3DEWA

The structure of a putative tetr family transcriptional regulator from geobacter sulfurreducens pca.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
DCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The structure of a putative TetR family transcriptional regulator from Geobacter sulfurreducens PCA.
rcsb
source organism Geobacter sulfurreducens
molecule tags Transcription regulator
total genus 69
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17938 TetR_C_29 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3dewA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dewA02
2FBQA 2LFBA 1UMQA 3QPLA 3BR5A 5AQCA 3HB9A 4UUSB 1A6IA 5EDNA 3HGGA 5EG0A 3OOUA 3S17J 3HTJA 3VVYA 3WHBA 1IC8A 2DMPA 3ON4A 1NTCA 3WHCA 3B6AA 1H88C 3CWRA 1BW6A 5EGOB 2R5ZA 5M5XJ 1MBGA 3GEUA 3HOWJ 5M3FJ 1B72B 5JLWA 1U78A 5FKMA 2DG7A 3TEDA 5EZHA 4X1EA 3DCFA 1OJLA 5J1YA 3RKQA 2JA6J 3BR3A 2DA7A 3BR0A 1HDPA 2YVHA 2QTQA 4W97A 3A03A 3RD3A 1T56A 3BG9A 2YUSA 1JUSA 3HIMA 2M34A 3W6VA 1JUMA 1AKHB 3C07A 4S0HB 1JTXA 3IH4A 5FKLA 2MW8A 3PASA 3ZQFA 4AYBN 3NI7A 4KWAA 3O8HA 4MO7A 1LFBA 1BL0A 3O8GA 2G7LA 3DPJA 3BT9A 2LVSA 1Y1VJ 4DW6A 2E2JJ 3FK7A 3DEWA 3H3VK 1FIPA 4A3CJ 3QBMA 2ZCXA 2NX4A 5FLMJ 3CCYA 2QIBA 2WV1A 1XC5A 2JMWA 1JJ8C 1YRNB 5E3OA 2ID6A 5GPCA 1ZR4A 3S2DJ 3VVZA 3S5RA 2EZKA 5FKOA 2MSYA 3GZIA 3P9TA 2HYTA 5F1JA 5C3EJ 5C4XJ 2LKXA 2CQXA 1OFCX 2V57A 2L7FP 3JR9A 5M5WJ 4UUSA 1O4XA 3JRFA 2I10A 1HLVA 4FCYA 1Q1VA 5J1UA 5JLXA 2DMUA 2Y0SN 5K7ZA 5H9TA 5FKNA 3LSRA 5M3MJ 2L7MP 1S7EA 2E19A 2FX0A 2LP0A 1TWHJ 3FIWA 3I4NJ 4LOCA 3OSGA 3LJLA 2RASA 2HKUA 4HKUA 4A3LJ 2XGEA 1I50J 3RZOJ 2UXHA 1RR7A 1Z77A 1PUFB 1JKOC 1RKWA 3E7LA 5FHPA 4M3DA 3BCGA 5C4YA 5IPAA 1RESA 3EUPA 1F36A 4L62A 1APLC 3S2HJ 3TP0A 1UG2A 1ZKGA 2EBIA 4V2GA 2ZCNA 1RETA 3LSGA 4IHVA 3ZQIA 4MXMA 2HDDA 2HOTA 1MBFA 3BTIA 2PZ9A 3VUQA 1AKHA 2M2EA 5K7FA 5J1RA 2JA7J 4RDUA 3PO2J 1RKTA 2IBDA 2GUHA 4EEFG 5D19A 3NNRA 1POGA 2Y2ZA 5F04A 4DYCA 5E3MA 4Y7NJ 1MSFC 1IV6A 3OSFA 2QKOA 1TWFJ 2G0EA 4JX5A 2L7ZA 3NAUA 2YU9J 2HOSA 2YVEA 2COBA 3VVXA 4A3MJ 1QPIA 2XB0X 3AQTA 2CU7A 2K9NA 2JA8J 3VW2A 3PM1A 1RPWA 3Q3SA 1GV5A 5EEAA 3GTLJ 1YRNA 1WI3A 3BHQA 2JWTA 2L0KA 3TP3A 2DA3A 4IHWA 3BTLA 2QOPA 4ACIA 5EF6A 5D1RA 3GTPJ 4CYCB 4XRMA 2HQ5A 4FE7A 3UKGA 2L9RA 2ECCA 3SFIA 3I4MJ 3BR2A 2HXIA 2GFNA 3ZQLA 3IH2A 3KKCA 3JRBA 2Y9YA 3CDLA 3MN2A 1MBKA 5F0FA 4ABZA 2XPWA 3VOXA 2VUMJ 4Y52J 2R7ZJ 1FTZA 3IH3A 5F0HA 2REKA 3F1BA 3NRGA 3A02A 3O60A 1QVUA 2DMTA 1MH4A 1PUFA 2X6OA 1BJZA 1LE8B 4XK4A 3BG3A 1JKQC 4QSHA 3ZQHA 4QIWN 1JJ6C 1IRZA 3KZ9A 2GM4A 1P7IA 2JN6A 1ETQA 2DA2A 3Q0VA 4AUXA 3RH2A 2WGBA 4A3BJ 2FJ1A 2PMZN 5DTDA 3HM5A 3NXCA 2FD5A 3HKZN 1JKPC 2Q24A 1OCPA 2R0QC 1ITYA 3B6CA 1ZGWA 1AHDP 1ZTRA 4XRSA 2EZIA 1T33A 3LNQA 2TCTA 2WUIA 4M6VA 5HSZA 1CQTA 2X48A 2NOGA 2HYJA 3HTIA 1VNDA 3GBGA 4FE4A 4B4CA 4B1RA 1WGXA 3BQYA 1U8BA 3GTQJ 3COLA 2NS7A 1QVTA 3CMYA 1E3OC 2R93J 2XGCA 1WCMJ 3IUVA 4NDLA 5E3LA 3BR6A 2O9LA 3S16J 2IAIA 1H89C 1I3QJ 4M3GA 1GT0C 2H1KA 2WAQN 5GP9A 2IEKA 2GBYA 1Z0XA 4JX4A 1AU7A 4CYCA 4A93J 3HOYJ 3G7RA 3HTAA 2LR8A 5J3LA 2ZCMA 4IEJA 5EZGA 2WB1N 1ETYA 3ON2A 3E7QA 2KT0A 1WH5A 1JTYA 5K58A 1ETWA 3NARA 1OCTC 2ZOYA 2OERA 3JRAA 3JRCA 3HGYA 1FIAA 2NP5A 2Y31A 1LE8A 2DA4A 2M8GX 4NELA 3VW1A 3CQZJ 4D7MA 3VIBA 1GUUA 4MFEA 2VKVA 3V6GA 5FGLA 1IDYA 3VPRA 3A01B 3S1MJ 2PBXA 1A5JA 5F0CA 2O7TA 3HEFA 2NVQJ 3GTKJ 4JL3A 5CXGA 2CUFA 2LY9A 1HDDC 5F27A 4FISA 2HOAA 2W48A 3GTMJ 1BA5A 1QRYA 2JA5J 3BTJA 3RZDJ 4BY1J 3HBLA 4HNVA 1G2HA 5HAWA 1B8IB 4MK6A 4D5FA 2ECBA 4IHYA 4X6AJ 2CQQA 1BW5A 4V2FA 3JREA 3C2BA 2ME6A 4JP0A 1IUFA 2ELKA 1ENHA 4C3JJ 1JKRC 1D5YA 3TW6A 1NK2P 1FEXA 2NP3A 2KDZA 1EF4A 1SGMA 4XICA 3VW0A 5C44J 4M3BA 2Y30A 4DZPA 4DYRA 4GCLA 1X58A 2NVYJ 2MG4A 2NVXJ 2ME0A 4A3KJ 2E1OA 4UUTA 4NN1A 1UHSA 1ZK8A 4BY7J 3SDGA 2VI6A 1U9OA 2DG8A 1ORKA 2DA6A 3QPSA 1JUPA 1X2NA 2YS9A 1MH3A 4IHXA 1MBEA 2CJJA 5IOYA 4AF5A 3TW7A 3T6NA 4GCTA 4D7NA 1K61A 4M3FA 3GTJJ 4MLOA 2CRGA 3Q0WA 3FK6A 4DZJA 1IDZA 1IGNA 2DN0A 3MNLA 2W53A 3BRUA 1MBJA 3G1MA 1VFCA 1NK3P 1TC3C 2P81A 3FISA 1X2MA 5D18A 1ETKA 3A01A 2ID3A 2UXIA 4D5CA 1R9TJ 2RAEA 4QTRA 1JT6A 3HTHA 2TRTA 2GLOA 5F08A 1SFOJ 3V78A 2LTPA 4BBSJ 3G56A 2LK2A 4MFDA 1WPKA 2OI8A 4A3JJ 1B8IA 5HBUA 3K2AA 3KNWA 2H8RA 2X9DA 3G1LA 3VOKA 3LSJA 3G1OA 1LFUP 2XGDA 2OF7A 3JRGA 4JYKA 2D6YA 1VI0A 2M9HA 4I6ZA 4XRSG 3GTOJ 2HI3A 2IU5A 2LLKA 2QWTA 3JSJA 4MIMA 3MVPA 4XIDA 4C2MJ 1HF0A 3FKIJ 1JGGA 3QQAA 2HXOA 1ZR2A 3BTCA 4GFLA 1TWGJ 4C3IJ 2R92J 4L5EA 4RBOA 5IYCJ 2E2HJ 2XRLA 3B81A 3BR1A 5FJ8J 5IP7J 2QCOA 3LOCA 2NVTJ 3NPIA 4UDSA 1W0UA 3ZQCA 1IJWC 2JJ7A 3S1NJ 4AC0A 1MBHA 4W1UA 5M5YJ 2M0CA 4A3EJ 1VF9A 2JK3A 3K7AJ 1Y1WJ 3BNIA 3QKXA 2EZLA 3CRJA 2AHQA 2ZB9A 2DTZA 2DMQA 3BQZA 1F43A 4FTHA 4A3FJ 1ETVA 5DAJA 3S1QJ 4G12A 3GTGJ 4CGRA 1UI6A 3M4OJ 4GFKA 2NS8A 1K83J 2FQ4A 5IYBJ 2DJNA 4A69C 3BJBA 1IG7A 4C3HJ 3H0GJ 1FJLA 1GDTA 5C4JJ 4AC6A 3S14J 5IP6A 5HODA 1I6HJ 4DYQA 4BBRJ 2R5YB 1H8AC 2VKEA 2VPRA 5DS9A 1TWCJ 1JT0A 4A3DJ 5IYDJ 4YZEA 5EFYA 2MGQA 4J19A 2G7GA 3IV5A 3JRIA 1MNMC 1HCRA 2F07A 3M3YJ 3AQSA 4GFBA 2ZOZA 1XS9A 3JRDA 2EQRA 1SANA 1W0TA 5EGOA 4ICHA 2OPTA 5CW8A 5EG0B 4JX6A 2UXPA 4JKZA 1ETXA 3D1NI 1B72A 5FLVA 4B3AA 2R5ZB 4JNNA 2Y9ZA 2K9QA 3HOVJ 3BG5A 4A3IJ 1ETOA 2XPUA 5CXIA 3S1RJ 1XG1A 2G3BA 2DA5A 2QF7A 2B63J 3HOUJ 4M3EA 5FKKA 3RQIA 3L1PA 3CJDA 3OIOA 2O8KA 2G7SA 2RHAA 4A3GJ 2LD5A 5IOZA 3ZQGA 3EGQA 2EZHA 2O7OA 3MKLA 3HE0A 3LWJA 4BXXJ 5EYRA 2K9SA 2EH3A 2K40A 5BNGA 3PO3J 4ME9A 2AO9A 1ZQ3P 2XB5A 2UXOA 2XSDC 2D5VA 2N8GA 1P7JA 1DU6A 3HDDA 1HOMA 2CUEA 2DA1A 1GVDA 1FTTA 2XDNA 3HOXJ 1MSEC 1GV2A 5K7HA 3ANPA 3ZOBA 4GCKA 3S15J 3LSPA 4PXIA 1TWAJ 3KKDA 1WH7A 4I76A 2R5YA 2DMNA 4BKXA 1UI5A 3FRQA 2GENA 3HOZJ 3LHQA 3Q0UA 2XPVA 3VP5A 5FMPA 3SJMA 1DU0A 5IP9J 3JRHA 9ANTA 1U9NA 5E3NA 2UXUA 3PPBA 3ANGA 2E2IJ 5GPAA 3F0CA
chains in the Genus database with same CATH superfamily
1V54H 4EM1A 3J7ZI 2OTJI 2MC3A 5AQCA 2UWMA 2FMLA 3S17J 4BAYA 4XLAA 2R7VA 3VVYA 4IHTA 2DQLA 2DMPA 4A0XA 3ASOH 3CF5F 3CWRA 4M6XA 2JQ7A 1VZ0A 2K86A 2R5ZA 3EYYA 4CO8A 1I1GA 2VB6A 5IT9K 3QU6A 3QRFF 1R00A 4IL6C 3P9CA 1YYVA 4ENJA 5JLWA 3MAJA 1TNTA 5FKMA 4NQWA 4E7KA 3TEDA 4X1EA 3RKQA 3PJRA 5IT9Z 2DA7A 3L09A 4PJMA 4RGRA 3VDXA 5LFAA 1IXRC 1WJDA 4W97A 3KLNA 3RD3A 2KHMA 1TQMA 1T56A 2MBFA 4F55A 2JZYA 1PDNC 2HR3A 2HPMA 3O6BB 4HW0A 5LGNA 3SHFA 1JI8A 1JUMA 1R1UA 2WWYA 5HLHA 3FWEA 2OQRA 3IH4A 2MW8A 4F7ZA 1O3QA 5E17F 3ZQFA 3PASA 3K4BA 3T0YA 3MZ8A 3CMEI 3DKXA 2PG4A 2G7LA 2Z16A 1W7PA 5JHUA 1J2XA 1IRGA 2L7KA 1P9QC 3CJNA 3CUQA 3FK7A 3I0TA 4N4OB 5FD6A 1H9GA 2NX4A 3CCYA 1D8JA 2LYCA 1ZH5A 1JHFA 2QIBA 1XC5A 5CPRB 2ZJQF 2DCEA 2JMWA 1K78B 3BOQA 3T1BA 1EJ9A 3VVZA 2ID6A 3S2DJ 3W6KB 2STWA 4GCLA 4S05A 3P9TA 2Y48A 3GZIA 2AQFA 4BQNA 5L3CA 4N4NB 2JRMA 2LKXA 3FM3A 5L3DA 5L3FA 1OFCX 3JR9A 5M5WJ 2EINH 2VXZA 1O4XA 1STZA 4CZCA 1MMGA 1Q1VA 4FCYA 2QBYB 4E7JA 2DMUA 2Y0SN 3HC7A 3DEEA 3ONQA 4YIFA 5K7ZA 5DDGA 3LSRA 5H9TA 3TGNA 1B9MA 2ICWG 2XAHA 1N75A 2KRCA 4IOCF 3M1CA 3LJLA 1IRXA 2DODA 1Z6RA 4A3LJ 2QLZA 3GW2A 1I50J 3RZOJ 1RR7A 3V8JA 4CCNA 2F2EA 3E7LA 4ENNA 4M3DA 1Y6IA 2BXYA 5J4VA 1XDSA 3DQVC 3OIQA 4BE0A 3HPGA 1UI6A 4BXFA 4EGYA 2ZCNA 3K0LA 4A2UA 1Y39A 4LGWA 4V19K 2R7XA 2HDDA 5FD5A 4RB3C 2V4JC 2EILH 2HS5A 5K7FA 2JA7J 1T38A 1BC8C 1POGA 2LMDA 1S7AA 3WG7H 1QBJA 1G8XA 4Y7NJ 2P5LC 2G0EA 2XAFA 4ETSA 2OC6A 2AS5F 4Q4ZF 4HLYA 4YFNF 2HOSA 2BXZA 3QP5A 3OYGA 3CCLI 3VVXA 2R4GA 2L4AA 3AQTA 2K9NA 1XGSA 2LKSA 3OYJA 4ON0A 3HSFA 1SMYF 3CTAA 1TZLA 3PM1A 3RCOA 4OAZA 5H6QA 5EEAA 2FQ3A 3CLOA 3GTLJ 3BHQA 4P1WA 5H2FC 3M8EA 2DA3A 4HEA2 1PP7U 1LVKA 4IHWA 4I09A 3P7NA 2QOPA 3AL0B 4AVPA 4HSTA 4XRMA 3TO9A 1IF1A 3UKGA 1V4RA 2L9RA 4CCKA 3I4MJ 4HOBA 2HXIA 1J59A 2QBYA 2IXSA 1MJAA 2QVOA 1VQ8I 2JSPA 3VOXA 2VUMJ 4Y52J 2R7UA 3IH3A 5F0HA 3F1BA 1QO0D 3A02A 4ZYGA 1GVJA 1KQ0A 3BZ6A 1WJEA 4KT6A 3WE3A 1U8RA 4BNCA 1BJZA 4IF4A 1LE8B 4OIRF 3F8CA 3BG3A 2ISZA 1JKQC 3SZTA 5BMZA 2BE5F 2DI3A 1JJ6C 1IRZA 3KZ9A 3TOBA 2HDWA 1ETQA 5E8GA 1D1AA 3Q0VA 3WU1B 3RH2A 1XPXA 3VOEA 3L2WA 2E35A 2Y0SA 5DTDA 1X1CA 3HHHA 3O3KA 4ANJA 2EA2A 4N0BA 3HKZN 1JKPC 4B48A 3B6CA 2M1BA 1AHDP 3RPUA 1KONA 3CUOA 4XRSA 2EZIA 2VQGA 1NG7A 5HSZA 2DDAA 1YS7A 1UCRA 1K4SA 5DEQA 4II3A 3V7CA 4BJTA 5D4RA 1LEBA 2EJRA 1G3SA 1QQIA 3CMYA 3FXRA 1HW2A 2R93J 2LBFA 5ICCA 1WCMJ 4M73A 3I64A 2WY7Q 2O9LA 1NHAA 2BBYA 2IAIA 1D8KA 4U87A 2K4BA 1I3QJ 5LRSA 3G6EI 2E5ZA 4GYGA 2WAQN 4GCVA 5GP9A 1Z0XA 1S6LA 3M9AA 4D0PA 3G7RA 5D5WB 3GX4X 3BJ6A 2RREA 2V6EA 4IEJA 5E20A 2WY8Q 2WB1N 3S3OA 3RKXA 2HZTA 3HTSB 4KICA 3JRAA 3JRCA 3E1SA 1TW3A 2DJIA 2F5FA 3FX3A 2NP5A 2Y31A 2L54A 4BGDA 2MD0A 1LE8A 2DA4A 3CCQI 2FJI1 1PVEA 4M9XA 2F6CA 2A3SA 2KFDA 1KU2A 2F5DA 3LQRA 2CUZA 2VE9A 4D7MA 2XRNA 4N9HA 3VIBA 4MFEA 2VKVA 4IQ4A 4MEYF 3I55I 4CGZA 3V6GA 2ZFUA 4HDUA 1BR4A 3VPRA 2FBHA 3CCUI 1RRJA 2NVQJ 3GTKJ 4JL3A 3DU6A 2LY9A 4GYIA 3PIOF 5F27A 2K3PA 2W48A 4RS8A 5LLQA 2JA5J 2ESHA 2XUBA 5D5UB 1PP8F 4HNVA 1B8IB 3RQ4A 3BLYA 2ZCWA 2ECBA 4IHYA 5E1XA 2CQQA 4AM3A 2PN6A 3JREA 4Y17A 4YRVA 2ZMEC 3PFIA 4C3JJ 3AG1H 1JKRC 4KISA 3N4MA 3TW6A 3H0DA 3HKZA 1NK2P 4ZDPA 4C2TA 5TRDA 3E6MA 3E6BA 4C9YA 2Y30A 4DYRA 2NVYJ 2MG4A 1BI1A 4BL0B 4GGGA 2F5CA 3X2QH 3OYBA 4BACA 2NVXJ 2HWVA 1BR2A 4BDYA 4Y3OA 4CCMA 2R7TA 2GXAA 4UUTA 4AWXB 3DTIA 5D6FA 3KYLA 3IRRA 3HUGB 2IGOA 4L9JA 4A5MA 2V9PA 3C2HA 2FMYA 3WTVC 2L9VA 3BZKA 2DK8A 2VJIA 2GXBA 4IHXA 1MBEA 1FOKA 4HYEA 2ZNYA 4UVCA 5KK1A 4UUVA 1P4AA 2GZWA 2E1MB 2WAQA 4DZJA 2CRGA 4AIKA 1FSHA 4F92B 2IS4A 2O03A 3IKTA 1O7FA 1TTYA 2W53A 3MNLA 2WB1A 4N9IA 4UNOA 1IN6A 1QHGA 1TC3C 1X3UA 1X2MA 2VKHA 5D18A 3R0JA 2CH0A 1U2WA 3G2BA 3CO7C 3A1YA 3K4MA 2VJ4A 4WF2A 2LTPA 1ZELA 5B1AH 2LY1A 4A0ZA 4MFDA 4Y15A 4LG0B 1XSVA 1OPCA 2A2FX 1B8IA 