3DENA

Structure of e. coli dhdps mutant y107w
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
291
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYWNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutating the tight-dimer interface of dihydrodipicolinate synthase disrupts the enzyme quaternary structure: toward a monomeric enzyme
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 107
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3denA00
4LVAA 4CNNA 2ABAA 3W1AA 3W7PA 1EP2A 1P4CA 5G1TA 4JYDA 3EX4A 3W1RA 1LRQA 1QPQA 3S1UA 1EEPA 4N02A 4BFAA 3VNDA 1B57A 5DY2A 1SO5A 5IM51 2FPYA 3P60A 2CZFA 1X8FA 4JTGA 4Y8FA 5KMYA 3NQEA 2QEZA 1TTQA 4NXSA 4O13A 4XQ6A 4HNUA 1YLVA 2V30A 3FYOA 4Q4KA 1TPWA 1I2QA 5D2XA 1OHLA 4O1CA 3M5YA 3NQMA 3QYQA 3BW3A 4ZQRA 3S6DA 1H63A 5AC8A 3FKRA 1WBHA 1NF0A 3FFSA 4JTSA 1LYXA 2OZ0A 4WZHA 1W56A 2V81A 1FBAA 3NQGA 1WXJA 4QJ1A 1WA3A 2CLLA 5LSMA 1CW2A 1Z48A 2ZRVA 3RLUA 3GVGA 2VENA 3HQ1A 4K39A 1ONRA 1V7YA 3SGZA 1DBTA 4ZQCA 2A7PA 2NXGA 4NJGA 3PS7A 3NDOA 1RPXA 1JQVA 3HGJA 1EX5A 1UUMA 3LV6A 1KFCA 1S3HA 3MHUA 3NXFA 2ZFAA 4MJMA 2O7SA 3RU6A 3UWYA 3NQ7A 2ZYFA 4N4PA 3CHVA 5HINA 3QF0A 4Y96A 1VJIA 3UPWA 3LTYA 5K9CA 2C15A 5HR7A 3PBWA 3VE7A 5SWUA 2Q8ZA 3FYPA 3PB2A 3LI0A 2ZCGA 4IPJA 3LXAA 3M6YA 4AH7A 1TQXA 1W5PA 1MEHA 2YFNA 1H60A 3MW7A 3KVMA 5KZDA 4O50A 2FB3A 2QCNA 3OHIA 3MHFA 1K7XA 3P62A 3TNOA 4K8EA 1AW5A 4JX5A 3UZ5A 3W84A 4UFLA 5LHFA 4O1DA 3N14A 1JCNA 3GR8A 1H50A 3R12A 1LLWA 2WOQA 4M7TA 5CPNA 4R33A 5HR6A 1GJPA 1VQTA 3LTPA 2QCDA 1TIMA 3L5LA 4K7VA 3MYOA 4RLIA 4EWND 1X1OA 2GVGA 4IOTA 2FPTA 2IQTA 5U4NA 2C14A 2D73A 1Q3NA 1LTDA 1QPRA 2H6RA 4JTJA 4IXHA 4FX8A 3NL3A 1PIIA 3NQDA 4I7WA 3ZWTA 2RDUA 2AQWA 4PEKA 3EEGA 3W1PA 3P61A 1KFBA 5DXXA 3TJLA 2ATSA 2WJZA 2RFGA 3ANYA 4UTTC 3L5MA 4UTWC 2NV2A 2YFOA 1LCOA 3E12A 1FCUA 3TMLA 3KVJA 1KFJA 2Y61A 5DLCA 3TAKA 2GOUA 4DO6A 2Y6ZA 3W7EA 4BWLA 1GWJA 2QCGA 4LS2A 3TC6A 3PBVA 4ADSA 5BMWA 1W5QA 4J9JA 4AXKA 4OU1A 3W83A 4LVFA 3R2GA 4RV8A 3WK0A 1VGAA 3L67A 3IVSA 3A5FA 3H53A 1NEYA 5AC6A 3W7LA 2ZRUA 2CZDA 3KRZA 3GKAA 3MP5A 4GC4A 2RDTA 2WSYA 2CU0A 4MYAA 4FF7A 1BKSA 1L9WA 4QNEA 1H7OA 3M5ZA 3WJXA 3TH6A 1C29A 4JY9A 5G4EA 3W2NA 1JCYA 3HPXA 4ML9A 3EX1A 3L0KA 5K7JA 3C2OA 4LOCA 1XXXA 3AO0A 3CPRA 3SSJA 3C56A 4O52A 3BGGA 1OF6A 3QPYA 3RK8A 1GVOA 3USBA 3T44A 3EX2A 1XBYA 3SW6A 3S1WA 2BWGA 3VI2A 2FB2A 3LX9A 1S5WA 3CIXA 2BLEA 2R91A 1EIXA 1A5BA 3E96A 1I45A 2JKEA 4LS0A 4UC5A 2WPBA 2DJLA 4GNJA 2FLIA 4RZ5A 4JNMA 4DO4A 1XUZA 3P82A 4JTUA 5HWJA 1JCMP 3EWWA 2OT0A 1GYNA 1G69A 1LP6A 3CEUA 4KKXA 1LORA 1I2OA 1OFBA 1HG3A 1THFD 3QMTA 3PF3A 1RVGA 3EWUA 4CCDA 1QAPA 1SZNA 3IEBA 2FJKA 2ZZ1A 1SW3A 2Q8LA 1H51A 3GDLA 1VC4A 4O0ZA 4OE7A 4M5PA 1VCVA 4AF0A 3BO9A 3G3DA 3NEVA 3W1XA 3LRKA 4LC8A 3S1VA 4TMCA 1SFLA 1FY6A 5I3KA 3FKKA 5LNUA 5C2XA 1TPFA 1R2TA 5CPLA 1R2SA 4BK9A 1QPNA 3GB6A 3KXQA 3NGJA 3SR7A 3V75A 1M7PA 4TO8A 2VEMA 1MEWA 2QJGA 4CNOA 2GJNA 5K2ZA 3RLVA 4FNTA 3W2UA 4MLJA 3VFLA 2Y70A 1MO0A 3NM3A 3HPZA 5LZLA 3N2MA 5TQLA 5AHLA 1W3IA 2ZRWA 3TXVA 3QEZA 5LGXA 4UXDA 1LROA 3IIXA 1OX4A 3SY5A 3NQ6A 1NAL1 3WK3A 4UFIA 3WFAA 2Z1BA 3CEPA 3BG3A 5BOOA 1GT8A 4IMDA 2A4AA 4LRTA 4WUIA 1ADOA 3BV4A 4BI7A 5BRBA 5EPDA 2C16A 4JXCA 5IBXA 1VYSX 4DF1A 3PBYA 1LDCA 3LXCA 2E6DA 1D9EA 5AN7A 4GRSA 3W1NA 3VKJA 5FEPA 3W70A 1EP1A 3LLDA 2GUUA 1SR9A 1GVRA 1SZEA 3W76A 3NZRA 3THQA 1O60A 3LCGA 5KSWA 1BEUA 1KV8A 1FXPA 2RDWA 1JQXA 2VFEA 3BW4A 1N8FA 5EKYA 3EXRA 1OJXA 3LTSA 3UD6A 3ABQA 3C2VA 3ABOA 1P5BA 2QUVA 5I3HA 3TQ0A 3LHUA 4PL1A 5AHIA 4WY0F 3ZFHA 4YLWA 5FF0A 4I9AA 4RZ4A 3TAOA 3G1HA 4JN6A 4NVTA 4O1AA 3DFOA 1G7UA 4NJKA 4XUGA 1WOBA 1GEQA 2Z6JA 3Q94A 3DI1A 5C55A 3EWZA 4OV4A 3LBMA 3NPVA 3BVJA 4N9EA 1TPH1 1SPQA 3W75A 3QPZA 4MYXA 3DGRA 4PTNA 4O15A 3LOTA 1TREA 1GTHA 3TDFA 2OJPA 1O5XA 3A21A 3W7JA 4JTEA 3S5NA 3GNDA 1LBFA 1OX6A 2A21A 3WJWA 4UTMA 4UTIA 2YW4A 2G5WA 3GKFA 3G3MA 3PB0A 1GG0A 1JCLA 2P10A 1LOQA 1C9DA 3N9SA 3TXZA 1XDLA 4NZJA 3JRKA 5FEXA 4JEQA 1JVNA 4K7YA 4O12A 3QZEA 3O05A 4ALDA 1CI1A 1ZENA 3M9YA 5L9FA 2WO5A 3FA5A 1G7VA 3W1MA 2C19A 4HNNA 4GBUA 4O8RA 3TROA 4QAIA 2ZZ3A 1OFDA 3JR2A 1HUVA 3QFEA 1HFBA 1H5YA 1GZGA 2WSRA 3SECA 1SUXA 4M19A 4KFOA 3DFTA 3LCIA 4GJ1A 1ZAHA 4LVGA 1F6KA 2TSYA 4XKYB 3C6CA 2ZRYA 1L6SA 3S5YA 3MI2A 3M47A 4PA8A 3HF3A 1GPWA 4OV9A 3KVKA 4FNUA 1FDYA 1ME7A 2Q3OA 1UB3A 2GVJA 1NSJA 1A5SA 1S5TA 4IGHA 2HS8A 3HIJA 1R47A 4UFKA 1L2UA 1KBJA 2E09A 4FHAA 3M43A 1JUBA 2GQAA 4RX0A 3VE9A 5I3JA 4WXZA 1XBZA 4MY1A 4X22A 1VZWA 4DPQA 3BLFA 2QUTA 3NL2A 2ZZ5A 5D2WA 2NV1A 2YYTA 5TIMA 3EXSA 3B03A 4UFMA 3N2XA 3A24A 1R2RA 1M7OA 1VLWA 2Z6IA 4FNPA 3UPBA 1KLYA 3SIZA 1XL9A 1XM3A 4KFNA 2OT1A 4JS3A 4OHQA 1VCGA 4A2SA 1JJKA 5FEZA 3SJ3A 2P0OA 4IMCA 2EAWA 3TSBA 2QCEA 1TTPA 2GPTA 5AHEA 4HSOA 1I2PA 5DY3A 4TR9A 3VCRA 3MUXA 4LNYA 2R14A 2HSAA 3LI1A 2JGQA 3CU2A 4PL2A 4DELA 1T96A 3IGSA 1LLZA 3CWNA 1SO4A 4LVDA 1YXCA 3L68A 3W86A 3E49A 3HG3A 1DKWA 3PWAA 1X1ZA 4HIBA 2GJLA 5ABTA 5CPMA 5HNRA 3A9IA 3HO8A 4MZYA 4UTUA 2A7NA 2RKXA 4O19A 5HMSA 2A1YA 3S8HA 3LHVA 4S2CA 3DFPA 4FXRA 3NO5A 4JYFA 1YTKA 3LCHA 