3DEWA

The structure of a putative tetr family transcriptional regulator from geobacter sulfurreducens pca.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
b'DCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The structure of a putative TetR family transcriptional regulator from Geobacter sulfurreducens PCA.
rcsb
source organism Geobacter sulfurreducens
molecule tags Transcription regulator
total genus 69
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17938 TetR_C_29 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3dewA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dewA02
4NELA 2K9NA 2O7OA 5D19A 4DW6A 1HCRA 1FTZA 4PXIA 1AKHB 3KNWA 3RH2A 1U8BA 2MSYA 2MW8A 2M0CA 1WPKA 2CU7A 4J19A 5EG0B 5C4YA 2JJ7A 1WCMJ 1ETKA 5FKOA 2WAQN 2NVQJ 3ZQFA 1MSEC 1VI0A 4JX5A 3JRAA 1OCTC 3VVZA 1WH7A 2XSDC 1ORKA 5E3LA 1JGGA 3GTKJ 3JRGA 3VUQA 3KKCA 2DMQA 4DZJA 3JR9A 3BR2A 2HYJA 1IJWC 3S16J 4KWAA 5H9TA 3B6AA 3G1MA 5IYCJ 4B4CA 4DYCA 1B72B 1UMQA 3TP3A 2VI6A 2UXOA 4UUTA 3V6GA 3ANGA 1GT0C 5JLXA 2ZOZA 2YUSA 5FMPA 1QPIA 2ZB9A 4JP0A 4M6VA 3HOZJ 4A3FJ 2YU9J 3BTJA 5FKKA 3NRGA 4MXMA 2HOSA 1PUFA 2QF7A 3CQZJ 3LSJA 1TWHJ 2JA7J 2RAEA 3B81A 1FIPA 3FRQA 2GBYA 1OCPA 5J1YA 5F27A 1I50J 4ABZA 4B3AA 2XB0X 4A3BJ 3NXCA 1ZK8A 1MNMC 3M4OJ 3BJBA 3BQZA 3ZQLA 1JUMA 4MIMA 3BR5A 5IP6A 5IOZA 5D18A 1IDYA 4IHYA 1HOMA 2WV1A 3K2AA 2O8KA 3GTGJ 5C44J 4JL3A 4A3LJ 1I6HJ 3GTOJ 3ZQCA 2DMPA 2GFNA 1Z0XA 2CRGA 4MK6A 1TWAJ 1EF4A 1K83J 1B8IB 1GDTA 4S0HB 1XS9A 3MNLA 2QWTA 1NTCA 1POGA 2XGDA 5FLVA 2R92J 3Q0WA 3CCYA 3LSGA 3G7RA 3LWJA 2ME6A 4JKZA 1F43A 2JA8J 5FKMA 2NVTJ 3Q3SA 2FD5A 3GTLJ 4M3BA 4Y7NJ 3BNIA 2DMTA 1G2HA 2I10A 3RQIA 4UUSA 3OSGA 3LOCA 4V2FA 5AQCA 5J1RA 1JJ6C 5J1UA 5K58A 1YRNA 1Y1VJ 2P81A 1SFOJ 4IHVA 2RASA 3CDLA 3Q0VA 4AC0A 4M3DA 3D1NI 3QPLA 3S14J 4ICHA 5C4JJ 1S7EA 3G1LA 1JKQC 3GTMJ 3GBGA 3LSRA 3PO2J 3G56A 3O8HA 3JRIA 3IH2A 2H1KA 2LK2A 3A02A 2EBIA 2DG7A 1APLC 4X6AJ 2G0EA 3I4NJ 2CQQA 2JK3A 3WHCA 3W6VA 4UDSA 2DA6A 2ID6A 2AO9A 4GCLA 3PPBA 3VW0A 3BG3A 3A01A 2VKVA 2OPTA 2OERA 2XB5A 1GV5A 1MBFA 2XDNA 3KZ9A 2YS9A 3BR1A 4DYRA 3FK7A 2EQRA 2JWTA 2LTPA 1JUPA 4BKXA 1WGXA 3E7LA 3ANPA 2JN6A 2E2IJ 1Y1WJ 1JT6A 2M8GX 3QKXA 4LOCA 3VPRA 2E1OA 2GENA 3VOKA 3NARA 3HTAA 1ETQA 1T33A 1P7JA 2HXIA 3S1MJ 5CXIA 1TWGJ 5F0CA 3S1QJ 1I3QJ 2ZCNA 1FIAA 1X2MA 3HTJA 5EGOB 4RDUA 1IC8A 1XC5A 2Y9ZA 2QTQA 2LY9A 4L5EA 5GP9A 2EZKA 2NP5A 5C4XJ 3ZOBA 2NP3A 5FLMJ 3Q0UA 1MSFC 4FISA 2MGQA 3QBMA 1W0UA 1NK2P 3DEWA 2XPUA 5K7HA 1IG7A 2R5YA 1SANA 2CJJA 1MH3A 3BTCA 2DJNA 3COLA 1X2NA 4AYBN 3S15J 5C3EJ 2ZOYA 5M3MJ 4D7NA 1RETA 2QCOA 1ZGWA 3O8GA 1LE8A 2NVYJ 1MH4A 2VKEA 2EZIA 3H0GJ 2UXPA 2DA7A 3PO3J 2IAIA 3PM1A 4DYQA 3CJDA 1HDDC 3HOXJ 4XRMA 3VIBA 5HSZA 2DN0A 3DPJA 5FHPA 2M34A 2AHQA 2YVEA 1VF9A 1W0TA 2W48A 3P9TA 2K9SA 2HKUA 1FTTA 3F0CA 4A3IJ 4BY7J 3H3VK 1U78A 3MKLA 2COBA 2X9DA 4RBOA 3HGGA 3IH3A 4JX4A 5HODA 1LFBA 3BG9A 4G12A 4MLOA 5IP7J 2R5ZB 5CXGA 1XG1A 4W97A 2MG4A 1FEXA 2FQ4A 3JRBA 2Y9YA 3HBLA 2N8GA 3BHQA 4D5FA 3BR0A 2HOAA 5FKNA 5JLWA 2NOGA 5M5WJ 2LLKA 4A69C 5EEAA 1ZQ3P 4CYCA 5J3LA 5IYDJ 2EZLA 4A3DJ 2IBDA 4YZEA 1GUUA 1MBGA 3L1PA 2FBQA 2O7TA 2ZCMA 3RZOJ 2ELKA 3CRJA 1H88C 3F1BA 2RHAA 1JUSA 1JKPC 3SFIA 3BRUA 2G3BA 1ZR2A 2E2JJ 5M5YJ 3HOWJ 3NNRA 1DU6A 3QPSA 1AKHA 5DAJA 5DS9A 1IDZA 5GPCA 3CMYA 4GCTA 1MBEA 4X1EA 5EG0A 1ENHA 4D5CA 4AC6A 2HDDA 4NN1A 2G7SA 2DA1A 4GFLA 1RR7A 1U9OA 3BCGA 2CUEA 1GVDA 2HI3A 5EF6A 3CWRA 3ON2A 5K7FA 4XRSG 4IHWA 4V2GA 4JNNA 3V78A 4M3FA 3LSPA 1SGMA 4A3GJ 4D7MA 3C2BA 1HLVA 2VUMJ 1A5JA 3RKQA 2LR8A 1X58A 2L7ZA 5FJ8J 3JRHA 3O60A 3HEFA 5EZGA 4EEFG 3BTIA 3HDDA 1ZR4A 1BJZA 2NS8A 2XPVA 2F07A 4FTHA 2M2EA 1PUFB 3HOYJ 4C3JJ 2L0KA 2L9RA 1IRZA 1B72A 2X48A 3HE0A 5F04A 2DA2A 3GTPJ 2G7GA 4ME9A 2D5VA 4GFKA 3JRFA 4MO7A 4Y52J 2L7MP 3G1OA 