3DENA

Structure of e. coli dhdps mutant y107w
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
291
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYWNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutating the tight-dimer interface of dihydrodipicolinate synthase disrupts the enzyme quaternary structure: toward a monomeric enzyme
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 107
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3denA00
3MMTA 4I7WA 4RR4A 1DVJA 5F1VA 4JTIA 3SW6A 3M16A 4OGZA 5KZEA 3F1QA 2PE4A 1JCJA 2TPSA 3NAVA 3PUOA 3BW4A 1F2JA 1HO4A 5FF4A 1T99A 4NJJA 3DH7A 3L5MA 1B3OA 3LCGA 3TJLA 2DU2A 1N8FA 4O18A 1YDOA 5AYXA 1LRQA 1KFJA 3UXAA 1TQJA 1U5JA 5K9CA 3P8JA 4N4QA 3HF3A 3LXAA 4RZ4A 3W1MA 1JJKA 1Q6OA 2YW4A 1WX0A 3BW3A 4M6PA 5D2WA 2DZXA 1RQBA 3MWAA 1S5WA 2BSLA 4CNNA 3N3MA 4S2BA 3IEBA 3VFLA 4MZYA 4UTUA 2OMAA 3G8EA 4UR7A 4DPPA 3WFAA 3GLCA 3UPBA 3S1VA 5K4XA 5TBOA 4QISA 3QRHA 4R34A 2FPTA 3QQ1A 4TMBA 4A29A 5D2VA 1XUZA 4LTSA 3L66A 3HPSA 1D3GA 1AW5A 3W1PA 3Q94A 2DZSA 4O0KA 3UYCA 3W1NA 1OX5A 1UCWA 1AL7A 1TPUA 3GDRA 2A6LA 1F5ZA 2V0TA 1M5WA 4WY0F 1YYAA 2ISWA 3P61A 2CLLA 4H4IA 2ZA1A 3MHGA 3W71A 2VOMA 3IIPA 5HQEA 1YDVA 2H3DA 4O16A 5CPOA 5G1TA 2HMCA 2V30A 3LRMA 4LUIA 1OVDA 3R2GA 3B0UX 1FX6A 4NJKA 3SSJA 3HB9A 3S5YA 1GG0A 1OABA 3W07A 1X6UA 2OCZA 4ADTA 1Z41A 3TFXA 1GVRA 4RX0A 3M44A 4K7VA 4E38A 3K30A 1SUXA 5HWNA 4MYAA 1P0NA 1SZNA 5I3IA 1XBZA 3WK0A 1WDWA 3DHDA 3HGJA 4N9DA 3D0CA 1S5VA 3TAKA 4DELA 2GQAA 2QJGA 1DORA 2CWNA 3FYOA 1FXQA 1K02A 2V5BA 3EX4A 1H1ZA 3PBUA 4N6EA 1MEHA 1KLYA 1SW0A 5CZ0A 3LLDA 1AG1O 1NFBA 1SZFA 5LNVA 4JTJA 4IMDA 4CCEA 3PM6A 1OJXA 3QM3A 4QNEA 2ZRWA 4A3UA 3I7SA 3KHJA 2Y7EA 3JRKA 4UTIA 4LOCA 4ONVA 4RXGA 3TX9A 2QKFA 2I14A 6TIMA 1CX9A 4IOTA 4ZQRA 5DBUA 1LRTA 4BI7A 1N55A 4BK9A 3KVKA 3W1UA 4XKYA 2NZLA 4JGDA 3UD6A 2WPBA 1W3TA 3A5FA 1OX6A 4FX8A 4KKXA 4DO4A 3Q37A 3VNDA 1PE1A 1B57A 3C6CA 4UXDA 1G4EA 4PFMA 1KA9F 3QC3A 2F7FA 1WQ5A 3CC1A 4LRTA 5H2ZA 3NL5A 3FOKA 2PRMA 3M9YA 4UMAA 1DOSA 1HTIA 5FF0A 3JR2A 3CEUA 2V5LA 3L0KA 3NQCA 3W3OA 2F84A 3UWVA 1TREA 3LTSA 1TPB1 2JBMA 1D9EA 1PS9A 2H90A 5KTLA 5K2ZA 3VI2A 3KVLA 5F2GA 2E5CA 3UWWA 2FTPA 1LM1A 4DPQA 2QCHA 4IMGA 3MI6A 3N2XA 1XI3A 1HUVA 4JTSA 1Q3NA 3NQ2A 2WJZA 4FXRA 1YXDA 3W7EA 5F4SA 3N9RA 1W0MA 2NUWA 1TIMA 2ZRVA 1FWNA 1DL3A 4K8EA 1F76A 1ONRA 1VYRA 4CQ9A 4PL2A 3GIYA 4FB7A 1FUYA 3A5VA 1OFDA 3TQ0A 4DXVA 1H7XA 5AHNA 1VHNA 1VH7A 4HNUA 2XFWA 2NWSA 1KM2A 1SO4A 1IGSA 5HJLA 3R8RA 5I3JA 2XN1A 2PC4A 3LGEA 1F7BA 2RDTA 2C15A 1NAL1 5HMSA 3PB0A 5AFDA 5K7JA 4NNBA 4OU1A 2CLIA 3NPWA 3L67A 4P2VA 1FY6A 4A21A 5A8GA 3B0PA 3QMSA 2CFFA 4ZZ9A 2J6XA 4OE7A 4O1AA 4JD4A 1B4EA 1K8ZA 3C2OA 4PH6A 1HG3A 1WOAA 5D38A 3E49A 1X8FA 5LHFA 2HS6A 3N9SA 1N7KA 3ZR4A 4JYFA 4EF8A 3GKFA 3NG3A 3T44A 3CWOX 1V5XA 4GWEA 1TJPA 3S5NA 3KRSA 5TIMA 3TFCA 1WXJA 5A5WA 3EX6A 5GVJA 4YCPA 3NQMA 5D04C 5DCDA 3TQKA 5BW6A 3L21A 4JS3A 1A53A 2VFHA 1H50A 3LV5A 4HIBA 1OX4B 3WJSA 3ATYA 5LSMA 3KVJA 2QAFA 3C3NA 2FLIA 3NQDA 4AF0B 2RDWA 4GUJA 3GXTA 3G1SA 5AHIA 4NT0A 3OG3A 1IXQA 4O53A 3G0XA 5AHMA 5FESA 2RHGA 3UZJA 1K8XA 1LORA 4GC4A 1PL9A 3CEPA 3M1ZA 4MLJA 3WK2A 5F2MA 1TCDA 4WZHA 3M47A 1L9WA 4WXZA 2J9ZA 1Q6LA 5KMYA 3LHUA 2OT0A 3TNOA 2IQTA 1I2OA 2V2CA 3FYPA 3O6YX 2P0OA 1JCNA 5T26A 2WNNA 5HR7A 4Z1BA 3A22A 3LXCA 3HOJA 2DZWA 3S0CA 4ZQMA 1Z48A 2GQ8A 3IVUA 1R46A 4FX6M 1IXOA 1Y0EA 5HUPA 4PC8A 2CZ5A 4FNRA 3HG4A 1DV7A 3W1QA 4RV8A 1UJPA 3A24A 1YDNA 2WKJA 2TRSA 1SFLA 3W7QA 5EA9A 1BKSA 4TU1A 3LCFA 5LNWA 3NO5A 1XKYA 1WOBA 4HSOA 4WX2A 3CM4A 3QF0A 3QJAA 4XUGA 2W6RA 2H3BA 5D2XA 3A9IA 4JXCA 2FQIA 1DQWA 3W1AA 1XDMA 4MOZA 4NNAA 5DELA 4IX2A 4UTWC 3RU6A 4KWVA 2FB3A 2Y6ZA 3MHFA 5DCBA 5K3VA 3O6DA 4AHQA 3M5YA 4XTIA 3OVRA 5HULA 3FS2A 1YTEA 3NQ6A 1ZAIA 4CCCA 4HPXA 1K7EA 3BVJA 1K8YA 4IMEA 4FXSA 1TTIA 2P1FA 4WY0B 5AHLA 4GUIA 1H7NA 5C6MA 5J5RA 1W3IA 3INPA 2G5WA 3EXSA 4NU7A 3W86A 4B5NA 3S6DA 4DBDA 2GVLA 1MSSA 4K6AA 1TTQA 3QFEA 5CKSA 1PCKA 1FCBA 2EF9A 3FJLA 3C2VA 3NM1A 5G4EA 4XBSA 3GR7A 4BR1A 3O06A 1J5TA 2ZFAA 4EIVA 3GB6A 4NZFA 4LVGA 3HPZA 4IJBA 3O16A 3WJXA 3W7DA 1GVSA 1I4NA 1FWWA 4KWWA 1TPVA 4U28A 3DKJA 3W84A 1XUUA 1TPEA 3W7KA 4UFMA 2DP3A 2OZ0A 1G7VA 3IRDA 3HGOA 3ATZA 4K8HA 3W88A 4XWUA 3LTYA 4Y90A 4RXFA 4JY9A 4S2CA 3P5YA 1XM3A 2GOUA 3S1XA 3GNNA 3NL6A 2E09A 1XC4A 5SWUA 2ZRUA 3MP5A 1LZOA 3MYPA 3MUXA 4ADUA 5AHFA 3T4CA 3F03K 1GOXA 3SECA 4LU0A 3W7HA 3NL3A 4FF7A 3IIZA 3UWYA 1SR9A 1QR7A 2NXHA 2TYSA 1EWDA 1RV8A 4OT7A 3GDLA 4JTFA 3TV8A 5HNRA 1T8XA 1TPFA 4UFKA 4O12A 2NV2A 1W5NA 1OYCA 1TV7A 1YPIA 3O8AA 3G1XA 3W2UA 4CNOA 2QCMA 3O1NA 2Y89A 4LNYA 4O15A 5FF7A 3T78A 3MP3A 5CPNA 1JCYA 4UTKA 2JKPA 3M7WA 4MYXA 1GT8A 3TAOA 1J4EA 1A5CA 2VFDA 4BWLC 1EP2A 1QOQA 5KZMA 2R91A 1ICQA 4R7JA 3NOEA 3NL2A 1ZAJA 3TC6A 3QSTA 1MZHA 5CG7A 1MXSA 2OT1A 3UWQA 1SW7A 3CT7A 2BLEA 3C0JA 4ALDA 1GG1A 3QSRA 4PODA 5E0KA 3BGJA 1I2NA 5D2TA 2I9EA 2VEKA 3I65A 4CNPA 3L5AA 3KVMA 4UFIA 4BF9A 1R2SA 4JTGA 2E5BA 1RD5A 3C56A 4YCOA 3IIXA 4OBTA 3KAOA 1VQTA 4O57A 4N9EA 3A23A 3FKKA 5FI8A 3P7YA 7TIMA 3B04A 5G1YA 1H51A 