1Z41A 5U7SA 3TW6A 3CIWA 4QQ3A 1K8XA 1LM1A 5EMUA 1SZFA 4TIMA 3NPWA 1O94A 1Z42A 3LCLA 1TJRA 5G2WA 3BG9A 1FWRA 4K38A 3W74A 1XDMA 2WNQA 2AGKA 3LCWA 2G96A 1KM0A 3CTLA 2C13A 4X2RA 1T99A 3G1VA 1D3HA 1YXDA 4PCFA 3JS3A 5K3VA 4IX2A 3M16A 4ZQMA 1OFEA 2JGYA 2P1FA 1DQWA 3TSDA 3TW7A 3G1DA 4YL2A 3GDTA 2ZA1A 1XBVA 5D30A 3LDVA 2DZPA 3LHWA 4LRSA 5EBUA 3NZ1A 1P0NA 3QMSA 1KTNA 5FF7A 1FQ0A 1PV8A 2Z0IA 4NZFA 1DJQA 3P7YA 1W5NA 1OG0A 3OIXA 3U6WA 1XKYA 4HKPA 4KFPA 4K8HA 2RH9A 3HGRA 3TQKA 2I14A 4MUZA 3MP3A 4GE8A 1H7PA 3SGUA 1TV5A 1UASA 4PC8A 1H7XA 3GR7A 2J6XA 5K9XA 3R8RA 4S1FA 4RZ6A 5EYWA 2BX7A 3I6RA 1KFLA 2QDGA 4JTKA 3U8GA 4WJEA 1GVQA 4IPIA 3LXBA 4JTTA 4LTSA 4MPQA 4LU0A 2CLOA 4ZQPA 3A22A 3PUDA 2J27A 4MZ8A 1RR2A 4JIPA 1UJPA 5CZSA 4MJZA 4X3ZA 1KFEA 3ABSA 5AC7A 4AF0B 2I1OA 2ZBTA 3NPUA 1KBIA 3PVFA 2VELA 4JYEA 3MI6A 2ZZ7A 4Z0SA 1A53A 4HPXA 1VHCA 2XN0A 2V2HA 1J5TA 2B0MA 2E5BA 3W07A 2YW3A 1G4TA 1TSIA 3W7CA 3QSTA 3DHDA 3M44A 3C0JA 4IJBA 4JTHA 1QWGA 3GXPA 2V2CA 1FCBA 1U83A 2NXIA 4EIVA 4FB7A 4MY9A 1KM2A 2Y89A 1AL7A 1YXYA 3S1XA 3PG8A 3C3NA 4N2YA 4W9TA 2EHHA 2Y63A 4XTIA 2E5CA 4E38A 3P74A 1VYRA 2TMDA 3GAYA 1K02A 1MSSA 1H7RA 4WX2A 1ICSA 3ZR4A 1DV7A 3FS2A 3LV5A 4KWWA 2DP3A 4IWWA 1WDWA 3MBDA 1L6YA 1PL9A 2GQ8A 3P84A 1F73A 5AHMA 3LHTA 3LB0A 4N9DA 3QMRA 5D32A 1AW2A 4O4WA 1FX6A 1H7NA 1A5CA 3QQ1A 5AOUA 4AMAA 3W6YA 4O28A 4LUIA 3PM6A 4WY0A 3I65A 1LBMA 6ALDA 1QO5A 4UMBA 1KM6A 3PSVA 4RXGA 4D2JA 1H61A 2VC6A 4ADUA 1C8VA 2H8ZA 2YR1A 1O95A 2CZEA 1JR1A 4LC6A 3TMQA 2XFWA 3FJ6A 1VLIA 4IMGA 5D09A 3TJXA 3L0NA 2DORA 3I7RA 2X1TA 5F4WA 1Q6RA 4OWGA 1DJNA 2ZDRA 2CLEA 2NXHA 4CCCA 5LKYA 4R34A 1KM3A 3BG5A 3O15A 4YMZA 4A22A 1O5KA 4BWLC 5C5YA 2V9DA 4JGDA 1JULA 2CZ5A 2QKFA 4DPPA 2RHGA 4UTWA 4DXVA 5LNWA 3CT7A 2NUWA 4WY0B 5AYYA 2H90A 1PHWA 5C6MA 5FF3A 1ZHAA 3G0XA 1KTBA 1MXSA 1OFPA 4RK8A 4GUFA 1QFEA 1OABA 4MKNA 1PVNA 3W2JA 4XBKA 4H4IA 2XN2A 1FWSA 2H8XA 2ZZ6A 2HMCA 3NL6A 4R7JA 3SZ8A 1SFJA 1ML1A 2Y7EA 3M5VA 3AJXA 4O17A 5F2IA 4N9CA 3EKZA 3HG4A 3Q58A 1SO3A 5HUPA 3GDKA 1E51A 4QNWA 2ISWA 2ISSA 1JRCA 5F4XA 5CG7A 2ALDA 2QCLA 5LNRA 3LGEA 2FFCA 4DF2A 2W79A 1K03A 1LZOA 3ATYA 3IIPA 3F4NA 3DHFA 1OK6A 3O6CA 5KZMA 3W7RA 3L0GA 3I7QA 2EKCA 5G5IA 1RZMA 4IUOA 1QPOA 3BK0A 2B7PA 3DFNA 4AEOA 3OVQA 4PODA 3HG2A 3G8EA 3NQAA 2PRHA 5IBXC 4H6KA 1LOLA 1PHQA 4GUHA 3TC7A 1Q6QA 4GFSA 4I7UA 2CFFA 1OX4B 4IXXA 3O8AA 4CNPA 1QR7A 3B05A 3EWXA 3SFKA 4LV4A 3IGUA 1F2JA 1MZHA 3T7VA 1XBXA 2V82A 3PAJA 3PG9A 3L9CA 3P5ZA 4UTKA 4FNSA 4E2BA 3MYPA 3GYEA 3QQ0A 2QJHA 2QR6A 1W0MA 3F4WA 4OT7A 3D0CA 4FXSA 2TPSA 2E6YA 5DCDA 1SU5A 1TPDA 2B4GA 5DN1A 4MIMA 1WX0A 2WNNA 3YPIA 3KVLA 1FWNA 4EF9A 4A21A 3DZ1A 2A0NA 2WQPA 4MOZA 3SI9A 1TV8A 2OMAA 3NNTA 2B7QA 1BTMA 1RV8A 3MI3A 2A85A 2CLMA 4I7VA 1UCWA 3HPSA 3WK1A 3EWBX 1TJPA 5E93A 3R13A 4Q33A 5BMXA 4ZQOA 4NX5A 3C2RA 1YYAA 3G1AA 2NLIA 4WOZA 5FF4A 3TQVA 3EKLA 1X7FA 2Y7FA 1Q6OA 3DENA 3TUUA 2PCQA 2WSQA 3M1ZA 5DBTA 5D37A 5T26A 3UXDA 2BSLA 3DH7A 3HMJG 2VXNA 2GQ9A 3MJYA 3DFQA 4UMAA 2NUYA 2KZHA 4DBDA 3NQ8A 1RQEA 4NUWA 1KA9F 4K37A 2ABBA 2Z2UA 3A23A 1B4KA 1TRDA 2WNZA 1FCVA 3ZS4A 3TX9A 3QH2A 2QCHA 3TE9A 4YCPA 1OYAA 1V5XA 1IGSA 4CLMA 4Y6GA 1W8SA 4BI6A 3NQ2A 1EUAA 1K3UA 3MHGA 6TIMA 1A5AA 4JDYA 3ELFA 1DORA 4UNLA 5H91A 2DZVA 3BW2A 4CCEA 2ZRZA 3B4UA 1TRIA 3E02A 5C54A 4IMFA 1TTIA 3NR0A 1JCJA 4JX4A 1F76A 1TPEA 3Q37A 3R5EA 3LBCA 1SSDA 4O4VA 3FJLA 5G4WA 1QOPA 1XUUA 1H7WA 1X6UA 2YYUA 1H1YA 3RFAA 1TTJA 3S9YA 3DXIA 1IXOA 2NX3A 4JICA 4FX7A 2YCEA 3A5VA 3C52A 1OFRA 3DKLA 4LT9A 3QRHA 2JKAA 2F84A 1GQNA 3TFCA 2ISVA 3G1XA 2QCMA 3KHJA 4NX0A 3CLMA 4RJEA 3W85A 2E68A 5DXYA 5FI8A 1DQXA 5I3FA 1RQHA 1YPFA 3MP4A 3NQVA 3M41A 1B9BA 2A5HA 4Z08A 1UBSA 2EGZA 4DO5A 2VEKA 2YX0A 4YWIA 1EPXA 1IXNA 3DKJA 3NVTA 4FIRA 1KLZA 5AHFA 4JY8A 4H3DA 4LV9A 1FCQA 5DCBA 2C0AA 3OG3A 3O6DA 4RCXA 5D2TA 3UQNA 5K9DA 2Y88A 4GWEA 1AW1A 3C4UA 1TV7A 3OBKA 4Z1AA 4YCOA 1F05A 2X1RA 3TFXA 1OF8A 3C8FA 1BWKA 5CGQA 3P81A 4M7SA 1VRDA 4FX6M 1CX9A 3IVUA 5BW6A 1W5OA 2BXVA 2F7FA 2PE4A 1GOXA 1H62A 1W5MA 2HS6A 3NA8A 4PFMA 1IIGA 3CWOX 1EB3A 4ADTA 4Q32A 1JCXA 4AHQA 2R94A 1LBLA 3IIOA 4UCGA 3KX6A 2C1HA 4QITA 2ZZ2A 3UWWA 3O16A 2CW6A 1LRTA 4HPJA 4UTLA 3TR2A 3PULA 2VFFA 3DU0A 4LVBA 1LRNA 3GAKA 5CKSA 3G1SA 1QDSA 1J2WA 4O10A 3P8IA 2CLHA 3P80A 1WAUA 4DEFA 4MVAA 4C1LA 3W7KA 1WQ5A 4O16A 4UUIA 3HJZA 5E0KA 3W7MA 4NQ1A 3PR2A 3UNDA 4Y9AA 3O63A 5AYXA 3W7GA 3G22A 1OFOA 3INPA 2JBMA 1VYPX 4AHPA 4UIOA 3K30A 3PY2A 2FQIA 4UFJA 1G6CA 3TA6A 4AWSA 1OFAA 4XKYA 1FWTA 2G95A 3W1TA 2DZSA 1YDOA 2YGYA 4CQAA 4UTHA 1A50A 1H1ZA 2QAFA 2Y62A 4QM1A 3RF9A 2C18A 1QOQA 3L5AA 1HL2A 3W2LA 3IRDA 1ICPA 2O7QA 3BGJA 3KFTA 3EB2A 1OYCA 2YXGA 3HBLA 1KV5A 4JTLA 4FNRA 1WBJA 2Y7DA 3I68A 2DZUA 4EF8A 2E6FA 2ZZ4A 4JIQA 5LHEA 1ZNNA 5EL1A 1ZY9A 1SSGA 1W3TA 1K7EA 3S42A 3B0UX 3Q2DA 5G2HA 3LERA 1XC4A 3UZJA 4O11A 2ATMA 1M6JA 4JX6A 3R89A 3S5OA 1F74A 3W7OA 1G4EA 3S0CA 3TSMA 4MZ1A 1ZAJA 3LCFA 1GVSA 3G1YA 7TIMA 3QC3A 4WXYA 4M6PA 2CLFA 4P2VA 3WJZA 3LHZA 3W7DA 1OFQA 1PE1A 4K6AA 1I2RA 2QUUA 4B5NA 2DZWA 2X1SA 3G24A 3UYCA 3N9RA 2ZA3A 1FUYA 3DFSA 1QO2A 2VFDA 