1TC3C 3E7QA 2IEKA 1MBHA 3ON4A 1BW5A 3HGYA 2NVXJ 3C07A 3GEUA 3IUVA 3HKZN 2R0QC 3IV5A 4JYKA 5EYRA 2Y2ZA 5GPAA 3VW2A 5M3FJ 1OJLA 2JMWA 3VW1A 1UI6A 4NDLA 2HOTA 1RPWA 1O4XA 3ZQIA 3S2HJ 3BT9A 2PMZN 4FE7A 4BBSJ 3BG5A 4IEJA 3VOXA 5EFYA 2LVSA 5IOYA 2R93J 2QOPA 2OF7A 2HQ5A 4XIDA 1ETXA 1ETWA 3TP0A 3JRDA 4M3EA 4AUXA 1RKWA 1TWFJ 2K9QA 5HBUA 2L7FP 3HTHA 4BXXJ 3KKDA 3VP5A 3HOVJ 4UUSB 2NS7A 2ME0A 1VFCA 1JKOC 2ZCXA 2XGEA 3MN2A 3NI7A 1YRNB 1UG2A 2CUFA 2IU5A 2Y30A 1B8IA 2DA5A 2REKA 5F0HA 5F0FA 1GV2A 4L62A 4M3GA 3NAUA 2K40A 5IYBJ 4GFBA 2E2HJ 4I6ZA 1BW6A 3HM5A 4CGRA 1AHDP 3SJMA 2XPWA 4QSHA 3A03A 2JA5J 3BR6A 1Z77A 4ACIA 1ZTRA 1TWCJ 3JRCA 2GM4A 1JT0A 3M3YJ 2GLOA 3OOUA 3WHBA 4B1RA 3UKGA 3A01B 5K7ZA 3JREA 1ETVA 1K61A 2DG8A 2FX0A 2OI8A 1H89C 1QVTA 9ANTA 3IH4A 5E3MA 1HDPA 1IV6A 2LKXA 1A6IA 1D5YA 5D1RA 1RESA 3FIWA 5E3NA 3BQYA 5FKLA 1U9NA 3TW6A 1R9TJ 2WUIA 3VVYA 1QVUA 1NK3P 4QIWN 1WI3A 5HAWA 5BNGA 4BBRJ 2ECBA 4C3IJ 2DMUA 1JJ8C 2Q24A 2UXUA 1OFCX 2V57A 1ITYA 2DTZA 3LJLA 1E3OC 4XK4A 2M9HA 3TEDA 3LHQA 3GTJJ 5FGLA 4HNVA 2XRLA 3RD3A 2B63J 1Q1VA 3FK6A 3AQTA 4QTRA 3EUPA 3GTQJ 1JTYA 3HIMA 3S1RJ 1T56A 3NPIA 2YVHA 4I76A 2JA6J 4DZPA 2LFBA 3DCFA 1RKTA 2PZ9A 3S5RA 4A93J 2LD5A 4IHXA 1QRYA 5EZHA 1BL0A 4C3HJ 2O9LA 1P7IA 2R5YB 4A3EJ 2H8RA 2NX4A 3GZIA 1ETOA 5IPAA 5EGOA 2UXHA 1UI5A 1F36A 3FKIJ 5F08A 2LP0A 1MBKA 1LE8B 3T6NA 5DTDA 4XICA 3S2DJ 1UHSA 2HYTA 1FJLA 1JTXA 3B6CA 4A3KJ 2DA4A 5M5XJ 5F1JA 2EZHA 2Y0SN 1VNDA 1MBJA 4C2MJ 2EH3A 2VPRA 3K7AJ 3MVPA 5E3OA 2TCTA 3ZQHA 4FE4A 2WB1N 3SDGA 3TW7A 4XRSA 2XGCA 2DMNA 3FISA 2D6YA 1BA5A 3QQAA 3S17J 4JX6A 3HOUJ 5CW8A 2R7ZJ 3I4MJ 1ETYA 4MFDA 3VVXA 2WGBA 3BR3A 2CQXA 3OSFA 3HTIA 3EGQA 4FCYA 1WH5A 1JKRC 3AQSA 2ID3A 4AF5A 2GUHA 4BY1J 5EDNA 3LNQA 2UXIA 2X6OA 3OIOA 2DA3A 2Y31A 1IGNA 2PBXA 4A3JJ 1IUFA 2KT0A 2G7LA 4CYCB 2FJ1A 1CQTA 4A3CJ 3JSJA 4HKUA 1H8AC 4GCKA 3ZQGA 4MFEA 2QIBA 1HF0A 5IP9J 1AU7A 2W53A 2KDZA 2ECCA 4W1UA 2TRTA 3RZDJ 1LFUP 3PASA 2E19A 2HXOA 1DU0A 3S1NJ 3HB9A 4A3MJ 2R5ZA 1ZKGA 3BTLA 2QKOA
chains in the Genus database with same CATH superfamily
4UUVA 2O7OA 4DW6A 4KN7X 3RH2A 1IZ1A 4AYBA 4XKCA 1U8BA 2M0CA 2ACJA 1VQ7I 1YG2A 1T2KA 2VC1A 5JI6A 1N75A 3PUBA 4BL0B 2YPRA 5DEQA 4R8HA 3CUQA 4M72A 1LUJB 1ERDA 3BP8A 4BJ5C 1YLFA 2NVQJ 1UB9A 2LSOA 4OAZA 4AM3A 1ONVA 3JRAA 1B59A 1V54H 1OCTC 3VVZA 2GXAA 2XSDC 3JRGA 4A6DA 3VUQA 3KKCA 2DMQA 4DZJA 2XC7A 1SD4A 1L3LA 5JHUA 5K5QA 2OA4A 4PFOA 3VDXA 3R6SA 3TDZC 1K4SA 3RYRA 2FA5A 4HA8A 5IYCJ 4DYCA 3TP3A 2VI6A 4UUTA 2OV7A 1VQ9I 1F1ZA 2BVLA 3V6GA 2FSWA 2RDPA 1DUXC 1BOBA 1U5TC 2IS1A 5JLXA 4WXHA 5FMPA 1BIBA 1QPIA 4A12A 3H5NA 4L5IA 3FBIB 2JT1A 4ENKA 5TJJA 3DPLC 2DJIA 2L9VA 3HSFA 1E3PA 1KU2A 3B81A 2RAEA 4HF1A 2EINH 5CQGA 3FRQA 2V79A 5J1YA 3LA3A 1DGRM 5FD5A 1I50J 4B3AA 4A3BJ 2DW4A 3MKYB 3CC7I 1MNMC 3M4OJ 2K85A 1IRXA 3BQZA 3ZQLA 5IOZA 4YIRX 3H3ZA 4ZDOA 2M87A 2JZYA 1F5TA 3GFLA 1I6HJ 3F72A 4BU2A 1VQMI 1RC9A 1EF4A 4Z6YA 4CO8A 3G73A 3NQOA 3MNLA 2E7XA 1R58A 1FLIA 4LG0A 5FLVA 1U3EM 1KONA 3F23A 2WB1A 2ME6A 3H9GA 2L9NA 2A6EF 4BJ6C 3RJPA 3H9QA 3Q3SA 4YEJA 4M6XA 3HC7A 4C2TA 2V9KA 3BNIA 4UXNA 1YHQI 4S05A 4MEXF 4UUSA 2OD5A 3O6BB 2LKSA 3ABMH 3OS2A 2ZJQF 5J1UA 4XOPA 1W7PD 1YRNA 2P81A 3IWZA 3Q0VA 3HKZA 1TQPA 5J8FA 3QPLA 5CVJA 4PGGA 2JTVA 4ICHA 3G56A 4CICA 3GBGA 3V7SA 1YX5A 2ZXIA 3O8HA 3IH2A 2HDCA 2EBIA 5L3GA 4XNFA 5E8IA 4X6AJ 2PMZA 5HLTA 2O0YA 3FHZA 3KP2A 1T98A 1H9GA 3MD2A 2A3SA 3BJOA 2PFBA 1VTNC 2V1UA 4UDSA 2ID6A 3PPBA 1T8IA 3A01A 5B1BH 2OPTA 3VFZA 2A61A 2W00A 5LHGA 1MBFA 4OMYA 4KN4X 3OYAA 2YS9A 2L3DA 1FMWA 1BOAA 2PLYA 4HYEA 1GLNA 4CCMA 1JUPA 4RAGA 4HSRA 2Y0MA 1WZ2A 3N4MA 4NC6A 1P2FA 3K2ZA 4EM1A 3VPRA 2P0WA 2EB7A 1J2XA 3E0JB 4QLCU 3NARA 1FOKA 2X0LA 4OU0A 3HTAA 2IA2A 2ESHA 4CA0A 2CYYA 3WTSC 3FM3A 3ZMZA 2Q1ZB 1JGSA 1TWGJ 3S1QJ 1I3QJ 1X2MA 