3KETA 3BG7A 2P8TA 2H8RA 5CYVA 2VASA 1S8NA 4E7IA 2Z9OA 2BGCA 1LFUP 2OF7A 4OINF 1EV7A 5CKTA 2D6YA 2FU4A 3JSJA 2M9HA 4XRSG 2K4JA 4II2A 2LLKA 2QWTA 3EUHA 2OUMA 1V5FA 3RYRA 3FDYA 3R6SA 4C2MJ 2XC7A 4KT5C 2ZSHB 1HF0A 3CJRB 1H9TA 3L2UA 3QQAA 1ZR2A 1IO2A 2CSOA 2L01A 3H3UA 1TWGJ 3U1KA 2V79A 3HRSA 4L5EA 1P6RA 1IAWA 2O6GE 3I54A 4R79A 1LFPA 1OR7A 3DLLF 2H94A 1V5GA 4RLQA 3L2VA 2IA1A 1W0UA 1V5EA 4UDSA 1IJWC 1MZBA 5HS8A 4UVBA 3H9QA 2DOAA 1W36C 4MGRA 5M5YJ 1K6OA 1JGSA 2QEXI 1WWXA 2ZB9A 2DTZA 5JR3A 1MMDA 5AIQA 1Z21A 2VJ5A 4ZZDA 1F43A 5CQGA 4A3FJ 1ETVA 1SD7A 2FBIA 3W2AA 3SQNA 2NS8A 1K83J 3KZZA 5IYBJ 2DJNA 3TDUC 4YEJA 2O8XA 3BJBA 2ZY9A 5F64A 1Z3YA 3KP3A 5C4JJ 2QQAA 1ZARA 4DYQA 2CGPA 3F8NA 2VT2A 3E6DA 1GLNA 4DGWB 2XF5A 2MGQA 1X19A 2R7QA 4P5OA 4LG0A 2L2OA 4YELA 2G7GA 3AQSA 3ZQ7A 4GFBA 1XS9A 4TV7A 3TL4X 4ZZLA 2EQRA 1BI3A 1R1TA 2HYGD 2PEXA 1LDKB 5CW8A 2A6TA 1P92A 3BWGA 2QKLB 2EIKH 1ETXA 5L3EA 3D5RC 3DPTA 2KMUA 2OCCH 4ESBA 2LSOA 1X1PA 2IA0A 3DFGA 3HSRA 3FMRA 1OCCH 2D1HA 5CXIA 2DT7B 2M3AA 1DQUA 2G3BA 5E1ZB 4G94A 3ULQB 4DOZA 2H6CA 2ZJPF 3K1PA 5DV5A 3HOUJ 3RQIA 2P7VB 2EFOA 5E79C 2V1XA 3OIOA 2LF7A 2EIMH 2FE3A 2G7SA 2V1UA 1ON2A 2LD5A 2O61A 3E3VA 1XMKA 3QOPA 2EZHA 3HE0A 3LWJA 1A31A 2ZXWH 2YU3A 2K40A 1TQIA 1QPMA 4C2UA 3H5RA 5AIPA 3QODA 2K3FA 3GFMA 2XB5A 2GXGA 2D5VA 4UV8A 3HDDA 1OKRA 5FFXA 2DA1A 4OAYA 4MHGA 1EH7A 4DBQA 2YPRA 1MSEC 3LMMA 1YS6A 1MMSA 1YFHA 4BYYA 3F9KA 3HRMA 1TT5B 2R7FA 2DMNA 2W7NA 1UI5A 1VQ9I 4KUMA 5FMPA 4JOMA 3VYRB 4OU0A 3K4CA 5BOXA 2UXUA 3NEUA 3DBLB 3AFHA 3ZPLA 1IRFA 1MNDA 2ETHA 3V7SA 4H0EA 3BR5A 2DOFA 4Z6YA 5E18F 4UUSB 1LQ1A 2M5WA 2ZKZA 3HGGA 1FMVA 3HTJA 2WC2A 5D6EA 1IC8A 3I4PA 3ON4A 3IAS2 3F8BA 4B3XA 3WG9A 1L0OC 1BW6A 4XR6A 3NS4A 5M5XJ 1W1WE 3QYEA 1TNSA 1T0FC 2WBMA 4XRFA 3GEUA 3HOWJ 3ZMTA 5M3FJ 2BHYA 2LKPA 3LAPA 5CVIA 2DG7A 1R4MB 1RC9A 1JE8A 3DCFA 3C2GA 3HRUA 2CMPA 3BR3A 4U0WA 3ZN1A 2RV8A 4MNUA 2VIXA 2QTQA 3A03A 3O2PE 2DT6A 2YUSA 1JUSA 5F6FA 1WKMA 3W6VA 2WV0A 3V42A 1ZRCA 4IRHA 2F48A 1XGNA 1I39A 2YSRA 2XVCA 5F1RA 5FO5A 3MFKA 2PMHA 2K85A 2LC2A 1OISA 2EK5A 3F6OA 1U3EM 1VQMI 4UHTA 1BL0A 1G4DA 3K4JA 3LWFA 5CLSA 4L9NA 5GAGJ 2LVSA 3J7AO 5K1YA 2H27A 2P6SA 3LSTA 2RQPA 3E97A 4DW6A 2E2JJ 3DEWA 4FETA 1FYLA 3MKWB 1BM9A 2ZCXA 3QWLA 2XSJC 2KISA 4BH9A 2HDCA 1AOYA 3MMYB 3F8FA 4NBQA 2WV1A 2HYFA 5E3OA 5GPCA 3U1DA 2V7FA 4R8HA 3NWTA 1LDJA 4UUSA 2UUZA 2L02A 4XN0A 1K79A 4XN3A 1WFXA 3FMQA 2G7HA 2FX0A 2LP0A 4KIBA 1TWHJ 2W4SA 3FIWA 1UZCA 3OSGA 2R7RA 2RASA 3R61A 2HKUA 4HKUA 2RNJA 1A04A 3QPHA 3KP4A 5DD8A 4ZJZA 2NVUB 2ZXHA 3K6GA 2M4GA 2CV1A 1NG6A 1T2KA 3BCGA 2GOMA 4U9LA 2M0MA 2R7OA 1F36A 2A05A 3TP0A 1UG2A 1ZKGA 4IPAA 4NQWB 3TDZC 1RETA 3W2VA 2WAFA 1W5TA 1KA8A 4IOAF 2BZTA 2HOTA 3BTIA 2FOKA 2GUHA 1VQ5I 1MMAA 5F04A 5E3MA 1MSFC 2QKOA 1TWFJ 4E70A 1BIBA 3NAUA 2YU9J 3H9GA 4XKBA 2QGUA 2D45A 2IVMA 4KITB 5DD4A 3AKZA 4HF1A 3FM5A 3PL8A 3K70C 1G3TA 1RPWA 3ERMA 1FBQA 2BY0A 2OZ6A 3DPUA 3TP3A 2K5CA 2NOJB 4BXUA 2KQRA 3HHGA 4JBAA 5ICFA 3ZMDA 5EF6A 5FRMA 5D1RA 3GTPJ 2W00A 1MNEA 2DW4A 3SFIA 2VXDA 1P2FA 3KE2A 3KKCA 3CDLA 1Z1DA 4UB6C 4E7LA 2JVHA 2L3DA 1ODDA 3HRTA 4ABZA 2R7ZJ 4FQGA 1FTZA 2E36A 3U9GA 1SAXA 2H09A 3AG4H 2IGNA 3ZXSA 1MH4A 2XAGA 1X3ZB 4IZZA 4XK4A 1SVLA 3ZQHA 1Z67A 2DFHA 1P7IA 4S04A 4AUXA 1FT9A 2Y0MA 2WGBA 4A3BJ 4M72A 4UXNA 4OD5A 3CMMA 2BW3B 2Q24A 1OCPA 2EFPA 1ITYA 1ZGJA 3DBRB 5DM7F 1DGWY 2WUIA 4M6VA 4RB2C 1S5LC 5FB2A 1W36D 2PQ8A 2NOGA 2HYJA 1QA6A 3I53A 3HTIA 1X1BA 2MH2A 3WODF 4B4CA 4B1RA 1U8BA 3SEQA 5CQEA 4OIPF 1EA3A 1QVTA 2NS7A 1LB2A 1J9IA 2BYVE 1E3OC 2XGCA 1IXCA 5J8CA 1USSA 2VOPA 1TQPA 3TKYA 3GFIA 5D8LB 3KCCA 1B6AA 5BPDA 1H89C 1HQCA 1XDUA 4M3GA 2NNNA 3L9FA 1GT0C 4I2OA 1S7OA 1AU7A 1U5TC 4NC7A 1FC3A 1XMAA 4H4KC 3TO6A 2LR8A 2ZCMA 1FNNA 3PNYA 1YW9A 3F8MA 4HZFA 3KLOA 1YI2I 1WH5A 4I7HA 3OS2A 1JTYA 4HG2A 5K58A 1KZHA 3LA2A 2IGMA 2DPDA 3GZ5A 1O57A 2OERA 2KRFA 2ZJRF 2E1CA 5K5RA 4DVYP 4XL9A 4HAMA 3DV8A 4CICA 1R49A 2X1EA 2M8GX 5DCMA 4PCQA 3EQLF 3IWZA 3CQZJ 5AONA 1USTA 2QA4I 3S93A 2R3SA 2MYSA 1RNLA 2BVLA 1OMIA 2H6BA 1KYZA 1HXDA 3D5LA 3FXLA 1J75A 2GWRA 3KIOA 2O7TA 1FOYA 2BW3A 5CXGA 1BBYA 5CVJA 2OTLI 3E0JB 1MIJA 1HDDC 1KU3A 3GTMJ 1QRYA 3TO7A 3S2WA 1OYWA 3IL2A 4FT8A 1XN7A 2RVCA 4X6AJ 1U6GA 2ME6A 5GADJ 1IUFA 1WI9A 4F3QA 3BROA 4ESJA 3RIRA 2NP3A 2IA2A 3VW0A 2IJLA 4XQFA 1TP4A 4DZPA 4GXOA 3WGGA 1X58A 4M9ZA 2LBFB 2ME0A 1ZAOA 3K1NA 4HX4A 4Y33A 2ZSIB 4X0GA 5LHIA 2V9KA 1VQ6I 3IHUA 3F23A 2E1OA 4HF2A 1ZK8A 2Q1ZB 4BY7J 3WTZA 5LRRA 1XCVA 4MEXF 3REOA 2DA6A 3OYHA 4BU2A 4UV9A 1D3YA 3V7RA 1MH3A 2MABA 1TLHB 1F5TA 4AF5A 3GYHX 3TW7A 1KQ8A 2OQGA 4Z2YA 5FROA 1IUYA 3T6NA 1LEAA 1R23A 2COMA 2NYXA 3Q0WA 1XB4A 1IGNA 2O0YA 1E3HA 2PMUA 1AWCA 1Z9CA 3DWLE 3G1MA 1QNTA 4C30A 1YJ9I 2P81A 1M1EB 4MTEA 4D5CA 1R9TJ 3VB2A 3DPLC 2IRFG 1IN5A 3SZGA 2TRTA 1SFOJ 3RPQA 2LK2A 2Z33A 1LUJB 2FNAA 2QWWA 4LJZF 1WPKA 1K4TA 2OI8A 2CW7A 2PJRA 5HBUA 3ZCOA 3K2AA 5JFRA 3G1LA 2OCEA 3VOKA 2F4IA 3LSJA 4LG3A 1SFXA 2XGDA 2PFBA 2X0LA 2HU9A 1XTAA 4KNYA 2B3WA 4R1HA 2R7SA 3FKIJ 4U88A 3EUAA 1Y8RB 2E7WA 1R4NB 4XOPA 4M9SA 1G59A 4WIBA 5IYCJ 2QQ8A 3VYTB 2XRLA 2E2HJ 3ECHA 4FX0A 5E1WA 1D0YA 2QCOA 3NPIA 4LMYA 5FGMA 3ZQCA 1SMTA 2A07F 2STTA 1X4OA 4W1UA 3ESWB 4A3EJ 4BQAA 3DU5A 1W5CC 3BNIA 3RSNA 4P9UA 2EZLA 2CQ7A 4HX7A 4E7SA 2DMQA 3BQZA 3E5UA 4FTHA 4HQMA 3K2ZA 2K9MA 5DAJA 2P0WA 3W6JB 2QQ9A 3EUKL 4G12A 3GTGJ 3S1QJ 4CGRA 1FY7A 1TBXA 3H35A 2E5NA 1X4PA 3OYCA 1RI7A 4PGHA 1Y0UA 4AIDA 1UHWA 1F4KA 4C3HJ 1YX5A 2AXLA 3H0GJ 1SVOA 1FJLA 3H5AA 3CC4I 2ELJA 3ABUA 1GDTA 1REPC 3TMOA 4AC6A 5IP6A 1I6HJ 2Q0OA 1R5GA 2JRTA 2KIUA 4BBRJ 2VPRA 4CYDA 5DS9A 2B0LA 1SC7A 4A3DJ 1JXSA 5EFYA 2EA4A 4LLNA 4O5VA 4WXDA 5TJJA 2XHKA 1JHHA 1IN4A 4PUSA 3JRIA 1T6SA 1G6NA 3M3YJ 3Q5FA 3R0AA 3JRDA 5LHHA 4O6JA 5EGOA 2M4KA 1E0EA 2QENA 2WTEA 1QU3A 4JX6A 4IXAA 3D5SC 3GWZA 4RAFA 2IS2A 4JKZA 1B72A 2CW8A 2DU9A 3CUQC 3PNVA 4EM0B 3QYBA 1UB9A 4GRIA 1ZG5A 4G9YA 1VQPI 1CGPA 4ENMA 2PX9A 5LGTA 3M8FA 4A6DA 5E8IA 1OLTA 4U0VA 3FF5A 3GZ6A 4FASD 3S1RJ 2DA5A 4BDZA 1LPQA 3JTHA 3K70D 1R71A 2V9VA 3CJDA 2E71A 3IAM2 3HSEA 3I9V2 2A6HF 3JW4A 1R1VA 4NUBA 2OJED 4XLEA 1D5VA 5IOZA 1Z91A 2W1OA 2O7OA 3ABTA 3ZQGA 3EGQA 5EEHA 4BXXJ 2QUFA 5EYRA 5HLIA 1IV8A 5BNGA 4ME9A 1MDMB 3WTTC 4BQQA 2M30A 4EM2A 4L9VA 1DU6A 1HOMA 3OWTA 2CUEA 3RJPA 2EIJH 1TW2A 4B8XA 4YIIA 2ZBKA 3QAHA 2G7UA 3HPHA 1WJBA 2HOEA 3ANPA 3ROUA 4YG2F 3DBHB 4L18B 4I76A 2AXTC 2GENA 2LF8A 2XPVA 3VP5A 5HDNA 1DU0A 3RKWA 1U9NA 3CJTB 1ZRDA 3ANGA 2DO7A 3ZQQA 2LFBA 2ESNA 2LY2A 3MEXA 4AD9A 4F91B 3K8PC 1D1CA 3HB9A 1A6IA 5EDNA 3OOUA 3WHBA 1ZLJA 2MC4A 2IS1A 3B6AA 1H88C 3I71A 3KP2A 3LFKA 3OL4A 4E7HA 4ENKA 4AIJA 2FUG2 3N97A 3VWBA 4ZTJA 4LFUA 5HVQC 3SYTA 4DNCA 2I5UA 1WZ2A 5EZHA 5J1YA 2A61A 1OJLA 5DYMA 2JA6J 3DTKA 3PQJA 4CUGA 2JVGA 1HDPA 2EB7A 2JPBA 2LDUA 2W57A 5KVRA 4U9NA 4EJWA 2A68F 3HIMA 2FEZA 4XONA 1AKHB 3ZGKA 1MDMA 4S0HB 1JTXA 2B9SA 2LRDA 4AYBN 1I5ZA 2ZXJA 4HDVA 1WVRA 2EWNA 3O8HA 1LFBA 3KFWX 3LFUA 3O8GA 3V8KA 2CFOA 2VBZA 1V3FA 3VSLA 1W5SA 2RNGA 3CD6I 3E5XA 3HZJA 3H3VK 4YFKF 1FIPA 4QPQA 5JVGF 3KPHA 3QBMA 5H6RA 4ESFA 2KZGA 4L5IA 4KMFA 2DOEA 2E1NA 1H0MA 3M07A 3FKJA 3F22A 1YRNB 1ZR4A 4FHTA 3S5RA 5FKOA 4ASNA 2MSYA 3QOEA 4MTDA 3DEUA 2HYTA 2A5WA 2KRHA 5F1JA 2DTRA 2DPUA 2V57A 2CG4A 2BY1A 2I10A 1YLFA 4CXFA 3JRFA 5J1UA 4G6TB 4XSZF 2P7CB 3T8RA 5FKNA 1QHHD 3KYCB 2L7MP 2XKOA 2E19A 1FYMA 2IGKA 3JCUC 1SFUA 3PSFA 3S3NA 3I4NJ 2M8EA 1WJ5A 4LOCA 2GQQA 2IT0A 3W2WA 1ZHFA 2XGEA 3ABKH 1E17A 1Z77A 3QU3A 4QWQA 1PUFB 2DLLA 1ONVA 1RKWA 4HX8A 5C4YA 3CF2A 3Q9SA 5IPAA 3AL0C 3CDIA 2L4MA 1APLC 3HOSA 3S2HJ 4LIVA 2HTJA 3WU2C 4V2GA 3FXKA 3QYFA 4K2EA 3BC8A 4KIGA 4LIUA 2D1VA 2WADA 3PSIA 3G73A 2ZFWA 5LEKA 2P5VA 4MXMA 3VUQA 1AKHA 2M2EA 1Q1HA 2DYSH 3KEQA 1RKTA 4PDKA 4EEFG 5D19A 3CDHA 1FP2A 4DYCA 3CC7I 1QZEA 1HKSA 5HDKA 3OSFA 4CHUA 4JX5A 4AVZA 2L7ZA 4IKFA 3KP5A 2YVEA 4A3MJ 1QPIA 2XB0X 3ZMVA 2CU7A 4MQVA 2HQRA 2XAQA 3VW2A 1BOBA 2BY2A 3Q3SA 3OYKA 1GV5A 4RB1A 3HOTA 1HW1A 2DFIA 1YRNA 1WI3A 2D2WA 2JWTA 2L0KA 1ZREA 1RZ4A 3KP7A 5KNLA 1YTYA 4ACIA 4CDGA 3GLLA 4E6KG 4RGUA 2P5KA 2Y69H 4KMUX 3D0SA 3SZPA 2ZXIA 2HQ5A 4CYCB 3SWHA 3OOPA 2PLYA 1TT0A 4UVAA 5J8FA 1UFMA 2ECCA 3BR2A 3IP4B 3BDDA 2GFNA 3ZQLA 1ZN2A 3IH2A 2PJPA 2QKMB 4IQJA 3O60A 5HOOA 1YX3A 4CCOA 3J80K 1Z7LA 3FHNA 3H36A 2IPQX 2P4WA 2X6OA 1PUFA 4EJTA 2A5YB 2EV6A 4QSHA 1XCBA 3J80Z 3GEZA 3FZVA 1HKQA 2DA2A 2FJ1A 4RB0A 2FD5A 2R0QC 1I27A 3GO5A 1ZGWA 2UZKA 5KAFC 2LH9A 1DPUA 1ZTRA 1X3WB 4IVNA 1T33A 2X48A 2JUCA 2Y75A 3HIFA 1VNDA 3GBGA 4FE4A 4EMSA 4ZYEA 5ED4A 3BQYA 3GTQJ 3PFYA 2Z5UA 3COLA 1PYVA 5GAHJ 3K4LA 1LKXA 2L9NA 1VQLI 1VQNI 3ZMSA 5FFZA 3CMAI 3S16J 2VN2A 4ZTFA 5GTHC 2L5QA 4YIRX 2H1KA 3C1DA 3FXJA 4EATA 1MJ9A 2GBYA 4PSXA 1HSJA 4CYCA 1YITI 3HOYJ 2FOWA 5EZGA 1HBXG 2HQNA 2PI0A 1KGSA 3OR1C 3I3LA 5HS7A 3JAMK 3WTYC 1ETWA 3WGHA 3MKZA 4A0YA 3EUHC 3BCAA 5FLXK 5LEJA 1FIAA 3JAMZ 1B59A 3IC7A 3OIPA 1W7PD 2FRHA 3IUOA 4RLFA 4ZH4F 3LSKA 5FLXZ 2I8DA 2KIQA 4IJAA 4NELA 5DUKA 3VW1A 1FMWA 1GUUA 2A6EF 3GF2A 2X51A 3SDBA 1G3WA 1OR7C 2DFEA 3S1MJ 1Y0NA 1LDDA 1Y56A 5F0CA 1BR1A 3HEFA 3FXQA 1N77A 1A5JA 2LREA 2CUFA 3T5XA 1UAAA 4FISA 2HOAA 2A69F 3M7GA 4G7HF 1BA5A 2CS3A 3BTJA 3RZDJ 3GMEA 3HBLA 4LLLA 2E1MC 2GOXB 1G2HA 5HAWA 2X1CA 3OYLA 1HA8A 1D0ZA 5JI6A 1BW5A 1ZYRF 2F5VA 4U7BA 4V2FA 4PGGA 3HJEA 2CV2A 3KP6A 2ADUA 2ELHA 3S32A 1D5YA 5KHDA 1FEXA 2IP2A 5HLGA 4Q48A 3OMYA 4XLPF 2FF4A 3CJQB 4EQQA 4NC8A 4XMYA 3K69A 1SFKA 2W84A 2P6TA 3H92A 4I98B 5L3BA 2VC1A 4NN1A 2ACJA 3SDGA 2Z2SB 1O7LA 2M87A 2DG8A 2DK5A 3L2CA 4U0YA 5ICGA 1JUPA 2QQBA 2X6WA 3ZP5A 2YS9A 4AIHA 3DXJF 2CJJA 4ZYAA 3DLAA 4IHSA 4D7NA 4I01A 3T8TA 3P5JA 4M3FA 2KL4A 3ERED 3UNGC 3MWMA 2R7DA 2ZMEB 2M7BA 5D5VB 2HPIA 4M71A 3BRUA 3A0BC 2EFWA 5ERIA 1MBJA 1PJRA 3JTGA 