3EXTA 4HHPA 4RKAA 4AAJA 5CSRA 2VFIA 5G1YA 1ALDA 1W37A 1I4NA 4OQVA 3H54A 4P61A 4O1BA 1IXPA 4UMCA 4NJIA 3W9ZA 3GK0A 3F03K 1OVDA 3PC0A 2ZTKA 1HTIA 1SW7A 1TMHA 3P67A 1KW1A 2VEIA 1FDZA 2YPIA 3DAQA 1QNVA 1IIHA 1B4EA 3IIZA 5HJLA 1UUOA 3N73A 2VFHA 4Z1BA 1ICQA 3GLCA 3BPWA 3NM1A 4UTTA 4TMBA 4AHOA 4DQWA 3WK2A 4WD0A 4NXKA 4Y90A 3GNNA 3TKFA 1TPVA 4HNVA 3W1LA 1YPIA 4GUJA 2QCCA 3IGXA 3B06A 3FEMA 4ONVA 3OVPA 2QCDB 4NJHA 4XBSA 2YDAA 2OCZA 4GXMA 4NNBA 1TCDA 1JRBA 1KM1A 1SZGA 3LRMA 3LCXA 4C1KA 1SO6A 2NWSA 3W72A 2TYSA 2DZTA 2V0TA 1YTEA 5I3GA 5D03A 5DCEA 3KAOA 4HNTA 1JUKA 2CLIA 2A6NA 4TX9A 4TU1A 4NNAA 3W73A 3IV3A 4N4QA 1S5VA 4E2DA 1P1XA 5LGZA 2VKZG 3W88A 3B0VC 3DBPA 3H55A 1YDVA 2ZRXA 3NQFA 3S5ZA 4G1KA 1PCWA 2CWNA 3MWAA 1TPUA 4DF0A 4NT0A 4AWTA 2B7OA 3P5YA 5TBOA 5EY5A 2GVLA 2V2DA 4L4LA 3NYZA 2ZTJA 4S2BA 5D05A 3UY8A 3THAA 2H3BA 3CB8A 3T78A 1AMKA 5I3IA 4ZQNA 4FIQA 4OBTA 1XI3A 3MMTA 4N6FA 3CM4A 2V8ZA 1ZJIA 2NZLA 3W1QA 4DBEA 3LRLA 3EX3A 3O6YX 3GDMA 1T0OA 1T8XA 2NUXA 1OK4A 5AFDA 5D02A 3LHYA 1YTDA 1R46A 1LOSA 3UXAA 3W7NA 1WYIA 2CLKA 1RQBA 4BR1A 4POCA 2QJIA 4A2RA 4RR4A 4R53A 2FTPA 1NF7A 3STGA 2B7NA 5D38A 3RMJA 2LLEA 1ME9A 2Q3RA 1IF2A 3W7IA 1Y0EA 1I8JA 1W31A 2X30A 3E9AA 2JK2A 1DL3A 3HGOA 1NVMA 4JTIA 3GXTA 4M6QA 3TV8A 4LUJA 2G97A 1B3OA 4PH6A 4WOQA 5GVJA 1KM5A 1WOAA 3G18A 2BZNA 2YZRA 5D2YA 4BF9A 4YXGA 5H2ZA 5KINA 1VH7A 2X1UA 2PURA 3HOJA 2A2IA 1PS9A 1G4PA 3PBUA 3QW3A 3N19B 4M6VA 5AB3A 4AVFA 1R30A 1RD5A 4Z1DA 5F2LA 2ZA2A 2Y85A 1QMLA 2I9EA 3C2FA 3O07A 5J5RA 3EWYA 4ZMGA 5HWMA 2E77A 5DBUA 1EA0A 3WJSA 2PRLA 5CSSA 1TPB1 1L6WA 5CZTA 3L65A 2J9ZA 5A5WA 3T55A 3G0UA 2PRMA 4O57A 1JUEA 3L66A 1KM4A 2C3ZA 2VEPA 2W6RA 3LM7A 3FIGA 1N7KA 1GYLA 5LNSA 1W1ZA 3CC1A 3B0PA 2A6LA 1IXQA 3DI0A 1HO1A 1BWLA 1EUNA 3LLFA 4AWUA 3NPXA 3UWZA 3CQ0A 1Q6LA 4UR7A 5LNVA 2QAPA 1W3NA 5HUOA 4ICNA 1YADA 1M5WA 3HG5A 3ATZA 1VCFA 1F7BA 2ZQ0A 4HSNA 1MEIA 2X16A 5F1VA 4ZZ9A 4E0CA 5F2GA 2VOMA 1PCKA 1KTCA 1F6PA 4ORIA 4LY8A 1FXQA 5E1QA 5KITA 1G4SA 1ME8A 2Y7GA 2NX1A 4QIUA 3STCA 5G2IA 4JTFA 4Z1CA 4MFEA 4AB4A 3HB9A 4ORMA 1TYGA 5J5DA 4K36A 3BLEA 5FESA 4X9SA 1F5ZA 3W87A 4N9BA 1XFBA 4QISA 1TO3A 1VR6A 2AAMA 2X2GA 1QCWA 4ZVJA 3M7WA 3KOFA 3HGSA 1G67A 4GUGA 3N3MA 3NQCA 1I2NA 2EF9A 2BTMA 5K4ZA 3W71A 2V5LA 1NFBA 4A3UA 2WV8A 3OEXA 5CPOA 3FOKA 3UY7A 3MO7A 3G0SA 5KTLA 2TRSA 4NU7A 3W2MA 3KRSA 4NNCA 3L2IA 3B8DA 2V5BA 3TU9A 1AG1O 3UWVA 4LWWA 2VFGA 2H3DA 3M5XA 4FO4A 4O0KA 3KRUA 2EPHA 4Z0JA 4EVZA 2FDSA 2DZXA 1Q45A 4O54A 4L4MA 5D04C 8TIMA 4IMEA 4UNKA 1HO4A 4FEZA 2J9XA 3BARA 3W2KA 1EP3A 1K8YA 4LW7A 1XCFA 4U28A 5D2VA 3O1NA 3QSRA 1FWWA 1O4UA 4XWUA 1VHNA 3U2OA 2OX1A 3M0ZA 1YDNA 4CQ9A 3EX6A 3P8JA 2E5DA 1AK5A 4O14A 4UTJA 2QCFA 5CZ0A 1ZAIA 3QW4B 4BI5A 4CQ8A 3PSWA 4HN4A 5EA9A 5A8GA 1FDJA 4MFDA 5BNKA 1OYBA 3NOEA 1K7FA 1TPC1 3GX9A 5AYZA 4OGZA 1GVFA 1DVJA 3I7SA 5F1UA 4MY8A 3W7HA 1ZCOA 1EWEA 2J24A 3OVRA 3V1PA 2DJXA 1U5JA 4IX0A 3F1QA 2JKPA 3BLIA 3E0IA 1VPXA 4NJJA 3IIVA 4HT3A 2NX9A 5FF2A 1KFKA 2DU2A 5D33A 5F2MA 3T4CA 5HULA 1AL8A 1ZALA 3FLUA 1N55A 5L6UA 3TCEA 1DHPA 4JDBA 2W0UA 2WKJA 3PUEA 1TQJA 4O18A 1GG1A 5DELA 3NL5A 3OA3A 4UR8A 3C2EA 3G1FA 3ABRA 3W23A 2R8WA 1TB3A 3G8RA 5MHBA 2XN1A 3TIMA 4UFHA 3STFA 3NAVA 1VS1A 4IQLA 3STEA 1GTEA 3B04A 4N6EA 3RNDA 3GDRA 1P0KA 3QM3A 3QJAA 3W1UA 4KWVA 5KZEA 1EWDA 4WQ6A 3W3OA 3ZWSA 4U4MA 5FEWA 4A29A 2HTMA 3GIYA 1OX5A 2NWRA 4RXFA 2E1DA 3WJYA 2J88A 3NG3A 4LS1A 3W22A 4GUIA 3PUOA 3MBFA 3N34A 1D3GA 3TK7A 3W7QA 5F4SA 2C6QA 4XZ9A 4XTDA 1ZFJA 5CZJA 2PC4A 3L21A 1W54A 2J9YA 2FPVA 5HQEA 4ZL1A 2FIQA 1WV2A 4O53A 2QF7A 3IVTA 1K8ZA 3UWUA 1DOSA 3O06A 1Z44A 4JD4A 4MLRA 5K4XA 2YSWA 3UWQA 4EOUA 1SQ7A 5HWNA 2A7RA 3C61A 3GZ3A 4FNQA 1J4EA 3GXNA 4QSHA 2E6AA 5AHNA 4JR5A 2QDHA 2UV8G 3T40A 1SW0A
chains in the Genus database with same CATH superfamily
4LVAA 3H2OA 3CZJA 4XSMA 3AMKA 2ABAA 3W7PA 3B0YA 3S2NA 4XZWA 1XLJA 3EX4A 2E9LA 1RY0A 4PTDA 3VD5A 1HJXA 1QPQA 1EEPA 4N02A 3KL0A 3REQB 5MKGA 3VNDA 1EDGA 1B57A 2REQB 3OZMA 1V4YA 4P8UA 4X0NA 5IM51 2FPYA 1U2YA 4UQBA 3LPOA 4V2XA 1US3A 2Z28A 5KMYA 3GVRA 2JALA 1P7TB 1QK2A 1I6NA 2QEZA 3NWRA 2OOGA 1NJJA 1W1PA 1YLVA 3EPNA 4OOUA 5CGTA 4G9PA 4HPHA 1OHLA 3M5YA 1Z89A 2WZTA 2XVLA 3B8WA 3W26A 1NF0A 2DDXA 3FFSA 4S39A 2YL8A 3GNXA 3NQGA 2DT2A 3ME3A 2CLLA 3LYEA 5LSMA 1DHKA 4IJCA 1B3XA 3RLUA 3GVGA 3PJXA 4L4PA 3SGZA 2Z24A 3XIMA 3PS7A 5CCZA 1JQVA 2O56A 1EX5A 1XD1A 1UUMA 1S3HA 1XF0A 1BRLB 3RU6A 1IYXA 3UWYA 4LAKA 3VX1A 5K9CA 2C15A 2Q8ZA 3PB2A 2O9PA 3LI0A 2WBKA 3HPFA 1YBQA 2PGFA 1TQXA 1XD0A 5I77A 2EG8A 3UGVA 2W92A 4LUTB 4W87A 4PB4A 1W9UA 1G9HA 3P62A 3W84A 4UFLA 3N4AA 3H2MA 1E9YB 1JCNA 3GR8A 1H50A 2PP1A 2WOQA 2MUCA 4R33A 3AIWA 1ECQA 1D3CA 4S3FA 4ZB5A 5JBDA 1TIMA 3IRSA 2O9OA 3EDKA 4MNMA 4RLIA 2VI0A 1LTDA 5CLTA 4QBXA 2GL5A 1FRBA 3KBVA 3NL3A 3CJPA 4I7WA 3HURA 3ZWTA 1CB2A 4OVXA 1PZ2A 4Q8QA 4PEKA 4LGXA 4BEUA 2E8ZA 3P61A 1MQQA 3HMCA 2IKHA 3RMEA 1Q6FA 1A5OC 1TUXA 1IHIA 1E4NA 2GWNA 3UZXA 4AEEA 3KW3A 4DWSD 1IT7A 2FVKA 4V1XA 1AZ2A 3STPA 2DH2A 2GOUA 4JFUA 3BJFA 4IZGA 5LA2A 4K1GA 3TC6A 3MMDA 1E9IA 4H8VA 4OU1A 1B9ZA 3WK0A 2PDGA 