2QBYA 3WU2C 2OQGA 2Z99A 4RDUA 2VOOA 3JW4A 2VQHA 3D5RC 2IGKA 1N77A 4I0AA 3ZOBA 2L4AA 2ZSIB 3S93A 1MSFC 4KIBA 3SDBA 4KDPA 1H9TA 1ZLJA 2V6CA 1NK2P 2HYFA 5CVUA 1MMAA 1PVEA 4RMNA 3JSOA 2KJBA 5K7HA 2VONA 3ABUA 1RUNA 3BTCA 2DJNA 4Q48A 3COLA 3DBRB 3QPHA 2XAJA 3S15J 1TP4A 1ZGAA 1SMTA 2PG4A 4FASD 1RETA 2V26A 1KYWA 1LE8A 2NVYJ 2HZDA 3H0GJ 4EJOA 2AXTC 4E7SA 2VC0A 2BYVE 4DYQA 4YFKF 3CJDA 4NC7A 3J7ZI 3W3CA 4KIFA 4EMSA 2KHMA 1MJ9A 1R00A 3A1YA 5E20A 2K3PA 3OYFA 3KZIC 3ASOH 3CCEI 1W0TA 2HQNA 2O6GE 3H35A 4PDKA 3KP5A 3DXJF 3DP7A 2M7AA 3HGGA 3EQLF 1ON1A 2EFPA 2BHYA 5KAIC 2QKMB 1Z91A 3E3VA 4DIQA 2HOEA 4W97A 2MG4A 2OUMA 1SMYF 4IZZA 2KFDA 4XLFA 2Z3YA 4HX4A 2CW0F 5FKNA 1HKTA 3W6KB 3RSNA 1ZQ3P 2EZLA 3BPVA 2WA0A 5KK1A 4LG3A 2IVMA 1MW7A 2CW7A 2HYGD 1WHUA 1H88C 2V1NA 1JUSA 1JKPC 4HRIA 2GZWA 3LQRA 3F21A 1FSHA 2HVSA 3DTKA 3ONQA 1UJ8A 2JUCA 1AKHA 4UHTA 1LDJA 1IDZA 2R7TA 1P4AA 5DCMB 4X1EA 2DFEA 4B8XA 4AC6A 2HDDA 3KEOA 2DA1A 4BEHB 1U9OA 5LD2C 4ZYHA 2HI3A 3ON2A 4XRSG 4IHWA 4GRIA 4BAYA 3V78A 1B9NA 5ILVA 1DQUA 3HHGA 4J00A 4A3GJ 2PX9A 2L02A 2QA4I 3FM5A 2QZ8A 2L7ZA 2VT3A 5EZGA 4E7LA 1XCBA 2QENA 1ACIA 3HOYJ 1RI7A 2X48A 2WTEA 3HE0A 1LJ9A 2VL8A 5H2FC 2FUG2 1HC8A 2DA2A 5K5RA 4ENJA 2NOJB 4GFKA 5CVVA 4MO7A 3CTAA 4Y52J 3E7QA 2QEXI 1KU7A 4UV8A 3RI4A 3WGIA 4Y17A 2K86A 1JHHA 3RPQA 1S7AA 3SQNA 4HV6A 4P1WA 3FHNA 3C2HA 4LFUA 3WG9A 5M3FJ 4BQOA 2ISZA 1UI6A 4G9YA 1HSTA 2E60A 3ZQIA 4HQEA 2GWRA 2X1EA 4LLGF 4BBSJ 4IEJA 3NWTA 1X1DA 2X6YA 2R93J 2WV0A 1KQ9A 1ETXA 1M1EB 2K4JA 3HSEA 4XSXF 3BOQA 4WWCA 4AUXA 1GXQA 2MA3A 3DTEA 1HXDA 2HKOA 2K9QA 4RGUA 2L7FP 3HTHA 5DM6F 1DP7P 3VSKA 4A0YA 2WY8Q 1F9NA 3F8MA 2IA0A 3ML6A 4YIIA 2P5VA 2RREA 2YR2A 4BJTA 1TW2A 4Q4ZF 2REKA 2DA5A 1W36D 2ZMEC 3WTXC 3VODA 1P4WA 1GV2A 3ZMTA 2ISYA 4LJZF 3E6CC 4HF0A 4HSTA 5IYBJ 4GFBA 4ESJA 2OU2A 1YJ9I 2EV0A 5HNHA 2LNBA 2G7UA 2E35A 2IGNA 2D1HA 4DNCA 4L9VA 1Z77A 3BJ6A 2DU9A 2V9PA 4PGHA 1IF1A 2Z5UA 3UKGA 5F1RA 3JREA 1K61A 3M7GA 1NH3A 4XKWA 2OI8A 4HF2A 1MMNA 2LKXA 5J8CA 1D5YA 3R0JA 1OR7C 5D1RA 2L54A 3U9GA 2DT5A 5BOXA 3OIQA 3BQYA 4A2UA 2EV6A 5FFZA 1CF7A 3G4SI 5FB2A 2CQ7A 1NK3P 1WI3A 3H1CA 4BBRJ 4UB6C 2ECBA 2DMUA 3ECHA 2UXUA 1U5TA 3M8EA 4A6EA 4XK4A 1VQNI 2M9HA 2MC3A 2YU3A 3GX4X 1HKSA 3AG4H 3OWTA 3GTJJ 1R71A 4L9NA 4GXOA 1Q1VA 3OOPA 1DPRA 1MJBA 3EUPA 3LSMA 3P9IA 3OR1C 1YOVB 3TOAA 1JTYA 1V3FA 3DFGA 3HIMA 4BGDA 1X1CA 4A5MA 2YVHA 3ZN0A 4AVZA 2LFBA 3SZPA 3DCFA 1D8KA 2UZKA 1FZPB 3CJRB 2VT2A 2FU4A 2KRFA 2F5DA 3BG6A 1D8JA 2V4JC 4C3HJ 2WADA 5ED4A 1P7IA 2R4GA 3GWZA 2E1MB 1TQIA 4BDYA 1ETOA 3M1CA 1R22A 3SFZA 5IPAA 4U7DA 2UXHA 4PJLA 4IPAA 1UI5A 2ZFWA 4ESBA 2LP0A 1MBKA 2X4HA 1LVKA 3T6NA 4IKFA 3IWFA 1QNTA 2Z2SB 2BBYA 1A36A 2HFHA 2IXSA 1VNDA 4YFXF 3HOSA 1MBJA 1XMXA 4IO9F 2EH3A 3ZMVA 2K9LA 2VQLA 4I2OA 1XGOA 2DK8A 3PNVA 4XSZF 2TCTA 4CCJA 3NRVA 5FFXA 1Z6TA 3QQAA 4Q47A 3TO9A 3ABTA 4MFDA 2RNJA 5B3SH 3OSFA 4HW0A 4FCYA 3A4CA 3W2VA 4KNYA 4AF5A 2W4SA 4LK0F 1DPUA 2BXZA 4BHPA 5D8LB 1X3ZB 3VOEA 2UXIA 4B47A 4EV0A 4MHGA 1AOYA 4NNJA 3F3XA 3J7AO 5E18F 1WI9A 4A3CJ 2CWEA 1UZCA 1HF0A 2KDZA 5FO5A 4W1UA 1TLHB 4NQWB 1YJWI 3FMSA 3HRTA 2K5CA 5CKTA 1UHMA 1RRJA 2HXOA 1DU0A 3HB9A 1FX7A 4BE0A 4I99C 4O6JA 4RAYA 2XAGA 2KRCA 3BTLA 2DA4A 3GMEA 1O7LA 4EJWA 4HEA2 4RB0A 2K9NA 3WGHA 2QSHX 4OAYA 1U0JA 4G8XA 1YE9A 1ZG1A 3I53A 2QLZA 1WPKA 2CU7A 2NVUB 5CPRB 2Y48A 3W6JB 2PMUA 2XAHA 4MEYF 2VLAA 2F4IA 3L2RA 2WAQN 3BLYA 3HXLA 3VSLA 4YRVA 1YJNI 5FRNA 2XKPA 3ZQFA 3NEUA 2R7VA 2RN7A 3GFJA 2CUJA 1OMIA 2GOXB 2FMYA 3DLAA 2NXNB 1Y56A 2HYJA 3HUGB 3BDDA 1YW9A 5TRDA 2MLKA 1CGPA 2P4WA 4KWAA 5H9TA 3G1MA 4B4CA 1B72B 2K3FA 4NUBA 2HVQA 4HX8A 3CJQB 3GUDA 3FXLA 3ANGA 3R4KA 3FXRA 1GT0C 3M8JA 4M6VA 2DDBA 5CYVA 2F6CA 3QOEA 4EQQA 2XUBA 3BTJA 2MD5A 4BUPA 4BXFA 1MZBA 1VZ0A 3NRGA 3PSIA 2RQQA 3OYDA 5HDKA 1PUFA 3CQZJ 