2NNYA 1NK3P 3FISA 5B1BH 3J81K 5DCMB 1ETKA 2MLGA 2UXIA 3C3WA 3N05A 4RAZA 2H1LA 2RAEA 2UV1A 4XBFA 1J7KA 1JT6A 3RYPA 3ZR8X 3HTHA 2GLOA 5F08A 3J81Z 3V78A 4BBSJ 1RUOA 1HC8A 3U2RA 5TISC 3PUFA 3CP8A 2CQNA 4KN4X 4PFPA 3WGIA 3KNWA 3CZ6A 1OYYA 3ABMH 3I5UA 4PZJA 2XGXA 1DPRA 3DTEA 4I6ZA 2IU5A 2HKXA 3GFJA 3MVPA 5KAIC 6PAXA 1O3TA 4CZZA 4KJZA 5D8KB 3OYDA 2R92J 1YO5C 4XLFA 2HFHA 1OYIA 3B81A 3BR1A 5IP7J 3LOCA 4EV0A 3G3ZA 3RPUD 5H20A 2X6YA 1L3LA 1YIOA 1XX5A 3OYAA 2JJ7A 4AC0A 3FXOA 2M0CA 2UXXA 1ZG3A 1VF9A 1B9NA 2JK3A 4RM2A 4BEHB 2B1EA 3CRJA 3LSMA 2AHQA 5K5QA 3OS0A 5ILVA 4J00A 3L7WA 2F4MB 1SFEA 2ZMEA 4LLGF 3RDIA 1I6XA 1VTNC 3ECOA 3M4OJ 1I3AA 2EFQA 2FQ4A 1X1DA 2OU2A 5L3GA 3IRQA 2VKDA 4EJUA 5LD2C 2DAOA 4A6EA 1IG7A 4Y13A 2X1DA 3S14J 5HODA 1U0JA 3OYMA 3OYEA 3MKYB 2R5YB 1H8AC 1TWCJ 1W4MA 4ITVA 2YX4A 3WTWC 3TOAA 3L2RA 4J19A 2GA2A 2XAJA 3IV5A 1MNMC 1HCRA 1DGRM 1EH8A 3GXOA 3G71I 1HKTA 3LSIA 2F07A 1NH3A 4I0BA 3LSHA 1SANA 1WSUA 1W0TA 5GTIC 1SVMA 4D9JA 2PJRB 5EG0B 3OY9A 1DP7P 2XV4S 3BPVA 3CESA 2EPFA 1YG2A 3CCRI 4DJAA 2MFZA 1SD6A 2K9QA 2Y9ZA 2FBKA 2R7WA 3BG5A 3OR2C 4A3IJ 1ETOA 2K02A 2XPUA 3K1MA 3SEZA 2Z3YA 4M74A 1XG1A 2GIVA 2JUGA 2B63J 4RA2A 2W25A 5LBQA 3J7AY 2O8KA 3SFZA 2ZNZA 3H1CA 4L9TA 2KJBA 4A3GJ 2XIGA 1A36A 3VEPA 3LAJA 1F1ZA 2HTSA 2EH3A 4BEHA 3MZYA 1YW7A 2O3FA 5CVVA 3PO3J 2AO9A 4GO1A 1HW5A 1ZQ3P 2UXOA 4C2MA 3GZNB 2RC4A 2NAZA 2N8GA 1P7JA 1FTTA 1GVDA 4BE2A 4DIQA 2XDNA 4F93B 2V1DA 4I02A 1GV2A 3L00A 3LA7A 3NQOA 3ZOBA 4GCKA 3S15J 3LSPA 4A5NA 1K78A 3KKDA 1WH7A 2R5YA 2X85A 2XF6A 3ASNH 3CP2A 3LHQA 2RKHA 3A2KA 3GUDA 1KQ9A 5IP9J 2Q2EB 2Z99A 3PQKA 4HV6A 3JRHA 4XLNF 5E3NA 5B66C 3PPBA 5GPAA 2FBQA 2JPCA 4Q47A 3RKYA 1T39A 1UMQA 3LA3A 4DQ2A 3QPLA 4U7DA 4GDFA 2EV0A 4RMNA 3H9JA 5EG0A 2DXIA 1AA7A 1IN7A 2HGCA 4P96A 2VBYA 1NTCA 2LG4A 3WHCA 5IY5H 3ZRGA 5EGOB 2M7AA 1MBGA 4HSRA 4XKWA 2KP6A 3FBNB 1MJBA 4B09A 1I1SA 2OV7A 2WA0A 4PSWA 1B72B 1U78A 2RDPA 5CJ9A 2ZO4A 2V6CA 4E4HA 5J6XA 3BR0A 3B73A 2YVHA 1B4AA 1XMXA 3S8PA 4G7OF 1P4XA 1OCOH 1T08B 1EH6A 1MMNA 1MW7A 3BG9A 2J5PA 2NRAC 5HNFA 1IN8A 1N78A 2VE8A 3F72A 2M34A 2XROA 3CLQA 2V1NA 3C07A 2PBIA 2Q8KA 5FKLA 4NHJA 1KU7A 3F6VA 1D0XA 1FBUA 4P9FA 4RAGA 3AAFA 3NI7A 4KWAA 4MO7A 1T95A 3DKYA 4HBLA 3DPJA 2EV5A 3BT9A 2V26A 2VL8A 3WTSC 2E7XA 1Y1VJ 5J47A 1YE9A 4A3CJ 2W82A 2IW5A 1XSDA 5FLMJ 3WTXC 3GLXA 2ISYA 2Q2EA 2DDBA 4NNJA 1JJ8C 4BHBA 2EZKA 3PUBA 5B3SH 2OBPA 5C3EJ 3LL7A 5C4XJ 2CQXA 1LJ9A 1S29A 2H8WA 1UELB 5ILSA 2L7FP 1P4WA 1HLVA 2DQRA 2VT3A 5JLXA 2IS6A 4LB5A 1XGMA 5M3MJ 1C0WA 1Z7UA 2KZVA 1S7EA 3BPXA 1FZPB 2CUJA 4PJJA 3ZMUA 2UXHA 1WQ2A 3AG3H 3F21A 1VQOI 3ELKA 2Z1DA 1JKOC 5FHPA 1VQKI 1T98A 2QSHX 4ZDOA 1RESA 3EUPA 4L62A 2EBIA 1UG0A 1CF7B 3LSGA 3R60A 1BIAA 4IHVA 2E60A 3ZQIA 3COAC 3S3MA 4HRIA 4OWRB 2QZ8A 3K9TA 1MBFA 2K7LA 2PZ9A 2QYOA 3H3ZA 2LNBA 5J1RA 4RDUA 3PO2J 2IBDA 3M1EA 3NNRA 2Y2ZA 4ZDLA 1Z6TA 4OD4A 1IV6A 4PFOA 2HVQA 4OOIA 1YIJI 3TBIA 4XKVA 1FSEA 2COBA 4KIFA 2J5OA 1XD7A 2RQQA 3H5NA 1QZYA 3HXLA 2JA8J 2YX7A 2OAZA 1LVAA 1T0FA 5DM6F 3CCJI 3F3XA 5J40A 2BEOA 3BTLA 1GXPA 1Z05A 2F4OB 3P9IA 3EDPA 2PFVA 3R4KA 1LNWA 3WE2A 3FBIB 4QPOA 1SEUA 4FE7A 1PUEE 1SAUA 3NRVA 2OD5A 1FX7A 3JRBA 2Y9YA 3MN2A 3KZYA 1FYKA 1MBKA 5F0FA 1T8IA 2TDXA 2HNHA 2XPWA 4QLCU 5ILUA 2YVXA 1B1BA 2REKA 3NRGA 3ML6A 1QVUA 2DMTA 4UY8I 1R6RA 4RAYA 3I56I 4LITA 4XNFA 4QIWN 3CCSI 4ZYHA 3EYIA 3VYUB 4OMZA 4B47A 1J5YA 2JN6A 4KA4A 5LHGA 2GM4A 2KPMA 4EJOA 2X4HA 3KEOA 1ZGAA 5HLTA 3G4SI 1CF7A 2PMZN 3HM5A 3NXCA 4BJ6C 1BI0A 4LD5A 3OS1A 2W24A 2W85A 3FXUA 3MQ0A 2CQKA 3LNQA 2TCTA 2BOLA 1CQTA 2VBXA 4I99C 2GAUA 1ZLKA 3C18A 5D4SA 4BS9A 4OIOF 1WGXA 2QSGX 2HVSA 4ZYDA 1QGPA 3BCBA 3I59B 3OYNA 2ZJ2A 1X1AA 2FA5A 4M6YA 3IUVA 4RM3A 2G9WA 4NDLA 5E3LA 2LOOA 2FXAA 3KEYA 2XDVA 2MD5A 3BR6A 3NWSA 3ZN0A 3TQNA 3OYFA 5CVRA 3MZHA 3A0HC 2E34A 4IRVA 1S3JA 2VJJA 4B43A 3HUGA 2IEKA 3HYIA 5EJCA 1SD4A 4JX4A 4A93J 1XSXA 2RGVA 2CYYA 1R22A 3HTAA 5J3LA 1ETYA 2K9LA 4HNUA 2HQAA 3WTUC 4BE1A 4AU7A 3ON2A 3E7QA 3EPZA 2KT0A 2GA1A 2RN7A 1OCTC 3NARA 2X6XA 2CWEA 2ZOYA 3HGYA 1VQ4I 4EJVA 2BY3A 5D5XB 4G6QA 4HF0A 3Q9VA 1BOAA 4WXCA 1ON1A 3IWFA 1WJFA 5FGLA 3ZMZA 1IDYA 1FOXA 1KU9A 2OZUA 3A01B 1D1BA 3BP8A 2PBXA 2QSFX 4HNTA 1GXQA 1FBSA 2VLAA 2VQCA 2KKOA 2MH9A 1MD0A 2K27A 3VYSB 3E5QA 4P55A 4BY1J 4KYWA 1U5TB 3K4NA 4I0AA 2VONA 4BHCA 2UXNA 4MK6A 5J4YA 3I58A 4D5FA 1QZZA 4WX9A 1RR8C 3V4GA 1FOWA 3C2BA 4JP0A 2ELKA 1ENHA 2PMZA 3K10A 1HSTA 1BI2A 3I59A 1MKMA 3MCZA 2NXNB 2KDZA 1EF4A 1SGMA 4XICA 5C44J 4M3BA 3KZIC 5BS6A 3RI4A 4XLHA 1J09A 1BC7C 1WJAA 4CCLA 3OYIA 4Q5SF 2DYRH 4A3KJ 4RGSA 1DUXC 4XM3A 3V8LA 5ICEA 3WU0A 1BN5A 2KIMA 1SD5A 4AYBA 4YFXF 1UHSA 5A2QK 2VI6A 3OL3A 3OV8A 1U9OA 3E6CC 4L5JA 3JSOA 1ORKA 2BV6A 3QPSA 4CCJA 1G3YA 2CW0F 1X2NA 2VODA 2DT5A 2F5EA 4BHPA 5A2QZ 2EFNA 5IOYA 4OMYA 2VOOA 2YR2A 3HTUA 4GCTA 1K61A 4L0YB 1IXSB 3GTJJ 1ULYA 4MLOA 1IDZA 1WHUA 3FK6A 4XORA 1UJ8A 2XAUA 2CFXA 1R7JA 2DN0A 3KYDB 2O5RA 5DCFA 2CV0A 4HPQA 3VFZA 1ZG1A 1VFCA 4EGZA 3A01A 2ID3A 3IKVA 4G8XA 2ZC2A 4HQEA 4XOTA 4QTRA 5DUIA 5JVTA 3M8JA 3FMSA 4CH7A 1OQYA 2BHZA 2CO5A 2KDOA 5HS9A 2QM3A 3G56A 4WK8F 5LGUA 1U5TA 1UHMA 1YW8A 4A3JJ 3CCVI 4A12A 4G7ZF 2HVRA 5IT3A 3BJAA 2X9DA 3SXYA 4NB5A 3G1OA 3JRGA 4PK4A 4JYKA 4PJ0C 4UB8C 4BJ5C 1VI0A 3W3CA 4BQOA 3GTOJ 2HI3A 4MIMA 2MA3A 4XIDA 3CCMI 4HA8A 1O3SA 1JGGA 4XLCA 1S9HA 2HXOA 3FHZA 2KLOA 3VTIA 4JQFA 2VC0A 3BTCA 2AQEA 4C3IJ 4IO9F 3CO6C 1YJNI 4GFLA 1R5HA 3QP6A 2JTVA 4RBOA 2NS0A 3DF8A 4PJLA 5BPIA 4EVIA 5FJ8J 1A35A 2NVTJ 1FP1D 1VQ7I 5BQTA 4F52A 3FXMA 3S1NJ 1MBHA 4XKCA 4IRGA 1WJCA 4FX4A 1BJAA 1OCZH 1YHQI 3A4CA 3GVAA 3DP7A 3K7AJ 1Y1WJ 3QKXA 3GCMA 5B5EC 4XSXF 2HKOA 3BJOA 5K5OA 4ZC3A 1WRJA 4HLXA 4D1QA 2DFFA 1ZRFA 1J0RA 2XASA 2BVMA 4WWCA 4GFKA 3EETA 4A69C 2VBWA 3BY6A 4KN7X 5EEGA 1KYWA 5GAEJ 3PIPF 2FNPA 1DP3A 2M45A 3HG9A 3LQQA 1Z3XA 2L9SA 1O3RA 2VKEA 1JT0A 5IYDJ 4OIQF 1FLIA 4YZEA 2VQLA 1XGOA 1K7AA 1YQAA 5FRNA 4G6DA 1K6YA 3P9KA 1MGTA 3DKWA 2XKPA 1EKEA 4CSWA 1RIOH 3U21A 2ZOZA 5KCMA 4IX7A 3QPTA 1ACIA 3PNTA 1E3PA 3CC2I 4ICHA 5JHFA 2OPTA 4WXHA 2MLKA 2UXPA 3HL2A 3D1NI 5FLVA 1Y8QB 4B3AA 4CA0A 4HV5A 2R5ZB 4JNNA 4IRIA 1S72I 3JSPA 3HOVJ 5HDGA 2B7EA 1TL8A 2KIFA 2QF7A 3BG6A 1F9NA 2XF7A 3J7YJ 2OA4A 3RTRA 4M3EA 5FKKA 3GFLA 3BZCA 3L1PA 1R5ID 4E7ZA 3MD2A 3L2QA 1YJWI 2JSCA 3K4KA 1ERDA 1GHCA 1R58A 2RHAA 1FPQA 4JK1X 3MKLA 2HZDA 1A6QA 4LK1F 3VSKA 5HNHA 4KDPA 2K9SA 4O3MA 1YOVB 4LB6B 3ABLH 2VQHA 4PJNA 4Y4RA 3VODA 2XSDC 2GIZA 2VPLA 4L0ZB 4RGXA 1IW7F 2C6YA 1RUNA 5TGTA 4KFCA 2WAEA 1IZ1A 4WCGA 1DDNA 3ISPA 1E2XA 3HOXJ 4J01A 1W7PB 5K7HA 3C7JA 1R36A 1V55H 4PXIA 1TWAJ 3B02A 3CCEI 5CVUA 3KX2A 3CUQB 4BKXA 2JA2A 3FRQA 4NC6A 3HOZJ 1N25A 3Q0UA 2JT1A 3SJMA 3AG2H 2HEOA 4MQ9F 4DBRA 4BUPA 9ANTA 4B44A 1OCRH 2DBBA 4LK0F 3UR3C 2KJCA 1FWZA 2E2IJ 2FSWA 3F0CA
chains in the Genus database with same CATH topology
2FBQA 2LFBA 1UMQA 3QPLA 3BR5A 5AQCA 3HB9A 4UUSB 1A6IA 5EDNA 3HGGA 5EG0A 3OOUA 3S17J 3HTJA 3VVYA 3WHBA 1IC8A 2DMPA 3ON4A 1NTCA 3WHCA 3B6AA 1H88C 3CWRA 1BW6A 5EGOB 2R5ZA 5M5XJ 1MBGA 3GEUA 3HOWJ 5M3FJ 1B72B 5JLWA 1U78A 5FKMA 2DG7A 3TEDA 5EZHA 4X1EA 3DCFA 1OJLA 5J1YA 3RKQA 2JA6J 3BR3A 2DA7A 3BR0A 1HDPA 2YVHA 2QTQA 4W97A 3A03A 3RD3A 1T56A 3BG9A 2YUSA 1JUSA 3HIMA 2M34A 3W6VA 1JUMA 1AKHB 3C07A 4S0HB 1JTXA 3IH4A 5FKLA 2MW8A 3PASA 3ZQFA 4AYBN 3NI7A 4KWAA 3O8HA 4MO7A 1LFBA 1BL0A 3O8GA 2G7LA 3DPJA 3BT9A 2LVSA 1Y1VJ 4DW6A 2E2JJ 3FK7A 3DEWA 3H3VK 1FIPA 4A3CJ 3QBMA 2ZCXA 2NX4A 5FLMJ 3CCYA 2QIBA 2WV1A 1XC5A 2JMWA 1JJ8C 1YRNB 5E3OA 2ID6A 5GPCA 1ZR4A 3S2DJ 3VVZA 3S5RA 2EZKA 5FKOA 2MSYA 3GZIA 3P9TA 2HYTA 5F1JA 5C3EJ 5C4XJ 2LKXA 2CQXA 1OFCX 2V57A 2L7FP 3JR9A 5M5WJ 4UUSA 1O4XA 3JRFA 2I10A 1HLVA 4FCYA 1Q1VA 5J1UA 5JLXA 2DMUA 2Y0SN 5K7ZA 5H9TA 5FKNA 3LSRA 5M3MJ 2L7MP 1S7EA 2E19A 2FX0A 2LP0A 1TWHJ 3FIWA 3I4NJ 4LOCA 3OSGA 3LJLA 2RASA 2HKUA 4HKUA 4A3LJ 2XGEA 1I50J 3RZOJ 2UXHA 1RR7A 1Z77A 1PUFB 1JKOC 1RKWA 3E7LA 5FHPA 4M3DA 3BCGA 5C4YA 5IPAA 1RESA 3EUPA 1F36A 4L62A 1APLC 3S2HJ 3TP0A 1UG2A 1ZKGA 2EBIA 4V2GA 2ZCNA 1RETA 3LSGA 4IHVA 3ZQIA 4MXMA 2HDDA 2HOTA 1MBFA 3BTIA 2PZ9A 3VUQA 1AKHA 2M2EA 5K7FA 5J1RA 2JA7J 4RDUA 3PO2J 1RKTA 2IBDA 2GUHA 4EEFG 5D19A 3NNRA 1POGA 2Y2ZA 5F04A 4DYCA 5E3MA 4Y7NJ 1MSFC 1IV6A 3OSFA 2QKOA 1TWFJ 2G0EA 4JX5A 2L7ZA 3NAUA 2YU9J 2HOSA 2YVEA 2COBA 3VVXA 4A3MJ 1QPIA 2XB0X 3AQTA 2CU7A 2K9NA 2JA8J 3VW2A 3PM1A 1RPWA 3Q3SA 1GV5A 5EEAA 3GTLJ 1YRNA 1WI3A 3BHQA 2JWTA 2L0KA 3TP3A 2DA3A 4IHWA 3BTLA 2QOPA 4ACIA 5EF6A 5D1RA 3GTPJ 4CYCB 4XRMA 2HQ5A 4FE7A 3UKGA 2L9RA 2ECCA 3SFIA 3I4MJ 3BR2A 2HXIA 2GFNA 3ZQLA 3IH2A 3KKCA 3JRBA 2Y9YA 3CDLA 3MN2A 1MBKA 5F0FA 4ABZA 2XPWA 3VOXA 2VUMJ 4Y52J 2R7ZJ 1FTZA 3IH3A 5F0HA 2REKA 3F1BA 3NRGA 3A02A 3O60A 1QVUA 2DMTA 1MH4A 1PUFA 2X6OA 1BJZA 1LE8B 4XK4A 3BG3A 1JKQC 4QSHA 3ZQHA 4QIWN 1JJ6C 1IRZA 3KZ9A 2GM4A 1P7IA 2JN6A 1ETQA 2DA2A 3Q0VA 4AUXA 3RH2A 2WGBA 4A3BJ 2FJ1A 2PMZN 5DTDA 3HM5A 3NXCA 2FD5A 3HKZN 1JKPC 2Q24A 1OCPA 2R0QC 1ITYA 3B6CA 1ZGWA 1AHDP 1ZTRA 4XRSA 2EZIA 1T33A 3LNQA 2TCTA 2WUIA 4M6VA 5HSZA 1CQTA 2X48A 2NOGA 2HYJA 3HTIA 1VNDA 3GBGA 4FE4A 4B4CA 4B1RA 1WGXA 3BQYA 1U8BA 3GTQJ 3COLA 2NS7A 1QVTA 3CMYA 1E3OC 2R93J 2XGCA 1WCMJ 3IUVA 4NDLA 5E3LA 3BR6A 2O9LA 3S16J 2IAIA 1H89C 1I3QJ 4M3GA 1GT0C 2H1KA 2WAQN 5GP9A 2IEKA 2GBYA 1Z0XA 4JX4A 1AU7A 4CYCA 4A93J 3HOYJ 3G7RA 3HTAA 2LR8A 5J3LA 2ZCMA 4IEJA 5EZGA 2WB1N 1ETYA 3ON2A 3E7QA 2KT0A 1WH5A 1JTYA 5K58A 1ETWA 3NARA 1OCTC 2ZOYA 2OERA 3JRAA 3JRCA 3HGYA 1FIAA 2NP5A 2Y31A 1LE8A 2DA4A 2M8GX 4NELA 3VW1A 3CQZJ 4D7MA 3VIBA 1GUUA 4MFEA 2VKVA 3V6GA 5FGLA 1IDYA 3VPRA 3A01B 3S1MJ 2PBXA 1A5JA 5F0CA 2O7TA 3HEFA 2NVQJ 3GTKJ 4JL3A 5CXGA 2CUFA 2LY9A 1HDDC 5F27A 4FISA 2HOAA 2W48A 3GTMJ 1BA5A 1QRYA 2JA5J 3BTJA 3RZDJ 4BY1J 3HBLA 4HNVA 1G2HA 