1L0PA 3UR7A 3BLPX 2L5HA 4C6QA 1PDYA 5E9XA 2W91A 4GC4A 3K8KA 1UQZA 3WLSA 1C91A 4QNEA 2OEMA 4C1NA 2WJFA 1P48A 3WJXA 4EPEC 3W2NA 3A3HA 1GQLA 3OJGA 5JBEA 2ZX6A 1UC4A 4MNKA 3HPXA 4MWAC 4RNJA 4L65A 3CL8A 3M0LA 5M2FX 3SY1A 3C2OA 3ZO9A 1JZ4A 1K4HA 3F2CA 2ZVIA 3AO0A 1ONWA 4O52A 3C5QA 2Z29A 3BGGA 3QPYA 3UVIA 4DI8A 1WNOA 3T44A 1RCOB 3UG3A 3FXYA 3TN5A 3S1WA 2BWGA 2FB2A 3LX9A 3VNMA 1FA2A 2BLEA 5FKYA 2R91A 1A5BA 1MDRA 2CKRA 4YU1A 2JKEA 4LS0A 2D23A 2DJLA 3L12A 4EACA 1WZKA 4H7CA 1DJZA 2NT1A 1UD8A 5HWJA 1GW1A 2OT0A 1GYNA 3VIJA 3E6EA 2E40A 4KKXA 3H2CA 3TA9A 3SM0A 3MV11 3VIHA 2YOCA 4C6OA 3EWUA 5CEWA 4AXNA 5GNZA 1BG9A 4WKHA 1SW3A 1H51A 3GDLA 3GXFA 4AC1X 2BBFA 1YHTA 3CBWA 3TP4A 3CZ8A 1XG4A 5FA5A 3G3DA 4LX4A 2VD8A 3W1XA 1GOKA 1V3JA 1KXVA 2WVVB 1BXNA 4IMAA 4DM1A 4ECLA 1W3LA 4BK9A 3NGJA 3SR7A 4ZOAA 3SADA 2VEMA 1JL8A 4CNOA 1F4AA 1QTWA 2Y70A 2QNEA 3SFWA 3U5YA 4D1JA 2D69A 5FAGA 2ZRWA 4QXIA 4D6CA 3A9BA 2BGNE 3RDKA 4Y9PA 1NAL1 5PTDA 2F8QA 4F79A 4HTBA 1DE5A 6REQB 3U0HA 3P0XA 1HP5A 3GNRA 4BI7A 1PYMA 4EAMA 4LAUA 4B91A 1LDCA 3LXCA 3W1NA 2GGHA 4IPPA 5FEPA 3WH5A 1MW2A 3LLDA 2GUUA 5A6LA 1GVRA 1SZEA 3MTWA 5XIMA 5KSWA 3N18A 1UOZA 1GW9A 1V0NA 1FXPA 3BW4A 1MXDA 2V3EA 3EXRA 1M03A 4ATLA 2CNCA 4HU0A 4A6GA 1UKSA 2VCBA 5JXQA 2FDMA 3ABOA 4A3QA 5I3HA 1EBGA 2AOSA 1LG2A 4PL1A 5AHIA 4DJEA 4HMEA 4I9AA 4C90A 3TAOA 3W82A 4JN6A 2G3FA 3DFOA 4XUGA 4BCEA 4TOQA 4GGBA 2VC7A 4GYKA 1A5MC 3DI1A 4NSBA 2INZA 4JCMA 3TYBA 3EWZA 3LBMA 3NPVA 2OGJA 2ZDSA 4DJFA 2DQXA 1IR2A 3CYVA 4QSFA 5JH1A 4PMVA 3W7JA 1ITUA 1IEWA 4PUMA 3TONA 5C9XA 3PPCA 7TAAA 1W9DM 2PU0A 2YLAA 3BCDA 1UD3A 1GOOA 5BOEA 4Z2HA 4I5RA 2VX6A 3M0HA 5CLWA 2YW4A 1ZUAX 3GKFA 1GJUA 3G3MA 3PB0A 1GG0A 4JQ1A 1FHUA 2P10A 3QKZA 1C9DA 3SURA 3W38A 2C1GA 3N9SA 3PNZA 4UQ9A 4GC3A 3JRKA 4JEQA 3NZPA 1MRQA 4Q8MA 3UPMA 2UY5A 1C8XA 3AYRA 1KRAC 1OGSA 1W3KA 1NDVA 4B5XA 4HNNA 4GBUA 4O8RA 1GKQA 2ZZ3A 1OFDA 4M8UA 3JR2A 4XV0A 3SECA 1SUXA 2PTZA 3DFTA 1ISWA 3LCIA 5EBAA 4XKYB 2GUYA 4RE4A 3EA2A 1L6SA 3MI2A 3UZYA 4J3SA 1Q6DA 1O66A 3B4YA 3KVKA 1PAMA 2ONEA 1UB3A 3GY1A 3VDCA 4AZGA 3NCOA 4J3ZA 4IGHA 2HS8A 1R47A 1RLDA 1UC5A 2OQHA 3T9PA 3RRAA 3AYVA 5H8UA 1RK5A 3BLFA 4KEZA 1V0LA 1OD0A 1BQCA 4UFMA 4QEHA 3PNUA 3EDJA 2PWHA 3A24A 1M7OA 4IL2A 3WNKA 2Z6IA 4FNPA 3L2MA 3UPBA 4PSPA 1KLYA 1XM3A 3PZQA 5IFTA 2BB0A 2DSUA 4DVOA 3WNMA 1JJKA 5FEZA 3SJ3A 4KEMA 1H1NA 4G7EA 4GJJA 2EAWA 3FN9A 5C9ZA 2QCEA 1TTPA 2GPTA 2AAAA 4FAMA 1ZZMA 5DY3A 3WNNA 2GSJA 1J0YA 3CASA 1S5NA 3RX2A 4DZAA 4I5XA 1WDSA 1JZ7A 3LI1A 4AD2A 2MNRA 3QBUA 4DELA 4IL0A 3WNOA 1UZ1A 4BJHA 1DKWA 4DIAA 2WB5A 1CPUA 3KEHA 4UTUA 2HNEA 2A7NA 2RKXA 5HMSA 1KO0A 4S2CA 3DFPA 2PWEA 4A3RA 1XC6A 1YTKA 4Q8WA 2PDMA 3F4VA 5U7SA 5EU9A 3H7UA 3TN6A 3F7JA 4HMDA 5A6BA 3H23A 1OINA 3QLLA 4ZENA 3DC8A 3AYTA 5A6AA 4K38A 3WLNA 1L2QA 1QW9A 1HX0A 3CTLA 1JZ8A 4HK5A 4H9MA 4PCFA 3JS3A 3WMLA 1K6AA 1RCQA 1Q63A 2R1LA 1K4GA 4KPLA 3TSDA 4A8RA 1XP3A 2PC8A 1W17A 1EF2A 1TV4A 2DZPA 2XH4A 1KTNA 3FVDA 1FQ0A 2F38A 1W5NA 4MF4A 5C9RA 4HKPA 4K8HA 2RH9A 3OO2A 3AROA 1XLGA 4PC8A 1S2CA 1LL6A 2W66A 3GR7A 5A6SA 2XVKA 3QOMA 2POTA 3MQTA 4RZ6A 3KLLA 3T05A 2QDGA 4JTKA 4F0SA 1GVQA 3UR8A 3PUDA 2J27A 4GY0A 4G7FA 3K13A 4AF0B 3VGFA 1IR1A 3PVFA 2VELA 2XTKA 4JYEA 2ZZ7A 1A53A 2Y5JA 2HROA 1VB9A 1CGUA 1G4TA 1TSIA 1JDFA 3B9OA 3E2SA 3GXPA 5GNXA 4EIVA 4FB7A 3CZLA 2PSNA 1YXYA 1ZQ5A 1R3QA 2DSVA 3RAOA 3S1XA 3PG8A 4W9TA 2DZBA 5DRCA 2J79A 1RA0A 1J93A 3QY8A 2ZX9A 4YS1A 2HPIA 1H7RA 4WX2A 3ZR4A 3FS2A 2DP3A 1K1DA 4L1GA 3VNIA 4KRTA 4G7EB 1B5TA 3LB0A 1AW2A 4TX6A 1TJ2A 4X63A 2J13A 5AOUA 3W6YA 3EA3A 3PZTA 2WK2A 1TJ1A 1QPKA 3OTRA 1SGJA 3R43A 1ENUA 4PMRA 3PM6A 3ZQ9A 3I65A 1LBMA 3QLDA 1KM6A 3PSVA 2XZ7A 1H61A 4ZBCA 2VC6A 3CV6A 3PFRA 2PP0A 3AXMA 3UGRA 2XFWA 4IMGA 3V0SA 2Z00A 3CV1A 2DORA 1V6XA 3I7RA 5LA0A 1B54A 3RX4A 3BGAA 4U31A 1Q6RA 4OWGA 2ZDRA 4CCCA 5LKYA 1KM3A 4A22A 2HCVA 2OELA 2HVOA 5HATA 1C3FA 3PJWA 4QP0A 4HCDA 2QUNA 2P3EA 4XSLA 4DWSC 4UTWA 4DXVA 4DLMA 4PUDA 3N1AA 3S4TA 3PZGA 3DEQA 3KBJA 1KTBA 1FTXA 1RJQA 1MXSA 1Q8AA 1XIHA 1QFEA 4FR6A 4FP1A 3AIUA 1S2TA 2XN2A 2H8XA 3NL6A 5C7HA 3M0MA 3SZ8A 1ML1A 2Y7EA 3M5VA 4O17A 2XSXA 3EKZA 3HG4A 1NTHA 2J62A 1BXBA 3GDKA 4YIWA 2ISWA 2QCLA 2VGFA 2FFCA 2W79A 3GFXA 2YBUA 1XH0A 3WLJA 5D9NA 1OK6A 4QROA 3LG3A 2XJ7A 4RW5A 1UH3A 1RZMA 4GMEA 2B7PA 4AEOA 1JGMA 4PODA 3WG6A 3TW9A 1Q6QA 4I7UA 4IXXA 1O12A 3O8AA 1D7FA 3WDJA 2FVMA 3FNDA 3EWXA 2P88A 4LV4A 1OWQA 1F07A 2I5IA 4J3TA 3PG9A 3T8LA 4UTKA 5I5RA 5C0QA 3MYPA 3QQ0A 1V3KA 1WDRA 4FXSA 5F7UA 1SU5A 2B4GA 5GNYA 4AYGA 1X6NA 1F8IA 3KVLA 3DZ1A 2WQPA 7REQA 1BTMA 2A85A 4Q4OA 1UCWA 3HPSA 1E56A 3EWBX 3B0XA 1JIBA 5E93A 4Q33A 1CLXA 1FWHC 4W89A 3BJTA 3HQPA 1TWZA 6ENLA 3VOCA 1VFSA 3TQVA 1TE6A 3ZJ8A 3EKLA 1GJWA 2Y8UA 2Y7FA 3KOYA 4ZFCA 2WSQA 1Y7VA 4C1NB 2HBXA 1YW1A 3DH7A 3MJYA 3DFQA 1IT8A 4DBDA 3ERPA 1KA9F 2Z2UA 3TX9A 1B0IA 2QCHA 3V35A 3NEHA 1V5XA 3I3EA 1IGSA 1FWAC 4Y6GA 3NQ2A 3RITA 3RCMA 4GIRA 1U5VA 1DORA 3B97A 3BW2A 3UU0A 1EF3A 5C54A 2Z7GA 1TTIA 2VWSA 4KGJA 3XISA 2XGIA 1D8CA 3VPLA 1XIGA 1H7WA 2G4FA 2YYUA 2QYGA 4C6PA 3S9YA 4W86A 2NX3A 3FSTA 4JICA 