3DEVA

Crystal structure of sh1221 protein from staphylococcus haemolyticus, northeast structural genomics consortium target shr87
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
316
Chain Sequence
MVEIFNEIMQRVKEAETIIIHRHVRPDPDAYGSQLGLKLYLERKFPEKNIYATGEAEPSLSFIGDLDEIDDSVYSDALVIVCDTANAPRIDDQRYLNGQSLIKIDHHPATDQYGDVNFVNTEASSTSEIIFDFISHFNDLSIIDEHVARVLYLGIVGDTGRFLFSNTSPHTMEVASQLLAYPFNHNAELNKMSEKDPKLMPFQGYVLQNFELSDSHEYCQIKITNDVLKQFDIQPNEASQFVNTVADISGLKIWMFGVDEGDQIRCRIRSKGITINDVANQFGGGGHPNASGVSVYSWDEFEELAQALRQKLLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SH1221 protein from Staphylococcus haemolyticus, Northeast Structural Genomics Consortium Target ShR87
rcsb
source organism Staphylococcus haemolyticus
molecule tags Structural genomics, unknown function
molecule keywords SH1221
total genus 88
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02272 DHHA1 DHHA1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.30 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3devA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 3devA01
2ZXRA 2QB8A 2QB6A 1K23A 1WPPA 1WPNA 3W5WA 1K20A 2QB7A 2HAWA 2ENXA 2EB0A 4PY9A 4LS9A 3DEVA 2IW4A 1I74A 2ZXOA 2ZXPA 1IR6A 1WPMA 4RPAA
chains in the Genus database with same CATH superfamily
4K7XA 4LG3A 1U1WA 4Q2HA 4FC5A 1U0KA 4IK0A 3W5WA 1K20A 5GKXA 2QB7A 1W61A 2Q9HA 2HAWA 4DUNA 4LS9A 4K8LA 1YM5A 2IW4A 2ZXPA 4OA3A 1IR6A 2GKEA 2Q9JA 2ZVFA 4DWZA 2ZXRA 2PW0A 3G98A 3ICJA 2H9FA 1GQZA 1XUBA 2KW7A 1WPNA 1QY9A 5H2GA 4JBDA 3EKMA 3EJXA 2ENXA 5ANPA 2KPTA 1T6KA 5H2YA 1U1VA 2GKJA 3PVHA 4JCIA 1SDJA 4J9XA 3PW9A 2QB8A 2OTNA 4K7GB 2QB6A 2YMAA 1WPPA 1W62A 2MPBA 4IJZA 1BWZA 4LB0A 1QYAA 3WQZA 4J9WA 2AZPA 5GL2A 1I74A 4JUUA 3FVEA 3IGHX 1TM0A 5IWEA 1K23A 1XUAA 1S7JA 5HA4A 4GL6A 3PTJA 4Q60A 3G7KA 1U1XA 2EB0A 4JD7A 4PY9A 3DEVA 5M47A 2PVZA 5GL3A 2ZXOA 2LT2A 1WPMA 5GL4A 3EDNA 4RPAA
chains in the Genus database with same CATH topology
4K7XA 4LG3A 1U1WA 4Q2HA 4FC5A 1U0KA 4IK0A 3W5WA 1K20A 5GKXA 2QB7A 1W61A 2Q9HA 2HAWA 4DUNA 4LS9A 4K8LA 1YM5A 2IW4A 2ZXPA 4OA3A 1IR6A 2GKEA 2Q9JA 2ZVFA 4DWZA 2ZXRA 2PW0A 3G98A 3ICJA 2H9FA 1GQZA 1XUBA 2KW7A 1WPNA 1QY9A 5H2GA 4JBDA 3EKMA 3EJXA 2ENXA 5ANPA 2KPTA 1T6KA 5H2YA 1U1VA 2GKJA 3PVHA 4JCIA 1SDJA 4J9XA 3PW9A 2QB8A 2OTNA 4K7GB 2QB6A 2YMAA 1WPPA 1W62A 2MPBA 4IJZA 1BWZA 4LB0A 1QYAA 3WQZA 4J9WA 2AZPA 5GL2A 1I74A 