5HAWA 1B8IB 4MK6A 4D5FA 2ECBA 4IHYA 4X6AJ 2CQQA 1BW5A 4V2FA 3JREA 3C2BA 2ME6A 4JP0A 1IUFA 2ELKA 1ENHA 4C3JJ 1JKRC 1D5YA 3TW6A 1NK2P 1FEXA 2NP3A 2KDZA 1EF4A 1SGMA 4XICA 3VW0A 5C44J 4M3BA 2Y30A 4DZPA 4DYRA 4GCLA 1X58A 2NVYJ 2MG4A 2NVXJ 2ME0A 4A3KJ 2E1OA 4UUTA 4NN1A 1UHSA 1ZK8A 4BY7J 3SDGA 2VI6A 1U9OA 2DG8A 1ORKA 2DA6A 3QPSA 1JUPA 1X2NA 2YS9A 1MH3A 4IHXA 1MBEA 2CJJA 5IOYA 4AF5A 3TW7A 3T6NA 4GCTA 4D7NA 1K61A 4M3FA 3GTJJ 4MLOA 2CRGA 3Q0WA 3FK6A 4DZJA 1IDZA 1IGNA 2DN0A 3MNLA 2W53A 3BRUA 1MBJA 3G1MA 1VFCA 1NK3P 1TC3C 2P81A 3FISA 1X2MA 5D18A 1ETKA 3A01A 2ID3A 2UXIA 4D5CA 1R9TJ 2RAEA 4QTRA 1JT6A 3HTHA 2TRTA 2GLOA 5F08A 1SFOJ 3V78A 2LTPA 4BBSJ 3G56A 2LK2A 4MFDA 1WPKA 2OI8A 4A3JJ 1B8IA 5HBUA 3K2AA 3KNWA 2H8RA 2X9DA 3G1LA 3VOKA 3LSJA 3G1OA 1LFUP 2XGDA 2OF7A 3JRGA 4JYKA 2D6YA 1VI0A 2M9HA 4I6ZA 4XRSG 3GTOJ 2HI3A 2IU5A 2LLKA 2QWTA 3JSJA 4MIMA 3MVPA 4XIDA 4C2MJ 1HF0A 3FKIJ 1JGGA 3QQAA 2HXOA 1ZR2A 3BTCA 4GFLA 1TWGJ 4C3IJ 2R92J 4L5EA 4RBOA 5IYCJ 2E2HJ 2XRLA 3B81A 3BR1A 5FJ8J 5IP7J 2QCOA 3LOCA 2NVTJ 3NPIA 4UDSA 1W0UA 3ZQCA 1IJWC 2JJ7A 3S1NJ 4AC0A 1MBHA 4W1UA 5M5YJ 2M0CA 4A3EJ 1VF9A 2JK3A 3K7AJ 1Y1WJ 3BNIA 3QKXA 2EZLA 3CRJA 2AHQA 2ZB9A 2DTZA 2DMQA 3BQZA 1F43A 4FTHA 4A3FJ 1ETVA 5DAJA 3S1QJ 4G12A 3GTGJ 4CGRA 1UI6A 3M4OJ 4GFKA 2NS8A 1K83J 2FQ4A 5IYBJ 2DJNA 4A69C 3BJBA 1IG7A 4C3HJ 3H0GJ 1FJLA 1GDTA 5C4JJ 4AC6A 3S14J 5IP6A 5HODA 1I6HJ 4DYQA 4BBRJ 2R5YB 1H8AC 2VKEA 2VPRA 5DS9A 1TWCJ 1JT0A 4A3DJ 5IYDJ 4YZEA 5EFYA 2MGQA 4J19A 2G7GA 3IV5A 3JRIA 1MNMC 1HCRA 2F07A 3M3YJ 3AQSA 4GFBA 2ZOZA 1XS9A 3JRDA 2EQRA 1SANA 1W0TA 5EGOA 4ICHA 2OPTA 5CW8A 5EG0B 4JX6A 2UXPA 4JKZA 1ETXA 3D1NI 1B72A 5FLVA 4B3AA 2R5ZB 4JNNA 2Y9ZA 2K9QA 3HOVJ 3BG5A 4A3IJ 1ETOA 2XPUA 5CXIA 3S1RJ 1XG1A 2G3BA 2DA5A 2QF7A 2B63J 3HOUJ 4M3EA 5FKKA 3RQIA 3L1PA 3CJDA 3OIOA 2O8KA 2G7SA 2RHAA 4A3GJ 2LD5A 5IOZA 3ZQGA 3EGQA 2EZHA 2O7OA 3MKLA 3HE0A 3LWJA 4BXXJ 5EYRA 2K9SA 2EH3A 2K40A 5BNGA 3PO3J 4ME9A 2AO9A 1ZQ3P 2XB5A 2UXOA 2XSDC 2D5VA 2N8GA 1P7JA 1DU6A 3HDDA 1HOMA 2CUEA 2DA1A 1GVDA 1FTTA 2XDNA 3HOXJ 1MSEC 1GV2A 5K7HA 3ANPA 3ZOBA 4GCKA 3S15J 3LSPA 4PXIA 1TWAJ 3KKDA 1WH7A 4I76A 2R5YA 2DMNA 4BKXA 1UI5A 3FRQA 2GENA 3HOZJ 3LHQA 3Q0UA 2XPVA 3VP5A 5FMPA 3SJMA 1DU0A 5IP9J 3JRHA 9ANTA 1U9NA 5E3NA 2UXUA 3PPBA 3ANGA 2E2IJ 5GPAA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBQ A;  2LFB A;  1UMQ A;  3QPL A;  3BR5 A;  5AQC A;  3HB9 A;  4UUS B;  1A6I A;  5EDN A;  3HGG A;  5EG0 A;  3OOU A;  3S17 J;  3HTJ A;  3VVY A;  3WHB A;  1IC8 A;  2DMP A;  3ON4 A;  1NTC A;  3WHC A;  3B6A A;  1H88 C;  3CWR A;  1BW6 A;  5EGO B;  2R5Z A;  5M5X J;  1MBG A;  3GEU A;  3HOW J;  5M3F J;  1B72 B;  5JLW A;  1U78 A;  5FKM A;  2DG7 A;  3TED A;  5EZH A;  4X1E A;  3DCF A;  1OJL A;  5J1Y A;  3RKQ A;  2JA6 J;  3BR3 A;  2DA7 A;  3BR0 A;  1HDP A;  2YVH A;  2QTQ A;  4W97 A;  3A03 A;  3RD3 A;  1T56 A;  3BG9 A;  2YUS A;  1JUS A;  3HIM A;  2M34 A;  3W6V A;  1JUM A;  1AKH B;  3C07 A;  4S0H B;  1JTX A;  3IH4 A;  5FKL A;  2MW8 A;  3PAS A;  3ZQF A;  4AYB N;  3NI7 A;  4KWA A;  3O8H A;  4MO7 A;  1LFB A;  1BL0 A;  3O8G A;  2G7L A;  3DPJ A;  3BT9 A;  2LVS A;  1Y1V J;  4DW6 A;  2E2J J;  3FK7 A;  3DEW A;  3H3V K;  1FIP A;  4A3C J;  3QBM A;  2ZCX A;  2NX4 A;  5FLM J;  3CCY A;  2QIB A;  2WV1 A;  1XC5 A;  2JMW A;  1JJ8 C;  1YRN B;  5E3O A;  2ID6 A;  5GPC A;  1ZR4 A;  3S2D J;  3VVZ A;  3S5R A;  2EZK A;  5FKO A;  2MSY A;  3GZI A;  3P9T A;  2HYT A;  5F1J A;  5C3E J;  5C4X J;  2LKX A;  2CQX A;  1OFC X;  2V57 A;  2L7F P;  3JR9 A;  5M5W J;  4UUS A;  1O4X A;  3JRF A;  2I10 A;  1HLV A;  4FCY A;  1Q1V A;  5J1U A;  5JLX A;  2DMU A;  2Y0S N;  5K7Z A;  5H9T A;  5FKN A;  3LSR A;  5M3M J;  2L7M P;  1S7E A;  2E19 A;  2FX0 A;  2LP0 A;  1TWH J;  3FIW A;  3I4N J;  4LOC A;  3OSG A;  3LJL A;  2RAS A;  2HKU A;  4HKU A;  4A3L J;  2XGE A;  1I50 J;  3RZO J;  2UXH A;  1RR7 A;  1Z77 A;  1PUF B;  1JKO C;  1RKW A;  3E7L A;  5FHP A;  4M3D A;  3BCG A;  5C4Y A;  5IPA A;  1RES A;  3EUP A;  1F36 A;  4L62 A;  1APL C;  3S2H J;  3TP0 A;  1UG2 A;  1ZKG A;  2EBI A;  4V2G A;  2ZCN A;  1RET A;  3LSG A;  4IHV A;  3ZQI A;  4MXM A;  2HDD A;  2HOT A;  1MBF A;  3BTI A;  2PZ9 A;  3VUQ A;  1AKH A;  2M2E A;  5K7F A;  5J1R A;  2JA7 J;  4RDU A;  3PO2 J;  1RKT A;  2IBD A;  2GUH A;  4EEF G;  5D19 A;  3NNR A;  1POG A;  2Y2Z A;  5F04 A;  4DYC A;  5E3M A;  4Y7N J;  1MSF C;  1IV6 A;  3OSF A;  2QKO A;  1TWF J;  2G0E A;  4JX5 A;  2L7Z A;  3NAU A;  2YU9 J;  2HOS A;  2YVE A;  2COB A;  3VVX A;  4A3M J;  1QPI A;  2XB0 X;  3AQT A;  2CU7 A;  2K9N A;  2JA8 J;  3VW2 A;  3PM1 A;  1RPW A;  3Q3S A;  1GV5 A;  5EEA A;  3GTL J;  1YRN A;  1WI3 A;  3BHQ A;  2JWT A;  2L0K A;  3TP3 A;  2DA3 A;  4IHW A;  3BTL A;  2QOP A;  4ACI A;  5EF6 A;  5D1R A;  3GTP J;  4CYC B;  4XRM A;  2HQ5 A;  4FE7 A;  3UKG A;  2L9R A;  2ECC A;  3SFI A;  3I4M J;  3BR2 A;  2HXI A;  2GFN A;  3ZQL A;  3IH2 A;  3KKC A;  3JRB A;  2Y9Y A;  3CDL A;  3MN2 A;  1MBK A;  5F0F A;  4ABZ A;  2XPW A;  3VOX A;  2VUM J;  4Y52 J;  2R7Z J;  1FTZ A;  3IH3 A;  5F0H A;  2REK A;  3F1B A;  3NRG A;  3A02 A;  3O60 A;  1QVU A;  2DMT A;  1MH4 A;  1PUF A;  2X6O A;  1BJZ A;  1LE8 B;  4XK4 A;  3BG3 A;  1JKQ C;  4QSH A;  3ZQH A;  4QIW N;  1JJ6 C;  1IRZ A;  3KZ9 A;  2GM4 A;  1P7I A;  2JN6 A;  1ETQ A;  2DA2 A;  3Q0V A;  4AUX A;  3RH2 A;  2WGB A;  4A3B J;  2FJ1 A;  2PMZ N;  5DTD A;  3HM5 A;  3NXC A;  2FD5 A;  3HKZ N;  1JKP C;  2Q24 A;  1OCP A;  2R0Q C;  1ITY A;  3B6C A;  1ZGW A;  1AHD P;  1ZTR A;  4XRS A;  2EZI A;  1T33 A;  3LNQ A;  2TCT A;  2WUI A;  4M6V A;  5HSZ A;  1CQT A;  2X48 A;  2NOG A;  2HYJ A;  3HTI A;  1VND A;  3GBG A;  4FE4 A;  4B4C A;  4B1R A;  1WGX A;  3BQY A;  1U8B A;  3GTQ J;  3COL A;  2NS7 A;  1QVT A;  3CMY A;  1E3O C;  2R93 J;  2XGC A;  1WCM J;  3IUV A;  4NDL A;  5E3L A;  3BR6 A;  2O9L A;  3S16 J;  2IAI A;  1H89 C;  1I3Q J;  4M3G A;  1GT0 C;  2H1K A;  2WAQ N;  5GP9 A;  2IEK A;  2GBY A;  1Z0X A;  4JX4 A;  1AU7 A;  4CYC A;  4A93 J;  3HOY J;  3G7R A;  3HTA A;  2LR8 A;  5J3L A;  2ZCM A;  4IEJ A;  5EZG A;  2WB1 N;  1ETY A;  3ON2 A;  3E7Q A;  2KT0 A;  1WH5 A;  1JTY A;  5K58 A;  1ETW A;  3NAR A;  1OCT C;  2ZOY A;  2OER A;  3JRA A;  3JRC A;  3HGY A;  1FIA A;  2NP5 A;  2Y31 A;  1LE8 A;  2DA4 A;  2M8G X;  4NEL A;  3VW1 A;  3CQZ J;  4D7M A;  3VIB A;  1GUU A;  4MFE A;  2VKV A;  3V6G A;  5FGL A;  1IDY A;  3VPR A;  3A01 B;  3S1M J;  2PBX A;  1A5J A;  5F0C A;  2O7T A;  3HEF A;  2NVQ J;  3GTK J;  4JL3 A;  5CXG A;  2CUF A;  2LY9 A;  1HDD C;  5F27 A;  4FIS A;  2HOA A;  2W48 A;  3GTM J;  1BA5 A;  1QRY A;  2JA5 J;  3BTJ A;  3RZD J;  4BY1 J;  3HBL A;  4HNV A;  1G2H A;  5HAW A;  1B8I B;  4MK6 A;  4D5F A;  2ECB A;  4IHY A;  4X6A J;  2CQQ A;  1BW5 A;  4V2F A;  3JRE A;  3C2B A;  2ME6 A;  4JP0 A;  1IUF A;  2ELK A;  1ENH A;  4C3J J;  1JKR C;  1D5Y A;  3TW6 A;  1NK2 P;  1FEX A;  2NP3 A;  2KDZ A;  1EF4 A;  1SGM A;  4XIC A;  3VW0 A;  5C44 J;  4M3B A;  2Y30 A;  4DZP A;  4DYR A;  4GCL A;  1X58 A;  2NVY J;  2MG4 A;  2NVX J;  2ME0 A;  4A3K J;  2E1O A;  4UUT A;  4NN1 A;  1UHS A;  1ZK8 A;  4BY7 J;  3SDG A;  2VI6 A;  1U9O A;  2DG8 A;  1ORK A;  2DA6 A;  3QPS A;  1JUP A;  1X2N A;  2YS9 A;  1MH3 A;  4IHX A;  1MBE A;  2CJJ A;  5IOY A;  4AF5 A;  3TW7 A;  3T6N A;  4GCT A;  4D7N A;  1K61 A;  4M3F A;  3GTJ J;  4MLO A;  2CRG A;  3Q0W A;  3FK6 A;  4DZJ A;  1IDZ A;  1IGN A;  2DN0 A;  3MNL A;  2W53 A;  3BRU A;  1MBJ A;  3G1M A;  1VFC A;  1NK3 P;  1TC3 C;  2P81 A;  3FIS A;  1X2M A;  5D18 A;  1ETK A;  3A01 A;  2ID3 A;  2UXI A;  4D5C A;  1R9T J;  2RAE A;  4QTR A;  1JT6 A;  3HTH A;  2TRT A;  2GLO A;  5F08 A;  1SFO J;  3V78 A;  2LTP A;  4BBS J;  3G56 A;  2LK2 A;  4MFD A;  1WPK A;  2OI8 A;  4A3J J;  1B8I A;  5HBU A;  3K2A A;  3KNW A;  2H8R A;  2X9D A;  3G1L A;  3VOK A;  3LSJ A;  3G1O A;  1LFU P;  2XGD A;  2OF7 A;  3JRG A;  4JYK A;  2D6Y A;  1VI0 A;  2M9H A;  4I6Z A;  4XRS G;  3GTO J;  2HI3 A;  2IU5 A;  2LLK A;  2QWT A;  3JSJ A;  4MIM A;  3MVP A;  4XID A;  4C2M J;  1HF0 A;  3FKI J;  1JGG A;  3QQA A;  2HXO A;  1ZR2 A;  3BTC A;  4GFL A;  1TWG J;  4C3I J;  2R92 J;  4L5E A;  4RBO A;  5IYC J;  2E2H J;  2XRL A;  3B81 A;  3BR1 A;  5FJ8 J;  5IP7 J;  2QCO A;  3LOC A;  2NVT J;  3NPI A;  4UDS A;  1W0U A;  3ZQC A;  1IJW C;  2JJ7 A;  3S1N J;  4AC0 A;  1MBH A;  4W1U A;  5M5Y J;  2M0C A;  4A3E J;  1VF9 A;  2JK3 A;  3K7A J;  1Y1W J;  3BNI A;  3QKX A;  2EZL A;  3CRJ A;  2AHQ A;  2ZB9 A;  2DTZ A;  2DMQ A;  3BQZ A;  1F43 A;  4FTH A;  4A3F J;  1ETV A;  5DAJ A;  3S1Q J;  4G12 A;  3GTG J;  4CGR A;  1UI6 A;  3M4O J;  4GFK A;  2NS8 A;  1K83 J;  2FQ4 A;  5IYB J;  2DJN A;  4A69 C;  3BJB A;  1IG7 A;  4C3H J;  3H0G J;  1FJL A;  1GDT A;  5C4J J;  4AC6 A;  3S14 J;  5IP6 A;  5HOD A;  1I6H J;  4DYQ A;  4BBR J;  2R5Y B;  1H8A C;  2VKE A;  2VPR A;  5DS9 A;  1TWC J;  1JT0 A;  4A3D J;  5IYD J;  4YZE A;  5EFY A;  2MGQ A;  4J19 A;  2G7G A;  3IV5 A;  3JRI A;  1MNM C;  1HCR A;  2F07 A;  3M3Y J;  3AQS A;  4GFB A;  2ZOZ A;  1XS9 A;  3JRD A;  2EQR A;  1SAN A;  1W0T A;  5EGO A;  4ICH A;  2OPT A;  5CW8 A;  5EG0 B;  4JX6 A;  2UXP A;  4JKZ A;  1ETX A;  3D1N I;  1B72 A;  5FLV A;  4B3A A;  2R5Z B;  4JNN A;  2Y9Z A;  2K9Q A;  3HOV J;  3BG5 A;  4A3I J;  1ETO A;  2XPU A;  5CXI A;  3S1R J;  1XG1 A;  2G3B A;  2DA5 A;  2QF7 A;  2B63 J;  3HOU J;  4M3E A;  5FKK A;  3RQI A;  3L1P A;  3CJD A;  3OIO A;  2O8K A;  2G7S A;  2RHA A;  4A3G J;  2LD5 A;  5IOZ A;  3ZQG A;  3EGQ A;  2EZH A;  2O7O A;  3MKL A;  3HE0 A;  3LWJ A;  4BXX J;  5EYR A;  2K9S A;  2EH3 A;  2K40 A;  5BNG A;  3PO3 J;  4ME9 A;  2AO9 A;  1ZQ3 P;  2XB5 A;  2UXO A;  2XSD C;  2D5V A;  2N8G A;  1P7J A;  1DU6 A;  3HDD A;  1HOM A;  2CUE A;  2DA1 A;  1GVD A;  1FTT A;  2XDN A;  3HOX J;  1MSE C;  1GV2 A;  5K7H A;  3ANP A;  3ZOB A;  4GCK A;  3S15 J;  3LSP A;  4PXI A;  1TWA J;  3KKD A;  1WH7 A;  4I76 A;  2R5Y A;  2DMN A;  4BKX A;  1UI5 A;  3FRQ A;  2GEN A;  3HOZ J;  3LHQ A;  3Q0U A;  2XPV A;  3VP5 A;  5FMP A;  3SJM A;  1DU0 A;  5IP9 J;  3JRH A;  9ANT A;  1U9N A;  5E3N A;  2UXU A;  3PPB A;  3ANG A;  2E2I J;  5GPA A;  3F0C A; 