3QMTA 1LBLA 3E12A 4JR5A 3CPRA 2DZUA 2HSAA 1RZMA 1R2TA 1A5BA 3UWZA 3ZWSA 3MJYA 4OWGA 5CZTA 3UXDA 4O4WA 5LNUA 1AMKA 3LI0A 4O19A 2W0UA 1I2RA 6ALDA 2Z6IA 2G97A 1P1XA 1XFBA 3MP4A 4MZ1A 2FPVA 2Q3OA 2FDSA 4MY1A 1GPWA 2WV8A 4HNTA 3EEGA 3CLMA 3DZ1A 1Q6RA 5AN7A 3UZ5A 3GK0A 2TMDA 4YXGA 2E1DA 5H91A 1L6YA 4UTLA 2B7QA 3ZS4A 1FXPA 2VFEA 4E0CA 1OF6A 1SZGA 1KFLA 5E93A 4OV4A 3P81A 4PTNA 3L5LA 4Z1AA 3TXZA 2NUXA 4D2JA 3ZFHA 2ZZ4A 4QJ1A 3ABOA 1O5KA 3NQEA 2V82A 4FNPA 3LHVA 4AF0A 3HG2A 2X1RA 1EWEA 2GQ9A 5HUOA 1OK4A 1GJPA 1XXXA 4U4MA 2ZYFA 3KXQA 3NXFA 3IIVA 5BOOA 4GUHA 5IBXC 1ZCOA 3W23A 4O1BA 1CW2A 3IVTA 3T55A 3TA6A 4Q4KA 2A2IA 1OF8A 3PSWA 5D33A 4WQ6A 3M0ZA 4X3ZA 1QPQA 3TH6A 3LCXA 3QPZA 1XBVA 3CTLA 1VCFA 2O7SA 3W7GA 3HG5A 1GTEA 3G18A 1ICPA 1EP1A 1O4UA 3S1WA 1QPNA 3H54A 2NV1A 3PB2A 1PHQA 1OYAA 1W3NA 2YPIA 1ZY9A 1G4TA 1VCVA 2WNQA 4MFEA 1LOQA 3KOFA 3EWWA 4O1DA 3SGZA 3TQVA 4P61A 5LNSA 3DBPA 4AXKA 3FLUA 3TW7A 5MHBA 3FJ6A 4PCFA 4UTJA 1FBAA 4UIOA 4TIMA 1PCWA 2QF7A 2D73A 2B7PA 2B7OA 3ANYA 3M41A 4LRSA 3FA5A 4QITA 3NZ1A 2Y88A 1DQXA 3LM7A 2NXGA 2H8XA 3W7PA 1W31A 3L9CA 4TR9A 1BWLA 1LBMA 5LZLA 1BEUA 4XTDA 1LLWA 1SW3A 4HHPA 1ZNNA 4RZ6A 5LGZA 3MO7A 1HFBA 4C1KA 4LW7A 1VJIA 4EOUA 3NZRA 1WBJA 2PCQA 3STEA 4IUOA 3BLIA 1NVMA 2R14A 3HQ1A 3LBCA 4UTTC 1OFEA 4K37A 5HINA 3HIJA 4J9JA 1ZALA 3MBDA 4FX7A 4RKAA 4JTEA 1MEIA 4S1FA 3S5ZA 1M7OA 3OEXA 4ZQOA 2C16A 1QNVA 1C9DA 1DKWA 1SQ7A 1SO6A 5FF2A 4ZQPA 3M5XA 3QPYA 2NWRA 3W2NA 4Y96A 2CU0A 1FWRA 3FFSA 1TRDA 1SZEA 4Q33A 4PA8A 5TQLA 1G7UA 1VPXA 4WXYA 1DHPA 4OQVA 3DHFA 3LERA 1YXYA 4BFAA 2ZZ5A 1VR6A 4N2YA 2EKCA 1TPDA 1ME7A 3MBFA 3MHUA 5HWMA 1W56A 1QAPA 4OHQA 5D05A 1H7OA 2LLEA 4M6QA 4ML9A 5KITA 3UWUA 3SJ3A 2RKXA 2ZZ3A 3T40A 2E68A 4FIRA 3CU2A 2G95A 3PWAA 5G4WA 2JKAA 3W7MA 3GDKA 2QUUA 1D3HA 4O0ZA 3W70A 4K36A 3N19B 1JQVA 3UY7A 4IPIA 1TRIA 2A21A 2BXVA 3EWXA 4FNTA 1TPH1 3WJZA 2ATMA 3NPUA 2J9YA 4GE8A 4DF0A 1W8SA 4Z0SA 3NGJA 1QO5A 1R30A 2C14A 4GXMA 4POCA 4O14A 1W5PA 3EXRA 2X30A 4IWWA 1VLIA 1KW1A 4ZL1A 5F4XA 4NXKA 1GZGA 1FWSA 4UTMA 1I2PA 1TSIA 1G4PA 4IGHA 1IIGA 1JUKA 3I7RA 2AAMA 3I68A 4WUIA 4UCGA 3W7NA 4XKYB 1OFPA 3TR2A 2YDAA 2A85A 4IMFA 2Q3RA 3C52A 1JUEA 1TO3A 4PEKA 2GJNA 3O05A 3PVFA 1KM3A 3DAQA 3GDTA 3GR8A 4N9CA 4O28A 5DBTA 1F74A 4KFOA 2VENA 4JYEA 3SR7A 3SIZA 3DFQA 5EMUA 4HPJA 2C6QA 3TW6A 5KSWA 1WYIA 4LT9A 1ZENA 4ZVJA 1VRDA 1LOSA 3Q58A 3NPVA 1UASA 4GRSA 5LHEA 1SSDA 1OYBA 3P5ZA 4NJHA 4JX6A 3TXVA 5EL1A 3PSVA 8TIMA 4JX5A 3TK7A 2QCCA 1KBJA 2OX1A 4MFDA 3ABQA 3E0IA 3KX6A 5DCEA 2AGKA 1I2QA 2J24A 5G2HA 3W87A 3W2KA 2YX0A 1X1ZA 2ABBA 4I7VA 3RF9A 2X1TA 3S42A 3STGA 3QQ0A 3RNDA 3G1AA 3BK0A 2NX9A 4W9TA 2WQPA 4GNJA 1OFAA 4MLRA 3TKFA 3SGUA 4RCXA 1I8JA 1LROA 2AQWA 4YL2A 1KFCA 1LCOA 3HMJG 4NJIA 1KV8A 3M6YA 3QW3A 3NQ8A 1JVNA 1AL8A 1THFD 3VE9A 3W1TA 1H7PA 1TPC1 5F4WA 4Y9AA 3W1XA 1IIHA 1RQEA 3M43A 4JTLA 1EA0A 4UR8A 3W83A 1JRBA 2HS8A 5FEWA 4Y6GA 1O60A 3TCEA 2VFFA 3RK8A 4GJ1A 3EXTA 1JQXA 2E5DA 4LV9A 5K9XA 1UUMA 3W7CA 3TU9A 1KTBA 3BPWA 5C5YA 1H1YA 2ISSA 4UUIA 1GVQA 4AB4A 4JDYA 5LGXA 3V75A 3P60A 1AW2A 1VYSX 1TMHA 3DFTA 1NF0A 4G1KA 2PRHA 3G3MA 4HT3A 4LS0A 4M5PA 1JCMP 4JIPA 3TSMA 1ZAHA 3IV3A 5EYWA 2Y85A 3E96A 1SU5A 2ALDA 3LOTA 4AHOA 3QW4B 2R8WA 3LTPA 3STFA 3TC7A 1W1ZA 2Q8LA 4HN4A 2J88A 4JNMA 4MPQA 2WO5A 4MIMA 4WOZA 4JX4A 2RDUA 2VFGA 3DGRA 4O54A 3WK3A 1EX5A 1KLZA 2A7NA 2X2GA 3B0VC 2ATSA 1B9BA 4EVZA 2DZTA 3G24A 2ZDRA 4TX9A 3TE9A 1BWKA 1OFOA 5FEXA 1NSJA 3B03A 3GZ3A 1KM6A 1PV8A 2RH9A 1MEWA 1WV2A 3PR2A 2FIQA 2FFCA 4MVAA 1F05A 4RJEA 3I7QA 3E9AA 3N2MA 5I3KA 2NLIA 3OBKA 1UBSA 1A5SA 1NEYA 1I45A 3F4NA 2BTMA 3PG8A 2V9DA 4OV9A 4YWIA 1GWJA 3LX9A 1RR2A 3W22A 4E2BA 3OVQA 3EWBX 5BRBA 1OX4A 3OHIA 2ZZ6A 3ABSA 1UUOA 3BW2A 3DFOA 4O1CA 1FCQA 3LLFA 4X9SA 3NM3A 1TQXA 4NJGA 2QCGA 1K7FA 3S8HA 1JCLA 4M7SA 1XL9A 3NQFA 2YCEA 2E6FA 1Z44A 2QJIA 3GAKA 3GNDA 1H63A 3W9ZA 2EAWA 1A50A 4LC6A 4M6VA 5L9FA 1R47A 4YLWA 3PULA 3L65A 3AJXA 2YFNA 3GKAA 1G69A 5I3FA 5J5DA 2QCNA 3PG9A 4JTUA 1VC4A 3VE7A 5FEPA 3C4UA 2GPTA 3CWNA 3P8IA 4Z08A 3V1PA 5AC7A 2BX7A 1T96A 4IQLA 1LOLA 1ALDA 1LYXA 1PHWA 3LCHA 3SI9A 1YPFA 4LS1A 3GAYA 3TDFA 4ZQCA 3VCRA 2CZDA 4EWND 3TSBA 3T7VA 4UMCA 4KFPA 3TMQA 1H5YA 5G2IA 4Y8FA 3QZEA 3DFSA 3BG5A 4LVFA 1W37A 5AC8A 1SPQA 3DXIA 4ADSA 1GTHA 4O17A 4Z0JA 2Z0IA 4ICNA 2KZHA 4O52A 3NNTA 1KM0A 2YGYA 2A7RA 4TMCA 3G8RA 4AH7A 3W85A 1EEPA 2BWGA 5C55A 3NA8A 4IPJA 3U6WA 3P84A 1TYGA 2EGZA 5G5IA 4N4PA 4JN6A 5C54A 3WJWA 4XBKA 3G3DA 4YMZA 4N6FA 2R94A 1X1OA 4HKPA 1O94A 1LLZA 2J9XA 1JULA 2XN2A 1U83A 3G0SA 3KFTA 2B7NA 4MY9A 3EKLA 4NQ1A 1HO1A 4IMCA 4UFJA 5F2IA 1KTCA 2W79A 3TSDA 2ZTKA 3HGSA 3NDOA 2CLHA 2CLOA 2Y61A 3DFPA 5LNRA 1KFBA 1GYLA 4AAJA 3B4UA 1O5XA 2ZBTA 1KV5A 3C2FA 3LCIA 1EP3A 5D32A 3BG9A 1K7XA 2ZA3A 4XQ6A 4MZ8A 2WOQA 4O4VA 5CSRA 3LI1A 3L2IA 3NPXA 2Y62A 2ZCGA 3LV6A 4NX5A 1J2WA 3DKLA 5I3HA 4LVBA 4LVDA 4JTHA 3PUEA 2Q8ZA 4UNKA 4QNWA 4LY8A 5D09A 2H6RA 3NVTA 4RZ5A 3NQGA 2FJKA 2NXIA 1Q45A 1ZFJA 2C13A 5D03A 2ZTJA 2C18A 5CPMA 2DJXA 3CQ0A 4UTHA 3KRZA 2VELA 3BO9A 3HO8A 4A2RA 1OFRA 2CZFA 2WNZA 3A21A 4CLMA 1FDJA 3HGRA 