3FX3A 4WIBA 4HPQA 5FRMA 1FIPA 4H0EA 2QSGX 4D9JA 2GBYA 2A5WA 1OCPA 3KCCA 4OD5A 5HLIA 2PMHA 3V7CA 3IP4B 2XB0X 2DDAA 1RNLA 3NXCA 2JA2A 1B1BA 2BW3A 2O03A 1OISA 5L3EA 4MIMA 5IP6A 3FKJA 5ERIA 3DPTA 2FF4A 3QYEA 2BY3A 3QU3A 1UHWA 1NHAA 4IHYA 1TBXA 3GTGJ 3Q9VA 5C44J 3KEQA 3K4BA 4JL3A 4UV9A 1IO2A 2HKXA 2KISA 2X1CA 4UVCA 3GTOJ 3JAMK 2GFNA 4KFCA 2CRGA 3IC7A 3QP6A 3GYHX 1FWZA 2MD0A 2GA1A 4BYYA 4S0HB 3KETA 1XS9A 2QWTA 2AQEA 3QOPA 2OCCH 4XL9A 3LSGA 3G7RA 3T8TA 3LWJA 4JKZA 4O5VA 1F43A 4OIPF 4I98B 1MNEA 2VASA 3TL4X 2MLGA 3AKZA 2FD5A 1G8XA 1S29A 3F8CA 3GTLJ 2K4BA 3OYHA 3E1SA 2I10A 3RPUD 2BV6A 4A5NA 3LOCA 3I5UA 5K58A 2EFOA 2ELHA 2E5NA 5LRRA 2DODA 4XLCA 3CDLA 3ABLH 4AC0A 3I3LA 2CV0A 5C4JJ 5AIPA 3JRIA 1GXPA 3D5LA 3PNYA 2LK2A 2DG7A 1QQIA 5B66C 5FD6A 1I1GA 1LDDA 2QSFX 2CQQA 2XV4S 1W36C 2BVMA 2HPMA 4XLEA 1XMAA 2DA6A 2FE3A 3VW0A 3BG3A 2FBHA 1EV7A 2VKVA 1D1BA 4EATA 1V55H 3BR1A 4DYRA 2H94A 3FK7A 3GFIA 2IW5A 5TGTA 2R7SA 2K02A 1K78A 3K8PC 2JWTA 2LTPA 1WJAA 1Y8RB 3DEUA 4ZTFA 1SD7A 3RYPA 2DQRA 5DUIA 4HAMA 3KLNA 3S32A 3GO5A 2IS6A 4M71A 3VOKA 4RB2C 3HTUA 1T33A 1D3YA 4ESFA 2OCEA 5CXIA 1B6AA 2ZCNA 3L7WA 2DXIA 1FIAA 2KLOA 3LA7A 4UVAA 1LVAA 5EGOB 4CGZA 3HTJA 2F48A 2H6CA 2E1MC 2Y9ZA 1PUEE 4U9LA 2LY9A 4DGWB 4G94A 2EZKA 5CLSA 2QUFA 3MCZA 3P9CA 3Q0UA 1YIJI 2MGQA 4P55A 4XLNF 3MKWB 3IRQA 3VYSB 1RZ4A 2RV8A 1ON2A 5CVRA 5H20A 2F5FA 4EM2A 1SANA 3WTVC 5BPIA 2LKPA 2Q2EA 2DQLA 1X2NA 4AYBN 4DBRA 4ZDLA 2GXGA 3K0LA 1ZGWA 2E1NA 4QWQA 4XMYA 1MH4A 1XGSA 2EA4A 5KCMA 4IRHA 2NNNA 1HDDC 1A31A 3HOXJ 1BR2A 4L18B 1A6QA 4WX9A 2M34A 3S3NA 2KP6A 5A2QZ 3OYBA 1VF9A 1YW8A 3OYGA 4CZZA 2ZMEA 3RKYA 1NG7A 2W48A 1FTTA 2RQPA 3F0CA 2EIMH 1T39A 3S3MA 3KP6A 3EYIA 1SD5A 2STWA 2CH0A 3MKLA 1ZG3A 2X9DA 1BN5A 5L3BA 4G12A 4HBLA 4MLOA 4EJUA 3MFKA 2R5ZB 2AXLA 3QPTA 3OY9A 2N8GA 1STZA 4D5FA 4WCGA 3BHQA 1QGPA 1D0YA 2VQCA 3PUFA 3L2WA 2LLKA 4KJZA 4RGXA 1YQAA 1R4NB 5EEHA 1Y39A 1S8NA 1FNNA 3CUQB 4M74A 1KYZA 3F1BA 4OMZA 3ASNH 2RHAA 1W7PA 2E2JJ 5M5YJ 3NNRA 1DU6A 2M8EA 3LFUA 5LHIA 2ZJRF 3CD6I 3QPSA 1T95A 1ULYA 4OIQF 2JPCA 5DAJA 3WTUC 1KA8A 3GLLA 4H4KC 3CMYA 1MNDA 1BI1A 2HEOA 5EG0A 1I6XA 1XTAA 5DDGA 4NN1A 2G7SA 2Y69H 4UB8C 4GFLA 3BCGA 3CWRA 5EF6A 5LLQA 5FROA 3F22A 3DKXA 4V2GA 1K7AA 4M3FA 3LSPA 3ZMUA 4KYWA 3BCAA 2VXZA 2BY2A 4MNUA 2QGUA 1BM9A 2F4MB 5EEGA 3JRHA 4BE1A 2B3WA 3HEFA 4EEFG 4XLPF 1ZR4A 2XPVA 2CS3A 2NS8A 3IHUA 5A2QK 2R7RA 1IV8A 1OCZH 2R7OA 1G3WA 4C3JJ 1IRZA 3HHHA 3T0YA 2Q8KA 4I7HA 1OYYA 4KA4A 3DF8A 3OYMA 3BZ6A 4AIKA 2IEKA 1MDMA 3I64A 3ON4A 4L9JA 1XD7A 4F7ZA 1QU3A 3K10A 2W1OA 4RA2A 1BW5A 2NVXJ 2EPFA 5GTIC 3IUVA 3HKZN 2R0QC 4JYKA 2XAFA 3IL2A 1OJLA 4A0XA 5LEKA 1SFKA 3CDHA 3LSHA 3IKVA 1FOXA 1T08B 1R1TA 3S2HJ 2PMZN 3I59A 4LG0B 5IOYA 2QOPA 5D6FA 1R5GA 2OF7A 4IQ4A 1ETWA 1OCOH 3TP0A 3NS4A 3SWHA 5HVQC 3SYTA 1MMGA 3I56I 1FYLA 1QZYA 4IHTA 2YSRA 4BXXJ 3EETA 1G3TA 4OINF 3VP5A 1WQ2A 4UUSB 2NS7A 5H6QA 2ME0A 6PAXA 4BH9A 2XGEA 3NI7A 1YTYA 1YRNB 1VQ4I 1UG2A 2CUFA 5HS7A 2Y30A 3QODA 1B8IA 2J5PA 2X6XA 1ODDA 1LEBA 5F0FA 2MBFA 2LBFA 4M3GA 1GVJA 1SFXA 3T1BA 1R1VA 2W24A 4GCVA 2E2HJ 2DBBA 3U21A 2LF8A 4KICA 4OD4A 2XPWA 4U88A 1IN7A 4E4HA 2JA5J 1O3TA 3CP2A 3BR6A 2CFXA 1IXCA 3A01B 5K7ZA 2H6BA 3RIRA 1ETVA 5HOOA 1S7OA 3HPGA 4RLQA 1Y8QB 1QVTA 1FYMA 5E3MA 3CLQA 9ANTA 1A6IA 2VBWA 3MZ8A 3OS0A 3FIWA 2VKHA 5E3NA 2DYSH 2XROA 2OTLI 2OQRA 3LL7A 1LDKB 3DPUA 2DOAA 3TW6A 1ZRCA 3VVYA 3CF5F 4ZYAA 4B3XA 2HS5A 4C3IJ 2Q24A 1ITYA 2DTZA 4BQAA 5J4VA 4CSWA 3IAS2 1WJBA 3LJLA 4UVBA 3HPHA 3LHQA 2ETHA 4M9SA 2QBYB 4HNVA 5JFRA 3RD3A 1X1BA 5D8KB 3FK6A 3BC8A 3AQTA 4QTRA 3K4MA 4XORA 4DBQA 4AD9A 4PJ0C 1K4TA 5FLXK 2JA6J 2W57A 4HV5A 2KRHA 3HL2A 1XCVA 1Z1DA 2J5OA 4L0ZB 3FBNB 3FXJA 3BG7A 4P5OA 3IKTA 3CCJI 4IHXA 2HZTA 3VWBA 2O9LA 1BR4A 1JI8A 4GDFA 3F9KA 3T8RA 2KQRA 2NX4A 3GZIA 1D1AA 2GOMA 