4XAFA 2V6AA 3A5VA 4X2PA 3MDWA 1OFRA 3DKLA 2VYOA 2JKAA 1NQ6A 2F84A 2ISVA 3DC0A 2QCMA 3ITVA 3WLHA 3W85A 1R0MA 4R9XA 2PUZA 3HPAA 2D24A 4TQTA 5BWFA 7ENLA 1UG6A 3MP4A 4WVXA 3NQVA 3W29A 1ZJBA 1VBRA 2VCCA 4Z08A 5E6YA 2VEKA 4L56A 1EPXA 1IXNA 3NVTA 4FIRA 3URNA 4F48A 1KLZA 3AFBA 3BQ6A 4B90A 1NFGA 2GQ3A 4QDPA 3NYDA 3TLLA 5CPQA 3C4UA 3OBKA 1XYBA 3TFXA 4H2HA 3C8FA 4TTUA 3TYAA 1P0BA 3P81A 4C6DA 4JN7A 1CX9A 4JN8A 3GZAA 1KFWA 1GOXA 3BE7A 1J2BA 1IIGA 3VA8A 4AWEA 3PTQA 4RE3A 3KX6A 3MB9A 5CJMA 2ZZ2A 4XD6A 3O16A 3UWWA 3H70A 2CW6A 1LRTA 4KRUA 3JU2A 3OYZA 1XCWA 3N2TA 1BAGA 4MAVA 4LVBA 4FA3A 3G1SA 1QDSA 4HA0A 1DTUA 4YYFA 2CLHA 2GVEA 3IACA 2DY3A 4HA4A 4EXQA 1BF2A 3ARUA 3IARA 2J75A 4C1LA 2HE5A 4UUIA 2YB1A 3HJZA 4Y9AA 3R25A 4XZMX 3FCPA 3INPA 4F0KA 4W93A 4UIOA 4HPGA 1OFAA 2W3ZA 2YGYA 1YDOA 3AUOA 5E70A 1VENA 1BSLA 2V3DA 5REQA 3UJEA 3BGJA 1K6WA 3EB2A 5I0DA 4C7FA 3R94A 3HBLA 1FWDC 4JTLA 2GDUA 2VL4A 4JIHA 2Y7DA 3PZIA 3GW3A 1BD0A 4EF8A 3VOIA 2BY3A 2OKTA 3FHQA 3TWBA 3WDRA 5EL1A 5CQ1A 4AIOA 4AD4A 4B5TA 5CBIA 3RM8A 3MWCA 1MQRA 1W3TA 4Q4SA 2Z1XA 3MZ2A 4GIAA 3S0CA 1UKOA 1XLHA 2GSHA 3GE7A 1ECEA 1EFZA 7TIMA 1QW8A 3WJZA 2E67A 5DRIA 4KRZA 2GJRA 4I3GA 1A5KC 2W63A 4K6AA 3WH8A 2WM1A 2X1SA 3QV6A 2YDQA 1JDCA 1FUYA 3DFSA 4RKAA 5C7VA 5CSRA 2WC7A 4WCJA 3E0LA 2FGLA 1ZP4A 4UMCA 4TVDA 4QTGA 4PTXA 4NJIA 4P7NA 3F03K 1OVDA 4BEQA 1TZ7A 3OW1A 1SW7A 3VU2A 2YPIA 1QNVA 1WZMA 4CQCA 4LEQA 3KDNA 4C6CA 3TTYA 1GZJA 4LAZA 1C92A 3F5JA 4DBWA 3AWNA 1ADDA 3VFCA 2HPMA 3W1LA 4GUJA 2QCCA 3FEMA 4ONVA 4IQEA 2FKPA 3B40A 4XBSA 1LG1A 1XV8A 4GXMA 4XO6A 1FHDA 1KM1A 1SZGA 1VFOA 3LRMA 4MAZA 1DJIA 1XIBA 3LCXA 3VD3A 2MANA 3W72A 2TYSA 2DZTA 2V0TA 2OX4A 5I3GA 1E5NA 3PTMA 4GOAA 3UF9A 3KCOA 2A6NA 3W73A 4OFCA 1RA5A 1W8GA 3IV3A 5LGZA 1QI4A 1J12A 2Z4GA 3K4AA 3H55A 3IV8A 3BL3A 2DVTA 4IG2B 3CZGA 1X8CA 4G1KA 2G3MA 4DF0A 2BASA 4NT0A 3N15A 2B7OA 5CZKA 3P5YA 3QY7A 3F2BA 2W62A 2GVLA 4L4LA 5HANA 2CEQA 2ZTJA 4S2BA 3UY8A 1FWCC 5LIXX 2CIPA 4I9MA 4TX8A 3RGTA 5I3IA 4ZEPA 4ZQNA 4FIQA 4K1WA 4UB9A 1TZZA 4CD8A 1ZJIA 4GQRA 2PGWA 1C93A 4QDWA 2P8CA 2V5KA 3VKKA 1AQ0A 1S2AA 1E1FA 2R6OA 5AFDA 3RUBL 1LOSA 2UZ9A 4Q4MA 2CLKA 3QHNA 3VD7A 3GHUA 1FFRA 2WMHA 3MVTA 2HVNA 2FTPA 1AZ1A 1DJGA 3K8LA 5D38A 3MJMA 5XINA 2ZICA 3W7IA 2XFFA 1Y0EA 1Q66A 1W31A 1A4LA 4TTGA 2X30A 4XZBA 3IJ8A 4DJEC 2WMJA 3D3AA 2WZEA 1YEYA 1KM5A 4LF2A 2Q09A 5H2ZA 5KINA 3VDBA 2X1UA 2PURA 2AMGA 3P6LA 1ESWA 4GXWA 4YTTA 4M6VA 4GISA 4XX6A 2OO0A 2DSWA 4REQA 4HYVA 1R30A 1RD5A 4Z1DA 2RJHA 4CQDA 2ZA2A 3AIRA 4LF1A 2Y85A 2QJNA 2QQ6A 5J5RA 3FY1A 2GGJA 2YCIX 5CZTA 4IIBA 2XIIA 3N2BA 3R8HA 3L65A 2J9ZA 4AZIA 4H1ZA 3DG6A 1JUEA 1KM4A 2C3ZA 3FA4A 2W6RA 1OT2A 2XM1A 3C8NA 2YL5A 4UQEA 1EPVA 3NPXA 3VX0A 2FH8A 3UJRA 1W3HA 3QZ6A 1NU5A 3ATZA 4DAIA 2VP8A 1MEIA 1FP9A 4ZZ9A 4ZOCA 5BU9A 2WZMA 3WUFA 1Q2RA 1PCKA 1KTCA 3VVGA 2XH0A 1TV3A 1F6PA 4YVVA 1OC7A 1KR1A 3OZOA 2Y7GA 1ME8A 4HA3A 1NWRA 2D2GA 5G2IA 4JTFA 4Z42C 1TMQA 4MFEA 4R88A 3HB9A 1GOWA 4ORMA 4ZE4A 2E28A 3CQJA 5JQ9A 4X9SA 1KCXA 2QDEA 3ZR6A 3NTYA 5A69A 3W87A 4UCFA 4KWSA 1TO3A 4QISA 1B31A 3BOXA 4JFVA 4GUGA 2WVVA 3URBA 5CAHA 3W71A 5CPOA 3UY7A 1J0IA 3PN8A 1YDYA 3G0SA 3UESA 4JL1A 3OGRA 1IQ8A 1CIUA 3UZWA 3CO4A 3GXIA 3L2IA 3GG0A 3U4FA 2WSPA 3TU9A 2OQLA 4LYKA 3VIOA 2VJXA 3NGFA 3LD5A 4GQBA 3M5XA 3MV01 4FALA 4EVZA 4S3EA 4L4MA 5D04C 4LFYA 4UNKA 1XLMA 3GRIA 2DUXA 1J6OA 2YJQA 3BARA 4NF7A 3WQOA 4AX6A 1XCFA 4U28A 1XLLA 2EG6A 3WDPP 2I57A 1H49A 4L9XA 3GH7A 1UH2A 3U2OA 2OX1A 3VM7A 4REQB 2J25A 3P8JA 2Z1VA 4UTJA 1AJZA 2QMJA 2QCFA 3WUGA 3QW4B 4BI5A 3PSWA 1FDJA 2QXWA 3PPHA 5AYZA 3I7SA 1EC7A 1KGXA 4DAFA 2J24A 4PFHA 1ONEA 4YTUA 1PO9A 1BYCA 1Q7ZA 3F1QA 4INFA 4JZ5A 1VPXA 1CGVA 2NX9A 5FF2A 4C6IA 1WP6A 4ZGYA 1KFKA 3U2EA 2DU2A 3URAA 1D8WA 1CXLA 3QR1A 5ABGA 1V3LA 2P3ZA 4PMZA 4RNHA 4LSBA 4C6FA 3N3TA 2W0UA 3KL3A 3UJSA 2WKJA 2R1PA 3FXGA 3N25A 4CGTA 3PUEA 3CO8A 4O18A 2V69A 5DELA 4PBEA 4F8XA 4UR8A 4HYRA 3C2EA 3ABRA 3W23A 3T6CA 1TB3A 4GCAA 3TIMA 9CGTA 2WJDA 3WSUA 2G41A 1VS1A 1CDGA 3SCNA 3K5XA 3CHDA 5HNNA 4ZTXA 1V6YA 3PPFA 3PANA 3LMYA 5JIWA 3TYUA 4KWVA 1RLCL 4WQ6A 2OLHA 1M65A 2BOEX 3SCOA 1OX5A 4RXFA 2J88A 3T0BA 4V33A 3W22A 3TCSA 4YYCA 1D3GA 3TK7A 3C0QA 4BQ4A 5F4SA 4XZ9A 5CZJA 2WHMA 3AU6A 5I06A 4E2OA 4L6HA 3VMPA 2FPVA 3NO3A 4O53A 2QHAA 3T2QA 3FJ4A 4CKQA 2DIJA 3CZKA 3QR0A 4I5UA 3U3HA 1PWLA 3EDEA 2XH2A 4IPLA 1HF6A 3TTSA 2IQ0A 3C61A 4JHOA 4FNQA 3GXNA 3CHCA 3HN3A 1AODA 5FD0A 4AVOA 4I6VA 3WUEA 1V6WA 4F3HA 3VINA 5AHNA 2UV8G 1SW0A 1KRCC 2NQ5A 3BQ5A 3W1AA 1EP2A 4BZYA 5G1TA 2REQA 1P6BA 3W1RA 4QR6A 4A8LA 3S1UA 2OZ3A 1HKVA 1GOQA 5DY2A 2ZUTA 4Q4PA 1SO5A 4L9YA 4RZBA 1XLFA 3TC3A 4AC7C 1E1CB 1X8FA 4JTGA 1GORA 4J2MA 3COTA 1J9YA 1Q5MA 1TTQA 4GH1A 4LANA 2FMNA 4PMJA 4HNUA 2O4QA 4JQ4A 1DJYA 2V30A 1I2QA 3PZUA 4O1CA 1HVXA 3BW3A 4ZQRA 3S6DA 5AC8A 5EMJA 2X1IA 2O4MA 5DFAA 3WF3A 3UXIA 1XSJA 2OZ0A 4WZHA 2CYGA 5E6ZA 2V81A 1WXJA 4QJ1A 1MNZA 1GOMA 1B30A 3CH0A 4K39A 5EMMA 4XISA 2NXGA 1LT7A 4D6JA 1RCXB 3HGJA 1O68A 5CPTA 1KFCA 4LUYA 2O7SA 4AFYA 1L6GA 2PS2A 4KCTA 1N8WA 1KR0A 3GQYA 1FWJC 3SCQA 7ODCA 5ABFB 4NZCA 4QHRA 