1AW1A 1YADA 3G1HA 1VHCA 2Y70A 4PL1A 2ZRZA 1OHLA 1ME9A 2DZVA 2ZRXA 3P74A 2C3ZA 5BMXA 3N73A 4K38A 3BG3A 5CPLA 5U4NA 2QDHA 4WJEA 4HNNA 1VCGA 2VEIA 4AVFA 4DF2A 2GVGA 3DI0A 3KRUA 3G1DA 3EKZA 1MO0A 3E02A 3GXPA 5DXXA 3L0NA 5D37A 1YTKA 3W6YA 4CQAA 3FIGA 3PUDA 2Y7FA 3EWUA 5CZSA 1RVGA 4JTTA 3W1LA 1L2UA 3CB8A 4AHPA 4L4MA 2A5HA 1P5BA 5DY2A 5KZDA 4LWWA 3NR0A 4JICA 4O8RA 4NZJA 2X1SA 5F1UA 3SY5A 3W75A 2GJLA 3TUUA 1KM5A 3O07A 1E51A 1FCVA 2E6DA 1K3UA 3P82A 2QAPA 1OK6A 2VEMA 5AOUA 2ZA2A 3S9YA 5KINA 4QSHA 3S5OA 1DJNA 3C2EA 4MJMA 1GVFA 4HSNA 2QUVA 3EWYA 2A6NA 3NQAA 4JEQA 4DO5A 2DJLA 1SO3A 1TTPA 3P62A 4FO4A 4WD0A 2A7PA 1TPWA 3F4WA 5AC6A 3W7RA 4DF1A 1ZJIA 3LB0A 1OFBA 3DFNA 1QMLA 3FKRA 4QM1A 2Z1BA 4TO8A 3GX9A 4JTKA 5CZJA 5LKYA 2H8ZA 3THQA 4IXXA 3N34A 4GUGA 1SSGA 2VFIA 3C2RA 3C8FA 5G2WA 1ICSA 1H60A 4MKNA 3QYQA 1ZHAA 2V8ZA 2Y7DA 3PBWA 1BTMA 2FPYA 2DZPA 4ORMA 1GYNA 3ELFA 1V7YA 3B8DA 1YXCA 3LRLA 4I9AA 3PY2A 1IXNA 3QMRA 1F73A 3ZWTA 2VKZG 4MY8A 2A1YA 3LHWA 1W54A 1XBYA 5EY5A 2B0MA 1P4CA 5EPDA 4UFHA 3MI2A 3AO0A 3BGGA 2CLMA 3W1RA 2CW6A 5I3GA 1OFQA 1TV5A 1NF7A 3STCA 2EHHA 3I6RA 3C61A 3TIMA 4BI5A 1P0KA 1JRCA 2X1UA 1KTNA 3JS3A 5DN1A 1C29A 3IGSA 4ZMGA 3THAA 3EB2A 1LTDA 1EB3A 1QCWA 4UFLA 4R33A 2ZQ0A 1GVOA 1H7RA 3G1VA 2FB2A 4NX0A 3BLEA 3M5ZA 5HWJA 3R12A 1HL2A 2YR1A 3TMLA 2JKEA 2YSWA 1AK5A 4UTTA 4WY0A 5K9DA 5U7SA 3G1YA 1G67A 2E6AA 1QO2A 4JDBA 3NEVA 4FNQA 4K39A 3Q2DA 3PBVA 4K7YA 1VYPX 3QH2A 1DJQA 2O7QA 2YYTA 3PC0A 3BV4A 1QDSA 3HG3A 4QQ3A 4Z1CA 4Q32A 2I1OA 1XDLA 1A5AA 1IF2A 4IX0A 2JK2A 3R5EA 4FHAA 1FDYA 2VXNA 4NUWA 4CQ8A 4R53A 4AEOA 3SFKA 2VEPA 1K03A 4UC5A 3N14A 5K4ZA 1KBIA 3RLUA 4QIUA 2YW3A 1QOPA 2NUYA 2JGQA 3MW7A 3U8GA 4DBEA 1YTDA 1JUBA 1GQNA 1B4KA 4CCDA 2ZZ2A 4DO6A 4NXSA 1M7PA 2TSYA 3QEZA 1WA3A 1LDCA 3NQ7A 2DORA 2E6YA 4GFSA 1ADOA 4MJZA 2C19A 2YFOA 3M5VA 4O11A 2HTMA 2X16A 4HNVA 3W7OA 4H3DA 2PURA 3TROA 1O95A 4X2RA 4MUZA 4JY8A 1W5MA 5F2LA 1ML1A 4JYDA 3LCLA 4ZQNA 4C1LA 2C0AA 1W5OA 1EUNA 4ORIA 3LDVA 1SFJA 5IM51 3IGXA 1C8VA 3LXBA 4UMBA 1FCUA 3H53A 2OJPA 2VC6A 3EX1A 2CLEA 2WSRA 1F6KA 2QCDA 1WAUA 5BMWA 4GUFA 1RQHA 5AHEA 3SZ8A 4BI6A 5AYYA 4DEFA 4AWTA 1T0OA 3YPIA 1JR1A 4FNUA 2NX3A 3B05A 3LCWA 2QDGA 3G0UA 3W76A 5L6UA 4M19A 4L4LA 3LHYA 4E2DA 1TJRA 3O63A 3W2JA 4NVTA 4JIQA 2WSQA 3LBMA 3MI3A 4QAIA 5AB3A 4XZ9A 3W2MA 4FEZA 3HBLA 5DXYA 3UNDA 4O50A 3CHVA 4WOQA 3LHTA 3TJXA 1S3HA 1KFKA 2BZNA 2V2DA 1QFEA 3UY8A 2A0NA 3RLVA 1KM1A 4RK8A 5EKYA 1QPRA 4DQWA 3PAJA 3IGUA 4UTWA 3CIXA 4FNSA 3NQVA 2YYUA 2ISVA 1TB3A 5D30A 5EBUA 1L6WA 2E77A 1EPXA 3ABRA 5IBXA 3W73A 3PF3A 1H7WA 3G1FA 3LHZA 4A22A 3OA3A 3EWZA 1M6JA 3P80A 5ABTA 4A2SA 4UNLA 5FEZA 2P10A 1FQ0A 3W7IA 1SO5A 1X7FA 3RFAA 1CI1A 1KM4A 4AMAA 5D02A 1Q6QA 2CZEA 3DU0A 4LVAA 2ZRYA 3FEMA 4NNCA 1LP6A 5E1QA 1XBXA 1YLVA 2GUUA 3BARA 4FIQA 3CIWA 2QR6A 5FF3A 3UPWA 1H62A 2UV8G 3LRKA 2QCLA 2Y7GA 1H61A 3HJZA 3GVGA 1FWTA 3W72A 2NX1A 3U2OA 4IXHA 5BNKA 2QEZA 3OVPA 3EX3A 4LUJA 4N02A 4BWLA 3G22A 3GXNA 4LS2A 2ZZ7A 1DBTA 4LV4A 1LRNA 2QCFA 5D2YA 2J27A 1FDZA 3OIXA 2QJHA 2Y63A 1QPOA 3L0GA 4GBUA 4Z1DA 3IIOA 4EF9A 3USBA 1S5TA 3WK1A 2Z2UA 3H55A 1G6CA 4I7UA 2WSYA 3NYZA 2YXGA 4O10A 5CSSA 2XN0A 5DY3A 1RPXA 2YZRA 4RLIA 3GYEA 4N9BA 4M7TA 5C2XA 3W7JA 1GEQA 3DI1A 3MYOA 2CLFA 3HPXA 3EX2A 4O13A 1TTJA 1VZWA 2EPHA 2ZZ1A 4X22A 4AWSA 1F6PA 3VKJA 3GDMA 2B4GA 1EUAA 1QWGA 1R2RA 2RFGA 3RMJA 1PVNA 3L68A 3B06A 3PBYA 3W7LA 1PIIA 3S1UA 1LBFA 5DLCA 1JCXA 4KFNA 1ME8A 3IVSA 1L6SA 1IXPA 2V81A 5HR6A 3DENA 2QCDB 2A4AA 1WBHA 5AYZA 1VGAA 1XCFA 2ABAA 3BLFA 2V2HA 3W2LA 3PS7A 4H6KA 1G4SA 1VS1A 4LC8A 2JGYA 1Z42A 2QCEA 3O6CA 1TV8A 2PRLA 3R89A 1VLWA 2CLKA 2Z6JA 2QUTA 5CGQA 3UQNA 3O15A 3W74A 1KFEA 1OG0A 3P67A 3WJYA 2G96A 1UB3A 3R13A 1W5QA 2C1HA 4AWUA 1EIXA 2GVJA
chains in the Genus database with same CATH superfamily
3EWDA 3TTOA 5F1VA 4GPNA 1YBQA 1OGSA 3M16A 1P6WA 3CQHA 2TPSA 4NJJA 3DH7A 3ZJ6A 4F0RA 3TJLA 1XIDA 3EOLA 5JMUA 1RCXB 4LGXA 4AZBA 1YDOA 5AYXA 2WK2A 1LRQA 3UXAA 2OEMA 4LXFA 3NGFA 3W1MA 1JJKA 1WX0A 4PBEA 2DZXA 1W3LA 3RPDA 3CUJA 2BFGA 4UTUA 2C0HA 2FVLA 1KWGA 1E5NA 2J8TA 5TBOA 4R34A 4TMBA 1KCLA 1KBLA 3NO1A 1XG3A 1E6QM 1T8QA 3W1PA 1AW5A 3Q94A 2DZSA 2CZVA 1VFLA 4O0KA 3CAQA 3UYCA 3TYBA 2A6LA 1F5ZA 5E09A 1DE5A 3KL3A 4WY0F 2PGRA 3P61A 4H4IA 2CLLA 2ZA1A 3IIPA 3WLPA 4JKMA 4B90A 3KS6A 1EZWA 5CPOA 1PX8A 1EFZA 2HMCA 3LRMA 3ES7A 3RPMA 1FWFC 1EBGA 5D9NA 1P6CA 2BY1A 4NJKA 3S2LA 3SSJA 3HB9A 5ABFB 1X6UA 4ADTA 1Z41A 5DMNA 1GVRA 4XD5A 3GC2A 3K30A 1JD7A 3MDUA 3QHNA 5JH1A 4MYAA 3EYPA 3ITXA 5I3IA 2OZ3A 3DHDA 3AHYA 3RITA 3QXBA 4N9DA 2Z7KA 1S5VA 4DELA 3RM4A 1KB3A 2QJGA 1LT8A 4NZ3A 2D24A 1K02A 5FJOA 1MEHA 2ACQA 3VKBA 1NFBA 3QM3A 3KHJA 2Y7EA 4UTIA 4LOCA 2Q01A 3RJYA 1J6PA 2WKLA 2XH2A 3GTIA 4XBJA 2HBVA 1WDQA 4C65A 3CHEA 1NFGA 3VIOA 1T7LA 3T05A 4XZBA 4HYVA 2JE8A 4KKXA 3VA8A 2WJDA 2I56A 2DGAA 3AMGA 4QEEA 2G37A 3VOIA 2F7FA 4LRTA 2QXWA 1G1YA 3DC0A 1DOSA 1OEPA 5FF0A 2WHMA 2ADAA 1K9TA 3RPTA 3U4FA 4KESA 3UWVA 1TPB1 2YBUA 3W82A 2QJJA 2WC7A 5F2GA 1CXLA 3WF0A 1WDDA 2V5CA 4J28A 4JTSA 4FXRA 4GH1A 1KFWA 4XO7A 4TVCA 2J7DA 1HZYA 1FWNA 