4G7OF 3OL3A 3MAJA 3H5RA 4XLHA 4B44A 1LE8B 2E1CA 5E79C 5DTDA 3S2DJ 1UHSA 4LGWA 2HYTA 3CJNA 3B6CA 3E5XA 4BHBA 4E70A 4A3KJ 2QWWA 5M5XJ 2EZHA 2Y0SN 1UG0A 2D45A 3TGNA 2PJRA 1OCCH 3L09A 3U1DA 5DYMA 2HU9A 5L3FA 5E3OA 4FE4A 2R7FA 3SDGA 1FBUA 2ZO4A 5AIQA 4LLLA 3SHFA 2NAZA 4CCKA 2IRFG 1Z7UA 3HOUJ 1VQ8I 2R7ZJ 3I4MJ 1ETYA 3VVXA 1UCRA 2ZCWA 4MTEA 2WGBA 3BR3A 2CQXA 1AWCA 3AG3H 4KIGA 1WH5A 5ILSA 1JKRC 2EIJH 2ID3A 1TTYA 4M6YA 3TO7A 3ZCOA 4BY1J 4AIHA 2BEOA 3KFWX 1R5ID 2EFWA 2BZTA 2WWYA 2L01A 4AWXB 4LMYA 5BQTA 2PBXA 4A3JJ 1X4OA 2I8DA 4HKUA 1CQTA 4GCKA 1J9IA 3ROUA 2W53A 2VKDA 3MZHA 2ECCA 3RZDJ 3PASA 3PNTA 4V19K 3E6BA 2UXNA 2LC2A 3CUQC 5B5EC 3OS1A 3GW2A 5HSZA 4NELA 2O8XA 5E1ZB 1ZAOA 1HCRA 1FTZA 2BGCA 3K4JA 4XBFA 1AKHB 3KNWA 2GQQA 3H9JA 4J19A 1LNWA 1XGMA 3C1DA 3ESWB 3CCRI 5C4YA 3DWLE 2JJ7A 1WCMJ 1ETKA 1T0FA 4CDGA 4QPOA 1BJAA 2UWMA 4C2MA 1Z67A 1MD0A 4HLYA 1S9HA 4BXUA 3BPXA 1SVOA 1MSEC 1USTA 1VI0A 2A6TA 2G9WA 4JX5A 2B0LA 4L9TA 5IY5H 1Z3YA 5D5VB 3GTKJ 4Q5SF 4PFPA 2COMA 3B02A 2HR3A 2QYOA 3JR9A 2LH9A 2ZXWH 3BR2A 2MABA 1IJWC 2FQ3A 1O3SA 3S16J 2XF7A 3SXYA 1UMQA 3PQJA 2UXOA 2GIZA 3LQQA 2DK5A 3DTIA 2DCEA 4G7ZF 2ZOZA 4JBAA 5DV5A 2A05A 2ZB9A 3TQNA 4JP0A 4GYIA 2L4MA 3CCSI 1OYWA 3R0AA 3HOZJ 2G7HA 5HDGA 1LB2A 4A3FJ 3Q5FA 2YU9J 4IRVA 2IGMA 5FKKA 3VTIA 4IXAA 1KU9A 2H27A 4MXMA 3K4NA 3UNGC 4ZYGA 2HOSA 2QF7A 3LSJA 1TWHJ 2JA7J 1S3JA 4HNUA 4JQFA 1FP1D 2JSPA 2FOWA 1J7KA 4IX7A 5F27A 2XGXA 3ZGKA 2UXXA 4GYGA 3X2QH 3D0SA 3I9V2 3BJBA 3GF2A 2X85A 4NC8A 2DOEA 5HDNA 1MMDA 1QZEA 1JUMA 2Z16A 3ZMSA 4BNCA 2DLLA 2VPLA 1IDYA 4NBQA 2L9SA 5HNFA 2WV1A 1HOMA 4M9ZA 2RGVA 4XKBA 1BI0A 1V5EA 1VQ6I 3MWMA 4U7BA 3ZQCA 2DMPA 3I4PA 3MMYB 1Z0XA 3ULQB 4MK6A 1SD6A 3E5UA 4AIDA 1GDTA 2R7UA 4N9HA 3I54A 2K9MA 2XGDA 2R92J 4IRGA 2KJCA 3CCYA 2NS0A 2V1DA 3KP4A 3QYBA 3WGGA 1YITI 3OYKA 3AL0B 3TBIA 3PIOF 2NVTJ 1EH7A 3PFIA 4M3BA 4HOBA 5GAHJ 3ZXSA 4Y7NJ 1G2HA 2X51A 3RQIA 4U0YA 3OSGA 2BE5F 1VQ5I 5AQCA 2BY1A 4IHVA 2RASA 2JVHA 1SFOJ 1ZG5A 3OYCA 2CV2A 1USSA 3KX2A 4F92B 1S7EA 1X1AA 3BWGA 3GTMJ 3QWLA 2CW8A 2VBXA 2H1KA 2ZNYA 3A02A 3HIFA 2L2OA 2K7LA 1APLC 1CF7B 2G0EA 1XPXA 3I4NJ 2JK3A 4CCLA 3WHCA 5FGMA 4F55A 3LAJA 3W6VA 3TDUC 1O3QA 1U5TB 4GCLA 4LB5A 2OERA 3ZRGA 5JVTA 1GV5A 2XDNA 2WAEA 1MKMA 1I27A 4LLNA 1W5SA 3OR2C 4ZZLA 2F5CA 2WC2A 1R4MB 3GZ6A 1WFXA 1FOWA 1WGXA 3E7LA 1IUYA 3ANPA 2F5VA 2PFVA 1Y1WJ 2RC4A 3QKXA 2UV1A 2E1OA 3AFHA 4C2UA 3MZYA 2GENA 3ABKH 3K69A 1P7JA 3JAMZ 3FMRA 1W4MA 2R7XA 1IC8A 1O57A 5IT9Z 1XC5A 1P92A 3CMMA 3GEZA 4L5EA 2H09A 2LOOA 2NP5A 5ICFA 3EUHC 5FLMJ 2NP3A 2QKOA 1A35A 3HRMA 4FISA 3QBMA 1XSDA 4Z2YA 1G6NA 2XPUA 3GCMA 2RVCA 3F8FA 2R5YA 2CJJA 4Y4RA 3H36A 2QQBA 3EPZA 3WTWC 1FP2A 1Z9CA 3I0TA 5C3EJ 2CO5A 5M3MJ 3I71A 1PP8F 3O8GA 2VKEA 2DA7A 4N4OB 3PO3J 4XN0A 5E1XA 1IN4A 4ZDPA 3M9AA 2P6TA 5JHFA 3DPJA 3RQ4A 4I02A 2GAUA 3EDPA 1D0ZA 4E7IA 1S5LC 2A6HF 2JUGA 3PJRA 3P9TA 3HTSB 5HLHA 1U8RA 4QPQA 4A3IJ 4BY7J 1IRGA 1KQ8A 1U78A 1FBQA 2FBKA 4KT5C 4II3A 2COBA 4RBOA 2UUZA 3IH3A 4JX4A 1LFBA 4KUMA 1L0OC 5CXGA 3S2WA 2FQ4A 3JRBA 2Z9OA 1FT9A 3HBLA 4IOAF 2O61A 2QVOA 2HOAA 1FBSA 4XKVA 1FMVA 3U2RA 5JLWA 1MIJA 2LMDA 2NOGA 4WXCA 4Y3OA 4CYCA 5J3LA 2IBDA 2WBMA 3OIPA 1K6YA 1Q1HA 1XDSA 5IT9K 2FBQA 1PP7U 2O7TA 2M5WA 3RZOJ 4RAFA 2ZCMA 3OL4A 3RPUA 4CYDA 3DLLF 3G6EI 3WTYC 1JHFA 1ZR2A 4ZZDA 3O2PE 3HRSA 1YS7A 4I0BA 4LIUA 2P8TA 3K4LA 3H0DA 3M8FA 3L2UA 5GPCA 1YYVA 2O5RA 3HRUA 1RUOA 5LGNA 2WAFA 4D5CA 2VJIA 2JSCA 1MJAA 2OZUA 1RR7A 2D1VA 4ITVA 1HW2A 4KMUX 2A5YB 1WKMA 1SFEA 4BDZA 2MH9A 1OQYA 3JSPA 1HLVA 2VUMJ 1A5JA 3RKQA 2I5UA 2LR8A 5ICGA 3CMAI 4XOTA 5FJ8J 1XMKA 2EWNA 4C30A 1OKRA 1D5VA 4MQVA 4HNTA 2EK5A 3MEXA 4FTHA 2M2EA 3KZYA 1PUFB 3CMEI 2L0KA 2ZNZA 2L9RA 1HKQA 1X3UA 3RTRA 2Y75A 5DD4A 2G7GA 5CQEA 4ASNA 3JRFA 1HA8A 3G1OA 3KEYA 3HJEA 5CJ9A 1MBHA 2KZVA 