 3BWEA 3LBIA 3QM1A 4RESA 4OSPA 4LJ7A 3SD7A 1Q1GA 4DSNA 3DULA 4E22A 5JLJA 3EGIA 3H4VA 2C4MA 1OWPA 3UFBA 4DLPA 2IVZA 1Z36A 3U31A 5FYDA 1CUEA 2HCTA 1IVSA 4R2HA 1FYWA 2EW8A 2GAIA 3O6VA 5FEMA 3A9VA 1M10A 1RXSA 1A4XA 2V58A 2VBFA 3GN2A 1FSFA 3RFTA 4Y3UA 3ZTTA 4JI3B 4K9KA 3NZEA 1AHPA 4PO9A 3GT0A 1O4VA 2YW2A 3CPEA 3C98A 3KKMA 1KI6B 2JFHA 3E1GA 4Y67A 3SYLA 5JNVA 3QRWA 3EA4A 2YWFA 3CX4A 1Z37A 2EP7A 4UHKA 3TLEA 1S5PA 4DA0A 1EX9A 2D2VA 3ICCA 3NM5A 5IBCA 3W4KA 5A04A 4QT0A 5I9NA 3ZR4B 4BLWA 3M8KA 4WKCA 5FLEX 2ISSD 5AHRA 1GQFA 1H8ED 1SK9A 3C3YA 1AJEA 1ODFA 4LYDA 1GSIA 1NL3A 4PAOA 3GEBA 4K1LA 1XEWY 1R8SA 3CB4A 4E1VA 2HZBA 3LXRA 4L4ZA 3OZSA 4N82A 5GOTA 2XT0A 3WZ2A 5REQB 3ROFA 1CYEA 3LUKA 4GECA 4LWZA 1PYOA 5K8UA 3EUFA 5K0EA 3C7KA 3QOFA 1XLUA 1M1YA 1E6UA 2J7PD 3I6IA 4F2DA 4N7BA 2EX0A 4JUDX 2RAPA 4KXQA 3IPRA 3MS2A 4EW2A 2GFIA 1XLTA 4X85A 3WNZA 3R9XB 4XQ0A 1ZI6A 1JKXA 2IK8A 3N6VA 5CLQA 4F8EA 1IN8A 4UTOA 2NXEA 4QM7A 3E1KA 5KO2A 1RJFA 5MN6A 4XDZA 4P83A 2EP8A 2FMUA 1HSOA 1QIHA 2Q1YA 4KR0A 4NBVA 4A6EA 5B64A 1Q1AA 2ERYA 3O82A 2YOHA 4OA5A 5HQ3A 4MYHA 2IEYA 4G5OA 5IC4A 4FQ5A 4CVNA 1IQPA 1IQRA 4XVUA 3PQEA 2VQFB 3E9ZA 1MD9A 4HVTA 1PK7A 1ISJA 1J8FA 2ZANA 4DB4A 1P31A 1SHJA 5J2TF 3NWOA 3UAXA 4H27A 2GBLC 3VR3D 2ZETA 5K20A 4GOKA 1BAPA 2ZT8A 1KNXA 1NR7A 3S40A 3E84A 2XT6A 5JASA 1K6IA 5JRDS 1N92A 2QD5A 2YICA 3DFKA 5J2UA 2WYWA 2GD0A 1E7MA 2YXEA 2ZBDA 2RH4A 2XIQA 1N2CE 9MHTA 3CKLA 3RHTA 5CLHA 4CLEA 1U9CA 3L6CA 3M3HA 1ND5A 4KLZA 5G41A 4DRXB 1ZJWA 3EWAA 3TEMA 1NVEA 5K0FA 3AEKB 1EAYA 1Z2EA 1L5VA 1R6VA 2R79A 3G8YA 3CLSC 1P2SA 3PNLA 2J85A 4PHCA 5BRJA 5I4IA 2GM5A 5ITSA 1YCFA 3KWLA 2P9TA 4CGZA 3T3OA 3S4YA 2PGDA 1IOWA 2I0FA 1ZJ5A 3ZHUA 4JOSA 1N8NA 2VATA 3KZXA 1UMKA 3B1YA 1NVGA 3OE5A 3HLKA 2H4YA 1FMCA 2VJQA 4IJQA 4ZVVA 5J63A 3L41A 1YGPA 4DARA 3HKEA 4URWR 1H0KA 1H6AA 1HYQA 4D5GA 1V3VA 5GONF 2AKAB 2UYCA 2FZKA 3NETA 4QGFA 2HF8A 4F3YA 2BEUA 4EO9A 2XWSA 2FRXA 1SIUA 5IJ9B 2J0EA 3BRQA 4XZ3A 3L7AA 4Q19A 5EP3A 