4OJYA 1A49A 3AS3A 3GIYA 1BRLB 3A5VA 3TQ0A 1H7XA 5AHNA 3GHUA 1GOMA 4DO7A 2BV9A 2NWSA 4GOAA 1IGSA 1UH3A 2XU2A 4GKTA 7ODCA 1P43A 5I3JA 4W7WA 2PC4A 3LGEA 1H5VA 4C6FA 4ZGYA 4F4RA 1VPYA 4OE7A 1O1ZA 5C9XA 4JD4A 1IEIA 2EO7A 1K8ZA 2V3DA 1TIWA 3K8MA 3VILA 1DWAM 2X7WA 3CWHA 3ZR4A 4JYFA 3R43A 3CWOX 4GWEA 3S5NA 3TFCA 1MYRA 3CBWA 1BGAA 1W2PA 5BW6A 3L21A 4H83A 1CYGA 4N42A 2A3AA 1BXNA 3LV5A 2VRJA 3QY8A 4B5UA 4RE4A 4LEQA 1XLDA 3K46A 2ZDSA 2QAFA 4XZNX 4ZA0A 4NT0A 4DZ5A 4Q8QA 3RG6A 4O53A 3WD4A 1PL9A 3LSBA 3TYZA 1GHRA 2O9RA 4C6EA 4ERIA 3QOKA 3RX3A 4AZ6A 1EJRC 1L9WA 4IP5A 3B9NA 1Q6LA 5KMYA 1B54A 1BF6A 9XIAA 3SCNA 1K9FA 1Q6EA 2V2CA 1I2OA 3O6YX 2P0OA 1B0IA 3M07A 2WNNA 4M81A 2VX7A 4Z1BA 1RUSA 4TVDA 4EAYA 2CYGA 2G3FA 1Z48A 2XUCA 4KRUA 2EXOA 2GQ8A 4B9ZA 4FX6M 5HUPA 4JPGA 2VC7A 2GUYA 3STPA 4RV8A 4YVVA 2TRSA 5JVLA 1Q63A 3NO5A 1XKYA 4DBWA 1WOBA 3ZR5A 4GY7A 3CM4A 3QF0A 1PTGA 3ITCA 3EA1A 5D2XA 1Q4NX 3U5YA 3K1GA 4C1NA 1JPDX 4NNAA 5DELA 2W3ZA 3CUHA 4M24A 1OG6A 2FB3A 3O2LA 4AVNA 4AHQA 3M5YA 3OVRA 5HULA 4HPGA 3FS2A 1YTEA 1ZAIA 3JZUA 4CCCA 1UWIA 4HPXA 3DX5A 2DT3A 4DN1A 5AHLA 1J01A 1H0IA 1H7NA 3UVIA 1R86A 1VENA 1W3JA 3TTYA 4YTRA 1CB2A 4HCLA 4B5NA 3S6DA 4DBDA 1BTCA 2R6OA 2GSJA 4L6DA 1FCBA 1HQTA 1FTXA 5CBBA 3C2VA 3NM1A 2A3HA 1UMYA 4GK8A 5DRIA 4F66A 1J0JA 1S2CA 1GVSA 3A3HA 4QRNA 1EA9C 4IIBA 3AIRA 4KWWA 3IJ7A 3PZVA 3MY9A 2R82A 3DKJA 1X97A 4QAWA 3W7KA 4UFMA 3WH5A 2B31A 3LPPA 3SCQA 3LTYA 5CQ1A 4JY9A 5BU6A 1XM3A 3RM8A 1JPIA 3DBNA 3OO2A 4D6FA 1U22A 2ZRUA 3MYPA 1AFSA 1A0CA 4KQNA 3O6AA 3AU6A 1HT6A 4FF7A 3VU2A 3UWYA 3CZEA 3IUDA 2TYSA 1EWDA 4JTFA 4Q7BA 5HNRA 2YA2A 4P5UA 2NV2A 3B0YA 1GNXA 4CNOA 4PTWA 3O1NA 4O15A 5FF7A 2FH8A 3ZVHB 4CU8A 2PLKA 1D2KA 4MNMA 2FDMA 1JCYA 1TWSA 2JKPA 3P2VA 1Q8AA 3M0LA 3M7WA 4ES4A 1GT8A 3TAOA 1J8VA 3UJEA 3AIUA 2E8ZA 4R7JA 3NOEA 1HKMA 2PS2A 3BANA 5I6SA 4HU0A 4XD3A 1SMAA 4J35A 3LQLA 1MXSA 4GGBA 2BLEA 3VIPA 3VYLA 4A35A 3BGJA 3ZJ7A 3SRKA 2VEKA 3OGRA 1UR8A 3Q4DA 4BF9A 1R2SA 2D2GA 2E5BA 1RD5A 4QEHA 3APTA 1MVYA 1UD4A 3KAOA 4O57A 4S3KA 4CU7A 3A23A 3SB0A 3B04A 3TN3A 5G1YA 1H51A 1OB0A 3QMTA 3E12A 3BZJA 2HSAA 4H1ZA 4D6JA 3VIHA 1R2TA 3ZWSA 4OWGA 5CZTA 3BCDA 3VNYA 2YXXA 3MWCA 3TYEA 3WDIA 2FPVA 2FDSA 1GPWA 1T40A 2NSXA 2HPIA 3W26A 4KCWA 3UZ5A 3GK0A 3ZQ9A 1MUCA 2TMDA 2E1DA 3ZS4A 2PLCA 4J5NA 2BB0A 1W9DM 1AH4A 2IXVA 3WN6A 2XIQA 1KFLA 2GYIA 4OV4A 2E0PA 5BWFA 1H0GA 3I4EA 3UNTA 3E74A 1QK2A 5FAGA 4JKKA 3R0UA 4IIEA 2ZZ4A 4QJ1A 3TOPA 1NU5A 3LHVA 1FWIC 3HG2A 3W02A 1EYEA 2XISA 5HUOA 1Q2SA 2WMFA 2ZYFA 2UY4A 1GVEA 1KXVA 4PMQA 3L12A 2FVKA 2VRQA 2QJMA 2JEQA 3M0MA 3PSWA 1F3EA 4ZXOA 3LCXA 5C71A 1VCFA 4BEQA 2O7SA 3QTPA 4ACYA 1GTEA 2WZMA 1EP1A 3S1WA 2NV1A 2UY3A 4HPNA 3VIMA 1JYVA 2XG9A 4HK6A 4QCEA 4X60A 3KZPA 4XO6A 1TV2A 4GD0A 2WNQA 2WZIA 3LLXA 1LOQA 1DJHA 4Q8TA 1A5MC 4GYPA 3KOYA 3TQVA 4PUWA 2J62A 5MHBA 4Q8OA 4PCTA 4DXXA 2EPNA 3R0KA 3L4UA 2XINA 2D73A 1Q65A 3MUY1 3EPNA 2FKPA 3AHVA 1TV4A 4QITA 5M1TA 2Y88A 3DN5A 2PC8A 2H8XA 2GQ3A 3K4AA 3SQLA 1VP5A 1BWLA 3EMCA 5LZLA 3O0KA 4XTDA 5LGZA 3EOUA 4C1KA 1H4PA 1D8CA 2HCVA 3FSUA 4LW7A 4N7QA 3STEA 3BLIA 4IL2A 8XIMA 3AMDA 1WKFA 3HQ1A 3LBCA 1XG4A 1OFEA 2OGYA 4J9JA 4RKAA 1PYFA 3VMNA 1MEIA 1V3KA 4S1FA 3S5ZA 3LK6A 1ZP3A 1XF0A 1XLHA 4G7FA 3RO8A 4XISA 2OZ8A 5B7ZA 3W2NA 5A6BD 2KX9A 1MFVA 4FZIA 1MW3A 1Y7VA 1DHPA 4H6EA 3GM8A 1W32A 2PD9A 2DVXA 4HHLA 3GIPA 1F3WA 2QHAA 4QXIA 3MBFA 3WEZA 1L8NA 5HWMA 2XH0A 4WKAA 3MMDA 2QPSA 1GW9A 3R58A 2X0YA 3R6IA 3WKZA 1F4AA 3T08A 2Y5EA 1V6XA 4GYFA 3PWAA 3W7MA 4IQDA 1D3HA 4NASA 4U2ZA 1KNWA 3N19B 3TZNA 2F8QA 4IPIA 2A21A 3WJZA 1A5NC 1MXDA 1R3TA 1BVWA 1QO5A 2CETA 4POCA 4V28A 2Y2WA 2D2HA 1Z32X 3EXRA 4IWWA 3V18A 1KW1A 3LD5A 5FJJA 4XX6A 2O9TA 3HZ3A 5HJYA 4BQ5A 2DSVA 3I7RA 4R3UA 3SJNA 3I68A 4GH3A 2Z7GA 3PBGA 5HAOA 3W7NA 4QJ3B 4GLEA 2IQ0A 1UR0A 4P7QA 2Q3RA 3UA4A 3I3DA 4RPPA 3ARZA 1KM3A 2F61A 3CV2A 4H7ZA 3W81A 2PDXA 1F3TA 4HYRA 4JYEA 3SIZA 2BGQA 4AD1A 1Z89A 5I03A 4HPJA 3KBMA 4LT9A 3H2EA 1LOSA 2XIOA 4TOQA 4C6KA 1J6OA 1UASA 1SSDA 4L9ZA 3P5ZA 2PDIA 1XRFA 4IQJA 4GVHA 3PSVA 1EXBA 1FWJC 4DM1A 2QCCA 5JQ9A 4MFDA 2HE8A 5DCEA 1I2QA 3W87A 3W2KA 3BLKA 4MJ2A 3EBVA 1U5HA 3PNZA 4DNMA 2ABBA 4XB3A 3STGA 3PJWA 1PEZA 1TJ0A 4ZEPA 3RNDA 1YE4A 1UKPA 1JGMA 3CQJA 3GUWA 1S2TA 4GNJA 2PWFA 3LPGA 2ZX6A 1TKKA 3MPGA 2ZVRA 1E15A 1VIZA 1NY1A 3QR0A 3VD9A 3WLQA 1KO0A 3ENLA 2PSNA 1ZBCA 3WUBA 1KV8A 3ECQA 3I3EA 4XVDA 1ZBWA 3VE9A 3S9IA 4Y9AA 3SGGA 1IIHA 2J4GA 3M43A 4Y6GA 3ZOAA 4DWSC 3RK8A 1BXCA 3EXTA 1JQXA 4LV9A 1H1YA 4B5TA 3M0JA 3PZTA 2PDCA 4JDYA 3SCPA 1P7TB 2YDSA 2DH3A 5LGXA 3AZSA 4XAGA 1UKQA 3VCNA 1TMHA 1EO7A 3KEHA 1SM9A 4JIPA 3TSMA 1ZAHA 3E96A 1HGYA 4C6LA 3AROA 2P8CA 3LTPA 1HNYA 3H26A 3AU2A 2J88A 4NZ1A 2VUYA 4WOZA 2VFGA 4O54A 2P3EA 1JIBA 3DGRA 2GJPA 3SIMA 1EX5A 2A7NA 1XD1A 1YEYA 3GU1A 2IPFA 3B8VA 1YBQB 3H21A 5FEXA 3LENA 4GCXA 1KM6A 1KCZA 1PV8A 2RH9A 3MDWA 4DI8A 4QR6A 5B80A 1V4YA 5MKGB 3ARYA 1P0DA 4RJEA 3I7QA 3N2MA 4JBRA 4EACA 4HSHA 4FI4A 1I45A 3H2OA 3PG8A 2PWHA 2ACRA 1GWJA 4GGHA 4O8AA 1RR2A 3W22A 4E2BA 3NDYA 3OVQA 5BRBA 1OX4A 3RR1A 1UUOA 3MUZ1 3DFOA 8CGTA 3GG0A 