2LDUA 2BW3B 3KLOA 1J5YA 5GTHC 1MGTA 1X1PA 1YO5C 5L3DA 4KMFA 3L9FA 4JK1X 2IS2A 4DVYP 2XF6A 3S8PA 1JE8A 4N4NB 3IV5A 5EYRA 1FOYA 3F6VA 2Y2ZA 5GPAA 4NHJA 1REPC 1BC7C 1SVMA 2JMWA 3R61A 1RR8C 1ZREA 4B09A 4NDLA 4ZYEA 2HOTA 1RPWA 3SEQA 1J09A 1D1CA 1O4XA 1I5ZA 3BT9A 4PSXA 4RB3C 3BG5A 2TDXA 1HBXG 3N97A 1R49A 2HQ5A 3JRDA 2VJ4A 2ESNA 4M3EA 4N9IA 2ZY9A 1A04A 2LRDA 4JOMA 5D5XB 3AL0C 3G3ZA 3VB2A 5CVIA 3J81K 3HOVJ 1ZN2A 5AONA 3IAM2 3CP8A 4XRFA 1E0EA 4U87A 1VFCA 1JKOC 2ZCXA 1QA6A 3S3OA 2C6YA 2P5LC 1Z21A 1XB4A 3AG2H 4CHUA 3ECOA 3BZKA 3NAUA 2DFFA 2BXYA 3D5SC 3WG7H 2M45A 1ZARA 4CGRA 1AHDP 3SJMA 4QSHA 1EA3A 1R1UA 4ACIA 1ZTRA 3JRCA 1R36A 3GZNB 2GM4A 4KISA 3M3YJ 1V5FA 2LYCA 2GLOA 3OYNA 3WHBA 1I39A 2HNHA 3DBHB 4B1RA 4RB1A 2FX0A 3K70D 1R6RA 3CCVI 5E17F 1YIOA 2KDOA 3C3WA 4CH7A 1YFHA 3GVAA 1K78B 2FMLA 1SVLA 1R7JA 5DUKA 5FKLA 1R9TJ 2CMPA 4D1QA 1QVUA 4RS8A 4FHTA 5HAWA 2JRTA 1P6RA 2F4OB 1EH6A 4FT8A 1U2WA 4BQNA 3I55I 2V57A 2LY1A 2ZC2A 3IRRA 1E3OC 2ZJ2A 2QQAA 2NRAC 3TEDA 4PK4A 3J80K 4IQJA 2F2EA 1FY7A 5FGLA 1OR7A 3BY6A 4ZTJA 2ADUA 2VE8A 3FMQA 3TKYA 4ZJZA 3GTQJ 4R79A 3COAC 4ANJA 3S1RJ 3FF5A 1T56A 4XR6A 3NPIA 2A07F 2Q0OA 1RKTA 2PZ9A 3S5RA 4A93J 3CCUI 1XN7A 4IJAA 2LD5A 1BBYA 2GXBA 2XHKA 4RGRA 1TT0A 1BL0A 4FETA 5J47A 1B4AA 5KHDA 4A3EJ 2H8RA 4KT6A 2Q2EB 3L2VA 2L5QA 3LMMA 2OAZA 4G6DA 3FKIJ 5F08A 2XF5A 2DPDA 1WJ5A 1JTXA 5LGUA 1I3AA 3A2KA 2IPQX 1H0MA 3RKXA 1G59A 4B43A 1PYVA 2E7WA 2YX7A 3MVPA 3A0BC 3FXQA 3ZQHA 2WB1N 1SC7A 3L2QA 3TW7A 2IS4A 2XGCA 2LREA 2ZMEB 2DMNA 3E5QA 1OPCA 3S17J 2HGCA 4JX6A 1LFPA 2VIXA 1QBJA 5CW8A 4NB5A 4O3MA 4Y13A 5J40A 2PBIA 2FEZA 1RIOH 5K1YA 2X1DA 3EYYA 2XAUA 3DEEA 1Y0NA 1PDNC 5LHHA 3A0HC 5EDNA 1WJEA 4RGSA 4P9UA 3LNQA 2DI3A 2CUZA 2DA3A 2Y31A 3FXOA 1IGNA 4B48A 1IUFA 1X19A 3DU5A 5DD8A 4IOCF 3DKWA 3JSJA 4F93B 3KP7A 3ZQGA 2QIBA 2M30A 5IP9J 1AU7A 3P9KA 2QKLB 1G3YA 1LQ1A 4PJJA 3H3UA 3V8JA 4U0VA 1LFUP 1FPQA 4E7JA 3S1NJ 1W7PB 3FXMA 1B9MA 1HSJA 3TMOA 5D19A 2STTA 2R7WA 5FLXZ 5ICEA 4PXIA 2MSYA 2MW8A 5H6RA 3K1MA 2NNYA 4PZJA 1ZHFA 2GIVA 2PJPA 5EG0B 3CDIA 4IL6C 2V9VA 3KIOA 1FYKA 3FXKA 2E5ZA 5FKOA 3SEZA 2DPUA 4YG2F 4M73A 3KP3A 1WJFA 4PUSA 4E7ZA 1QZZA 1WH7A 1ORKA 5E3LA 3DBLB 3U1KA 1JGGA 1X4PA 1P9QC 2HTJA 4XM3A 4IF4A 2DTRA 3T5XA 3MQ0A 5BPDA 4UY8I 2XIGA 1BC8C 1OCRH 2VBZA 3TO6A 2Z1DA 3VYTB 5DCMA 1K79A 1GHCA 2EV5A 3B6AA 1IN8A 1Z6RA 4BEHA 3DKYA 4KITB 3ZPLA 3H5AA 5K5OA 2P5KA 3EUHA 1MDMB 2YUSA 3FZVA 1W1WE 4I01A 3CO6C 3CF2A 5BS6A 1TW3A 3M1EA 2KIQA 3KYLA 3CC2I 4YELA 5D6EA 1WJDA 2MC4A 1DDNA 3K9TA 2KKOA 3E6MA 3PSFA 1WJCA 3I58A 3EUAA 3FWEA 4P9FA 3GFMA 3MKZA 3F6OA 2FXAA 4WXDA 3LAPA 4ABZA 2EIKH 3I59B 3SZTA 1YI2I 1ZK8A 1S6LA 3GLXA 3UR3C 5D4SA 1TT5B 1E2XA 4LB6B 3CCMI 3CCLI 2EFQA 4IVNA 4J01A 3BR5A 2RNGA 1XGNA 4GGGA 2XVCA 3WE3A 5D18A 1QPMA 4E6KG 4YFNF 4M9XA 3K2AA 2O8KA 4GO1A 2EA2A 2PI0A 5D5WB 4A3LJ 2OZ6A 2P7CB 4D0PA 4RLFA 2VN2A 1SEUA 4P96A 3AAFA 3QAHA 4L0YB 1TWAJ 1K83J 4HZFA 2Y0SA 3QRFF 1B8IB 1R23A 3KE2A 2KL4A 2W85A 1NTCA 2MFZA 3CC4I 1POGA 2A69F 1TZLA 2LBFB 3IUOA 3Q0WA 2E71A 1QHHD 3WU0A 5LBQA 2JA8J 5FKMA 3ZQQA 2KPMA 2DMTA 4LIVA 1EH8A 5HS9A 4OIRF 5BMZA 3ZQ7A 2H8WA 3N05A 4V2FA 2RKHA 5J1RA 1JJ6C 1T38A 3OV8A 1Y1VJ 2M3AA 4XONA 2DT6A 4M3DA 3D1NI 3LSTA 3S14J 3G1LA 1JKQC 3PO2J 2ZBKA 3LSRA 2W82A 2M7BA 3KYDB 3ZMDA 3B73A 1ZRFA 3V42A 4FX4A 3JTHA 2P6SA 2AO9A 4EM0B 4PJMA 3ZR8X 4G6TB 4G7HF 1YX3A 4XQFA 3M07A 3PIPF 2XB5A 2HTSA 1J0RA 1JXSA 2XAQA 3KZ9A 1UFMA 2CFOA 2DYRH 5HLGA 3WE2A 3AG1H 2EQRA 4BKXA 1QHGA 2DFIA 2WY7Q 3DQVC 3E97A 3SZGA 2JN6A 2E2IJ 4EJTA 1JT6A 2M8GX 2M4GA 4HLXA 4ZYDA 3VYRB 4LOCA 3K70C 1SAUA 3WTZA 1BR1A 1N25A 1Y6IA 1XSXA 2LF7A 2P7VB 1ETQA 5HS8A 2QQ8A 4LD5A 2HXIA 3S1MJ 5LRSA 1O7FA 5F0CA 2VE9A 5E8GA 3TOBA 2V1XA 3KYCB 4F91B 3OYJA 1SFUA 2CV1A 2QTQA 1T6SA 5GP9A 2FNAA 4F3QA 5C4XJ 2ZXHA 1D0XA 3K4KA 