2Q8NA 1L5LA 2JGIA 2Q4OA 3L3BA 3PV0A 4JFAA 4YAWA 4ZOAA 5CX1B 3T7CA 3GGPA 2FEPA 1V3TA 1R12A 5B55A 3HZRA 1LWNA 4EZBA 1E9EA 2OWEA 4YCCA 3IESA 1ONSA 5F3DA 1JH9A 2QMOA 1SVWA 5EPOA 2ZR7A 3KZ1E 2KLHA 5H9VA 4L0QA 4Y9SA 1EUCA 4LOLA 4X1IB 1MU0A 4DABA 2R9VA 1PG0A 1ZUHA 3BFPA 3KQWA 3IKLA 4ZO4A 3LS2A 5HFNA 3RHSA 4BFVA 4C21A 2HDOA 4EF6A 1OLSB 5KYXB 1FS6A 1U2EA 1D0IA 1UINA 1VJRA 3KEGA 5IWAB 1DQZA 4XGRA 1HOTA 4NFHA 4YCDA 1PI3A 3DBLB 3VVLA 1P73A 5FOQA 3GT4A 2PA3A 3RYCB 5LQJA 5C5DA 3H5VA 5JI3E 1QHHA 4E31A 2H08A 3G5AA 1E5QA 1T5DX 1PV2A 4XGNA 4LPKA 2Y6VA 1ADBA 5JD6A 2ZRCA 4OIMA 4EKEA 3VSCA 1ISRA 3UCXA 2P8JA 4K28A 2X4DA 1R9NA 2JHFA 3H04A 3SOPA 2B6HA 1DUSA 4IH9A 1VJ0A 1GG2A 4QM6A 2V59A 1ZSYA 3HXTA 1EINA 3QVMA 4XWTA 5HQ3B 4PIPA 1U8AA 5J4HA 1UQUA 4FEAA 1ODSA 2FRDA 3HJGA 1ADCA 1V3UA 1J0EA 3HY3A 3LHKA 2ZEJA 2XWQA 5EXSA 3DVAA 2Z98A 3E9EA 4IG4A 4MP6A 2C5HA 3G2KA 4ZVTA 3T1NA 5AVWA 2C99A 3R7FA 1AGRA 2P1DA 4JSTA 1DEAA 3GEPA 3L7OA 4KI7A 4WKOA 5KOJA 1U0NA 5JJLA 3BK1A 1QMGA 3TUIC 2KE5A 3UICA 2A4KA 1XPJA 3IAS1 2PKWA 1THZA 3MRSA 4KK3A 1UADA 1Y80A 3G2PA 4TKZA 1L0BA 5DH9A 1SBNE 3B1FA 3MPOA 4Y6LA 1XMOB 3FDIA 3CW2A 3ESQA 1KTIA 2Z1DA 5JD4A 3WL7A 3U4QB 1NXWA 2HDHA 5I7RA 1E9BA 4LXXA 4GBJA 4JOBA 1WD7A 1JDSA 1ENPA 4LJRA 3L0CA 1YR3A 3QTBA 4UTZA 2V5AA 2FUEA 4EHAA 5CCXA 4ZAGA 4K9MA 4XOIA 1HLGA 2YN2A 1HFJA 1QK5A 1WTAA 1C9JA 4Q3OA 3N0WA 4W1RA 2RC6A 3FDFA 4D3XA 3CNNA 3KQYA 3LQKA 3MFQA 4GF5A 3STYA 3TE7A 4U2EA 3VPBA 4AO7A 4EX7A 4CQNA 2WUDA 2NOAA 2HWYA 1PJ3A 4CR8A 4U5QA 1QS0A 4RVHA 1JI0A 2GEUA 7YASA 2FAXA 4UVGA 3D4OA 4QU5A 3H11B 10MHA 1B3RA 1L5RA 4NYJQ 1DELA 1JAXA 4KYTA 3GLGE 2ZM5A 3HU1A 4RFVA 3A7EA 2W6CX 1BXGB 3AB8A 4X97A 3Q0IA 1PT6A 2GAJA 3O1HB 2AN4A 1SUAA 2GRUA 2R6FA 3TCKA 3IP5A 1FFDA 4FI3C 3BSYA 2ZJ3A 3FI0A 3LDFA 1Q7RA 1H2EA 4KQGA 3IULA 4KQJA 3N8HA 1OQAA 4ZOLA 1G2PA 4EHIA 2AB0A 3CH6A 1YZFA 4KRFA 4L50A 3I5UA 1GNRA 3F6BX 4TTPA 2JRCA 4KGDA 5E0KB 3TTXA 1EVJA 4IYJA 5EZYF 1SXPA 1ML3A 4KH0A 3NBYC 3K70C 4HDMB 1CLEA 