2QCGA 3JW7A 1JCLA 3H2FA 4M7SA 4IP4A 3NQFA 2E6FA 1DJYA 2JQXA 4JTCA 4NZ4A 4XZMX 4XUYA 1ZUAX 2V5JA 5KZ6A 2WVVA 3MO4A 4DVOA 4L9XA 1R47A 4YLWA 5EMKA 4GIEA 1WDPA 4S3GA 1W17A 5I3FA 1IEXA 1MW2A 1VC4A 1OZMA 5JU6A 3UZWA 6PTDA 3P8IA 4Z08A 3E2QA 2JIWA 3BJSA 1RK5A 2XZ9A 2BX7A 4G5DA 3WF1A 1HIZA 1YPFA 3PZIA 1H2JA 3AALA 3QOMA 4HMEA 4HNCA 4UMCA 1E72M 1XW8A 2W4XA 4KFPA 4Y8FA 3QZEA 3VNJA 1SPQA 3T0TA 1GTHA 4ZE4A 3ITTA 1NP0A 3E2SA 3KTSA 4PUMA 2KZHA 4L1GA 4O52A 1KM0A 2D0GA 3EEZA 1EHAA 4LYKA 4AH7A 3W85A 2AMXA 3TJ4A 4IPJA 2AOSA 4DWDA 2I9UA 1IEQA 2RJHA 1XV8A 2EGZA 4MAZA 4YN5A 4ZOAA 2E1WA 3LGGA 4JN6A 3BAKA 4XIAA 4EE9A 1E6SM 5A6LA 4HKPA 3HN3A 4ZO8A 1OCJA 2BHZA 3F5JA 1C8QA 3PNUA 1B31A 3WG6A 3OGVA 3G0SA 3KFTA 3SQMA 4NQ1A 1QVBA 4UFJA 5F2IA 1RP9A 3XIMA 3CUFA 3UR7A 3TSDA 2PDPA 5AYBA 2ZUWA 3NDOA 3IJ9A 2CLOA 1RK6A 2A3EA 4O1FA 3A4AA 4AAJA 4J3ZA 5LIUX 1WKEA 4AD5A 4PTXA 1HKWA 1EP3A 1K7XA 1X6NA 2WOQA 3EWCA 4O4VA 4JTDA 3UCDA 3DKLA 3Q65A 3UBPC 1MMFA 5FJIA 4H9UA 4IUGA 4LVDA 2C1GA 4JTHA 4D1JA 4G7EB 4S38A 2W63A 3B40A 1QHOA 2IKIA 2XVGA 2ZVIA 3WQOA 1RD6A 1UH2A 2CXEA 5BU9A 1VD6A 1BVNP 4NI8A 1OFRA 1QI2A 3BICA 4HP5A 2GFTA 2WNZA 1DIDA 4R5EA 1VHCA 4PL1A 1RBLA 3H7RA 1ME9A 4ILSA 2ZRXA 3P74A 3IK2A 4HA0A 2C3ZA 2G4JA 1Z9AA 5BMXA 4K38A 3BG3A 4QS6A 4IF2A 1EO5A 2PPGA 2G50A 3GW0A 4DF2A 4PTMA 1EJ7L 2GVGA 3DYPA 4PMYA 3G1DA 1XLBA 3E02A 2PI6A 2ZXBA 5D37A 3W6YA 4I9MA 5XINA 3NQBA 2P5NA 4LSBA 3EWUA 1H11A 3POCA 3W1LA 3S6OA 2A5HA 3CL7A 3NR0A 1QXLA 4IZGA 4O8RA 3SM0A 4ZFCA 4NZJA 4DXKA 4UQ9A 4JQAA 3DFHA 1M53A 3KW3A 4I9JA 2HRWA 1K3UA 4OZOA 4CUCA 2QAPA 3GNPA 3WL1A 3EOEA 3P6LA 4QSHA 1DJNA 2BODX 4E8GA 1MXGA 2QUVA 3EWYA 4DO5A 3HQPA 4WD0A 4D6HA 5CLWA 4HMDA 3F4WA 1TJ2A 5AC6A 1J12A 4I5RA 1ZJIA 1LG2A 5ABFA 1OFBA 2FHFA 4I6KA 4TV6A 4QM1A 4JTKA 5CZJA 1FWBC 1FHDA 2H8ZA 4IXXA 4ZCWA 2DVUA 3C2RA 3PTDA 5G2WA 1IZCA 2SFPA 3GY1A 3G5EA 4MWAC 4ORMA 1D7FA 3ELFA 2Z00A 3LSCA 4AYGA 1V7YA 2ONEA 2J79A 3QMRA 3ZWTA 4PTVA 1HL9A 2A1YA 1BLIA 1MQRA 1XBYA 5EY5A 5CC6A 1KBBA 3AO0A 2O56A 3W1RA 1OFQA 1NF7A 3STCA 2EHHA 4BJHA 3TIMA 3H70A 2PB1A 2XM1A 1QBAA 3ARTA 3KBWA 1JFXA 5E0FA 4LFYA 3T2QA 3GIQA 4EP8C 4EWJA 1H7RA 3R0DA 2FB2A 4M51A 1NWUA 1IV8A 3R12A 2YR1A 3AIQA 3GXDA 2JKEA 2VC5A 2YSWA 2WHLA 4Q7NA 4UTTA 3J7HA 3ES8A 4WY0A 4LQ1A 4OIFA 4Z2IA 1JZ2A 3V5CA 1QO2A 2GJXA 4C6NA 3A6OA 3NEVA 2WCAA 4K39A 1A3HA 3Q2DA 3TCSA 4XZIA 2A3CA 3QH2A 3ZR6A 5DT5A 2YYTA 4JFVA 4QE5A 3PC0A 3BV4A 4DLFA 4NYYA 2I1OA 3WEOA 4DYJA 3SCWA 1W3HA 4FHAA 1YQ2A 3VKAA 1RH9A 5FL1A 5E9AA 3IS4A 3GHTA 4NUWA 2OZTA 2VEPA 1DIKA 5K4ZA 1UMLA 2YW3A 3MQTA 2ZUMA 4MDOA 4GISA 4DBEA 4OECA 3SEPA 3HQOA 1IWAA 1B4KA 1TELA 2ZZ2A 4NXSA 2TSYA 3WF4A 1A5UA 4ZODA 3ZLGA 4YS1A 2Y24A 2DORA 1ADOA 2C19A 2VQTA 4HNOA 3M5VA 1I1XA 2X16A 3W7OA 4JYDA 3VNIA 4AISA 4ZQNA 1PO9A 3T81A 3IJIA 1CGUA 3BSGA 3BCFA 1UWSA 6TAAA 3NSMA 2GWNA 2INEA 4D6IA 3DEQA 1C8VA 1E0XA 1FHUA 2YDRA 2OJPA 5GJMA 3AC0A 4M56A 1F6KA 1WKDA 4GUFA 1RQHA 3CZKA 3G6LA 4XZHA 3TVAA 1S2VA 4AMCA 4BI6A 1XLIA 1UIPA 4YWSA 1V7AA 4DEFA 3RX4A 3YPIA 1S2UA 3B97A 3RHGA 3V1HA 1XIIA 2J8GA 3NSNA 2OSXA 3VIJA 3B05A 3LCWA 2QDGA 2Z1SA 1UD5A 1CXKA 3LHYA 4L4LA 4UCFA 5IRPA 2WSQA 3P0WA 2REQB 2QJNA 3H2AA 3W2MA 3PZNA 4REQA 5DXYA 5FD0A 5BWAA 3SO7A 4UBPC 4WOQA 1EJVC 1S3HA 1QATA 3UY8A 3GTXA 2YCJA 2GUBA 3PAJA 4FS9A 5A6JA 3CIXA 4FNSA 3KOZA 4QX4A 3IK4A 4DJFA 3ZVHA 2BS9A 4XD6A 2E77A 3R94A 2GZXA 3A3WA 2OLSA 4MUPA 5AVHA 1U30A 3WUGA 2GDVA 3ZT7A 1Z69A 3QC0A 3P80A 1X1NA 4UNLA 5FEZA 1EIBA 1FQ0A 3W7IA 1X7FA 2OX4A 1KM4A 4AMAA 5IHSA 3GVQA 4REQB 1XLCA 1LLOA 4PUUA 3FEMA 3MUCA 1IT7A 1XBXA 3GHRA 1TE1A 2QR6A 1M04A 3KLKA 3BLOA 3ICJA 1DQUA 3UPWA 1GEHA 2UV8G 1ELSA 3LRKA 2QCLA 1EXPA 4H8HA 3HJZA 3GVGA 1ZJHA 2NX1A 1EYWA 2QEZA 3L4TA 3EX3A 1A47A 4TX6A 4N02A 1QI3A 4LS2A 4LV4A 1E0UA 4QSFA 5D2YA 1FDZA 4DZIA 4PMNA 3ITVA 2Y63A 4QJ4B 3SN1A 2WZEA 3XISA 3IIOA 1S5MA 4KRTA 1FKWA 3FAWA 3USBA 1UROA 4O10A 5CSSA 1NARA 3GYEA 4N9BA 4M7TA 2PDMA 4PB3A 4LB4A 3DI1A 3F2BA 2VJXA 2NVCA 4OUIA 5DEZA 3AXKA 3IJ6A 1VZWA 4W8LA 4C7FA 3CHDA 5CJNA 4PCNA 1SMDA 2RFGA 2NQJA 2VCCA 2DEPA 4YJ5A 1JDDA 4GY1A 3WLLA 1UC5A 3L68A 2IPWA 3PBYA 1PIIA 3FGCA 4W8BA 4KFNA 1L6SA 1Q8JA 2ZUTA 1IXPA 2V81A 3S6TA 1NWRA 1VGAA 5GPRA 3AI0A 2Z4GA 4FLSA 2IW0A 4H6KA 1G4SA 1VS1A 3N6JA 3M6DA 3RLHA 1TV8A 4ZSUA 2J47A 3UQNA 1KFEA 3P67A 3WJYA 3CZ8A 3R13A 1XJBA 2QPUA 3WYZA 2GVJA 3AIBA 3VIGA 3U7VA 4U3AA 4JFSA 4OGZA 4HU8A 5KZEA 1BG4A 3TQPA 4F9DA 3F1QA 3HPAA 4ZOCA 3NAVA 3PUOA 3BW4A 4DUOA 3TWAA 1T99A 3UG4A 2WPGA 5RUBA 1G9HA 1B3OA 3T0AA 4HZ8A 3WDPP 4O18A 3K8LA 1TQJA 1U5JA 5K9CA 2G3MA 3P8JA 3HF3A 3LXAA 4I6VA 1Q6OA 2BBFA 5D2WA 2OWWA 2GWGA 4AZCB 1S5WA 2BSLA 4M1RA 3A4WA 4PRWA 4UR7A 4XG1A 4DPPA 3GVWA 2GGGA 4V2XA 2J7GA 3S1VA 5K4XA 4JIRA 4S3DA 1Q13A 5I09A 3DUGA 1CPUA 4PULA 3HPSA 1D3GA 5EFFA 1DXEA 1OX5A 1MNSA 1AL7A 4AY1A 2VTFA 2VGIA 3WLHA 2V0TA 1M5WA 4U10A 2GVYA 2ISWA 1E6ZA 3MHGA 3W71A 5A6BA 1I1WA 5HQEA 4PN2A 3D46A 7XIMA 5HATA 4ASTA 1O7AA 2NLYA 3UFYA 3S9ZA 1OCBA 2AKZA 4XD4A 2PZNA 2OLAA 3B0UX 1TVLA 1WAWA 1FX6A 2V38A 1US3A 3N29A 3S5YA 1FKXA 3W07A 4JHMA 4RX0A 3MJMA 3M0HA 4DJED 2D2OA 