4ERGA 2WLYA 1ZSXA 3PFMA 1VFMA 2Y0FA 3N29A 3MW7A 1I0DA 1UOKA 3E3HA 1JDDA 5ECUA 5KZDA 2XIMA 1YKWA 2FB3A 2QCNA 3KWXA 4JTRA 3CYJA 1E43A 1K7XA 2FYMA 3MHFA 3PJUA 3UZ5A 4JX5A 2VUYA 5AZ0A 4O1DA 1QHPA 4KCVA 1WKEA 1W2PA 4GZJA 3R12A 2V68A 4M7TA 1LQ2A 1HGYA 5CPNA 5HAOA 1GJPA 1VQTA 3R0DA 2QCDA 2F2KA 2Z1SA 3MYOA 2NQHA 3OG2A 3C0SA 1X1OA 2GVGA 2ZX8A 5U4NA 1ISXA 1Q3NA 2GOKA 4FX8A 1PZ3A 1PIIA 4HA1A 3TVAA 2YCKX 5HDRA 4DHGA 3W1PA 1BLIA 5DXXA 1W9XA 1UMLA 4J40A 4UTWC 4QLLA 1LCOA 3K2GA 4GNKB 1FCUA 2Z25A 3KBNA 2P53A 2AKZA 3DFYA 2CXGA 5CGMA 1JXKA 3WBEA 2Y61A 3EB3A 5DLCA 3DERA 3LZ3A 1PX8A 4PUEA 4CD6A 4G56A 4D8LA 1DP0A 4ADSA 4JCLA 1CENA 3W83A 4LVFA 3IVSA 1AD1A 3EPOA 4C7DA 3V7PA 3MKVA 3APGA 8CGTA 2CZDA 2GYIA 4G1NA 3WQ4A 2WSYA 2CU0A 4B3ZA 4MYAA 2WHJA 1UYQA 2G8ZA 4PBFA 1QW7A 1O7AA 2AQVA 4HK7A 1A3WA 3OYXA 4CUCA 2WWCA 2BGQA 3NZGA 1C8QA 1E72M 4ML9A 4BF5A 2VZUA 5K7JA 3EOSA 1DJXA 5I79A 1S2UA 3SEPA 1OF6A 3RK8A 3UG4A 1M53A 4YHEA 1XBYA 2QPUA 3CIXA 2D0FA 4LXFA 2FMOA 3KUMA 1EIXA 4LCRA 4R27A 1S2WA 1Q6EA 3E96A 1I45A 4HHMA 4GNJA 4L9ZA 4RZ5A 1V08A 3EWWA 3EZ4A 2F6UA 1G69A 3GD6A 1JZ2A 4RDWA 1HG3A 5I07A 5A3HA 1THFD 2CITA 3QMTA 1TX2A 1DIKA 4AVNA 3BXWA 4CCDA 2VZTA 1XYMA 4DBSA 3GG8A 4HN8A 1HJWA 2Q8LA 3M46A 1HQTA 3EA1A 1O5RA 3T2OA 2D1ZA 1VCVA 3BJSA 3A3WA 4AF0A 3BO9A 1QNQA 2VRQA 4ASTA 1XYZA 3LRKA 3SN0A 3KOWA 4XAGA 4GJIA 4TMCA 1XLIA 1GVIA 2JFEX 1G5AA 5C2XA 1VAHA 1R2TA 4YHGA 5CPLA 1I1WA 1QPNA 1Y8BA 3GB6A 2ZUSA 4GPNA 5DMLA 1MEWA 2QJGA 5K2ZA 3V16A 1H11A 3W2UA 1R9XA 1MO0A 3VC5A 3ENLA 4PMYA 5LZLA 4XG1A 5AHLA 1XLAA 1W3IA 1EC8A 1LWJA 4GIEA 4GO9A 4L6OA 3QEZA 1DEDA 4QE1A 2D3LA 1M68A 4P5UA 1LROA 3IIXA 3CPUA 3SY5A 5CBJA 4IQJA 3AZTA 3MCOA 4UFIA 3KCLA 5BOOA 1FKWA 4UBPC 2QUMA 2R1NA 5BRBA 3OZPA 3ZR5A 4RNFA 5IBXA 1AUSL 3ISIX 2WHLA 1PB0A 1R38A 3PBYA 1UR1A 4AZBA 5JH2A 3W70A 6A3HA 1KWKA 1EP1A 3V0UA 1O60A 3LCGA 1BEUA 1KV8A 5DANA 1XYCA 4UWMA 4QG8A 3S2MA 1OGBA 3ARRA 3G6MA 4JIEA 2W5FA 3FX4A 2XIBA 1OJXA 1MDLA 3M0VA 3LTSA 2D20A 4DZHA 3C2VA 4PRWA 3QPEA 1P5BA 4EX4A 2IXVA 3UXLA 3ZFHA 4YLWA 4QCEA 4RZ4A 3RIKA 4O1AA 4TUFA 1WOBA 1T41A 4V28A 2XIOA 1TZ9A 3Q94A 3UR2A 1QU4A 3ARWA 4QDMA 1TPH1 1U1HA 4MYXA 4WSJA 3DGRA 4O15A 1US2A 2OJPA 1O5XA 3A21A 4JTEA 3NJ3A 1LL4A 3WQ8A 4HNCA 3AMGA 4MB3A 3APTA 4EK7A 4LYPA 2XDFA 4IG2A 1RBOB 5DQPA 3ITCA 1WE5A 4B3LA 2OVLA 3SCVA 4UQAA 1FWGC 1JCLA 1MVYA 2A3HA 4GG9A 3AS3A 2O9TA 2CCRA 1XDLA 1VBJA 4NZJA 3W00A 4K7YA 3LA4A 5JMUA 3O05A 1DWHM 1CI1A 1ZENA 4X9YA 3FA5A 1QOXA 5C71A 3TROA 4QAIA 2I7GA 4D6IA 1R3TA 2Z1WA 1HUVA 3EOUA 2R1KA 1QJWA 3RM4A 1HFBA 3WMBA 2WSRA 4M19A 4QQUA 2A79A 4GJ1A 4D72A 4LVGA 1F6KA 3VGDA 3C6CA 1OCNA 4EPKA 5HJYA 5CAKA 3QTGA 3NSXA 5FJOA 1QATA 2PWVA 4AIUA 4MJ4A 4UFKA 3NXLA 1TIWA 4B2DD 1KBJA 3CXOA 3WO8A 4PE8A 1DWIM 2GQAA 2GZXA 4WXZA 4YN5A 4MY1A 4ZXLA 4DPQA 3SQSA 1DE6A 2YYTA 3GC4A 3D5HA 1Q4WA 4R3UA 1U33A 1CLVA 1S38A 1DTNA 3ID7A 3ZSSA 2P0OA 2J6VA 2EEXA 5A6KA 1XIEA 5AHEA 1JNEA 3AIQA 4HSOA 1I2PA 1JG9A 4TR9A 3WDIA 3MUXA 2HSAA 3K4WA 2I9UA 3LS9A 3CNYA 4PL2A 5LYRA 1HIZA 1SJAA 3ITOA 4C6JA 3CWNA 1AH0A 5FSDC 4Y8EA 2OKOA 3ZVHB 2QGYA 4E5TA 2VTFA 1QI3A 4JNZA 4MZYA 2YA2A 3BAXA 1KCLA 4KIRA 3B9EA 5FJIA 3S8HA 5JUVA 2WKLA 3T0AA 1F9CA 1SJBA 2J4GA 4LUSB 3NO5A 4PRRA 3WYZA 4KW2A 3LCHA 1Z41A 1XLKA 3TW6A 1PIFA 1SMDA 2WKGA 1LM1A 5EMUA 1DIDA 4TIMA 3TOPA 3LCLA 2NVDA 5BZAA 4US5D 4ZOEA 3QGAC 3WX7A 1XDMA 2WNQA 3WEMA 3LCWA 2PTDA 1KM0A 1PZ1A 1R3SA 1XHGA 2C13A 1TELA 1XYAA 3R7MA 1YXDA 1EXPA 1OFEA 2P1FA 3TW7A 3G1DA 2GJXB 3S2JA 3LDVA 3NZ1A 4NAEB 4P8VA 1WXZA 5FL1A 4CCZA 1P0NA 3GW0A 4UR9A 1E6ZA 5FF7A 1OG0A 1RVKA 3LZ5A 4D6EA 2ZWZA 4DUVA 4KFPA 4R7WA 2X05A 3HGRA 3TQKA 4MMWA 1GHSA 5EMKA 2DEPA 5E9AA 1H7PA 1TV5A 1ZB5A 3R0KA 1KGUA 4HHLA 2VRJA 2JEQA 4S1FA 2ZX7A 2OLSA 2BX7A 4TV6A 3U8GA 2ALRA 3VIPA 4LTSA 3A22A 4ATWA 4IFRA 1TFVA 4RPQA 3ABSA 2ZXQA 4JTDA 3PZMA 4S23A 5ECVA 2I1OA 3RLGA 1AVAA 2ZBTA 1NOUA 1KBIA 1E40A 3L7RA 5T9CE 3H2EA 4WGHA 4B9YA 2EPNA 4ZO6A 3BAJA 4Z0SA 1VHCA 1IT0A 2BODX 3W07A 4GXPA 3ORWA 3DHDA 4JTHA 1QWGA 1FCBA 2W9MA 3THDA 1KM2A 2Y89A 1Q6CA 4AU0A 3VKBA 1J10A 1UHVA 1UWAA 2H9AA 4ROPA 3P74A 1IWPA 1VYRA 3U9IA 3GAYA 1VFTA 2VQTA 4QE4A 4C6NA 3KOZA 1MSSA 1ICSA 2XIQA 1KBLA 1DJHA 3M7SA 2BHYA 4HZ7A 2HEJA 4JAWA 1L6YA 1ISYA 3SN4A 4US5A 3WQFA 4N9DA 3QMRA 3BOFA 1H7NA 1A5CA 4PMQA 5HPCA 5LIKX 3O3RA 4LUIA 4BKNA 5BYWA 4L4OA 3TNBA 1UZ4A 5J04A 1IV8A 4RXGA 4D2JA 2J78A 1S5MA 1G0CA 1TUFA 1O95A 5HJXA 2J7EA 3S46A 1JR1A 4Q8UA 3TMQA 2GK1B 5A1AA 1KGWA 1VLIA 5D09A 3L0NA 4R34A 1IZCA 3BG5A 3O15A 4BWLC 1O5KA 4PTWA 1SFTA 1GCYA 4JGDA 4IH3A 3O7UA 4GY7A 4PB5A 1JULA 3C2YA 5ENLA 5HOSA 4M0XA 2IKGA 2RHGA 5LNWA 3CS2A 1PHWA 3L4TA 4H9XA 3WH7A 5C6MA 2FZMA 2ZVRA 5FF3A 1ZHAA 1LT8A 4GI4A 2BY0A 3ARTA 4XBKA 1UD2A 2ZZ6A 1FWSA 1SFJA 1XGDA 4AZ5A 2CETA 1SO3A 3FV9A 3KZPA 1JRCA 1P1MA 2PD5A 1BYAA 4DF2A 2CZVA 3IIPA 1WO2A 2INEA 4MJ2A 3SDOA 1VBGA 5AY7A 3QVQA 2EKCA 1LL7A 2VX5A 3TQPA 4F0LA 1W9VA 1XWYA 3SBFA 3PTDA 3G8EA 3NQAA 2PRHA 5IBXC 5CBBA 1PHQA 4GUHA 2A3BA 1OX4B 2E25A 2FZNA 1QR7A 3OODA 1UWUA 3B05A 3N6HA 3SFKA 3IGUA 3T7VA 2PFHA 1XBXA 3W53A 2HJPA 5DMMA 2QJHA 2QR6A 4CU7A 