#chains in the Genus database with same CATH topology
 1V54 H;  4EM1 A;  3J7Z I;  2OTJ I;  2MC3 A;  5AQC A;  2UWM A;  2FML A;  3S17 J;  4BAY A;  4XLA A;  2R7V A;  3VVY A;  4IHT A;  2DQL A;  2DMP A;  4A0X A;  3ASO H;  3CF5 F;  3CWR A;  4M6X A;  2JQ7 A;  1VZ0 A;  2K86 A;  2R5Z A;  3EYY A;  4CO8 A;  1I1G A;  2VB6 A;  5IT9 K;  3QU6 A;  3QRF F;  1R00 A;  4IL6 C;  3P9C A;  1YYV A;  4ENJ A;  5JLW A;  3MAJ A;  1TNT A;  5FKM A;  4NQW A;  4E7K A;  3TED A;  4X1E A;  3RKQ A;  3PJR A;  5IT9 Z;  2DA7 A;  3L09 A;  4PJM A;  4RGR A;  3VDX A;  5LFA A;  1IXR C;  1WJD A;  4W97 A;  3KLN A;  3RD3 A;  2KHM A;  1TQM A;  1T56 A;  2MBF A;  4F55 A;  2JZY A;  1PDN C;  2HR3 A;  2HPM A;  3O6B B;  4HW0 A;  5LGN A;  3SHF A;  1JI8 A;  1JUM A;  1R1U A;  2WWY A;  5HLH A;  3FWE A;  2OQR A;  3IH4 A;  2MW8 A;  4F7Z A;  1O3Q A;  5E17 F;  3ZQF A;  3PAS A;  3K4B A;  3T0Y A;  3MZ8 A;  3CME I;  3DKX A;  2PG4 A;  2G7L A;  2Z16 A;  1W7P A;  5JHU A;  1J2X A;  1IRG A;  2L7K A;  1P9Q C;  3CJN A;  3CUQ A;  3FK7 A;  3I0T A;  4N4O B;  5FD6 A;  1H9G A;  2NX4 A;  3CCY A;  1D8J A;  2LYC A;  1ZH5 A;  1JHF A;  2QIB A;  1XC5 A;  5CPR B;  2ZJQ F;  2DCE A;  2JMW A;  1K78 B;  3BOQ A;  3T1B A;  1EJ9 A;  3VVZ A;  2ID6 A;  3S2D J;  3W6K B;  2STW A;  4GCL A;  4S05 A;  3P9T A;  2Y48 A;  3GZI A;  2AQF A;  4BQN A;  5L3C A;  4N4N B;  2JRM A;  2LKX A;  3FM3 A;  5L3D A;  5L3F A;  1OFC X;  3JR9 A;  5M5W J;  2EIN H;  2VXZ A;  1O4X A;  1STZ A;  4CZC A;  1MMG A;  1Q1V A;  4FCY A;  2QBY B;  4E7J A;  2DMU A;  2Y0S N;  3HC7 A;  3DEE A;  3ONQ A;  4YIF A;  5K7Z A;  5DDG A;  3LSR A;  5H9T A;  3TGN A;  1B9M A;  2ICW G;  2XAH A;  1N75 A;  2KRC A;  4IOC F;  3M1C A;  3LJL A;  1IRX A;  2DOD A;  1Z6R A;  4A3L J;  2QLZ A;  3GW2 A;  1I50 J;  3RZO J;  1RR7 A;  3V8J A;  4CCN A;  2F2E A;  3E7L A;  4ENN A;  4M3D A;  1Y6I A;  2BXY A;  5J4V A;  1XDS A;  3DQV C;  3OIQ A;  4BE0 A;  3HPG A;  1UI6 A;  4BXF A;  4EGY A;  2ZCN A;  3K0L A;  4A2U A;  1Y39 A;  4LGW A;  4V19 K;  2R7X A;  2HDD A;  5FD5 A;  4RB3 C;  2V4J C;  2EIL H;  2HS5 A;  5K7F A;  2JA7 J;  1T38 A;  1BC8 C;  1POG A;  2LMD A;  1S7A A;  3WG7 H;  1QBJ A;  1G8X A;  4Y7N J;  2P5L C;  2G0E A;  2XAF A;  4ETS A;  2OC6 A;  2AS5 F;  4Q4Z F;  4HLY A;  4YFN F;  2HOS A;  2BXZ A;  3QP5 A;  3OYG A;  3CCL I;  3VVX A;  2R4G A;  2L4A A;  3AQT A;  2K9N A;  1XGS A;  2LKS A;  3OYJ A;  4ON0 A;  3HSF A;  1SMY F;  3CTA A;  1TZL A;  3PM1 A;  3RCO A;  4OAZ A;  5H6Q A;  5EEA A;  2FQ3 A;  3CLO A;  3GTL J;  3BHQ A;  4P1W A;  5H2F C;  3M8E A;  2DA3 A;  4HEA 2;  1PP7 U;  1LVK A;  4IHW A;  4I09 A;  3P7N A;  2QOP A;  3AL0 B;  4AVP A;  4HST A;  4XRM A;  3TO9 A;  1IF1 A;  3UKG A;  1V4R A;  2L9R A;  4CCK A;  3I4M J;  4HOB A;  2HXI A;  1J59 A;  2QBY A;  2IXS A;  1MJA A;  2QVO A;  1VQ8 I;  2JSP A;  3VOX A;  2VUM J;  4Y52 J;  2R7U A;  3IH3 A;  5F0H A;  3F1B A;  1QO0 D;  3A02 A;  4ZYG A;  1GVJ A;  1KQ0 A;  3BZ6 A;  1WJE A;  4KT6 A;  3WE3 A;  1U8R A;  4BNC A;  1BJZ A;  4IF4 A;  1LE8 B;  4OIR F;  3F8C A;  3BG3 A;  2ISZ A;  1JKQ C;  3SZT A;  5BMZ A;  2BE5 F;  2DI3 A;  1JJ6 C;  1IRZ A;  3KZ9 A;  3TOB A;  2HDW A;  1ETQ A;  5E8G A;  1D1A A;  3Q0V A;  3WU1 B;  3RH2 A;  1XPX A;  3VOE A;  3L2W A;  2E35 A;  2Y0S A;  5DTD A;  1X1C A;  3HHH A;  3O3K A;  4ANJ A;  2EA2 A;  4N0B A;  3HKZ N;  1JKP C;  4B48 A;  3B6C A;  2M1B A;  1AHD P;  3RPU A;  1KON A;  3CUO A;  4XRS A;  2EZI A;  2VQG A;  1NG7 A;  5HSZ A;  2DDA A;  1YS7 A;  1UCR A;  1K4S A;  5DEQ A;  4II3 A;  3V7C A;  4BJT A;  5D4R A;  1LEB A;  2EJR A;  1G3S A;  1QQI A;  3CMY A;  3FXR A;  1HW2 A;  2R93 J;  2LBF A;  5ICC A;  1WCM J;  4M73 A;  3I64 A;  2WY7 Q;  2O9L A;  1NHA A;  2BBY A;  2IAI A;  1D8K A;  4U87 A;  2K4B A;  1I3Q J;  5LRS A;  3G6E I;  2E5Z A;  4GYG A;  2WAQ N;  4GCV A;  5GP9 A;  1Z0X A;  1S6L A;  3M9A A;  4D0P A;  3G7R A;  5D5W B;  3GX4 X;  3BJ6 A;  2RRE A;  2V6E A;  4IEJ A;  5E20 A;  2WY8 Q;  2WB1 N;  3S3O A;  3RKX A;  2HZT A;  3HTS B;  4KIC A;  3JRA A;  3JRC A;  3E1S A;  1TW3 A;  2DJI A;  2F5F A;  3FX3 A;  2NP5 A;  2Y31 A;  2L54 A;  4BGD A;  2MD0 A;  1LE8 A;  2DA4 A;  3CCQ I;  2FJI 1;  1PVE A;  4M9X A;  2F6C A;  2A3S A;  2KFD A;  1KU2 A;  2F5D A;  3LQR A;  2CUZ A;  2VE9 A;  4D7M A;  2XRN A;  4N9H A;  3VIB A;  4MFE A;  2VKV A;  4IQ4 A;  4MEY F;  3I55 I;  4CGZ A;  3V6G A;  2ZFU A;  4HDU A;  1BR4 A;  3VPR A;  2FBH A;  3CCU I;  1RRJ A;  2NVQ J;  3GTK J;  4JL3 A;  3DU6 A;  2LY9 A;  4GYI A;  3PIO F;  5F27 A;  2K3P A;  2W48 A;  4RS8 A;  5LLQ A;  2JA5 J;  2ESH A;  2XUB A;  5D5U B;  1PP8 F;  4HNV A;  1B8I B;  3RQ4 A;  3BLY A;  2ZCW A;  2ECB A;  4IHY A;  5E1X A;  2CQQ A;  4AM3 A;  2PN6 A;  3JRE A;  4Y17 A;  4YRV A;  2ZME C;  3PFI A;  4C3J J;  3AG1 H;  1JKR C;  4KIS A;  3N4M A;  3TW6 A;  3H0D A;  3HKZ A;  1NK2 P;  4ZDP A;  4C2T A;  5TRD A;  3E6M A;  3E6B A;  4C9Y A;  2Y30 A;  4DYR A;  2NVY J;  2MG4 A;  1BI1 A;  4BL0 B;  4GGG A;  2F5C A;  3X2Q H;  3OYB A;  4BAC A;  2NVX J;  2HWV A;  1BR2 A;  4BDY A;  4Y3O A;  4CCM A;  2R7T A;  2GXA A;  4UUT A;  4AWX B;  3DTI A;  5D6F A;  3KYL A;  3IRR A;  3HUG B;  2IGO A;  4L9J A;  4A5M A;  2V9P A;  3C2H A;  2FMY A;  3WTV C;  2L9V A;  3BZK A;  2DK8 A;  2VJI A;  2GXB A;  4IHX A;  1MBE A;  1FOK A;  4HYE A;  2ZNY A;  4UVC A;  5KK1 A;  4UUV A;  1P4A A;  2GZW A;  2E1M B;  2WAQ A;  4DZJ A;  2CRG A;  4AIK A;  1FSH A;  4F92 B;  2IS4 A;  2O03 A;  3IKT A;  1O7F A;  1TTY A;  2W53 A;  3MNL A;  2WB1 A;  4N9I A;  4UNO A;  1IN6 A;  1QHG A;  1TC3 C;  1X3U A;  1X2M A;  2VKH A;  5D18 A;  3R0J A;  2CH0 A;  1U2W A;  3G2B A;  3CO7 C;  3A1Y A;  3K4M A;  2VJ4 A;  4WF2 A;  2LTP A;  1ZEL A;  5B1A H;  2LY1 A;  4A0Z A;  4MFD A;  4Y15 A;  4LG0 B;  1XSV A;  1OPC A;  2A2F X;  1B8I A;  3KET A;  3BG7 A;  2P8T A;  2H8R A;  5CYV A;  2VAS A;  1S8N A;  4E7I A;  2Z9O A;  2BGC A;  1LFU P;  2OF7 A;  4OIN F;  1EV7 A;  5CKT A;  2D6Y A;  2FU4 A;  3JSJ A;  2M9H A;  4XRS G;  2K4J A;  4II2 A;  2LLK A;  2QWT A;  3EUH A;  2OUM A;  1V5F A;  3RYR A;  3FDY A;  3R6S A;  4C2M J;  2XC7 A;  4KT5 C;  2ZSH B;  1HF0 A;  3CJR B;  1H9T A;  3L2U A;  3QQA A;  1ZR2 A;  1IO2 A;  2CSO A;  2L01 A;  3H3U A;  1TWG J;  3U1K A;  2V79 A;  3HRS A;  4L5E A;  1P6R A;  1IAW A;  2O6G E;  3I54 A;  4R79 A;  1LFP A;  1OR7 A;  3DLL F;  2H94 A;  1V5G A;  4RLQ A;  3L2V A;  2IA1 A;  1W0U A;  1V5E A;  4UDS A;  1IJW C;  1MZB A;  5HS8 A;  4UVB A;  3H9Q A;  2DOA A;  1W36 C;  4MGR A;  5M5Y J;  1K6O A;  1JGS A;  2QEX I;  1WWX A;  2ZB9 A;  2DTZ A;  5JR3 A;  1MMD A;  5AIQ A;  1Z21 A;  2VJ5 A;  4ZZD A;  1F43 A;  5CQG A;  4A3F J;  1ETV A;  1SD7 A;  2FBI A;  3W2A A;  3SQN A;  2NS8 A;  1K83 J;  3KZZ A;  5IYB J;  2DJN A;  3TDU C;  4YEJ A;  2O8X A;  3BJB A;  2ZY9 A;  5F64 A;  1Z3Y A;  3KP3 A;  5C4J J;  2QQA A;  1ZAR A;  4DYQ A;  2CGP A;  3F8N A;  2VT2 A;  3E6D A;  1GLN A;  4DGW B;  2XF5 A;  2MGQ A;  1X19 A;  2R7Q A;  4P5O A;  4LG0 A;  2L2O A;  4YEL A;  2G7G A;  3AQS A;  3ZQ7 A;  4GFB A;  1XS9 A;  4TV7 A;  3TL4 X;  4ZZL A;  2EQR A;  1BI3 A;  1R1T A;  2HYG D;  2PEX A;  1LDK B;  5CW8 A;  2A6T A;  1P92 A;  3BWG A;  2QKL B;  2EIK H;  1ETX A;  5L3E A;  3D5R C;  3DPT A;  2KMU A;  2OCC H;  4ESB A;  2LSO A;  1X1P A;  2IA0 A;  3DFG A;  3HSR A;  3FMR A;  1OCC H;  2D1H A;  5CXI A;  2DT7 B;  2M3A A;  1DQU A;  2G3B A;  5E1Z B;  4G94 A;  3ULQ B;  4DOZ A;  2H6C A;  2ZJP F;  3K1P A;  5DV5 A;  3HOU J;  3RQI A;  2P7V B;  2EFO A;  5E79 C;  2V1X A;  3OIO A;  2LF7 A;  2EIM H;  2FE3 A;  2G7S A;  2V1U A;  1ON2 A;  2LD5 A;  2O61 A;  3E3V A;  1XMK A;  3QOP A;  2EZH A;  3HE0 A;  3LWJ A;  1A31 A;  2ZXW H;  2YU3 A;  2K40 A;  1TQI A;  1QPM A;  4C2U A;  3H5R A;  5AIP A;  3QOD A;  2K3F A;  3GFM A;  2XB5 A;  2GXG A;  2D5V A;  4UV8 A;  3HDD A;  1OKR A;  5FFX A;  2DA1 A;  4OAY A;  4MHG A;  1EH7 A;  4DBQ A;  2YPR A;  1MSE C;  3LMM A;  1YS6 A;  1MMS A;  1YFH A;  4BYY A;  3F9K A;  3HRM A;  1TT5 B;  2R7F A;  2DMN A;  2W7N A;  1UI5 A;  1VQ9 I;  4KUM A;  5FMP A;  4JOM A;  3VYR B;  4OU0 A;  3K4C A;  5BOX A;  2UXU A;  3NEU A;  3DBL B;  3AFH A;  3ZPL A;  1IRF A;  1MND A;  2ETH A;  3V7S A;  4H0E A;  3BR5 A;  2DOF A;  4Z6Y A;  5E18 F;  4UUS B;  1LQ1 A;  2M5W A;  2ZKZ A;  3HGG A;  1FMV A;  3HTJ A;  2WC2 A;  5D6E A;  1IC8 A;  3I4P A;  3ON4 A;  3IAS 2;  3F8B A;  4B3X A;  3WG9 A;  1L0O C;  1BW6 A;  4XR6 A;  3NS4 A;  5M5X J;  1W1W E;  3QYE A;  1TNS A;  1T0F C;  2WBM A;  4XRF A;  3GEU A;  3HOW J;  3ZMT A;  5M3F J;  2BHY A;  2LKP A;  3LAP A;  5CVI A;  2DG7 A;  1R4M B;  1RC9 A;  1JE8 A;  3DCF A;  3C2G A;  3HRU A;  2CMP A;  3BR3 A;  4U0W A;  3ZN1 A;  2RV8 A;  4MNU A;  2VIX A;  2QTQ A;  3A03 A;  3O2P E;  2DT6 A;  2YUS A;  1JUS A;  5F6F A;  1WKM A;  3W6V A;  2WV0 A;  3V42 A;  1ZRC A;  4IRH A;  2F48 A;  1XGN A;  1I39 A;  2YSR A;  2XVC A;  5F1R A;  5FO5 A;  3MFK A;  2PMH A;  2K85 A;  2LC2 A;  1OIS A;  2EK5 A;  3F6O A;  1U3E M;  1VQM I;  4UHT A;  1BL0 A;  1G4D A;  3K4J A;  3LWF A;  5CLS A;  4L9N A;  5GAG J;  2LVS A;  3J7A O;  5K1Y A;  2H27 A;  2P6S A;  3LST A;  2RQP A;  3E97 A;  4DW6 A;  2E2J J;  3DEW A;  4FET A;  1FYL A;  3MKW B;  1BM9 A;  2ZCX A;  3QWL A;  2XSJ C;  2KIS A;  4BH9 A;  2HDC A;  1AOY A;  3MMY B;  3F8F A;  4NBQ A;  2WV1 A;  