3MB9A 5HWNA 1RSCA 1P0NA 1B2YA 1SZNA 1K8CA 3WK0A 5IDIA 3D0CA 3WQDA 2GQAA 2CWNA 1BGGA 3FYOA 3GH7A 3EX4A 2FMNA 3CH9A 4J2PA 1QI4A 1LQ0A 5CZ0A 3LEPA 4JTJA 4O0QA 5LIYX 3IRSA 2WQDA 2ZRWA 2FTYA 3I7SA 3TX9A 2BY2A 2I14A 1CX9A 4UOQA 4ZO6A 5DBUA 3RIKA 3OGSA 4K68A 4BI7A 1E3XA 1FOBA 1TR9A 2GK1A 4PGLA 4OBSA 5HPOA 4JGDA 4D6GA 5FCZA 1SVDA 2DSKA 1NJJA 1OX6A 2DY3A 4FX8A 4DO4A 3Q37A 2L5HA 4AZ5A 1XC6A 1QWKA 1B57A 1RY0A 3C6CA 4PFMA 1KA9F 4GIRA 1WQ5A 1RLCL 3A12A 4KCUA 3CYVA 3JR2A 1S2AA 4C6CA 3F4VA 4BF5A 1O12A 9RUBA 2JBMA 3ID7A 1PS9A 1E6XM 2J75A 2WHJA 2AKMA 3CZLA 2E5CA 2FTPA 1LM1A 1HUVA 4JAWA 4AD4A 1Q3NA 3NQ2A 1YXDA 4IMAA 1FHLA 1DL3A 2BVYA 4K8EA 3EDJA 1CDGA 4CQ9A 1OFDA 1HKIA 4HNUA 3N3TA 2YXOA 2DIKA 2PU1A 3UG8A 5HJLA 3R8RA 3VMOA 3BAWA 3LY0A 3BUVA 1F7BA 1M68A 4LAOA 5K7JA 2AMGA 4D8LA 4PYSA 4OU1A 2CLIA 1QNRA 3TTSA 1FY6A 4PUNA 4AIEA 5A8GA 1CLKA 1F8IA 2X2YA 2CFFA 3KDNA 3W25A 4H7CA 2P8BA 2FGZA 2RGMA 5E6YA 1K4HA 3ABZA 3UG5A 3E49A 1XDJA 4QDMA 1YE6A 2DT1A 1UG6A 1U33A 1VEOA 3NG3A 2O55A 4URIA 5GVJA 3WH6A 4HBKA 1W1B1 3GZAA 5DCDA 3UXKA 1A0EA 2C91A 2HPMA 4GJIA 1YX1A 4JS3A 1A53A 2FZDA 2DQWA 1H50A 4HIBA 3WJSA 1OX4B 1PZ0A 3ATYA 3KVJA 3C3NA 1B3WA 3W6LA 2RDWA 1J79A 1R0MA 5A2AA 3GXTA 3G1SA 3VKKA 2CKRA 5CLTA 3G0XA 3OZMA 3BGAA 3CEPA 3KL5A 3M1ZA 1EOMA 4MLJA 1JYWA 1TCDA 5D8ZA 5AC4A 3DGBA 3CL6A 1Q6GA 3TWBA 3KRBA 3QLLA 3NVDA 4GI4A 1OT2A 4MB3A 4XIMA 1HP4A 3NZQA 1TWDA 2VGFA 2JALA 1AA1B 3LXCA 3HOJA 4DAFA 3S0CA 1S38A 1R46A 3ZXWA 3FJNA 2V3FA 1Y0EA 3ANUA 4FNRA 2C71A 3FHQA 3W1QA 3EPMA 3BTNA 3A24A 2WKJA 5I0DA 3HU7A 1GORA 1L0PA 5IFPA 5EA9A 1YMYA 4TU1A 3LCFA 3WBXA 3CUZA 4HSOA 4WX2A 3QJAA 2W6RA 4LANA 1GOKA 3P93A 2DV0A 1DQWA 4Y9PA 3RU6A 4H2HA 4KEVA 4J3XA 2Y6ZA 3MHFA 1KKRA 5DCBA 5K3VA 4Y8EA 3VOGA 3NQ6A 1IR1A 5CPQA 4RDYA 4PFHA 1CWYA 1K7EA 3KDOA 2W27A 1TR1A 3BLDA 4A4AA 4FXSA 3E0LA 4DYKA 4WK9A 1AMYA 4WY0B 4XZLX 1OIMA 1M3UA 5E0CA 1RAKA 2G5WA 3W86A 5HNNA 2QLYA 5BXSA 3QFEA 1PCKA 3SUWA 1JYNA 2EF9A 1Q6DA 3FJLA 5G4EA 4MADA 5HJXA 3O06A 1J5TA 4IICA 3HPZA 4MNJA 3WJXA 4QTGA 4L6OA 3BXWA 1FWWA 1TPVA 5AC5A 2PGEA 5FJUA 3I10A 3SN0A 3URQA 3N15A 2OZ0A 3IRDA 5H8UA 4GX8A 3DG6A 4K8HA 3W88A 2Q09A 4R88A 4MB5A 1BF2A 2GOUA 1PKMA 4KF1A 4H9XA 2E09A 4NAFA 3MUXA 1C93A 5JH2A 5AHFA 4KWUA 4P7LA 3ZT5A 3W7HA 3NL3A 4H9VA 1LL6A 1RV8A 4OT7A 3GDLA 3TV8A 1V3MA 1TPFA 4IFKA 4CGTA 4UFKA 1C92A 3JZEA 4P8VA 1KR0A 2QCMA 4LNYA 6A3HA 1W1YA 5CPNA 1XHGA 3FY1A 3WFLA 2C79A 3B0XA 4MYXA 1DWGM 3H6OA 3TJIA 1X6LA 4B3ZA 1EP2A 1HW6A 2NSOA 1LF1A 1ZRQA 5AKQA 1W2VA 4MWAB 1X7IA 3RXZA 4CQDA 4X61A 4HK5A 1XYLA 1QTWA 1ZAJA 4M0XA 1QPKA 3QSTA 2XGZA 3QFWA 2PWVA 2OFJA 3UWQA 3C0JA 4GQBA 3N25A 4W7UA 4CNPA 3L5AA 3KVMA 3BC9A 2Z27A 1T6MA 4JTGA 1HP5A 2VEFA 3GFZA 4EXAA 1YNQA 1P7TA 2OO6A 2CIPA 2E7FA 3GWQA 4N9EA 1R7OA 3FKKA 3S2CA 5FI8A 3P7YA 7TIMA 1O5RA 5LXEA 3W4RA 1CGVA 1BSIA 3UWZA 2NT1A 2YB1A 4IGMA 1AMKA 3LI0A 3WQPA 2W0UA 5I23A 1I2RA 1HVQA 2G97A 4LAZA 1XX1A 3MSYA 5AN7A 4YXGA 5H91A 1L6YA 4UTLA 2WANA 3S83A 1CGWA 4LF2A 1JF6A 4ZENA 3HV9A 2WCSA 1VFMA 3E0FA 4C5ZA 3VINA 3W38A 3K4DA 1MQPA 1V0MA 3C3UA 4Z1AA 2V6AA 1KGUA 3TXZA 1ZL1A 5CCZA 2NUXA 5M2FX 1O5KA 3NQEA 2V82A 1U1HA 3K2GA 4NKCA 5JBEA 2ESCA 3GG7A 4L56A 2V67A 5HANA 3WLIA 5FJTA 2EPOA 1GKPA 2CWXA 3IIVA 5BOOA 4PMOA 3SADA 1Z8AA 3V3WA 4V1XA 3T55A 3R8GA 4IFKB 4WQ6A 2WB5A 3QLDA 1DPMA 5CJ5A 3RYSA 1IQ8A 3HG5A 1NQKA 2CNCA 1IEWA 3ZIZA 1PHQA 3TNBA 4CN1A 2YPIA 4CN4A 3RRAA 4MFEA 1CBGA 4CEXC 2D2JA 3LBOA 4PMDA 3W01A 3WMLA 4AC1X 4P61A 5LNSA 4B5SA 3FLUA 3FJ6A 3A47A 1OGBA 1XIEA 3BAIA 1PPIA 4TIMA 1PCWA 1XH2A 2QF7A 3VO0A 2B7OA 3ANYA 3M41A 1US0A 2WVUA 3TN5A 3UU0A 1ZU8A 1DQXA 2NXGA 1HJVA 1QNPA 3W7PA 4Z1YA 1E40A 3THCA 2WVSA 4TR9A 2DZAA 1PDZA 4HHPA 1SW3A 3WQVA 1HFBA 1VJIA 1POJA 4GVIA 1WBJA 2PCQA 4EKJA 1JI1A 2DIEA 4MB4A 4UTTC 3PTQA 3WDJA 1OCQA 3N18A 5HINA 3HIJA 5I2UA 3E2VA 4G56A 4HJFA 2G41A 1E4MM 4GCAA 2ZOXA 3TR9A 3WY1A 2C16A 1QNVA 3T42A 3C5QA 2VZUA 1E6RA 1V51A 2OTDA 2NT0A 4Y96A 2IPJA 4DNHA 2CU0A 1TRDA 4Q33A 4PA8A 3VD3A 2OGJA 3ARPA 4LF1A 4OQVA 1EJUC 5TNVA 1DXIA 3BMVA 3S46A 1M41A 3M7SA 3OZOA 4N2YA 3IJDA 4IT1A 3MHUA 3D5HA 1W56A 4QBXA 2XTKA 4D6DA 3BQ5A 2LLEA 5I24A 4JEJA 3CS2A 1KGWA 2VURA 2E68A 1LL4A 1DWIM 2YCLB 2Z1VA 3GDKA 3B9EA 2QUUA 4K36A 4GIYA 4M3PA 3EWXA 2ATMA 3WH8A 2J9YA 4E5TA 4GE8A 1DYSA 1W8SA 4Z0SA 1NIUA 3NGJA 1XPGA 2C14A 4GXMA 4P8WA 4QP0A 4NF7A 4I5UA 1VLIA 2XDFA 5CGTA 5F4XA 4ZL1A 5DMYA 2PAJA 1FWSA 1XLKA 4UTMA 1I2PA 1TSIA 1M7JA 2QMKA 4IGHA 1IIGA 2AAMA 4OKDA 1XWYA 1H41A 4WUIA 2VCAA 1QOXA 1JZ4A 4XKYB 1OFPA 5TF0A 2ANUA 4HMNA 1ISZA 4X63A 3DAQA 3GDTA 3GR8A 3L2MA 1CNVA 1W1TA 3MSRA 3S2JA 3WDQA 3B4YA 4KFOA 2VENA 3E5BA 3MT1A 5MKGA 3GQYA 1XYAA 2FZ8A 3NEHA 5EMUA 1MUWA 1M65A 5KSWA 3N2TA 1WYIA 3DOPA 1AUSL 1NTHA 3UZZA 2QS8A 1AZ2A 3NPVA 4GRSA 4JX6A 4JIEA 5EL1A 1MUMA 4CD5A 3VABA 3TK7A 1ISWA 4QFUA 1EC8A 3E0IA 2QV5A 1R3VA 5BOEA 5G2HA 1XLAA 2YX0A 2E40A 1S39A 4LX4A 2BVWA 5AY7A 1RBAA 4US6A 4J7RA 3GC4A 3G1AA 4PUKA 3ONCA 3KP0A 1W1VA 2NX9A 4W9TA 3MCNA 5A1AA 1OFAA 4MLRA 5A6TC 1Q66A 3TKFA 3GFYA 1DXFA 1PKYA 4GXWA 2POZA 4YL2A 3WNMA 1WZAA 4EAMA 3BAJA 2F6UA 2HV5A 2B81A 