4OT7A 4HU4A 1QNSA 3D0CA 3GHTA 1TPDA 3DECA 1GKRA 5DN1A 1YE4A 1ZRQA 2ISFA 1P6CA 2Y24A 1FWNA 4EF9A 4A21A 4HNOA 2PWUA 2OMAA 3GTHA 4ERAA 2V63A 1BRLA 4I7VA 3NO1A 4NILA 4RUBA 2PLMA 4HPNA 2IPGA 1YYAA 2OB3A 6XIMA 1E0WA 3TUUA 2PCQA 3OGVA 3M1ZA 1LLOA 3CUIA 2VWTA 4XKMA 1VRXA 5T26A 4GH3A 4PRTA 7PTDA 2GQ9A 1C8YA 3MUIA 5DT5A 2NUYA 2KZHA 3NQ8A 1RQEA 2CWXA 1NH6A 4B9ZA 4RE0A 1TRDA 2WNZA 3AHXA 3ZS4A 3QH2A 4J1OA 1WKFA 4YCPA 2BOFX 4CLMA 1QNOA 4J28A 1W8SA 4BI6A 4AYSA 1EUAA 5HNUA 3P3BA 1K3UA 2J8FA 3ELFA 4JQ3A 4S3KA 4UNLA 2J7FA 2DZVA 4CCEA 2XFYA 2F2HA 2YA0A 4JX4A 1TPEA 3F4CA 3DESA 1SSDA 3FJLA 2X7WA 4EPDC 5REQB 4Z2GA 3DXIA 1IXOA 4GI8A 4FX7A 3GVWA 4S3BA 2PD9A 3C52A 4LT9A 2WWDA 1GQNA 3WD4A 3VD9A 4LBUA 1NWTA 2O9RA 3CLMA 4DN1A 5DMNA 2F6KA 4HB7A 5DXYA 2PDWA 5FI8A 4DNHA 3RR4A 4XD3A 3W28A 3HV8A 4GA8A 1J5SA 4KS0A 2EGZA 4DO5A 2YX0A 4YWIA 2VCAA 3WBWA 4LV9A 4W5ZA 2EO7A 2Y88A 3GU9A 3QYSA 5K9DA 4GWEA 3AQUA 1AW1A 1E1EA 1TV7A 4Z1AA 4YCOA 1F05A 2X1RA 5G4HC 1HJVA 1LUCA 4DWSB 3ANVA 4D6HA 3PUGA 4XBJA 1EOMA 5BW6A 2Y5SA 4GYPC 1W5OA 2W61A 4R85A 3NA8A 4WJ8A 2Q6ZA 1FWFC 3CWOX 3E5PA 4H9UA 3DYPA 1LBLA 3IIOA 5FSEC 4N42A 4UTLA 4OUIA 2ZXDA 3PULA 3E74A 2ACSA 3WQCA 2AKMA 5BXPA 3DU0A 5CKSA 2CBVA 2Y4SA 1J2WA 3P8IA 5C2CA 4DYEA 2FZDA 3MT1A 4IGNA 4P8WA 4FOKA 2TAAA 3P80A 2WBGA 1WAUA 4K3ZA 2C0HA 1NFPA 4GVFA 1O6IA 1V02E 3W7GA 1OFOA 4ZE5A 3H7RA 1UR3M 4IICA 1A0CA 3TTEA 2BVYA 1UWSA 4XKYA 1FWTA 4HCLA 3OPSA 3W1TA 1A50A 2PMQA 2Y62A 1M04A 4D6FA 1W9PA 4QM1A 4DNMA 1QOQA 6XIAA 3JW7A 3IRDA 1O5QA 1US0A 1ICPA 2Y2WA 3R6IA 4Q4RA 5A6MA 1QI5A 1YBQB 3EMZA 4R9OA 4LY4A 3DDMA 6TAAA 4PSRA 1JFHA 4KEVA 1EJUC 1WBJA 2VR4A 2ZZ4A 2OO6A 1PKYA 4DUOA 4C5ZA 3WF2A 4GYJA 2PDFA 3S42A 1ZS2A 3Q2DA 3V0TA 4AISA 3E5BA 4PMNA 4AD5A 4JX6A 3GNOA 4MG4A 1G4EA 1A5NC 3G1YA 3AS0A 5HMFA 5CJNA 5HMEA 4YTQA 2DT0A 4OKDA 3VXGA 3V5CA 1I2RA 2QUUA 2DZWA 4W88A 3G24A 3GH4A 4HHPA 2WNWA 1W37A 2EBNA 3H54A 4P61A 4MB4A 3ZLFA 3IJ9A 1W1IE 2ZTKA 1TMHA 5ABHA 1KW1A 2VEIA 1FDZA 3WBXA 1IIHA 8XIAA 1B4EA 3IIZA 2ZE3A 1RP8A 2P5NA 3ZLGA 4UTTA 4TMBA 2X0HA 4AHOA 2PDYA 4PMXA 2JF7A 4JIIX 3TKFA 2ZUUA 1DWGM 2GUBA 4FK9A 1YPIA 4JL2A 2V5DA 4GYPA 2YDAA 1QRQA 4NNBA 1JRBA 4IIFA 4GNVA 1XSKA 1FKXA 2ZC1A 3S5SA 2NWSA 5D4YA 1PDZA 5DCEA 4C65A 6REQA 5B7ZA 2GJXA 3JUGA 1NY1A 3DCPA 2PBOA 3BCJA 4N4QA 1S5VA 1XRTA 1P1XA 3SCSA 4JHMA 3OQ8A 3W88A 3B0VC 3VIGA 3S5ZA 4A3HA 1ZJAA 1XSIA 5KEZA 3AZSA 3VO0A 3HTWA 4WHBA 3SB0A 5EY5A 3QOKA 3FSUA 4IISA 5ABEA 4UOZA 2DH3A 3GIPA 1QT1A 4H9ZA 4WRHA 4ATDA 4OBTA 2YL9A 4MUPA 2VDHA 1EQCA 4H83A 4LB4A 2PF0A 3CM4A 5FL0A 5J8LA 2DV0A 3O6YX 3E2VA 3B3DA 1T8XA 5A2BA 1OK4A 3G6LA 2BY1A 1R46A 1WYIA 3WNLA 3SY8A 1C90A 3LPGA 4POCA 2PTXA 2QJIA 4LYRA 4UOJA 1SJCA 4A2RA 4RR4A 3HJEA 1MUCA 1NF7A 1KB3A 3STGA 1PZ0A 1V77A 4ZB2A 3SUWA 4H9TA 4BQ5A 3TJIA 2Q3RA 3NQBA 1IF2A 4HVXA 3U48A 4FPSA 2JK2A 1DL3A 1JPIA 4A35A 5GQBA 3GXTA 1R87A 3TWAA 3ABXA 1B3OA 1NWUA 4PH6A 4WOQA 3J7HA 1WOAA 4L6DA 4DBUA 1RJPA 2DSZA 4DJDA 4CD7A 2BZNA 2G37A 2YZRA 1TA3A 3HOJA 3IGHX 2A2IA 3WUBA 4NY2A 1HKJA 4TXEA 3EGJA 5A95A 5AB3A 3GU1A 3PHAA 2J77A 2FGZA 5H6HA 3ZM8A 4I8YA 3EOOA 2E77A 3T07A 3WJSA 4DI9A 1BKHA 4RV3A 2PRLA 5CSSA 3FGCA 3T81A 1TPB1 1L6WA 1BWVA 1Y65A 3T0TA 4MADA 1WAWA 3A4JA 2ZADA 4DJFD 3WBAA 3G0UA 2PRMA 3K46A 4O57A 1S2VA 2C7FA 3UA3A 3LM7A 1N7KA 4PUWA 4OZOA 3N4FA 1IXQA 3DI0A 1HO1A 1EUNA 3CQ0A 4JTCA 4NP7A 3USZA 5LNVA 1W3NA 4LBRA 1KRMA 2X16A 5F1VA 1KKRA 4U2YA 1G94A 4ORIA 4GQGA 1FHVA 1FXQA 3GG1A 5E1QA 3GWQA 2NX1A 1V51A 3E38A 4KIEA 4AB4A 4K36A 3BLEA 5FESA 5H8PA 5HNTA 1NARA 1XFBA 4RW3A 4GVHA 4U3AA 3BH4A 3SRDA 1AA1B 3M7WA 4G5DA 3HGSA 1GKPA 4HZMA 4M29A 1I2NA 4JKKA 2BTMA 2VR2A 3LNPA 1OC6A 2V5LA 1NFBA 4A3UA 4U33A 2WV8A 1HN1A 3FOKA 4LBSA 2OZTA 2CC0A 5KTLA 4AZ7A 1X98A 4EANA 3KRSA 1CEOA 1JF5A 2V5BA 4W7VA 3UP8A 4LWWA 2H3DA 3KRUA 4Z0JA 2FDSA 5H8MA 4LEFA 4O54A 4LUTA 4HZ8A 1X7IA 4FEZA 1OCBA 3W2KA 4S3AA 3P93A 1EZWA 1V7AA 3O1NA 1FWWA 1W2VA 3CZEA 5I00A 3VKCA 5JU6A 4NG3A 3KBSA 3CUZA 3M0ZA 5T8GA 5KZ6A 4GHRA 1REQB 2V5CA 2E5DA 3FAWA 2YL6A 1XYLA 2CPUA 5CZ0A 2WMKA 3LN3A 5A8GA 4HK6A 3U4AA 2VD9A 4H8NA 4CNTA 1Q7MA 3AIBA 1EQPA 2A3AA 4EXAA 3W7HA 3BMWA 1U5JA 3WLMA 4NJJA 2OSXA 4HT3A 2PAJA 3T4CA 1OIMA 5HULA 4OIFA 4CVWA 2OQYA 2IQDA 1ZALA 5L6UA 1DHPA 4JDBA 3II1A 4MWAE 4UNIA 1UR9A 4XD5A 1S46A 1TQJA 3SUSA 2Z27A 3M64A 4U2ZA 3ARZA 1FWIC 3TZFA 2R8WA 3BC9A 4FXFA 2XN1A 3RO6A 1TVNA 1UWQA 4UFHA 3STFA 3NAVA 2XINA 3WL1A 5D9MA 4F40A 4DYKA 2OG9A 4E8DA 3VYLA 1HGWA 3QM3A 1CT5A 3QJAA 3W1UA 5KZEA 1EWDA 3W3OA 1D7KA 4U4MA 5FEWA 2DVUA 3T2PA 3ARPA 3AOFA 2E1DA 3WJYA 2XSAA 3BMVA 1JDEA 2HXTA 1ZCCA 2EJAA 2J9YA 4UZUA 4J27A 4DB7A 3IUHA 3FAXA 1WV2A 4MM1A 2FJUB 2INFA 2QF7A 1WB0A 1VFFA 3CUGA 3V3WA 3W02A 3GVVA 1K8ZA 3UWUA 1X39A 1R9ZA 2JQXA 2GWGA 4W7UA 3IS4A 3E0WA 4JD4A 5A6BD 3L4UA 2PODA 4IGSA 1R8LA 3E2QA 1K77A 1J4EA 1KC7A 1Z8AA 4XZHA 3EWDA 3IPWA 2E6AA 1OEPA 4JR5A 3MS8A 1FHLA 3LPPA 4CNNA 5BU6A 1NDWA 1P4CA 4S38A 3GFZA 2WLZA 1LRQA 3SRHA 5E5CA 3CV2A 4BFAA 3LNMA 3WENA 5IDIA 1A47A 4AG0A 3GUGA 2CZFA 3KHDA 1JPMA 2PZNA 3HFTA 2OYLA 4Y8FA 3NQEA 4P7OA 4GABA 4O13A 2QV5A 4NRSA 4IIHA 