4JUUA 3FVEA 3IGHX 1TM0A 5IWEA 1K23A 1XUAA 1S7JA 5HA4A 4GL6A 3PTJA 4Q60A 3G7KA 1U1XA 2EB0A 4JD7A 4PY9A 3DEVA 5M47A 2PVZA 5GL3A 2ZXOA 2LT2A 1WPMA 5GL4A 3EDNA 4RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXR A;  2QB8 A;  2QB6 A;  1K23 A;  1WPP A;  1WPN A;  3W5W A;  1K20 A;  2QB7 A;  2HAW A;  2ENX A;  2EB0 A;  4PY9 A;  4LS9 A;  3DEV A;  2IW4 A;  1I74 A;  2ZXO A;  2ZXP A;  1IR6 A;  1WPM A;  4RPA A; 
#chains in the Genus database with same CATH topology
 4K7X A;  4LG3 A;  1U1W A;  4Q2H A;  4FC5 A;  1U0K A;  4IK0 A;  3W5W A;  1K20 A;  5GKX A;  2QB7 A;  1W61 A;  2Q9H A;  2HAW A;  4DUN A;  4LS9 A;  4K8L A;  1YM5 A;  2IW4 A;  2ZXP A;  4OA3 A;  1IR6 A;  2GKE A;  2Q9J A;  2ZVF A;  4DWZ A;  2ZXR A;  2PW0 A;  3G98 A;  3ICJ A;  2H9F A;  1GQZ A;  1XUB A;  2KW7 A;  1WPN A;  1QY9 A;  5H2G A;  4JBD A;  3EKM A;  3EJX A;  2ENX A;  5ANP A;  2KPT A;  1T6K A;  5H2Y A;  1U1V A;  2GKJ A;  3PVH A;  4JCI A;  1SDJ A;  4J9X A;  3PW9 A;  2QB8 A;  2OTN A;  4K7G B;  2QB6 A;  2YMA A;  1WPP A;  1W62 A;  2MPB A;  4IJZ A;  1BWZ A;  4LB0 A;  1QYA A;  3WQZ A;  4J9W A;  2AZP A;  5GL2 A;  1I74 A;  4JUU A;  3FVE A;  3IGH X;  1TM0 A;  5IWE A;  1K23 A;  1XUA A;  1S7J A;  5HA4 A;  4GL6 A;  3PTJ A;  4Q60 A;  3G7K A;  1U1X A;  2EB0 A;  4JD7 A;  4PY9 A;  3DEV A;  5M47 A;  2PVZ A;  5GL3 A;  2ZXO A;  2LT2 A;  1WPM A;  5GL4 A;  3EDN A;  4RPA A; 
#chains in the Genus database with same CATH homology
 4K7X A;  4LG3 A;  1U1W A;  4Q2H A;  4FC5 A;  1U0K A;  4IK0 A;  3W5W A;  1K20 A;  5GKX A;  2QB7 A;  1W61 A;  2Q9H A;  2HAW A;  4DUN A;  4LS9 A;  4K8L A;  1YM5 A;  2IW4 A;  2ZXP A;  4OA3 A;  1IR6 A;  2GKE A;  2Q9J A;  2ZVF A;  4DWZ A;  2ZXR A;  2PW0 A;  3G98 A;  3ICJ A;  2H9F A;  1GQZ A;  1XUB A;  2KW7 A;  1WPN A;  1QY9 A;  5H2G A;  4JBD A;  3EKM A;  3EJX A;  2ENX A;  5ANP A;  2KPT A;  1T6K A;  5H2Y A;  1U1V A;  2GKJ A;  3PVH A;  4JCI A;  1SDJ A;  4J9X A;  3PW9 A;  2QB8 A;  2OTN A;  4K7G B;  2QB6 A;  2YMA A;  1WPP A;  1W62 A;  2MPB A;  4IJZ A;  1BWZ A;  4LB0 A;  1QYA A;  3WQZ A;  4J9W A;  2AZP A;  5GL2 A;  1I74 A;  4JUU A;  3FVE A;  3IGH X;  1TM0 A;  5IWE A;  1K23 A;  1XUA A;  1S7J A;  5HA4 A;  4GL6 A;  3PTJ A;  4Q60 A;  3G7K A;  1U1X A;  2EB0 A;  4JD7 A;  4PY9 A;  3DEV A;  5M47 A;  2PVZ A;  5GL3 A;  2ZXO A;  2LT2 A;  1WPM A;  5GL4 A;  3EDN A;  4RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...