1THFD 1H7PA 1TPC1 5F4WA 4DUWA 4JTLA 1EA0A 4UR8A 1GHSA 4C6IA 2J7BA 4YNGA 3FW6A 3CIVA 2E5DA 5K9XA 3TU9A 3TN4A 2EKGA 5G1MA 2WYSA 4D8AA 4AB4A 1IEVA 5AVNA 4DI9A 1MNZA 3F4CA 4I8YA 3NCOA 1VYSX 4CN6A 4QQUA 3DFTA 4XAZA 3RILA 1NF0A 4HT3A 2PRHA 1VAHA 3IV3A 3KP1A 4HZMA 5EYWA 3FEQA 4LAKA 4AHOA 3QW4B 3ZSTA 3CTTA 1XSKA 2Q8LA 1UYQA 4HN4A 4MIMA 3B8IA 2RDUA 1E71M 1U1UA 3V35A 3AFBA 3WQ5A 3B0VC 1ZPTA 4YTQA 3BZGA 2HVNA 1PYMA 3F5KA 1Q7ZA 1BWKA 1OFOA 5G4HC 2ICSA 3WNLA 3B03A 3GZ3A 1R5YA 1R87A 1WV2A 3PR2A 3H2NA 5F7UA 1KBKA 2XGIA 1US2A 1F05A 5BZAA 3U2EA 5I3KA 2NLIA 1RVKA 4IHCA 3VM5A 2V9DA 4YWIA 1JCTA 3TLQA 2WMGA 1QNSA 2BHYA 4L6HA 3AWOA 3OHIA 2ZZ6A 3ABSA 1MW1A 3ARVA 2VGBA 1FCQA 1IYXA 3SRFA 1E9YB 3FV9A 1TQXA 3VIKA 4AZ7A 2C8NA 1XL9A 3SCRA 2PGFA 3AHXA 2GJXB 1CLXA 1Q7MA 2V3GA 4HK7A 3MCOA 2FYMA 4LC6A 4W87A 4M6VA 5L9FA 1XQLA 3PULA 3GKAA 3HURA 1G69A 1GOOA 4H6RA 5D4YA 3VE7A 5DT7A 3WLTA 2GPTA 2OYKA 2PLMA 1UBPC 5AC7A 3WNPA 3GSMA 4IQLA 3WNKA 1LOLA 4LBRA 1LYXA 1POKA 4LS1A 2D3LA 3VCRA 1IR2A 3MS8A 1XLMA 3T7VA 1VRXA 3M0VA 3ZT6A 1RY8A 3M46A 3TMQA 4R85A 4WDTA 1S2WA 3BG5A 4LVFA 3RM9A 1W37A 1OD8A 4ADSA 3TTQA 4O17A 4B9YA 4Z0JA 4ZOBA 2Z0IA 4ICNA 2YGYA 4W5ZA 2YKKA 1EEPA 1KCKA 1VFHA 3DYMA 2W9MA 1V6TA 3V4BA 4AD2A 2WLYA 3NA8A 3U6WA 4WHBA 3CL8A 3P84A 1S3TC 5M03A 1TYGA 4GO9A 1WCGA 5C54A 3G3DA 4N6FA 2R9RA 2VZOA 1DJWA 3PFRA 2R94A 3O0FA 3FJ4A 4ZB5A 2BASA 1LLZA 1JULA 3HA1A 2VT0A 5LA2A 4MY9A 1HO1A 4IMCA 1KTCA 1ZJBA 3QV9A 1S5NA 3DFPA 4E2VA 1GYLA 4DHGA 2IKHA 3PZ9A 1KV5A 4C91A 5D32A 1ZTVA 1AQHA 4FK9A 3SY8A 1Q4WA 3L2IA 2ZCGA 3LV6A 4NX5A 1LJYA 2VO5A 5I3HA 1GUVA 4ZXLA 1RJQA 1EF3A 2Q8ZA 4QNWA 1EC9A 6REQB 2H6RA 1UIOA 3NVTA 2FJKA 2NXIA 1ZFJA 2C13A 1W1PA 4Z2HA 3TC3A 1XCWA 4LAMA 1JGIA 2PWEA 3BO9A 3HO8A 4A2RA 3I4KA 1EGZA 1A4MA 1FDJA 1AW1A 3E1F1 1LWHA 2ZXQA 3LMZA 2XSBA 4R7WA 4CD7A 1GOIA 1OCNA 4QHRA 3KUMA 2ZKMX 5U4NA 2QDHA 4WJEA 4HNNA 3SSZA 1BRLA 1VCGA 3VCCA 1O68A 3EB3A 3QZ6A 3DI0A 4XSMA 3VD5A 4Q4MA 1LQAA 1TG7A 3MSDA 3L0NA 1YTKA 4I5XA 4RW5A 3GHSA 4U3CA 3RR4A 4A8RA 2VDGA 1R3YA 5CZSA 1PB0A 1ISVA 1RVGA 2EPMX 4MAVA 3DG3A 5DY2A 3S2NA 3K13A 4H19A 5F1UA 3SY5A 3THDA 2ZUNA 4PE8A 2YL6A 3TUUA 1KM5A 4US5D 2E3ZA 1BVZA 1UWUA 2UZ9A 3S9YA 3GU9A 1GVFA 4J1OA 4HSNA 4CKQA 2A6NA 3NQAA 2DJLA 3QTGA 4B4HA 1SO3A 1JFHA 2I7GA 1Z7AA 1BAGA 3OA5A 3P62A 2ALRA 5DMMA 2A7PA 3BSMA 4H9YA 1BKHA 4XKMA 3QGAC 2Z24A 2DDXA 3AMCA 4TO8A 3GVRA 4BF7A 2PDFA 1A5KC 1EDGA 3N34A 1HJQA 2VFIA 3C8FA 4JTAA 1X98A 3VXGA 1UOKA 3UR2A 2FPYA 3QV8A 5FJRA 1GYNA 5E6ZA 3KBJA 3XINA 3ZM8A 3B8DA 3LRLA 1F6YA 4GYKA 1IXNA 3K4WA 3G6MA 3MA8A 2QVNA 1GOWA 5CC3A 3LHWA 1P4CA 2DT0A 5EPDA 2WMJA 4H9ZA 4MKSA 3C61A 4JL1A 2XFRA 4BI5A 2Z26A 2X1UA 5DN1A 4AG0A 4ZMGA 2PF8A 4C6MA 1LTDA 1EB3A 2ZQ0A 1GVOA 4K1WA 4J3WA 4JQ4A 1Y8BA 4V33A 3M5ZA 1ECEA 3TMLA 1DIOA 3B8UA 2JF6A 3G1YA 4L1XA 4JDBA 4FNQA 4JL2A 3PBVA 3EDFA 1JNDA 2GSEA 4LYPA 2F2HA 1VYPX 2ASHA 1O6IA 4XAFA 1WKYA 3GXFA 1V02A 2E8YA 2INZA 3HG3A 4QQ3A 4Q32A 1XDLA 3QV7A 1YNYA 4Q8VA 1IF2A 3R5EA 1FDYA 4EK7A 3IPWA 2Y5SA 4F3HA 1S1RA 2PBOA 3SFKA 1K03A 3PFMA 3VC5A 1GYMA 4J3SA 5T91A 2UWFA 3ALGA 2WSKA 5A6KA 1SFTA 3UF9A 3WBYA 3D3FA 4OBRA 3RN6A 3U8GA 1TV3A 1YTDA 5FIPA 4CCDA 2OOGA 4DO6A 2GGIA 5EFDA 4PCPA 1M7PA 3AICA 4QE1A 4YVXA 3CZGA 4G1NA 4MJZA 1HGWA 4UQEA 2WVVB 4A3QA 4H3DA 3TROA 4X2RA 1W5MA 3AQUA 5BXPA 3LCLA 4IP7A 1GCYA 2EJAA 3VIIA 2C0AA 1EUNA 4Q8NA 4F0KA 5IM51 2J6VA 1V79A 3WQ8A 2VC6A 3TYAA 2WSRA 1XLFA 5AYIA 3VAVA 2QCDA 5DX7A 3SY1A 3GE7A 2HXUA 1QNOA 3SZ8A 4UQDA 1B3ZA 4JIIX 5AYYA 2O9OA 4NILA 3BMXA 4J3UA 4P7NA 5EMYA 1T0OA 3D6NA 1XIBA 4F40A 1FWEC 1EDTA 1LUCA 1J11A 2HNEA 3II1A 4J4KA 4E2DA 3O63A 3O7UA 1E0WA 3LBMA 3MI3A 4FEZA 5CGMA 3B8SA 3UNDA 4DBSA 1TA3B 2BG5A 2KAUC 3MV11 2QVHA 3G1RA 3TJXA 4GY0A 3OG2A 2BZNA 2V2DA 1QFEA 4FR1A 1X8CA 3RLVA 3LYEA 1YKWA 5EKYA 1QPRA 4DQWA 1EBHA 3IGUA 3PPHA 2YYUA 4PRRA 1TB3A 5D30A 1L6WA 3VKDA 3L2LA 3AYVA 3PF3A 3G1FA 1NH6A 3URNA 3N17A 4A2SA 1GQLA 3LU2A 4YYCA 4HA3A 5JXQA 1SO5A 4PUEA 1AQFA 5C9ZA 3UESA 5D02A 4LYQA 1HJXA 1J0IA 1E70M 3DU0A 4ATWA 5H8PA 3SCUA 3HM7A 1PIFA 2ZRYA 2VRKA 4NNCA 2TAAA 1YLVA 3BE7A 3CT2A 4KIRA 1XFCA 4AZHA 1BFNA 1H62A 2PGWA 2MUCA 3W72A 3U2OA 4KWOA 2WM1A 1KGXA 1HL8A 3ARSA 4BWLA 3GXNA 4ZE5A 4E6MA 2D20A 2QCFA 3VD7A 2QJHA 1AH3A 2BVDA 3O9NA 4EF9A 1NOWA 1E1EA 2ZE3A 3WK1A 2Z2UA 3CO8A 3H55A 1G6CA 4I7UA 2YXGA 1HXJA 3QBUA 5DY3A 1QK0A 1BWVA 4J3TA 2XVPA 5FA5A 5C2XA 1GEQA 1WXZA 4C6OA 4KIEA 3MYOA 4AEEA 4O13A 1TTJA 2ZZ1A 4RNHA 1OIFA 3WQCA 3VKJA 5CSYA 3OYZA 1R8LA 2B4GA 1EUAA 1R2RA 3VDBA 1YPXA 3H4XA 1VEMA 3B8WA 3W7LA 5ENLA 3S1UA 5FL0A 3D47A 3F2CA 4S3JA 4DJEC 4ZOEA 1OSEA 1ME8A 3CAKA 3DENA 2XWEA 1WBHA 5AYZA 4K1GA 2ABAA 2OQLA 3I6EA 2X8RA 2V2HA 3W2LA 4L4OA 3CASA 3PS7A 2G3JA 2D0FA 1WE5A 2PP1A 2QCEA 3O6CA 4CD8A 2CLKA 2QUTA 3W74A 4PMUA 4E3VA 1AH0A 2C1HA 1PAMA 4R9OA 1KXHA 5M5DA 1EOKA 3MMTA 4I7WA 2WM0A 2PFHA 4KEUA 4JTIA 1D3CA 2ZXAA 3SW6A 3UJRA 4YTSA 4AIOA 2BGSA 3FA4A 1JCJA 3CMGA 1V0NA 4DJFD 1I75A 1QI0A 4FF5A 5FF4A 2PEVA 4JNYA 1QI5A 3LCGA 1E43A 3SAZA 4GVGA 2DU2A 1CENA 1XRSA 1XR2A 1JL8A 2O4MA 1KFJA 1V93A 4N4QA 2PU0A 4RZ4A 3BOLA 