2HYF A;  5E3O A;  5GPC A;  3U1D A;  2V7F A;  4R8H A;  3NWT A;  1LDJ A;  4UUS A;  2UUZ A;  2L02 A;  4XN0 A;  1K79 A;  4XN3 A;  1WFX A;  3FMQ A;  2G7H A;  2FX0 A;  2LP0 A;  4KIB A;  1TWH J;  2W4S A;  3FIW A;  1UZC A;  3OSG A;  2R7R A;  2RAS A;  3R61 A;  2HKU A;  4HKU A;  2RNJ A;  1A04 A;  3QPH A;  3KP4 A;  5DD8 A;  4ZJZ A;  2NVU B;  2ZXH A;  3K6G A;  2M4G A;  2CV1 A;  1NG6 A;  1T2K A;  3BCG A;  2GOM A;  4U9L A;  2M0M A;  2R7O A;  1F36 A;  2A05 A;  3TP0 A;  1UG2 A;  1ZKG A;  4IPA A;  4NQW B;  3TDZ C;  1RET A;  3W2V A;  2WAF A;  1W5T A;  1KA8 A;  4IOA F;  2BZT A;  2HOT A;  3BTI A;  2FOK A;  2GUH A;  1VQ5 I;  1MMA A;  5F04 A;  5E3M A;  1MSF C;  2QKO A;  1TWF J;  4E70 A;  1BIB A;  3NAU A;  2YU9 J;  3H9G A;  4XKB A;  2QGU A;  2D45 A;  2IVM A;  4KIT B;  5DD4 A;  3AKZ A;  4HF1 A;  3FM5 A;  3PL8 A;  3K70 C;  1G3T A;  1RPW A;  3ERM A;  1FBQ A;  2BY0 A;  2OZ6 A;  3DPU A;  3TP3 A;  2K5C A;  2NOJ B;  4BXU A;  2KQR A;  3HHG A;  4JBA A;  5ICF A;  3ZMD A;  5EF6 A;  5FRM A;  5D1R A;  3GTP J;  2W00 A;  1MNE A;  2DW4 A;  3SFI A;  2VXD A;  1P2F A;  3KE2 A;  3KKC A;  3CDL A;  1Z1D A;  4UB6 C;  4E7L A;  2JVH A;  2L3D A;  1ODD A;  3HRT A;  4ABZ A;  2R7Z J;  4FQG A;  1FTZ A;  2E36 A;  3U9G A;  1SAX A;  2H09 A;  3AG4 H;  2IGN A;  3ZXS A;  1MH4 A;  2XAG A;  1X3Z B;  4IZZ A;  4XK4 A;  1SVL A;  3ZQH A;  1Z67 A;  2DFH A;  1P7I A;  4S04 A;  4AUX A;  1FT9 A;  2Y0M A;  2WGB A;  4A3B J;  4M72 A;  4UXN A;  4OD5 A;  3CMM A;  2BW3 B;  2Q24 A;  1OCP A;  2EFP A;  1ITY A;  1ZGJ A;  3DBR B;  5DM7 F;  1DGW Y;  2WUI A;  4M6V A;  4RB2 C;  1S5L C;  5FB2 A;  1W36 D;  2PQ8 A;  2NOG A;  2HYJ A;  1QA6 A;  3I53 A;  3HTI A;  1X1B A;  2MH2 A;  3WOD F;  4B4C A;  4B1R A;  1U8B A;  3SEQ A;  5CQE A;  4OIP F;  1EA3 A;  1QVT A;  2NS7 A;  1LB2 A;  1J9I A;  2BYV E;  1E3O C;  2XGC A;  1IXC A;  5J8C A;  1USS A;  2VOP A;  1TQP A;  3TKY A;  3GFI A;  5D8L B;  3KCC A;  1B6A A;  5BPD A;  1H89 C;  1HQC A;  1XDU A;  4M3G A;  2NNN A;  3L9F A;  1GT0 C;  4I2O A;  1S7O A;  1AU7 A;  1U5T C;  4NC7 A;  1FC3 A;  1XMA A;  4H4K C;  3TO6 A;  2LR8 A;  2ZCM A;  1FNN A;  3PNY A;  1YW9 A;  3F8M A;  4HZF A;  3KLO A;  1YI2 I;  1WH5 A;  4I7H A;  3OS2 A;  1JTY A;  4HG2 A;  5K58 A;  1KZH A;  3LA2 A;  2IGM A;  2DPD A;  3GZ5 A;  1O57 A;  2OER A;  2KRF A;  2ZJR F;  2E1C A;  5K5R A;  4DVY P;  4XL9 A;  4HAM A;  3DV8 A;  4CIC A;  1R49 A;  2X1E A;  2M8G X;  5DCM A;  4PCQ A;  3EQL F;  3IWZ A;  3CQZ J;  5AON A;  1UST A;  2QA4 I;  3S93 A;  2R3S A;  2MYS A;  1RNL A;  2BVL A;  1OMI A;  2H6B A;  1KYZ A;  1HXD A;  3D5L A;  3FXL A;  1J75 A;  2GWR A;  3KIO A;  2O7T A;  1FOY A;  2BW3 A;  5CXG A;  1BBY A;  5CVJ A;  2OTL I;  3E0J B;  1MIJ A;  1HDD C;  1KU3 A;  3GTM J;  1QRY A;  3TO7 A;  3S2W A;  1OYW A;  3IL2 A;  4FT8 A;  1XN7 A;  2RVC A;  4X6A J;  1U6G A;  2ME6 A;  5GAD J;  1IUF A;  1WI9 A;  4F3Q A;  3BRO A;  4ESJ A;  3RIR A;  2NP3 A;  2IA2 A;  3VW0 A;  2IJL A;  4XQF A;  1TP4 A;  4DZP A;  4GXO A;  3WGG A;  1X58 A;  4M9Z A;  2LBF B;  2ME0 A;  1ZAO A;  3K1N A;  4HX4 A;  4Y33 A;  2ZSI B;  4X0G A;  5LHI A;  2V9K A;  1VQ6 I;  3IHU A;  3F23 A;  2E1O A;  4HF2 A;  1ZK8 A;  2Q1Z B;  4BY7 J;  3WTZ A;  5LRR A;  1XCV A;  4MEX F;  3REO A;  2DA6 A;  3OYH A;  4BU2 A;  4UV9 A;  1D3Y A;  3V7R A;  1MH3 A;  2MAB A;  1TLH B;  1F5T A;  4AF5 A;  3GYH X;  3TW7 A;  1KQ8 A;  2OQG A;  4Z2Y A;  5FRO A;  1IUY A;  3T6N A;  1LEA A;  1R23 A;  2COM A;  2NYX A;  3Q0W A;  1XB4 A;  1IGN A;  2O0Y A;  1E3H A;  2PMU A;  1AWC A;  1Z9C A;  3DWL E;  3G1M A;  1QNT A;  4C30 A;  1YJ9 I;  2P81 A;  1M1E B;  4MTE A;  4D5C A;  1R9T J;  3VB2 A;  3DPL C;  2IRF G;  1IN5 A;  3SZG A;  2TRT A;  1SFO J;  3RPQ A;  2LK2 A;  2Z33 A;  1LUJ B;  2FNA A;  2QWW A;  4LJZ F;  1WPK A;  1K4T A;  2OI8 A;  2CW7 A;  2PJR A;  5HBU A;  3ZCO A;  3K2A A;  5JFR A;  3G1L A;  2OCE A;  3VOK A;  2F4I A;  3LSJ A;  4LG3 A;  1SFX A;  2XGD A;  2PFB A;  2X0L A;  2HU9 A;  1XTA A;  4KNY A;  2B3W A;  4R1H A;  2R7S A;  3FKI J;  4U88 A;  3EUA A;  1Y8R B;  2E7W A;  1R4N B;  4XOP A;  4M9S A;  1G59 A;  4WIB A;  5IYC J;  2QQ8 A;  3VYT B;  2XRL A;  2E2H J;  3ECH A;  4FX0 A;  5E1W A;  1D0Y A;  2QCO A;  3NPI A;  4LMY A;  5FGM A;  3ZQC A;  1SMT A;  2A07 F;  2STT A;  1X4O A;  4W1U A;  3ESW B;  4A3E J;  4BQA A;  3DU5 A;  1W5C C;  3BNI A;  3RSN A;  4P9U A;  2EZL A;  2CQ7 A;  4HX7 A;  4E7S A;  2DMQ A;  3BQZ A;  3E5U A;  4FTH A;  4HQM A;  3K2Z A;  2K9M A;  5DAJ A;  2P0W A;  3W6J B;  2QQ9 A;  3EUK L;  4G12 A;  3GTG J;  3S1Q J;  4CGR A;  1FY7 A;  1TBX A;  3H35 A;  2E5N A;  1X4P A;  3OYC A;  1RI7 A;  4PGH A;  1Y0U A;  4AID A;  1UHW A;  1F4K A;  4C3H J;  1YX5 A;  2AXL A;  3H0G J;  1SVO A;  1FJL A;  3H5A A;  3CC4 I;  2ELJ A;  3ABU A;  1GDT A;  1REP C;  3TMO A;  4AC6 A;  5IP6 A;  1I6H J;  2Q0O A;  1R5G A;  2JRT A;  2KIU A;  4BBR J;  2VPR A;  4CYD A;  5DS9 A;  2B0L A;  1SC7 A;  4A3D J;  1JXS A;  5EFY A;  2EA4 A;  4LLN A;  4O5V A;  4WXD A;  5TJJ A;  2XHK A;  1JHH A;  1IN4 A;  4PUS A;  3JRI A;  1T6S A;  1G6N A;  3M3Y J;  3Q5F A;  3R0A A;  3JRD A;  5LHH A;  4O6J A;  5EGO A;  2M4K A;  1E0E A;  2QEN A;  2WTE A;  1QU3 A;  4JX6 A;  4IXA A;  3D5S C;  3GWZ A;  4RAF A;  2IS2 A;  4JKZ A;  1B72 A;  2CW8 A;  2DU9 A;  3CUQ C;  3PNV A;  4EM0 B;  3QYB A;  1UB9 A;  4GRI A;  1ZG5 A;  4G9Y A;  1VQP I;  1CGP A;  4ENM A;  2PX9 A;  5LGT A;  3M8F A;  4A6D A;  5E8I A;  1OLT A;  4U0V A;  3FF5 A;  3GZ6 A;  4FAS D;  3S1R J;  2DA5 A;  4BDZ A;  1LPQ A;  3JTH A;  3K70 D;  1R71 A;  2V9V A;  3CJD A;  2E71 A;  3IAM 2;  3HSE A;  3I9V 2;  2A6H F;  3JW4 A;  1R1V A;  4NUB A;  2OJE D;  4XLE A;  1D5V A;  5IOZ A;  1Z91 A;  2W1O A;  2O7O A;  3ABT A;  3ZQG A;  3EGQ A;  5EEH A;  4BXX J;  2QUF A;  5EYR A;  5HLI A;  1IV8 A;  5BNG A;  4ME9 A;  1MDM B;  3WTT C;  4BQQ A;  2M30 A;  4EM2 A;  4L9V A;  1DU6 A;  1HOM A;  3OWT A;  2CUE A;  3RJP A;  2EIJ H;  1TW2 A;  4B8X A;  4YII A;  2ZBK A;  3QAH A;  2G7U A;  3HPH A;  1WJB A;  2HOE A;  3ANP A;  3ROU A;  4YG2 F;  3DBH B;  4L18 B;  4I76 A;  2AXT C;  2GEN A;  2LF8 A;  2XPV A;  3VP5 A;  5HDN A;  1DU0 A;  3RKW A;  1U9N A;  3CJT B;  1ZRD A;  3ANG A;  2DO7 A;  3ZQQ A;  2LFB A;  2ESN A;  2LY2 A;  3MEX A;  4AD9 A;  4F91 B;  3K8P C;  1D1C A;  3HB9 A;  1A6I A;  5EDN A;  3OOU A;  3WHB A;  1ZLJ A;  2MC4 A;  2IS1 A;  3B6A A;  1H88 C;  3I71 A;  3KP2 A;  3LFK A;  3OL4 A;  4E7H A;  4ENK A;  4AIJ A;  2FUG 2;  3N97 A;  3VWB A;  4ZTJ A;  4LFU A;  5HVQ C;  3SYT A;  4DNC A;  2I5U A;  1WZ2 A;  5EZH A;  5J1Y A;  2A61 A;  1OJL A;  5DYM A;  2JA6 J;  3DTK A;  3PQJ A;  4CUG A;  2JVG A;  1HDP A;  2EB7 A;  2JPB A;  2LDU A;  2W57 A;  5KVR A;  4U9N A;  4EJW A;  2A68 F;  3HIM A;  2FEZ A;  4XON A;  1AKH B;  3ZGK A;  1MDM A;  4S0H B;  1JTX A;  2B9S A;  2LRD A;  4AYB N;  1I5Z A;  2ZXJ A;  4HDV A;  1WVR A;  2EWN A;  3O8H A;  1LFB A;  3KFW X;  3LFU A;  3O8G A;  3V8K A;  2CFO A;  2VBZ A;  1V3F A;  3VSL A;  1W5S A;  2RNG A;  3CD6 I;  3E5X A;  3HZJ A;  3H3V K;  4YFK F;  1FIP A;  4QPQ A;  5JVG F;  3KPH A;  3QBM A;  5H6R A;  4ESF A;  2KZG A;  4L5I A;  4KMF A;  2DOE A;  2E1N A;  1H0M A;  3M07 A;  3FKJ A;  3F22 A;  1YRN B;  1ZR4 A;  4FHT A;  3S5R A;  5FKO A;  4ASN A;  2MSY A;  3QOE A;  4MTD A;  3DEU A;  2HYT A;  2A5W A;  2KRH A;  5F1J A;  2DTR A;  2DPU A;  2V57 A;  2CG4 A;  2BY1 A;  2I10 A;  1YLF A;  4CXF A;  3JRF A;  5J1U A;  4G6T B;  4XSZ F;  2P7C B;  3T8R A;  5FKN A;  1QHH D;  3KYC B;  2L7M P;  2XKO A;  2E19 A;  1FYM A;  2IGK A;  3JCU C;  1SFU A;  3PSF A;  3S3N A;  3I4N J;  2M8E A;  1WJ5 A;  4LOC A;  2GQQ A;  2IT0 A;  3W2W A;  1ZHF A;  2XGE A;  3ABK H;  1E17 A;  1Z77 A;  3QU3 A;  4QWQ A;  1PUF B;  2DLL A;  1ONV A;  1RKW A;  4HX8 A;  5C4Y A;  3CF2 A;  3Q9S A;  5IPA A;  3AL0 C;  3CDI A;  2L4M A;  1APL C;  3HOS A;  3S2H J;  4LIV A;  2HTJ A;  3WU2 C;  4V2G A;  3FXK A;  3QYF A;  4K2E A;  3BC8 A;  4KIG A;  4LIU A;  2D1V A;  2WAD A;  3PSI A;  3G73 A;  2ZFW A;  5LEK A;  2P5V A;  4MXM A;  3VUQ A;  1AKH A;  2M2E A;  1Q1H A;  2DYS H;  3KEQ A;  1RKT A;  4PDK A;  4EEF G;  5D19 A;  3CDH A;  1FP2 A;  4DYC A;  3CC7 I;  1QZE A;  1HKS A;  5HDK A;  3OSF A;  4CHU A;  4JX5 A;  4AVZ A;  2L7Z A;  4IKF A;  3KP5 A;  2YVE A;  4A3M J;  1QPI A;  2XB0 X;  3ZMV A;  2CU7 A;  4MQV A;  2HQR A;  2XAQ A;  3VW2 A;  1BOB A;  2BY2 A;  3Q3S A;  3OYK A;  1GV5 A;  4RB1 A;  3HOT A;  1HW1 A;  2DFI A;  1YRN A;  1WI3 A;  2D2W A;  2JWT A;  2L0K A;  1ZRE A;  1RZ4 A;  3KP7 A;  5KNL A;  1YTY A;  4ACI A;  4CDG A;  3GLL A;  4E6K G;  4RGU A;  2P5K A;  2Y69 H;  4KMU X;  3D0S A;  3SZP A;  2ZXI A;  2HQ5 A;  4CYC B;  3SWH A;  3OOP A;  2PLY A;  1TT0 A;  4UVA A;  5J8F A;  1UFM A;  2ECC A;  3BR2 A;  3IP4 B;  3BDD A;  2GFN A;  3ZQL A;  1ZN2 A;  3IH2 A;  2PJP A;  2QKM B;  4IQJ A;  3O60 A;  5HOO A;  1YX3 A;  4CCO A;  3J80 K;  1Z7L A;  3FHN A;  3H36 A;  2IPQ X;  2P4W A;  2X6O A;  1PUF A;  4EJT A;  2A5Y B;  2EV6 A;  4QSH A;  1XCB A;  3J80 Z;  3GEZ A;  3FZV A;  1HKQ A;  2DA2 A;  2FJ1 A;  4RB0 A;  2FD5 A;  2R0Q C;  1I27 A;  3GO5 A;  1ZGW A;  2UZK A;  5KAF C;  2LH9 A;  1DPU A;  1ZTR A;  1X3W B;  4IVN A;  1T33 A;  2X48 A;  2JUC A;  2Y75 A;  3HIF A;  1VND A;  3GBG A;  4FE4 A;  4EMS A;  4ZYE A;  5ED4 A;  3BQY A;  3GTQ J;  3PFY A;  2Z5U A;  3COL A;  1PYV A;  5GAH J;  3K4L A;  1LKX A;  2L9N A;  1VQL I;  1VQN I;  3ZMS A;  5FFZ A;  3CMA I;  3S16 J;  2VN2 A;  4ZTF A;  5GTH C;  2L5Q A;  4YIR X;  2H1K A;  3C1D A;  3FXJ A;  4EAT A;  1MJ9 A;  2GBY A;  4PSX A;  1HSJ A;  4CYC A;  1YIT I;  3HOY J;  2FOW A;  5EZG A;  1HBX G;  2HQN A;  2PI0 A;  1KGS A;  3OR1 C;  3I3L A;  5HS7 A;  3JAM K;  3WTY C;  1ETW A;  3WGH A;  3MKZ A;  4A0Y