2LY2A 4E7HA 4ON0A 2OC6A 2PJRB 2A2FX 1EKEA 1W0UA 3F8NA 4LITA 3DEWA 4AIJA 1IG7A 2JRMA 2VBYA 3DU6A 1MH3A 4A0ZA 1WSUA 1KU3A 2CQNA 2VXDA 2ZOYA 4D7NA 2QCOA 3ISPA 2XKOA 2B1EA 2EZIA 3CCQI 2M0MA 2UXPA 3QYFA 2IAIA 3PM1A 4DQ2A 2B9SA 4XRMA 3VIBA 2DN0A 3PFYA 4EVIA 5FHPA 1XDUA 2AHQA 5F64A 5GAEJ 2YVEA 2F5EA 2LG4A 2FBIA 2W84A 2K9SA 3P5JA 4RM2A 5B1AH 2HKUA 1G3SA 2MH2A 3H3VK 3HG9A 4AVPA 4TV7A 4HX7A 5HODA 3BG9A 4FQGA 5IP7J 1XG1A 2HWVA 4XN3A 1FEXA 2X6WA 2Y9YA 3J7AY 3CZ6A 4RM3A 5J6XA 1U6GA 3JTGA 2ZJPF 4IHSA 3BR0A 2W7NA 3QU6A 2W25A 5M5WJ 4A69C 5EEAA 3G71I 1ZH5A 2BOLA 5IYDJ 4A3DJ 4YZEA 1GUUA 4PSWA 3DV8A 1VQPI 1HQCA 1MBGA 3J7YJ 2L7KA 3L1PA 3CRJA 1E3HA 4NQWA 2ELKA 3ERMA 1XX5A 4EGYA 2XASA 2MYSA 1IRFA 3SFIA 1P4XA 3BRUA 2G3BA 1X3WB 3QP5A 2CGPA 1IXRC 1ZRDA 3HOWJ 1IN5A 1YS6A 2OBPA 4HG2A 3OYLA 2QM3A 3LWFA 3KPHA 2ZXJA 1EJ9A 4U0WA 2YX4A 3K1NA 5DS9A 4F52A 2FNPA 1ZLKA 4GCTA 1Z3XA 3ZP5A 1MBEA 5JVGF 3H92A 1ENHA 3HYIA 2KIUA 4C9YA 4BE2A 1LKXA 3K4CA 1AA7A 2CUEA 1GVDA 3HOTA 5K7FA 3NWSA 3REOA 1HW5A 4JNNA 1SGMA 2VOPA 2ZSHB 4D7MA 3C2BA 3LSIA 1J59A 4MQ9F 2BHZA 3V4GA 1X58A 2HVRA 1VQOI 1BIAA 4II2A 4ETSA 4HDVA 2IT0A 3O60A 4OWRB 3HUGA 3BTIA 3HDDA 1BJZA 1ZGJA 2KIMA 3G2BA 1WVRA 5LFAA 2F07A 1W5TA 5D5UB 4EJVA 5GADJ 1B72A 5DCFA 3CO7C 5F04A 4LK1F 1Y0UA 3RDIA 5ICCA 3ERED 3GTPJ 4ME9A 4U9NA 2D5VA 4CXFA 3OYIA 3GXOA 2XRNA 2L7MP 4WK8F 1TC3C 2YVXA 1WWXA 4ZC3A 5JR3A 2R3SA 2V6EA 1OLTA 4DJAA 2IP2A 4CCNA 4UNOA 3HGYA 3LA2A 3L00A 4K2EA 3C07A 1IW7F 1OYIA 1IAWA 3GEUA 2AS5F 2WAQA 3BROA 2B7EA 1C0WA 5D4RA 4X0GA 3VW2A 2EJRA 2GA2A 3VW1A 1HW1A 4ZH4F 1G4DA 1UAAA 4L5JA 2VODA 2ICWG 3VEPA 2KIFA 4BACA 4FE7A 3KZZA 3CLOA 5DM7F 4R1HA 3HZJA 5EFYA 3VOXA 2LVSA 2HPIA 4XIDA 2BY0A 2R7QA 4CZCA 3F8BA 3JCUC 2HDWA 4HDUA 3R60A 4ENNA 1RKWA 1TWFJ 5HBUA 1KGSA 4WF2A 3KKDA 3GZ5A 2K27A 3WU1B 5IT3A 1R5HA 2XDVA 3WODF 4BQQA 4AU7A 1Z05A 3MN2A 3PQKA 1IN6A 2IU5A 3FDYA 2VB6A 4MTDA 5ILUA 5F0HA 5LEJA 3C7JA 2E36A 5KNLA 4L62A 2EFNA 3BCBA 3ELKA 3OMYA 2K40A 5KAFC 1E17A 1DP3A 4I6ZA 1BW6A 1IXSB 3HM5A 1J75A 3VYUB 1FSEA 3ZN1A 4HQMA 1MMSA 4ENMA 3A03A 3P7NA 5J4YA 1O3RA 2IJLA 1TL8A 1TWCJ 5EJCA 2FRHA 2ZFUA 1JT0A 2IA1A 3OOUA 3FXUA 1ZELA 3RCOA 2Z33A 2DG8A 2DOFA 1H89C 3IH4A 1HDPA 1IV6A 1BI3A 2HQRA 2DO7A 4YIFA 1N78A 1LEAA 1RESA 1WRJA 1K6OA 1S72I 2AQFA 5E1WA 2DAOA 1TNTA 1U9NA 2OJED 2WUIA 4XLAA 2CG4A 3K6GA 4QIWN 2FJI1 5BNGA 4CCOA 1JJ8C 1QO0D 2CQKA 2H1LA 2O3FA 3W2AA 1OFCX 2ZKZA 3EUKL 1ZYRF 3CESA 2VJJA 1KZHA 1NG6A 2XRLA 2B63J 4BS9A 2A68F 1Z7LA 1BI2A 4E7KA 2JVGA 2M1BA 4G6QA 4S04A 3Q9SA 3CUOA 1SAXA 3LFKA 1I1SA 3RKWA 4I76A 2R7DA 4DZPA 1KQ0A 1F4KA 3WTTC 4FX0A 4OIOF 1VQKI 2CSOA 5F6FA 1QRYA 5EZHA 3J81Z 4PJNA 2R5YB 2DFHA 1YW7A 2KZGA 5TISC 4OOIA 5EGOA 2DT7B 1VQLI 1XSVA 1F36A 4Y33A 4Y15A 1W5CC 4IRIA 2ELJA 5L3CA 1PJRA 4XICA 2QQ9A 1V5GA 5KVRA 1FJLA 3C18A 5F1JA 2OTJI 2XSJC 2V7FA 4RAZA 4BHCA 4C2MJ 2VPRA 3W2WA 3K7AJ 5GAGJ 2VJ5A 4MGRA 4XRSA 2IGOA 4I09A 3FISA 2PEXA 1BA5A 2D6YA 4PCQA 2HQAA 1TQMA 3HTIA 3EGQA 3C2GA 1TNSA 3AQSA 2FOKA 2KMUA 1UELB 1LPQA 2GUHA 3E6DA 2JQ7A 3OYEA 1V4RA 2X6OA 5LGTA 3OIOA 3K1PA 4EGZA 3PL8A 2M4KA 2KT0A 3BZCA 2G7LA 3V8LA 2FJ1A 2PN6A 3HSRA 4CYCB 1H8AC 4MFEA 1DGWY 2VQGA 4DOZA 4N0BA 2JPBA 2TRTA 2NYXA 2D2WA 2E34A 2E19A 3L2CA 4CUGA 3O3KA 3J80Z 3V8KA 3BJAA 2PQ8A 1T0FC 3CJTB 3LSKA 4A3MJ 1FC3A 3V7RA 2R5ZA 1ZKGA 2EILH
chains in the Genus database with same CATH topology