3KTXA 4JOMA 4QG8A 3WSUA 1RQBA 3W00A 4CCZA 5CH9A 3VX1A 3VFLA 4MZYA 4JIHA 1NWTA 3G8EA 4QISA 4W8AA 1XUZA 3GTFA 4LTSA 5EMMA 5C8BB 4RDWA 1UCWA 4L65A 3MKCA 1YYAA 4PMRA 3BLLA 2VOMA 2DUZA 2WMIB 2H3DA 4O16A 1EGMA 4AIUA 1UH4A 4WDUA 4LUIA 3LGDA 1OVDA 2IXUA 1XRTA 1E0VA 1OABA 5D8WA 1UP3A 1TMLA 2XJ7A 5J04A 2DH2A 4K7VA 2VCBA 4E38A 4GQ0A 4P7RA 2ZWZA 4F0SA 1DJXA 1FFRA 3V0SA 5A94A 2VDIA 2PF0A 2NW0A 4GI9A 3WLNA 2BMBA 3TAKA 3WX7A 1DORA 1FXQA 2V5BA 3R10A 1H1ZA 2FZNA 1SW0A 3VKCA 2V69A 4OUEA 1AG1O 1SZFA 5LNVA 5DFAA 1IHIA 4HOZA 2VI0A 4IMDA 3PM6A 1OJXA 3FCPA 4AFYA 4QNEA 1VKFA 4ONVA 4PR4A 4RXGA 2QKFA 4C7DA 4IOTA 4ZQRA 4HTYA 2G3NA 1LRTA 4GQGA 3REQB 1ZLPA 2R1PA 1MQQA 1GK8A 2OODA 4HZ7A 3SRDA 2WPBA 3UD6A 2HXTA 4Z2JA 1JF5A 2VUNA 3GBDA 1QW7A 1MI3A 5CPTA 1W3TA 4S39A 1PX3A 3VNDA 2HJPA 3VMPA 2NV9A 1G4EA 1D7KA 3CC1A 4GA8A 2GGHA 3FOKA 3M9YA 1RJRA 4INFA 1HTIA 5KETA 5I79A 3W3OA 3HMCA 2J7CA 1D9EA 3NWRA 5KTLA 3UP8A 3T0BA 4XSLA 4DWSD 2WNWA 2OOFA 3KVLA 3VNKA 2R24A 1XICA 4YTUA 3WBAA 4IMGA 4LH8A 1PWMA 3GU2A 1W1IE 2V5DA 1CT5A 3S47A 3W7EA 2WJZA 1DEDA 4Q8PA 1TIMA 2ZRVA 1OINA 1ONRA 2BY3A 5MF5A 3GH5A 4KERA 3KCOA 4DXVA 3AYSA 5I5RA 1VHNA 5T9BG 5EB8A 2XFWA 3VDAA 1KM2A 5CXPA 4UOZA 4KWSA 1F8MA 4LCRA 4ICCX 2PA6A 4NRSA 3N9KA 3QY6A 2HVMA 1NAL1 1B90A 5HMSA 4B2DA 4JZ5A 2E9BA 3L67A 2VX5A 5CC5A 4A21A 3QMSA 3WENA 4ZZ9A 3RGTA 4AY7A 6XIMA 2VMFA 1J5SA 2E67A 2WWDA 3C2OA 4PH6A 3UYIA 4ROPA 1HG3A 1WOAA 1X8FA 2HS6A 2XVKA 3UG3A 5IOBA 3RDKA 4MGGA 4DUVA 3GKFA 2CHNA 4TXEA 3T44A 4JFWA 1V5XA 3V0TA 1TJPA 3KRSA 3C0SA 3FYYA 1WXJA 3N4AA 5A5WA 3EX6A 3NQMA 3TQKA 1E56A 2VFHA 4Y9MA 4HCDA 5LSMA 2PD5A 5HMEA 4AF0B 4H04A 2VX6A 2PCEA 5AHIA 3R25A 2BXYA 3OG3A 2G8ZA 1IXQA 4XAPA 2RHGA 4KPLA 3UZJA 4BHYA 1OGGA 1LORA 4GC4A 2Z2BA 3KOWA 3WL0A 3GTHA 5F2MA 3WEMA 1XLGA 4WZHA 4HU3A 4C7GA 2DVTA 4WXZA 3CLWA 4WSKA 2OT0A 1LL7A 4YPJA 2IQTA 3FYPA 3MC5A 1YNPA 2XWDA 3H24A 3OU8A 5LA1A 3E3HA 3RMEA 1RCOB 1JZ8A 1P6BA 3C0LA 1BSLA 4GI8A 3WQEA 1J10A 4KCTA 3IVUA 4F2BA 3EDEA 5BYWA 1Q6CA 1IXOA 4MSSA 4PC8A 4S3FA 1DV7A 4L80A 3WLKX 2AAAA 3UJFA 3HFYA 1YDNA 4TTGA 2PLJA 2Z1XA 1GZJA 3TEVA 1TVPA 4NP7A 2R1KA 2CLPA 3GD6A 3HJEA 2HK0A 1UA3A 2DFAA 3UPMA 4GKLA 3A9IA 1Q6FA 1O1HA 3ZMRA 4JXCA 1WUEA 4IX2A 4AD3A 3I3BA 5JBFA 1XP3A 4ERAA 3DG7A 2ZE0A 4OOZA 3BVJA 4IMEA 1TTIA 2OYLA 3PWIA 1W6TA 3PAOA 3VOHA 3CAWA 6REQA 5J5RA 3INPA 3N6HA 1WZMA 3EXSA 1GQKA 4NU7A 2BOGX 3N2CA 1C7TA 1FFQA 1REQA 5BRPA 1NDYA 1DE6A 4KH2A 2FFIA 1OC7A 3AMLA 3ME3A 2EEXA 4BCEA 4EIVA 3GB6A 4NZFA 4LY4A 3KZSA 4LVGA 1V3HA 2WW5A 4IGSA 4FAMA 1J18A 3CUXA 4GI6A 4U28A 4G8TA 3BSHA 4WDXA 4LCQA 3W84A 1XUUA 1TPEA 4H00A 5I00A 1BPLB 2DP3A 1BYAA 3FXYA 3HGOA 1ONEA 4WF7A 1WB0A 4XWUA 4HA1A 2QMJA 4IPNB 4Y90A 4S2CA 4QE4A 3P5YA 2VL4A 3S1XA 1HKKA 1QHZA 3NL6A 1LWJA 1RA5A 4QG9A 3MP5A 4IQEA 2CC0A 2X05A 1CECA 3TOYA 4ADUA 3T4CA 3F03K 1GOXA 3PPFA 1E9LA 4C6JA 3UCQA 4HHMA 2WLZA 2PWDA 3WD0A 5GJNA 1PTAA 3DHPA 3BQ6A 3MKVA 2WZHA 3ISIX 1T8XA 2VD8A 1UUQA 1W5NA 4GMEA 1N82A 4HTBA 1TV7A 1ODZA 1YPIA 3O8AA 3W2UA 5JIWA 1PSCA 2Y89A 1CGXA 3AWNA 3BWWA 4YIWA 4Y9OA 4WKHA 1C91A 4UTKA 3U9IA 3SRHA 1J4EA 4L64A 5TAOA 4FA3A 3T6CA 1QOQA 4AEFA 2R91A 4H6QA 3RO6A 1OBAA 3NL2A 2I5IA 4L61A 3TC6A 2YL5A 1MZHA 3V36A 5IDZA 4BKNA 1SW7A 1PKLA 4PODA 1CXFA 5E0KA 1X39A 3ARQA 7PTDA 1I2NA 5D2TA 2I9EA 4H01A 3I65A 4RL3A 1T41A 4MM1A 1DHKA 4UFIA 4F2UA 2YIHA 4WEVX 4B92A 3C56A 4PEEA 1UOZA 4OBTA 5I7GA 3RRXA 1VQTA 2F38A 2VR4A 4GINA 2HDJA 4A6GA 2P53A 2WKGA 4JR5A 2DZUA 3WH7A 5ABGA 4Z17A 1RZMA 2EG6A 3MSGA 2WSPA 3MJYA 2VEGA 4M1BA 5LNUA 3WLOA 5A6MA 3UR5A 5GNYA 6ALDA 2Z6IA 1GPFA 1LQ2A 5HA7A 1M03A 2Q3OA 4DY1A 2WV8A 4HNTA 1E9ZB 3KWXA 3DZ1A 2B7QA 3W28A 1FXPA 2VFEA 1SZGA 3Q45A 2HNHA 3E38A 2V5KA 3P81A 4MWAD 4D2JA 4FPSA 3ABOA 5CBJA 3IAPA 4FNPA 2OYMA 3W29A 3GG8A 2VP8A 2OG9A 3PWGA 2GQ9A 1OK4A 1R3QA 1GJPA 4U4MA 5C7HA 1CB7B 1QT1A 2VDHA 1E1FA 3NXFA 3WLRA 4X2PA 4GUHA 1ZCOA 3FHAA 1CW2A 1ZQ5A 6CGTA 3TA6A 3PJTA 1OF8A 5D33A 3M0ZA 2Y4SA 2ZUUA 3TH6A 1SGJA 1BYCA 1VPQA 3L7RA 3W7GA 5A8PA 5M3WA 4I8DA 3OHMB 1AVAA 1ZZMA 5EGRA 4JQ1A 1O4UA 1GQIA 4IG2A 1W3KA 3PB2A 1W3NA 1ZY9A 1G4TA 4L9YA 1VCVA 3UT0A 3V0UA 1E55A 4GXPA 1UPPA 2FZ9A 3EWWA 1W9PA 4O1DA 3SGZA 3WFZA 4DZHA 4AXKA 1FH7A 3TW7A 5BXRA 3GR4A 3L4ZA 1RP8A 4UIOA 4IFRA 4ZR8A 2B7PA 1FH9A 1RLDA 3ZYZA 4IL0A 1JAKA 4LRSA 2C7FA 3FA5A 3T8QA 4Q7IA 1YDYA 3LM7A 2FZBA 1CGYA 4A05A 2NQLA 3CNYA 1XIMA 3TN6A 1BEUA 1UD6A 3U7BA 1A5OC 1FWHC 4G7EA 4EOUA 4LUSB 4G2DA 4V1YA 1E0TA 4A3YA 1NVMA 2R14A 2ZC8A 3WO8A 3B8TA 2P88A 5EU9A 4JTEA 1Y5VA 4B91A 3NIYA 4NL1A 4ZQOA 5JBDA 1R9YA 4MWAE 1ONXA 1SQ7A 1SO6A 4FOUA 1I0BA 3M5XA 3QPYA 1R38A 2NWRA 4WCJA 3N6QA 2GGJA 2ACUA 2PDWA 2REQA 4LUTA 1FWRA 1XRVA 3FFSA 3MTWA 5TQLA 4NYUA 1G7UA 4WXYA 2CEQA 3DHFA 1PIGA 2Z2AA 1XIJA 4BFAA 3DECA 3MUIA 1VR6A 4JN7A 3ITLA 3FAXA 2EKCA 2V68A 3VDGA 1ME7A 3MKKA 3LN3A 2A3LA 2MANA 1KR1A 1H7OA 4XAYA 5D05A 3OLGA 4M6QA 4ML9A 5KITA 3SJ3A 2RKXA 3SCTA 4RNIA 2O9PA 2CBUA 5G4WA 2G95A 2BP1A 4AVOA 4O0ZA 3GUGA 2PP0A 3Q67A 1OT1A 2ON3A 3UY7A 4BQ3A 2BXVA 3OVGA 4FNTA 3NPUA 4NG3A 4DF0A 3WF2A 3VGBA 3AZTA 2DSZA 4CEUC 2DQXA 1MRQA 1W5PA