A;  3EUH C;  3BCA A;  5FLX K;  5LEJ A;  1FIA A;  3JAM Z;  1B59 A;  3IC7 A;  3OIP A;  1W7P D;  2FRH A;  3IUO A;  4RLF A;  4ZH4 F;  3LSK A;  5FLX Z;  2I8D A;  2KIQ A;  4IJA A;  4NEL A;  5DUK A;  3VW1 A;  1FMW A;  1GUU A;  2A6E F;  3GF2 A;  2X51 A;  3SDB A;  1G3W A;  1OR7 C;  2DFE A;  3S1M J;  1Y0N A;  1LDD A;  1Y56 A;  5F0C A;  1BR1 A;  3HEF A;  3FXQ A;  1N77 A;  1A5J A;  2LRE A;  2CUF A;  3T5X A;  1UAA A;  4FIS A;  2HOA A;  2A69 F;  3M7G A;  4G7H F;  1BA5 A;  2CS3 A;  3BTJ A;  3RZD J;  3GME A;  3HBL A;  4LLL A;  2E1M C;  2GOX B;  1G2H A;  5HAW A;  2X1C A;  3OYL A;  1HA8 A;  1D0Z A;  5JI6 A;  1BW5 A;  1ZYR F;  2F5V A;  4U7B A;  4V2F A;  4PGG A;  3HJE A;  2CV2 A;  3KP6 A;  2ADU A;  2ELH A;  3S32 A;  1D5Y A;  5KHD A;  1FEX A;  2IP2 A;  5HLG A;  4Q48 A;  3OMY A;  4XLP F;  2FF4 A;  3CJQ B;  4EQQ A;  4NC8 A;  4XMY A;  3K69 A;  1SFK A;  2W84 A;  2P6T A;  3H92 A;  4I98 B;  5L3B A;  2VC1 A;  4NN1 A;  2ACJ A;  3SDG A;  2Z2S B;  1O7L A;  2M87 A;  2DG8 A;  2DK5 A;  3L2C A;  4U0Y A;  5ICG A;  1JUP A;  2QQB A;  2X6W A;  3ZP5 A;  2YS9 A;  4AIH A;  3DXJ F;  2CJJ A;  4ZYA A;  3DLA A;  4IHS A;  4D7N A;  4I01 A;  3T8T A;  3P5J A;  4M3F A;  2KL4 A;  3ERE D;  3UNG C;  3MWM A;  2R7D A;  2ZME B;  2M7B A;  5D5V B;  2HPI A;  4M71 A;  3BRU A;  3A0B C;  2EFW A;  5ERI A;  1MBJ A;  1PJR A;  3JTG A;  2NNY A;  1NK3 P;  3FIS A;  5B1B H;  3J81 K;  5DCM B;  1ETK A;  2MLG A;  2UXI A;  3C3W A;  3N05 A;  4RAZ A;  2H1L A;  2RAE A;  2UV1 A;  4XBF A;  1J7K A;  1JT6 A;  3RYP A;  3ZR8 X;  3HTH A;  2GLO A;  5F08 A;  3J81 Z;  3V78 A;  4BBS J;  1RUO A;  1HC8 A;  3U2R A;  5TIS C;  3PUF A;  3CP8 A;  2CQN A;  4KN4 X;  4PFP A;  3WGI A;  3KNW A;  3CZ6 A;  1OYY A;  3ABM H;  3I5U A;  4PZJ A;  2XGX A;  1DPR A;  3DTE A;  4I6Z A;  2IU5 A;  2HKX A;  3GFJ A;  3MVP A;  5KAI C;  6PAX A;  1O3T A;  4CZZ A;  4KJZ A;  5D8K B;  3OYD A;  2R92 J;  1YO5 C;  4XLF A;  2HFH A;  1OYI A;  3B81 A;  3BR1 A;  5IP7 J;  3LOC A;  4EV0 A;  3G3Z A;  3RPU D;  5H20 A;  2X6Y A;  1L3L A;  1YIO A;  1XX5 A;  3OYA A;  2JJ7 A;  4AC0 A;  3FXO A;  2M0C A;  2UXX A;  1ZG3 A;  1VF9 A;  1B9N A;  2JK3 A;  4RM2 A;  4BEH B;  2B1E A;  3CRJ A;  3LSM A;  2AHQ A;  5K5Q A;  3OS0 A;  5ILV A;  4J00 A;  3L7W A;  2F4M B;  1SFE A;  2ZME A;  4LLG F;  3RDI A;  1I6X A;  1VTN C;  3ECO A;  3M4O J;  1I3A A;  2EFQ A;  2FQ4 A;  1X1D A;  2OU2 A;  5L3G A;  3IRQ A;  2VKD A;  4EJU A;  5LD2 C;  2DAO A;  4A6E A;  1IG7 A;  4Y13 A;  2X1D A;  3S14 J;  5HOD A;  1U0J A;  3OYM A;  3OYE A;  3MKY B;  2R5Y B;  1H8A C;  1TWC J;  1W4M A;  4ITV A;  2YX4 A;  3WTW C;  3TOA A;  3L2R A;  4J19 A;  2GA2 A;  2XAJ A;  3IV5 A;  1MNM C;  1HCR A;  1DGR M;  1EH8 A;  3GXO A;  3G71 I;  1HKT A;  3LSI A;  2F07 A;  1NH3 A;  4I0B A;  3LSH A;  1SAN A;  1WSU A;  1W0T A;  5GTI C;  1SVM A;  4D9J A;  2PJR B;  5EG0 B;  3OY9 A;  1DP7 P;  2XV4 S;  3BPV A;  3CES A;  2EPF A;  1YG2 A;  3CCR I;  4DJA A;  2MFZ A;  1SD6 A;  2K9Q A;  2Y9Z A;  2FBK A;  2R7W A;  3BG5 A;  3OR2 C;  4A3I J;  1ETO A;  2K02 A;  2XPU A;  3K1M A;  3SEZ A;  2Z3Y A;  4M74 A;  1XG1 A;  2GIV A;  2JUG A;  2B63 J;  4RA2 A;  2W25 A;  5LBQ A;  3J7A Y;  2O8K A;  3SFZ A;  2ZNZ A;  3H1C A;  4L9T A;  2KJB A;  4A3G J;  2XIG A;  1A36 A;  3VEP A;  3LAJ A;  1F1Z A;  2HTS A;  2EH3 A;  4BEH A;  3MZY A;  1YW7 A;  2O3F A;  5CVV A;  3PO3 J;  2AO9 A;  4GO1 A;  1HW5 A;  1ZQ3 P;  2UXO A;  4C2M A;  3GZN B;  2RC4 A;  2NAZ A;  2N8G A;  1P7J A;  1FTT A;  1GVD A;  4BE2 A;  4DIQ A;  2XDN A;  4F93 B;  2V1D A;  4I02 A;  1GV2 A;  3L00 A;  3LA7 A;  3NQO A;  3ZOB A;  4GCK A;  3S15 J;  3LSP A;  4A5N A;  1K78 A;  3KKD A;  1WH7 A;  2R5Y A;  2X85 A;  2XF6 A;  3ASN H;  3CP2 A;  3LHQ A;  2RKH A;  3A2K A;  3GUD A;  1KQ9 A;  5IP9 J;  2Q2E B;  2Z99 A;  3PQK A;  4HV6 A;  3JRH A;  4XLN F;  5E3N A;  5B66 C;  3PPB A;  5GPA A;  2FBQ A;  2JPC A;  4Q47 A;  3RKY A;  1T39 A;  1UMQ A;  3LA3 A;  4DQ2 A;  3QPL A;  4U7D A;  4GDF A;  2EV0 A;  4RMN A;  3H9J A;  5EG0 A;  2DXI A;  1AA7 A;  1IN7 A;  2HGC A;  4P96 A;  2VBY A;  1NTC A;  2LG4 A;  3WHC A;  5IY5 H;  3ZRG A;  5EGO B;  2M7A A;  1MBG A;  4HSR A;  4XKW A;  2KP6 A;  3FBN B;  1MJB A;  4B09 A;  1I1S A;  2OV7 A;  2WA0 A;  4PSW A;  1B72 B;  1U78 A;  2RDP A;  5CJ9 A;  2ZO4 A;  2V6C A;  4E4H A;  5J6X A;  3BR0 A;  3B73 A;  2YVH A;  1B4A A;  1XMX A;  3S8P A;  4G7O F;  1P4X A;  1OCO H;  1T08 B;  1EH6 A;  1MMN A;  1MW7 A;  3BG9 A;  2J5P A;  2NRA C;  5HNF A;  1IN8 A;  1N78 A;  2VE8 A;  3F72 A;  2M34 A;  2XRO A;  3CLQ A;  2V1N A;  3C07 A;  2PBI A;  2Q8K A;  5FKL A;  4NHJ A;  1KU7 A;  3F6V A;  1D0X A;  1FBU A;  4P9F A;  4RAG A;  3AAF A;  3NI7 A;  4KWA A;  4MO7 A;  1T95 A;  3DKY A;  4HBL A;  3DPJ A;  2EV5 A;  3BT9 A;  2V26 A;  2VL8 A;  3WTS C;  2E7X A;  1Y1V J;  5J47 A;  1YE9 A;  4A3C J;  2W82 A;  2IW5 A;  1XSD A;  5FLM J;  3WTX C;  3GLX A;  2ISY A;  2Q2E A;  2DDB A;  4NNJ A;  1JJ8 C;  4BHB A;  2EZK A;  3PUB A;  5B3S H;  2OBP A;  5C3E J;  3LL7 A;  5C4X J;  2CQX A;  1LJ9 A;  1S29 A;  2H8W A;  1UEL B;  5ILS A;  2L7F P;  1P4W A;  1HLV A;  2DQR A;  2VT3 A;  5JLX A;  2IS6 A;  4LB5 A;  1XGM A;  5M3M J;  1C0W A;  1Z7U A;  2KZV A;  1S7E A;  3BPX A;  1FZP B;  2CUJ A;  4PJJ A;  3ZMU A;  2UXH A;  1WQ2 A;  3AG3 H;  3F21 A;  1VQO I;  3ELK A;  2Z1D A;  1JKO C;  5FHP A;  1VQK I;  1T98 A;  2QSH X;  4ZDO A;  1RES A;  3EUP A;  4L62 A;  2EBI A;  1UG0 A;  1CF7 B;  3LSG A;  3R60 A;  1BIA A;  4IHV A;  2E60 A;  3ZQI A;  3COA C;  3S3M A;  4HRI A;  4OWR B;  2QZ8 A;  3K9T A;  1MBF A;  2K7L A;  2PZ9 A;  2QYO A;  3H3Z A;  2LNB A;  5J1R A;  4RDU A;  3PO2 J;  2IBD A;  3M1E A;  3NNR A;  2Y2Z A;  4ZDL A;  1Z6T A;  4OD4 A;  1IV6 A;  4PFO A;  2HVQ A;  4OOI A;  1YIJ I;  3TBI A;  4XKV A;  1FSE A;  2COB A;  4KIF A;  2J5O A;  1XD7 A;  2RQQ A;  3H5N A;  1QZY A;  3HXL A;  2JA8 J;  2YX7 A;  2OAZ A;  1LVA A;  1T0F A;  5DM6 F;  3CCJ I;  3F3X A;  5J40 A;  2BEO A;  3BTL A;  1GXP A;  1Z05 A;  2F4O B;  3P9I A;  3EDP A;  2PFV A;  3R4K A;  1LNW A;  3WE2 A;  3FBI B;  4QPO A;  1SEU A;  4FE7 A;  1PUE E;  1SAU A;  3NRV A;  2OD5 A;  1FX7 A;  3JRB A;  2Y9Y A;  3MN2 A;  3KZY A;  1FYK A;  1MBK A;  5F0F A;  1T8I A;  2TDX A;  2HNH A;  2XPW A;  4QLC U;  5ILU A;  2YVX A;  1B1B A;  2REK A;  3NRG A;  3ML6 A;  1QVU A;  2DMT A;  4UY8 I;  1R6R A;  4RAY A;  3I56 I;  4LIT A;  4XNF A;  4QIW N;  3CCS I;  4ZYH A;  3EYI A;  3VYU B;  4OMZ A;  4B47 A;  1J5Y A;  2JN6 A;  4KA4 A;  5LHG A;  2GM4 A;  2KPM A;  4EJO A;  2X4H A;  3KEO A;  1ZGA A;  5HLT A;  3G4S I;  1CF7 A;  2PMZ N;  3HM5 A;  3NXC A;  4BJ6 C;  1BI0 A;  4LD5 A;  3OS1 A;  2W24 A;  2W85 A;  3FXU A;  3MQ0 A;  2CQK A;  3LNQ A;  2TCT A;  2BOL A;  1CQT A;  2VBX A;  4I99 C;  2GAU A;  1ZLK A;  3C18 A;  5D4S A;  4BS9 A;  4OIO F;  1WGX A;  2QSG X;  2HVS A;  4ZYD A;  1QGP A;  3BCB A;  3I59 B;  3OYN A;  2ZJ2 A;  1X1A A;  2FA5 A;  4M6Y A;  3IUV A;  4RM3 A;  2G9W A;  4NDL A;  5E3L A;  2LOO A;  2FXA A;  3KEY A;  2XDV A;  2MD5 A;  3BR6 A;  3NWS A;  3ZN0 A;  3TQN A;  3OYF A;  5CVR A;  3MZH A;  3A0H C;  2E34 A;  4IRV A;  1S3J A;  2VJJ A;  4B43 A;  3HUG A;  2IEK A;  3HYI A;  5EJC A;  1SD4 A;  4JX4 A;  4A93 J;  1XSX A;  2RGV A;  2CYY A;  1R22 A;  3HTA A;  5J3L A;  1ETY A;  2K9L A;  4HNU A;  2HQA A;  3WTU C;  4BE1 A;  4AU7 A;  3ON2 A;  3E7Q A;  3EPZ A;  2KT0 A;  2GA1 A;  2RN7 A;  1OCT C;  3NAR A;  2X6X A;  2CWE A;  2ZOY A;  3HGY A;  1VQ4 I;  4EJV A;  2BY3 A;  5D5X B;  4G6Q A;  4HF0 A;  3Q9V A;  1BOA A;  4WXC A;  1ON1 A;  3IWF A;  1WJF A;  5FGL A;  3ZMZ A;  1IDY A;  1FOX A;  1KU9 A;  2OZU A;  3A01 B;  1D1B A;  3BP8 A;  2PBX A;  2QSF X;  4HNT A;  1GXQ A;  1FBS A;  2VLA A;  2VQC A;  2KKO A;  2MH9 A;  1MD0 A;  2K27 A;  3VYS B;  3E5Q A;  4P55 A;  4BY1 J;  4KYW A;  1U5T B;  3K4N A;  4I0A A;  2VON A;  4BHC A;  2UXN A;  4MK6 A;  5J4Y A;  3I58 A;  4D5F A;  1QZZ A;  4WX9 A;  1RR8 C;  3V4G A;  1FOW A;  3C2B A;  4JP0 A;  2ELK A;  1ENH A;  2PMZ A;  3K10 A;  1HST A;  1BI2 A;  3I59 A;  1MKM A;  3MCZ A;  2NXN B;  2KDZ A;  1EF4 A;  1SGM A;  4XIC A;  5C44 J;  4M3B A;  3KZI C;  5BS6 A;  3RI4 A;  4XLH A;  1J09 A;  1BC7 C;  1WJA A;  4CCL A;  3OYI A;  4Q5S F;  2DYR H;  4A3K J;  4RGS A;  1DUX C;  4XM3 A;  3V8L A;  5ICE A;  3WU0 A;  1BN5 A;  2KIM A;  1SD5 A;  4AYB A;  4YFX F;  1UHS A;  5A2Q K;  2VI6 A;  3OL3 A;  3OV8 A;  1U9O A;  3E6C C;  4L5J A;  3JSO A;  1ORK A;  2BV6 A;  3QPS A;  4CCJ A;  1G3Y A;  2CW0 F;  1X2N A;  2VOD A;  2DT5 A;  2F5E A;  4BHP A;  5A2Q Z;  2EFN A;  5IOY A;  4OMY A;  2VOO A;  2YR2 A;  3HTU A;  4GCT A;  1K61 A;  4L0Y B;  1IXS B;  3GTJ J;  1ULY A;  4MLO A;  1IDZ A;  1WHU A;  3FK6 A;  4XOR A;  1UJ8 A;  2XAU A;  2CFX A;  1R7J A;  2DN0 A;  3KYD B;  2O5R A;  5DCF A;  2CV0 A;  4HPQ A;  3VFZ A;  1ZG1 A;  1VFC A;  4EGZ A;  3A01 A;  2ID3 A;  3IKV A;  4G8X A;  2ZC2 A;  4HQE A;  4XOT A;  4QTR A;  5DUI A;  5JVT A;  3M8J A;  3FMS A;  4CH7 A;  1OQY A;  2BHZ A;  2CO5 A;  2KDO A;  5HS9 A;  2QM3 A;  3G56 A;  4WK8 F;  5LGU A;  1U5T A;  1UHM A;  1YW8 A;  4A3J J;  3CCV I;  4A12 A;  4G7Z F;  2HVR A;  5IT3 A;  3BJA A;  2X9D A;  3SXY A;  4NB5 A;  3G1O A;  3JRG A;  4PK4 A;  4JYK A;  4PJ0 C;  4UB8 C;  4BJ5 C;  1VI0 A;  3W3C A;  4BQO A;  3GTO J;  2HI3 A;  4MIM A;  2MA3 A;  4XID A;  3CCM I;  4HA8 A;  1O3S A;  1JGG A;  4XLC A;  1S9H A;  2HXO A;  3FHZ A;  2KLO A;  3VTI A;  4JQF A;  2VC0 A;  3BTC A;  2AQE A;  4C3I J;  4IO9 F;  3CO6 C;  1YJN I;  4GFL A;  1R5H A;  3QP6 A;  2JTV A;  4RBO A;  2NS0 A;  3DF8 A;  4PJL A;  5BPI A;  4EVI A;  5FJ8 J;  1A35 A;  2NVT J;  1FP1 D;  1VQ7 I;  5BQT A;  4F52 A;  3FXM A;  3S1N J;  1MBH A;  4XKC A;  4IRG A;  1WJC A;  4FX4 A;  1BJA A;  1OCZ H;  1YHQ I;  3A4C A;  3GVA A;  3DP7 A;  3K7A J;  1Y1W J;  3QKX A;  3GCM A;  5B5E C;  4XSX F;  2HKO A;  3BJO A;  5K5O A;  4ZC3 A;  1WRJ A;  4HLX A;  4D1Q A;  2DFF A;  1ZRF A;  1J0R A;  2XAS A;  2BVM A;  4WWC A;  4GFK A;  3EET A;  4A69 C;  2VBW A;  3BY6 A;  4KN7 X;  5EEG A;  1KYW A;  5GAE J;  3PIP F;  2FNP A;  1DP3 A;  2M45 A;  3HG9 A;  3LQQ A;  1Z3X A;  2L9S A;  1O3R A;  2VKE A;  1JT0 A;  5IYD J;  4OIQ F;  1FLI A;  4YZE A;  2VQL A;  1XGO A;  1K7A A;  1YQA A;  5FRN A;  4G6D A;  1K6Y A;  3P9K A;  1MGT A;  3DKW A;  2XKP A;  1EKE A;  4CSW A;  1RIO H;  3U21 A;  2ZOZ A;  5KCM A;  4IX7 A;  3QPT A;  1ACI A;  3PNT A;  1E3P A;  3CC2 I;  4ICH A;  5JHF A;  2OPT A;  4WXH A;  2MLK A;  2UXP A;  3HL2 A;  3D1N I;  5FLV A;  1Y8Q B;  4B3A A;  4CA0 A;  4HV5 A;  2R5Z B;  4JNN A;  4IRI A;  1S72 I;  3JSP A;  3HOV J;  5HDG A;  2B7E A;  1TL8 A;  2KIF A;  2QF7 A;  3BG6 A;  1F9N A;  2XF7 A;  3J7Y J;  2OA4 A;  3RTR A;  4M3E A;  5FKK A;  3GFL A;  3BZC A;  3L1P A;  1R5I D;  4E7Z A;  3MD2 A;  3L2Q A;  1YJW I;  2JSC A;  3K4K A;  1ERD A;  1GHC A;  1R58 A;  2RHA A;  1FPQ A;  4JK1 X;  3MKL A;  2HZD A;  1A6Q A;  4LK1 F;  3VSK A;  5HNH A;  4KDP A;  2K9S A;  4O3M A;  1YOV B;  4LB6 B;  3ABL H;  2VQH A;  4PJN A;  4Y4R A;  3VOD A;  2XSD C;  2GIZ A;  2VPL A;  4L0Z B;  4RGX A;  1IW7 F;  2C6Y A;  1RUN A;  5TGT A;  4KFC A;  2WAE A;  1IZ1 A;  4WCG A;  1DDN A;  3ISP A;  1E2X A;  3HOX J;  4J01 A;  1W7P B;  5K7H A;  3C7J A;  1R36 A;  1V55 H;  4PXI A;  1TWA J;  3B02 A;  3CCE I;  5CVU A;  3KX2 A;  3CUQ B;  4BKX A;  2JA2 A;  3FRQ A;  4NC6 A;  3HOZ J;  1N25 A;  3Q0U A;  2JT1 A;  3SJM A;  3AG2 H;  2HEO A;  4MQ9 F;  4DBR A;  4BUP A;  9ANT A;  4B44 A;  1OCR H;  2DBB A;  4LK0 F;  3UR3 C;  2KJC A;  1FWZ A;  2E2I J;  2FSW A;  3F0C A; 
#chains in the Genus database with same CATH homology
 2FBQ A;  2LFB A;  1UMQ A;  3QPL A;  3BR5 A;  5AQC A;  3HB9 A;  4UUS B;  1A6I A;  5EDN A;  3HGG A;  5EG0 A;  3OOU A;  3S17 J;  3HTJ A;  3VVY A;  3WHB A;  1IC8 A;  2DMP A;  3ON4 A;  1NTC A;  3WHC A;  3B6A A;  1H88 C;  3CWR A;  1BW6 A;  5EGO B;  2R5Z A;  5M5X J;  1MBG A;  3GEU A;  3HOW J;  5M3F J;  1B72 B;  5JLW A;  1U78 A;  5FKM A;  2DG7 A;  3TED A;  5EZH A;  4X1E A;  3DCF A;  1OJL A;  5J1Y A;  3RKQ A;  2JA6 J;  3BR3 A;  2DA7 A;  3BR0 A;  1HDP A;  2YVH A;  2QTQ A;  4W97 A;  3A03 A;  3RD3 A;  1T56 A;  3BG9 A;  2YUS A;  1JUS A;  3HIM A;  2M34 A;  3W6V A;  1JUM A;  1AKH B;  3C07 A;  4S0H B;  1JTX A;  3IH4 A;  5FKL A;  2MW8 A;  3PAS A;  3ZQF A;  4AYB N;  3NI7 A;  4KWA A;  3O8H A;  4MO7 A;  1LFB A;  1BL0 A;  3O8G A;  2G7L A;  3DPJ A;  3BT9 A;  2LVS A;  1Y1V J;  4DW6 A;  2E2J J;  3FK7 A;  3DEW A;  3H3V K;  1FIP A;  4A3C J;  3QBM A;  2ZCX A;  2NX4 A;  5FLM J;  3CCY A;  2QIB A;  2WV1 A;  1XC5 A;  2JMW A;  1JJ8 C;  1YRN B;  5E3O A;  2ID6 A;  5GPC A;  1ZR4 A;  3S2D J;  3VVZ A;  3S5R A;  2EZK A;  5FKO A;  2MSY A;  3GZI A;  3P9T A;  2HYT A;  5F1J A;  5C3E J;  5C4X J;  2LKX A;  2CQX A;  1OFC X;  2V57 A;  2L7F P;  3JR9 A;  5M5W J;  4UUS A;  1O4X A;  3JRF A;  2I10 A;  1HLV A;  4FCY A;  1Q1V A;  5J1U A;  5JLX A;  2DMU A;  2Y0S N;  5K7Z A;  5H9T A;  5FKN A;  3LSR A;  5M3M J;  2L7M P;  1S7E A;  2E19 A;  2FX0 A;  2LP0 A;  1TWH J;  3FIW A;  3I4N J;  4LOC A;  3OSG A;  3LJL A;  2RAS A;  2HKU A;  4HKU A;  4A3L J;  2XGE A;  1I50 J;  3RZO J;  2UXH A;  1RR7 A;  1Z77 A;  1PUF B;  1JKO C;  1RKW A;  3E7L A;  5FHP A;  4M3D A;  3BCG A;  5C4Y A;  5IPA A;  1RES A;  3EUP A;  1F36 A;  4L62 A;  1APL C;  3S2H J;  3TP0 A;  1UG2 A;  1ZKG A;  2EBI A;  4V2G A;  2ZCN A;  1RET A;  3LSG A;  4IHV A;  3ZQI A;  4MXM A;  2HDD A;  2HOT A;  1MBF A;  3BTI A;  2PZ9 A;  3VUQ A;  1AKH A;  2M2E A;  5K7F A;  5J1R A;  2JA7 J;  4RDU A;  3PO2 J;  1RKT A;  2IBD A;  2GUH A;  4EEF G;  5D19 A;  3NNR A;  1POG A;  2Y2Z A;  5F04 A;  4DYC A;  5E3M A;  4Y7N J;  1MSF C;  1IV6 A;  3OSF A;  2QKO A;  1TWF J;  2G0E A;  4JX5 A;  2L7Z A;  3NAU A;  2YU9 J;  2HOS A;  2YVE A;  2COB A;  3VVX A;  4A3M J;  1QPI A;  2XB0 X;  3AQT A;  2CU7 A;  2K9N A;  2JA8 J;  3VW2 A;  3PM1 A;  1RPW A;  3Q3S A;  1GV5 A;  5EEA A;  3GTL J;  1YRN A;  1WI3 A;  3BHQ A;  2JWT A;  2L0K A;  3TP3 A;  2DA3 A;  4IHW A;  3BTL A;  2QOP A;  4ACI A;  5EF6 A;  5D1R A;  3GTP J;  4CYC B;  4XRM A;  2HQ5 A;  4FE7 A;  3UKG A;  2L9R A;  2ECC A;  3SFI A;  3I4M J;  3BR2 A;  2HXI A;  2GFN A;  3ZQL A;  3IH2 A;  3KKC A;  3JRB A;  2Y9Y A;  3CDL A;  3MN2 A;  1MBK A;  5F0F A;  4ABZ A;  2XPW A;  3VOX A;  2VUM J;  4Y52 J;  2R7Z J;  1FTZ A;  3IH3 A;  5F0H A;  2REK A;  3F1B A;  3NRG A;  3A02 A;  3O60 A;  1QVU A;  2DMT A;  1MH4 A;  1PUF A;  2X6O A;  1BJZ A;  1LE8 B;  4XK4 A;  3BG3 A;  1JKQ C;  4QSH A;  3ZQH A;  4QIW N;  1JJ6 C;  1IRZ A;  3KZ9 A;  2GM4 A;  1P7I A;  2JN6 A;  1ETQ A;  2DA2 A;  3Q0V A;  4AUX A;  3RH2 A;  2WGB A;  4A3B J;  2FJ1 A;  2PMZ N;  5DTD A;  3HM5 A;  3NXC A;  2FD5 A;  3HKZ N;  1JKP C;  2Q24 A;  1OCP A;  2R0Q C;  1ITY A;  3B6C A;  1ZGW A;  1AHD P;  1ZTR A;  4XRS A;  2EZI A;  1T33 A;  3LNQ A;  2TCT A;  2WUI A;  4M6V A;  5HSZ A;  1CQT A;  2X48 A;  2NOG A;  2HYJ A;  3HTI A;  1VND A;  3GBG A;  4FE4 A;  4B4C A;  4B1R A;  1WGX A;  3BQY A;  1U8B A;  3GTQ J;  3COL A;  2NS7 A;  1QVT A;  3CMY A;  1E3O C;  2R93 J;  2XGC A;  1WCM J;  3IUV A;  4NDL A;  5E3L A;  3BR6 A;  2O9L A;  3S16 J;  2IAI A;  1H89 C;  1I3Q J;  4M3G A;  1GT0 C;  2H1K A;  2WAQ N;  5GP9 A;  2IEK A;  2GBY A;  1Z0X A;  4JX4 A;  1AU7 A;  4CYC A;  4A93 J;  3HOY J;  3G7R A;  3HTA A;  2LR8 A;  5J3L A;  2ZCM A;  4IEJ A;  5EZG A;  2WB1 N;  1ETY A;  3ON2 A;  3E7Q A;  2KT0 A;  1WH5 A;  1JTY A;  5K58 A;  1ETW A;  3NAR A;  1OCT C;  2ZOY A;  2OER A;  3JRA A;  3JRC A;  3HGY A;  1FIA A;  2NP5 A;  2Y31 A;  1LE8 A;  2DA4 A;  2M8G X;  4NEL A;  3VW1 A;  3CQZ J;  4D7M A;  3VIB A;  1GUU A;  4MFE A;  2VKV A;  3V6G A;  5FGL A;  1IDY A;  3VPR A;  3A01 B;  3S1M J;  2PBX A;  1A5J A;  5F0C A;  2O7T A;  3HEF A;  2NVQ J;  3GTK J;  4JL3 A;  5CXG A;  2CUF A;  2LY9 A;  1HDD C;  5F27 A;  4FIS A;  2HOA A;  2W48 A;  3GTM J;  1BA5 A;  1QRY A;  2JA5 J;  3BTJ A;  3RZD J;  4BY1 J;  3HBL A;  4HNV A;  1G2H A;  5HAW A;  1B8I B;  4MK6 A;  4D5F A;  2ECB A;  4IHY A;  4X6A J;  2CQQ A;  1BW5 A;  4V2F A;  3JRE A;  3C2B A;  2ME6 A;  4JP0 A;  1IUF A;  2ELK A;  1ENH A;  4C3J J;  1JKR C;  1D5Y A;  3TW6 A;  1NK2 P;  1FEX A;  2NP3 A;  2KDZ A;  1EF4 A;  1SGM A;  4XIC A;  3VW0 A;  5C44 J;  4M3B A;  2Y30 A;  4DZP A;  4DYR A;  4GCL A;  1X58 A;  2NVY J;  2MG4 A;  2NVX J;  2ME0 A;  4A3K J;  2E1O A;  4UUT A;  4NN1 A;  1UHS A;  1ZK8 A;  4BY7 J;  3SDG A;  2VI6 A;  1U9O A;  2DG8 A;  1ORK A;  2DA6 A;  3QPS A;  1JUP A;  1X2N A;  2YS9 A;  1MH3 A;  4IHX A;  1MBE A;  2CJJ A;  5IOY A;  4AF5 A;  3TW7 A;  3T6N A;  4GCT A;  4D7N A;  1K61 A;  4M3F A;  3GTJ J;  4MLO A;  2CRG A;  3Q0W A;  3FK6 A;  4DZJ A;  1IDZ A;  1IGN A;  2DN0 A;  3MNL A;  2W53 A;  3BRU A;  1MBJ A;  3G1M A;  1VFC A;  1NK3 P;  1TC3 C;  2P81 A;  3FIS A;  1X2M A;  5D18 A;  1ETK A;  3A01 A;  2ID3 A;  2UXI A;  4D5C A;  1R9T J;  2RAE A;  4QTR A;  1JT6 A;  3HTH A;  2TRT A;  2GLO A;  5F08 A;  1SFO J;  3V78 A;  2LTP A;  4BBS J;  3G56 A;  2LK2 A;  4MFD A;  1WPK A;  2OI8 A;  4A3J J;  1B8I A;  5HBU A;  3K2A A;  3KNW A;  2H8R A;  2X9D A;  3G1L A;  3VOK A;  3LSJ A;  3G1O A;  1LFU P;  2XGD A;  2OF7 A;  3JRG A;  4JYK A;  2D6Y A;  1VI0 A;  2M9H A;  4I6Z A;  4XRS G;  3GTO J;  2HI3 A;  2IU5 A;  2LLK A;  2QWT A;  3JSJ A;  4MIM A;  3MVP A;  4XID A;  4C2M J;  1HF0 A;  3FKI J;  1JGG A;  3QQA A;  2HXO A;  1ZR2 A;  3BTC A;  4GFL A;  1TWG J;  4C3I J;  2R92 J;  4L5E A;  4RBO A;  5IYC J;  2E2H J;  2XRL A;  3B81 A;  3BR1 A;  5FJ8 J;  5IP7 J;  2QCO A;  3LOC A;  2NVT J;  3NPI A;  4UDS A;  1W0U A;  3ZQC A;  1IJW C;  2JJ7 A;  3S1N J;  4AC0 A;  1MBH A;  4W1U A;  5M5Y J;  2M0C A;  4A3E J;  1VF9 A;  2JK3 A;  3K7A J;  1Y1W J;  3BNI A;  3QKX A;  2EZL A;  3CRJ A;  2AHQ A;  2ZB9 A;  2DTZ A;  2DMQ A;  3BQZ A;  1F43 A;  4FTH A;  4A3F J;  1ETV A;  5DAJ A;  3S1Q J;  4G12 A;  3GTG J;  4CGR A;  1UI6 A;  3M4O J;  4GFK A;  2NS8 A;  1K83 J;  2FQ4 A;  5IYB J;  2DJN A;  4A69 C;  3BJB A;  1IG7 A;  4C3H J;  3H0G J;  1FJL A;  1GDT A;  5C4J J;  4AC6 A;  3S14 J;  5IP6 A;  5HOD A;  1I6H J;  4DYQ A;  4BBR J;  2R5Y B;  1H8A C;  2VKE A;  2VPR A;  5DS9 A;  1TWC J;  1JT0 A;  4A3D J;  5IYD J;  4YZE A;  5EFY A;  2MGQ A;  4J19 A;  2G7G A;  3IV5 A;  3JRI A;  1MNM C;  1HCR A;  2F07 A;  3M3Y J;  3AQS A;  4GFB A;  2ZOZ A;  1XS9 A;  3JRD A;  2EQR A;  1SAN A;  1W0T A;  5EGO A;  4ICH A;  2OPT A;  5CW8 A;  5EG0 B;  4JX6 A;  2UXP A;  4JKZ A;  1ETX A;  3D1N I;  1B72 A;  5FLV A;  4B3A A;  2R5Z B;  4JNN A;  2Y9Z A;  2K9Q A;  3HOV J;  3BG5 A;  4A3I J;  1ETO A;  2XPU A;  5CXI A;  3S1R J;  1XG1 A;  2G3B A;  2DA5 A;  2QF7 A;  2B63 J;  3HOU J;  4M3E A;  5FKK A;  3RQI A;  3L1P A;  3CJD A;  3OIO A;  2O8K A;  2G7S A;  2RHA A;  4A3G J;  2LD5 A;  5IOZ A;  3ZQG A;  3EGQ A;  2EZH A;  2O7O A;  3MKL A;  3HE0 A;  3LWJ A;  4BXX J;  5EYR A;  2K9S A;  2EH3 A;  2K40 A;  5BNG A;  3PO3 J;  4ME9 A;  2AO9 A;  1ZQ3 P;  2XB5 A;  2UXO A;  2XSD C;  2D5V A;  2N8G A;  1P7J A;  1DU6 A;  3HDD A;  1HOM A;  2CUE A;  2DA1 A;  1GVD A;  1FTT A;  2XDN A;  3HOX J;  1MSE C;  1GV2 A;  5K7H A;  3ANP A;  3ZOB A;  4GCK A;  3S15 J;  3LSP A;  4PXI A;  1TWA J;  3KKD A;  1WH7 A;  4I76 A;  2R5Y A;  2DMN A;  4BKX A;  1UI5 A;  3FRQ A;  2GEN A;  3HOZ J;  3LHQ A;  3Q0U A;  2XPV A;  3VP5 A;  5FMP A;  3SJM A;  1DU0 A;  5IP9 J;  3JRH A;  9ANT A;  1U9N A;  5E3N A;  2UXU A;  3PPB A;  3ANG A;  2E2I J;  5GPA A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...