1TPWA 5D2XA 1J79A 3NQMA 4QCFA 4GZIA 1H63A 3JVAA 1HKIA 1JNDA 1JPHA 3FKRA 3WD1A 7XIMA 3FW6A 3OU8A 1WBHA 1LYXA 3VUSA 3AZRA 4QX4A 2ZWYA 1FBAA 3CTTA 1WA3A 3A6OA 1J0HA 2FH6A 1CW2A 1Z48A 2ZRVA 2BXZA 3ZIZA 1HL9A 1ONRA 1XCXA 3IAQA 1DBTA 3EMCA 1VEMA 1RPXA 3WQGA 2ASHA 3MHUA 3NXFA 2VNCA 3NQ7A 1RP9A 3CHFA 5A6JA 1XRSA 1MW3A 5HQLA 3WQVA 3QF0A 4Y96A 1VJIA 3UPWA 2ICSA 1ZP3A 2DIEA 4UOQA 1IEVA 3W37A 5HR7A 3PZOA 3CAQA 3D46A 5SWUA 3MSRA 1YNPA 4W85A 3VK5A 2DPEA 3FYPA 1HKWA 1VBUA 2EQDA 4IPJA 3LXAA 3M6YA 4UQDA 1W5PA 4Y9OA 2YFNA 3UCQA 3ZMRA 4Z1YA 3KVMA 1U22A 3IUDA 4O50A 3M0XA 2KX9A 4J2PA 3CUJA 4DO7A 4BQ3A 1LLWA 1R7AA 1UWIA 1WUEA 3OBEA 2ZC8A 3NZQA 3XINA 1GQIA 4K7VA 4EWND 4IOTA 2FPTA 2IQTA 2D73A 2J7BA 4IXHA 1NDYA 5FOOA 2AQWA 5BRQA 1YPXA 2HBVA 2ATSA 1TCMA 4UTTC 3ANYA 4GIYA 3WQDA 1J6PA 2XUCA 1PUDA 4CD5A 3E12A 2D2JA 1JZ5A 4F4RA 4ERIA 1KFJA 1OD8A 3TAKA 1UP2A 4H2CA 1UP3A 7REQB 4BWLA 1GWJA 4LS2A 3PBVA 5E0FA 5BMWA 1W5QA 1DXEA 3BANA 2XSBA 3CH9A 4L80A 4RV8A 1VGAA 2BVDA 3KS6A 3A5FA 3QGKC 5AC6A 4DWDA 3W7LA 1R86A 4IHCA 3GBEA 3CIVA 1UR4A 3OA5A 1ITXA 2YCLA 4FF7A 3EAUA 3BLOA 2DW6A 4AZCB 3A4WA 2YCJA 4JY9A 2EPKX 1PJ9A 5G4EA 3VD4A 3CQIA 1HXJA 4M1BA 1EYWA 4A05A 3EEZA 4QAWA 3L0KA 3RRXA 2OU4A 2C8NA 1CXKA 2J8TA 3VNZA 4MWAB 1GVOA 2VX4A 3EX2A 2Z2BA 3ARSA 3SCUA 3VI2A 1XIMA 1S5WA 3UCCA 1FWEC 2DGAA 2A3LA 1UIOA 3OZYA 1HL8A 1JI2A 5JIPA 2FLIA 2QJMA 4JNMA 1TWIA 4U5IA 5EMLA 4DO4A 1XUZA 3EPMA 1EJVC 2IKIA 3P82A 4JTUA 1JCMP 1B2YA 5TD4A 1JI1A 1LP6A 2FVLA 1OFBA 4H00A 2YDSA 1ZU8A 3GC5A 1EDQA 4MGGA 2UWFA 1Q85A 2OSWA 1RVGA 3B8TA 1W1YA 1SZNA 4JOMA 3IEBA 1UUQA 2FJKA 2ZZ1A 3I6EA 1CB7B 4HMNA 1VC4A 4O0ZA 1I1XA 3S2CA 3CGTA 4M5PA 1ZBWA 3KBMA 4BA0A 4E8CA 2PDBA 2X40A 3VABA 4LC8A 1SFLA 4LH8A 3UWEA 1E71M 2QLYA 5I3KA 3FKKA 2VVSA 3A3XA 5LNUA 2RAGA 3VKDA 1R2SA 2EKGA 3KXQA 2B81A 3RJYA 1M7PA 1N2VA 3H2NA 4FNTA 3L4XA 4IQDA 4MLJA 1C7SA 3VFLA 1WDPA 3HPZA 4H6EA 3QV9A 3N2MA 3ZJ7A 5BOFA 3TXVA 4IP5A 4FSAA 2XWEA 3ANUA 5LGXA 2ISDA 4EXBA 4UXDA 2GJPA 4LPCA 4KMQA 3WFAA 2Z1BA 3CEPA 3BG3A 2VGIA 4IMDA 5D8ZA 3BV4A 3WLKX 5EPDA 1EX1A 2C16A 4KEUA 1U1UA 4GRSA 2DFAA 4Z2KA 3MCNA 1SR9A 2PTYA 3W76A 3NZRA 3REQA 3NUKA 3GSMA 5CH9A 1UA7A 1JQXA 1BG4A 1RUSA 1N8FA 5EKYA 3OB8A 1TVLA 1CGTA 4QGCA 1Q13A 2EXOA 4MWAD 1QI2A 2QUVA 1GQKA 3LHUA 2EG7A 4WY0F 5FF0A 4L61A 1N8IA 3G1HA 4NVTA 3A4AA 1G7UA 4NJKA 3ZYZA 3N6JA 3LGGA 2Z6JA 2WMIA 5C55A 4OV4A 4WGXA 4ZTYA 4N9EA 3VOJA 3W75A 3QPZA 1X6LA 2C1IA 1SJDA 2YB4A 4PTNA 3H2AA 3PTKA 4NI8A 3CPGA 1GTHA 2OTDA 3PZVA 4QE5A 1XLBA 3MVIA 3V4BA 2WSKA 2J7GA 1XJBA 3V1HA 1OX6A 2A21A 3WJWA 1A3XA 5MKGB 1F61A 4UTMA 4UTIA 5IFPA 4WKFA 4I9TA 3ARYA 1SVDA 2BVTA 3FGCB 1KQYA 2GDQA 3TXZA 2VZOA 2VGBA 5FEXA 2HWGA 2QV4A 1JVNA 1KXHA 2PF8A 4O12A 2RUSA 3QZEA 1G7VA 2YDRA 4YPJA 1BVNP 3AMCA 1TA3B 4J5NA 3BAYA 3QFEA 3UXKA 4ZO8A 1RK6A 1GZGA 1WCGA 2ZKMX 1T7LA 1ITQA 1S1RA 4L64A 2TSYA 4LAMA 3ZZ1A 2E4TA 1F3EA 2XVGA 3M47A 4PA8A 1H4PA 3BDKA 1ME7A 2Q3OA 3WD3A 5HQMA 1OQFA 1S5TA 3GIQA 3SN1A 2E09A 4HOWA 1QXLA 1XDJA 3M43A 4RX0A 3BMXA 5I3JA 3WQ5A 1XBZA 4X22A 1VZWA 5A94A 1GEHA 3KDOA 1XLCA 3NL2A 2NV1A 3EXSA 3ES8A 4IGMA 2BOGX 2FGBA 2YXOA 3G77A 1GOIA 4KFNA 1P0DA 2OT1A 1GQJA 3GH5A 2UY4A 1B90A 1W3JA 4JS3A 4OHQA 1U5HA 1VCGA 4A2SA 1XKJA 2WC4A 4IMCA 1MI3A 3TTQA 2YXXA 4DYJA 3FJNA 5I2UA 3VCRA 2CKSA 3ZVIA 2JGQA 1B3VA 1ODUA 1BXCA 2GDVA 3FA3A 1T96A 3IGSA 4N7QA 1SO4A 4LVDA 1YXCA 3L68A 3W86A 3RG6A 4D1IA 3HG3A 4HIBA 2GJLA 4DJFC 5CPMA 5HNRA 3VIIA 3SUVA 4ZO7A 2XIJA 3V5FA 3WLIA 4O19A 1TWWA 3VGGA 2QGHA 2QIIA 4A3YA 3LHVA 1Q4NX 3B9NA 5C70A 1OIFA 2GVYA 4JYFA 2NV9A 1A4MA 4HBKA 3VGEA 2YCLB 4ZR8A 3CIWA 4QQ3A 1K8XA 1SZFA 3CUHA 3LU2A 4W4QA 3NPWA 4H41A 1O94A 2RGLA 1TJRA 5G2WA 4B5WA 1FWRA 2YLLA 3W74A 2AGKA 2G96A 4CN6A 2G0WA 3GDBA 3G1VA 1D3HA 2XYLA 2QMKA 4G6CA 1MUMA 4ZQMA 1HVQA 3OIHA 3WEOA 1JD7A 1BTCA 1XS2A 3GDTA 4Q3MA 1QUMA 5T91A 2ZA1A 1UQYA 3VOGA 1UZDA 1XBVA 5DX7A 2NSXA 2FFIA 3WLLA 4LRSA 5EBUA 3QMSA 2Z0IA 2NT0A 4Y7EA 3S9IA 3P7YA 1AJ0A 4EE9A 1PKMA 4GK8A 3NSMA 1XKYA 2OYMA 4AY8A 2O55A 3CMFA 3ICJA 2P0IA 2YIHA 4TVUA 4MUZA 3LY0A 1E3XA 4GE8A 1Q8JA 3SIMA 1UD4A 4QLKA 3SGUA 4NZ3A 1PKNA 1UPPA 1H7XA 4XVDA 3F5KA 3T1GA 1VD6A 2J6XA 4XZNX 5K9XA 5FCZA 3AXIA 3R58A 5FJJA 3CUFA 1E4MM 4D8AA 3I6RA 1M7XA 1KFLA 2V38A 4IPIA 2HDJA 1Z32X 4JTTA 3AIEA 4MPQA 1UZHA 4ACZA 4LU0A 4ZQPA 2CLOA 4GI9A 1RR2A 1W1VA 1UJPA 3KM8A 4MJZA 1KFEA 2D3NA 3ZLHA 5BCAA 5LXEA 3EWCA 3FDGA 1VIWA 1EHAA 1PSCA 4W84A 3MI6A 4HPXA 1W1A1 2XN0A 4R5EA 1W91A 2E5BA 4HHHA 4DUXA 3LQGA 3B8SA 3W7CA 3QSTA 2D2OA 3M44A 4GVGA 1U83A 2ACQA 1AL7A 3HV9A 2PA6A 5BROA 4AZHA 1V6TA 3C3NA 1XR2A 2CLPA 2Y63A 3RLHA 2XZ9A 4YVPA 1PBGA 3H21A 2NSOA 1QASA 3VGHA 1K02A 4LCSA 4HP5A 1DV7A 4GACA 3H26A 5JVLA 3LV5A 4KWWA 4IWWA 1WDWA 3MBDA 1PL9A 3P84A 1F73A 3LHTA 1JYWA 3QQ1A 1DIOA 4O28A 1IZKA 1HJQA 3WLRA 1DIEA 1HZYA 1IGWA 3DHPA 2W67A 2QULA 6ALDA 1QO5A 3MUAA 4UMBA 4HOXA 1RALA 3TYZA 5FJPA 4ADUA 2BS9A 1C8VA 2H8ZA 3IUIA 4FF5A 4XO7A 2YR1A 3CT2A 4HZ6A 1M41A 2OR2A 3FJ6A 3R8GA 3FDKA 1XRFA 4Y9NA 2X1TA 2PLCA 4WDUA 5F4WA 2F61A 1DJNA 4D6DA 1QWKA 4FLSA 4YMZA 1WZAA 1KBKA 4HNLA 5C5YA 4WDXA