3DEVA

Crystal structure of sh1221 protein from staphylococcus haemolyticus, northeast structural genomics consortium target shr87
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
316
Chain Sequence
MVEIFNEIMQRVKEAETIIIHRHVRPDPDAYGSQLGLKLYLERKFPEKNIYATGEAEPSLSFIGDLDEIDDSVYSDALVIVCDTANAPRIDDQRYLNGQSLIKIDHHPATDQYGDVNFVNTEASSTSEIIFDFISHFNDLSIIDEHVARVLYLGIVGDTGRFLFSNTSPHTMEVASQLLAYPFNHNAELNKMSEKDPKLMPFQGYVLQNFELSDSHEYCQIKITNDVLKQFDIQPNEASQFVNTVADISGLKIWMFGVDEGDQIRCRIRSKGITINDVANQFGGGGHPNASGVSVYSWDEFEELAQALRQKLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SH1221 protein from Staphylococcus haemolyticus, Northeast Structural Genomics Consortium Target ShR87
rcsb
source organism Staphylococcus haemolyticus
molecule tags Structural genomics, unknown function
molecule keywords SH1221
total genus 88
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02272 DHHA1 DHHA1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.30 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3devA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 3devA01
1I74A 2IW4A 2EB0A 2ZXOA 4LS9A 2QB6A 2QB7A 2ENXA 2ZXPA 2ZXRA 3W5WA 1WPMA 1K20A 1WPPA 2QB8A 4PY9A 1K23A 3DEVA 4RPAA 1IR6A 1WPNA 2HAWA
chains in the Genus database with same CATH superfamily
1I74A 2EB0A 2ZXOA 4FC5A 2KW7A 4Q60A 1W61A 2QB6A 1XUAA 2QB7A 2ENXA 2ZXPA 2ZXRA 3PW9A 2GKJA 4JCIA 5GL4A 1K20A 5HA4A 1WPPA 4LB0A 1SDJA 2QB8A 2MPBA 3EKMA 4J9XA 5H2GA 2PVZA 1U1WA 1WPNA 4DUNA 1U1XA 4JD7A 1XUBA 1TM0A 1S7JA 5GL2A 3G7KA 3EDNA 4PY9A 4K7XA 4Q2HA 5H2YA 5GKXA 3FVEA 2Q9HA 5M47A 2IW4A 4K7GB 4GL6A 1T6KA 1U1VA 3ICJA 5GL3A 1U0KA 5IWEA 2Q9JA 2H9FA 1GQZA 3W5WA 4DWZA 5ANPA 4IK0A 4OA3A 1QYAA 2ZVFA 2AZPA 4JBDA 2HAWA 3IGHX 2PW0A 4LS9A 2KPTA 3PVHA 4IJZA 1QY9A 4LG3A 2OTNA 1YM5A 1WPMA 3WQZA 2GKEA 4JUUA 3EJXA 4J9WA 2LT2A 1BWZA 1W62A 3G98A 1K23A 2YMAA 3DEVA 4RPAA 1IR6A 4K8LA 3PTJA
chains in the Genus database with same CATH topology
1I74A 2EB0A 2ZXOA 4FC5A 2KW7A 4Q60A 1W61A 2QB6A 1XUAA 2QB7A 2ENXA 2ZXPA 2ZXRA 3PW9A 2GKJA 4JCIA 5GL4A 1K20A 5HA4A 1WPPA 4LB0A 1SDJA 2QB8A 2MPBA 3EKMA 4J9XA 5H2GA 2PVZA 1U1WA 1WPNA 4DUNA 1U1XA 4JD7A 1XUBA 1TM0A 1S7JA 5GL2A 3G7KA 3EDNA 4PY9A 4K7XA 4Q2HA 5H2YA 5GKXA 3FVEA 2Q9HA 5M47A 2IW4A 4K7GB 4GL6A 1T6KA 1U1VA 3ICJA 5GL3A 1U0KA 5IWEA 2Q9JA 2H9FA 1GQZA 3W5WA 4DWZA 5ANPA 4IK0A 4OA3A 1QYAA 2ZVFA 2AZPA 4JBDA 2HAWA 3IGHX 2PW0A 4LS9A 2KPTA 3PVHA 4IJZA 1QY9A 4LG3A 2OTNA 1YM5A 1WPMA 3WQZA 2GKEA 4JUUA 3EJXA 4J9WA 2LT2A 1BWZA 1W62A 3G98A 1K23A 2YMAA 3DEVA 4RPAA 1IR6A 4K8LA 3PTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I74 A;  2IW4 A;  2EB0 A;  2ZXO A;  4LS9 A;  2QB6 A;  2QB7 A;  2ENX A;  2ZXP A;  2ZXR A;  3W5W A;  1WPM A;  1K20 A;  1WPP A;  2QB8 A;  4PY9 A;  1K23 A;  3DEV A;  4RPA A;  1IR6 A;  1WPN A;  2HAW A; 
#chains in the Genus database with same CATH topology
 1I74 A;  2EB0 A;  2ZXO A;  4FC5 A;  2KW7 A;  4Q60 A;  1W61 A;  2QB6 A;  1XUA A;  2QB7 A;  2ENX A;  2ZXP A;  2ZXR A;  3PW9 A;  2GKJ A;  4JCI A;  5GL4 A;  1K20 A;  5HA4 A;  1WPP A;  4LB0 A;  1SDJ A;  2QB8 A;  2MPB A;  3EKM A;  4J9X A;  5H2G A;  2PVZ A;  1U1W A;  1WPN A;  4DUN A;  1U1X A;  4JD7 A;  1XUB A;  1TM0 A;  1S7J A;  5GL2 A;  3G7K A;  3EDN A;  4PY9 A;  4K7X A;  4Q2H A;  5H2Y A;  5GKX A;  3FVE A;  2Q9H A;  5M47 A;  2IW4 A;  4K7G B;  4GL6 A;  1T6K A;  1U1V A;  3ICJ A;  5GL3 A;  1U0K A;  5IWE A;  2Q9J A;  2H9F A;  1GQZ A;  3W5W A;  4DWZ A;  5ANP A;  4IK0 A;  4OA3 A;  1QYA A;  2ZVF A;  2AZP A;  4JBD A;  2HAW A;  3IGH X;  2PW0 A;  4LS9 A;  2KPT A;  3PVH A;  4IJZ A;  1QY9 A;  4LG3 A;  2OTN A;  1YM5 A;  1WPM A;  3WQZ A;  2GKE A;  4JUU A;  3EJX A;  4J9W A;  2LT2 A;  1BWZ A;  1W62 A;  3G98 A;  1K23 A;  2YMA A;  3DEV A;  4RPA A;  1IR6 A;  4K8L A;  3PTJ A; 
#chains in the Genus database with same CATH homology
 1I74 A;  2EB0 A;  2ZXO A;  4FC5 A;  2KW7 A;  4Q60 A;  1W61 A;  2QB6 A;  1XUA A;  2QB7 A;  2ENX A;  2ZXP A;  2ZXR A;  3PW9 A;  2GKJ A;  4JCI A;  5GL4 A;  1K20 A;  5HA4 A;  1WPP A;  4LB0 A;  1SDJ A;  2QB8 A;  2MPB A;  3EKM A;  4J9X A;  5H2G A;  2PVZ A;  1U1W A;  1WPN A;  4DUN A;  1U1X A;  4JD7 A;  1XUB A;  1TM0 A;  1S7J A;  5GL2 A;  3G7K A;  3EDN A;  4PY9 A;  4K7X A;  4Q2H A;  5H2Y A;  5GKX A;  3FVE A;  2Q9H A;  5M47 A;  2IW4 A;  4K7G B;  4GL6 A;  1T6K A;  1U1V A;  3ICJ A;  5GL3 A;  1U0K A;  5IWE A;  2Q9J A;  2H9F A;  1GQZ A;  3W5W A;  4DWZ A;  5ANP A;  4IK0 A;  4OA3 A;  1QYA A;  2ZVF A;  2AZP A;  4JBD A;  2HAW A;  3IGH X;  2PW0 A;  4LS9 A;  2KPT A;  3PVH A;  4IJZ A;  1QY9 A;  4LG3 A;  2OTN A;  1YM5 A;  1WPM A;  3WQZ A;  2GKE A;  4JUU A;  3EJX A;  4J9W A;  2LT2 A;  1BWZ A;  1W62 A;  3G98 A;  1K23 A;  2YMA A;  3DEV A;  4RPA A;  1IR6 A;  4K8L A;  3PTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...