2VN8A 2W2XA 1P2DA 1U2QA 3OI7A 4LRSB 2QMZA 1S4QA 4PLYA 4WEOA 3PXBA 4ENSA 1UJNA 4LYJA 3NJRA 1SU4A 3O4IA 3MJCA 2AJCA 2JCSA 3EK2A 4L0CA 5HRCA 2NT3A 4RHEA 2DUNA 5ALSA 3QWBA 5HWSA 2PXAA 5I9LA 5BT8A 1ODJA 2FN7A 1KRWA 3G9UA 1Q95A 5E2BA 3ZCQA 2YJTD 1XLWA 4P81A 2IW1A 2CW5A 2WT8A 2FVYA 4DL9A 2QVCA 4DWWA 2ID9A 4UPDA 3I32A 1GU7A 1HT2E 4O2AF 3T38A 4TZ6A 2C0CA 1XAJA 2QYHA 2GNPA 5E2IA 4KEAA 1KJIA 2FK8A 3E48A 4ZYVA 5C7LO 1AXGA 4WWHA 3EVDA 1RYFA 4AZ0B 1LK5A 3EGEA 2BJVA 5G1OA 2Q49A 2DR2A 2PSHA 3ISTA 4Z51A 2I9KA 2CNNA 4EF4A 1MOPA 3WX0A 1JHAA 4K6HA 2Y99A 1O0CA 2WJGA 4GPEA 3ICEA 2YMPA 3IALA 1OWNA 3D1VA 3QLVA 1EWKA 4QRDA 2H11A 2HB6A 4C4PA 2Q4DA 3VUEA 4PYIA 3O8BA 5IBRA 1H6BA 4C6TB 4Z1MA 2GUGA 2R7MA 2R66A 4LGMA 4KKXB 4XD2A 4D25A 2YXLA 3R44A 1T9ZA 3P2JA 2FWRA 5FLXA 3AZPA 4OREX 2QZPA 1U9IA 2B25A 1VIMA 2VL7A 3QSGA 3QE0A 4LRYA 1QZUA 3B3AA 4B8YA 3HPQA 1O5OA 4LKOA 2ZJFA 2I2DA 2IW3A 4URFA 4ETIA 5K5EA 2NU7B 2UYQA 4Z3OA 1OAKA 1W0JA 3M49A 3PNSA 2EG9A 3F1LA 5T57A 1I7DA 3I8SA 3PD1A 4KB5A 1ZQ1A 2YQZA 2O54A 3B7PA 2WWVD 3WRYA 1XJWA 1K97A 1YRBA 2BFDB 2QIOA 4D4MA 5A3QA 5JSZB 4CUKA 3IP9A 1QX3A 2H5IA 1EUZA 3FNIA 4JT9A 2DBZA 3K09A 2WWGA 3KTAA 3V4SA 4B40A 1XC7A 1JQEA 2D5CA 3I64A 3VKFA 4Q3EA 1X1AA 1EA7A 3T1VA 1A2OA 4ZT7A 1SVOA 5ALXA 1CB7A 3R7NA 4BX0A 5ALIA 1TCUA 5BW8A 4FYIA 1L1FA 1TJ3A 1QGAA 1QANA 2GA9A 4RX1A 4YR7A 2X1LA 4PFKA 3RANA 4OA8A 4OF4A 2HW8A 1DC3A 5T7BA 3UB3A 2PMKA 1G5IA 1GQ2A 1KZ4A 2HEGA 3TSOA 2O5EA 5H5JA 1VHLA 1KEWA 3FCSB 3LJKA 2IF0A 4LVUA 5CK5A 1UZMA 2R00C 4MGKR 1L7XA 5AI4A 1HM5A 4QLOA 1SBIA 3A26A 4OXXA 3UUFA 2AOWA 3RV4A 3L4BA 3IT0A 3HBAA 5EWJA 4W5NA 1Q0UA 3FR7A 2VHZA 1W6RA 3WV4A 4KAFA 2XTJA 2FW9A 2ZIFA 5E6SA 3MVEA 3H1TA 1QRAA 2P11A 2Q28A 3IT2A 4HC4A 3T1QA 5KPJA 3AVUA 3N70A 1Q0PA 3PXAA 1G8JA 2ARKA 2FP4B 4NZOA 3CJQA 4BV9A 3MSXA 2ZAGA 5IDQA 1NJ8A 2QLFA 1E79A 4P6VF 3IV9A 1U02A 2VQDA 1ZAYA 1FPMA 4TXNA 2FMHA 2RGAA 5KTSA 5F4BA 1GR1A 1R0KA 3O21A 3HACA 3AU8A 3EB9A 2BGWA 4ODIA 3ZQJA 4PYQA 1RRGA 2OKGA