4NELA 2K9NA 2O7OA 5D19A 4DW6A 1HCRA 1FTZA 4PXIA 1AKHB 3KNWA 3RH2A 1U8BA 2MSYA 2MW8A 2M0CA 1WPKA 2CU7A 4J19A 5EG0B 5C4YA 2JJ7A 1WCMJ 1ETKA 5FKOA 2WAQN 2NVQJ 3ZQFA 1MSEC 1VI0A 4JX5A 3JRAA 1OCTC 3VVZA 1WH7A 2XSDC 1ORKA 5E3LA 1JGGA 3GTKJ 3JRGA 3VUQA 3KKCA 2DMQA 4DZJA 3JR9A 3BR2A 2HYJA 1IJWC 3S16J 4KWAA 5H9TA 3B6AA 3G1MA 5IYCJ 4B4CA 4DYCA 1B72B 1UMQA 3TP3A 2VI6A 2UXOA 4UUTA 3V6GA 3ANGA 1GT0C 5JLXA 2ZOZA 2YUSA 5FMPA 1QPIA 2ZB9A 4JP0A 4M6VA 3HOZJ 4A3FJ 2YU9J 3BTJA 5FKKA 3NRGA 4MXMA 2HOSA 1PUFA 2QF7A 3CQZJ 3LSJA 1TWHJ 2JA7J 2RAEA 3B81A 1FIPA 3FRQA 2GBYA 1OCPA 5J1YA 5F27A 1I50J 4ABZA 4B3AA 2XB0X 4A3BJ 3NXCA 1ZK8A 1MNMC 3M4OJ 3BJBA 3BQZA 3ZQLA 1JUMA 4MIMA 3BR5A 5IP6A 5IOZA 5D18A 1IDYA 4IHYA 1HOMA 2WV1A 3K2AA 2O8KA 3GTGJ 5C44J 4JL3A 4A3LJ 1I6HJ 3GTOJ 3ZQCA 2DMPA 2GFNA 1Z0XA 2CRGA 4MK6A 1TWAJ 1EF4A 1K83J 1B8IB 1GDTA 4S0HB 1XS9A 3MNLA 2QWTA 1NTCA 1POGA 2XGDA 5FLVA 2R92J 3Q0WA 3CCYA 3LSGA 3G7RA 3LWJA 2ME6A 4JKZA 1F43A 2JA8J 5FKMA 2NVTJ 3Q3SA 2FD5A 3GTLJ 4M3BA 4Y7NJ 3BNIA 2DMTA 1G2HA 2I10A 3RQIA 4UUSA 3OSGA 3LOCA 4V2FA 5AQCA 5J1RA 1JJ6C 5J1UA 5K58A 1YRNA 1Y1VJ 2P81A 1SFOJ 4IHVA 2RASA 3CDLA 3Q0VA 4AC0A 4M3DA 3D1NI 3QPLA 3S14J 4ICHA 5C4JJ 1S7EA 3G1LA 1JKQC 3GTMJ 3GBGA 3LSRA 3PO2J 3G56A 3O8HA 3JRIA 3IH2A 2H1KA 2LK2A 3A02A 2EBIA 2DG7A 1APLC 4X6AJ 2G0EA 3I4NJ 2CQQA 2JK3A 3WHCA 3W6VA 4UDSA 2DA6A 2ID6A 2AO9A 4GCLA 3PPBA 3VW0A 3BG3A 3A01A 2VKVA 2OPTA 2OERA 2XB5A 1GV5A 1MBFA 2XDNA 3KZ9A 2YS9A 3BR1A 4DYRA 3FK7A 2EQRA 2JWTA 2LTPA 1JUPA 4BKXA 1WGXA 3E7LA 3ANPA 2JN6A 2E2IJ 1Y1WJ 1JT6A 2M8GX 3QKXA 4LOCA 3VPRA 2E1OA 2GENA 3VOKA 3NARA 3HTAA 1ETQA 1T33A 1P7JA 2HXIA 3S1MJ 5CXIA 1TWGJ 5F0CA 3S1QJ 1I3QJ 2ZCNA 1FIAA 1X2MA 3HTJA 5EGOB 4RDUA 1IC8A 1XC5A 2Y9ZA 2QTQA 2LY9A 4L5EA 5GP9A 2EZKA 2NP5A 5C4XJ 3ZOBA 2NP3A 5FLMJ 3Q0UA 1MSFC 4FISA 2MGQA 3QBMA 1W0UA 1NK2P 3DEWA 2XPUA 5K7HA 1IG7A 2R5YA 1SANA 2CJJA 1MH3A 3BTCA 2DJNA 3COLA 1X2NA 4AYBN 3S15J 5C3EJ 2ZOYA 5M3MJ 4D7NA 1RETA 2QCOA 1ZGWA 3O8GA 1LE8A 2NVYJ 1MH4A 2VKEA 2EZIA 3H0GJ 2UXPA 2DA7A 3PO3J 2IAIA 3PM1A 4DYQA 3CJDA 1HDDC 3HOXJ 4XRMA 3VIBA 5HSZA 2DN0A 3DPJA 5FHPA 2M34A 2AHQA 2YVEA 1VF9A 1W0TA 2W48A 3P9TA 2K9SA 2HKUA 1FTTA 3F0CA 4A3IJ 4BY7J 3H3VK 1U78A 3MKLA 2COBA 2X9DA 4RBOA 3HGGA 3IH3A 4JX4A 5HODA 1LFBA 3BG9A 4G12A 4MLOA 5IP7J 2R5ZB 5CXGA 1XG1A 4W97A 2MG4A 1FEXA 2FQ4A 3JRBA 2Y9YA 3HBLA 2N8GA 3BHQA 4D5FA 3BR0A 2HOAA 5FKNA 5JLWA 2NOGA 5M5WJ 2LLKA 4A69C 5EEAA 1ZQ3P 4CYCA 5J3LA 5IYDJ 2EZLA 4A3DJ 2IBDA 4YZEA 1GUUA 1MBGA 3L1PA 2FBQA 2O7TA 2ZCMA 3RZOJ 2ELKA 3CRJA 1H88C 3F1BA 2RHAA 1JUSA 1JKPC 3SFIA 3BRUA 2G3BA 1ZR2A 2E2JJ 5M5YJ 3HOWJ 3NNRA 1DU6A 3QPSA 1AKHA 5DAJA 5DS9A 1IDZA 5GPCA 3CMYA 4GCTA 1MBEA 4X1EA 5EG0A 1ENHA 4D5CA 4AC6A 2HDDA 4NN1A 2G7SA 2DA1A 4GFLA 1RR7A 1U9OA 3BCGA 2CUEA 1GVDA 2HI3A 5EF6A 3CWRA 3ON2A 5K7FA 4XRSG 4IHWA 4V2GA 4JNNA 3V78A 4M3FA 3LSPA 1SGMA 4A3GJ 4D7MA 3C2BA 1HLVA 2VUMJ 1A5JA 3RKQA 2LR8A 1X58A 2L7ZA 5FJ8J 3JRHA 3O60A 3HEFA 5EZGA 4EEFG 3BTIA 3HDDA 1ZR4A 1BJZA 2NS8A 2XPVA 2F07A 4FTHA 2M2EA 1PUFB 3HOYJ 4C3JJ 2L0KA 2L9RA 1IRZA 1B72A 2X48A 3HE0A 5F04A 2DA2A 3GTPJ 2G7GA 4ME9A 2D5VA 4GFKA 3JRFA 4MO7A 4Y52J 2L7MP 3G1OA 1TC3C 3E7QA 2IEKA 1MBHA 3ON4A 1BW5A 3HGYA 2NVXJ 3C07A 3GEUA 3IUVA 3HKZN 2R0QC 3IV5A 4JYKA 5EYRA 2Y2ZA 5GPAA 3VW2A 5M3FJ 1OJLA 2JMWA 3VW1A 1UI6A 4NDLA 2HOTA 1RPWA 1O4XA 3ZQIA 3S2HJ 3BT9A 2PMZN 4FE7A 4BBSJ 3BG5A 4IEJA 3VOXA 5EFYA 2LVSA 5IOYA 2R93J 2QOPA 2OF7A 2HQ5A 4XIDA 1ETXA 1ETWA 3TP0A 3JRDA 4M3EA 4AUXA 1RKWA 1TWFJ 2K9QA 5HBUA 2L7FP 3HTHA 4BXXJ 3KKDA 3VP5A 3HOVJ 4UUSB 2NS7A 2ME0A 1VFCA 1JKOC 2ZCXA 2XGEA 3MN2A 3NI7A 1YRNB 1UG2A 2CUFA 2IU5A 2Y30A 1B8IA 2DA5A 2REKA 5F0HA 5F0FA 1GV2A 4L62A 4M3GA 3NAUA 2K40A 5IYBJ 4GFBA 2E2HJ 4I6ZA 1BW6A 3HM5A 4CGRA 1AHDP 3SJMA 2XPWA 4QSHA 3A03A 2JA5J 3BR6A 1Z77A 4ACIA 1ZTRA 1TWCJ 3JRCA 2GM4A 1JT0A 3M3YJ 2GLOA 3OOUA 3WHBA 4B1RA 3UKGA 3A01B 5K7ZA 3JREA 1ETVA 1K61A 2DG8A 2FX0A 2OI8A 1H89C 1QVTA 9ANTA 3IH4A 5E3MA 1HDPA 1IV6A 2LKXA 1A6IA 1D5YA 5D1RA 1RESA 3FIWA 5E3NA 3BQYA 5FKLA 1U9NA 3TW6A 1R9TJ 2WUIA 3VVYA 1QVUA 1NK3P 4QIWN 1WI3A 5HAWA 5BNGA 4BBRJ 2ECBA 4C3IJ 2DMUA 1JJ8C 2Q24A 2UXUA 1OFCX 2V57A 1ITYA 2DTZA 3LJLA 1E3OC 4XK4A 2M9HA 3TEDA 3LHQA 3GTJJ 5FGLA 4HNVA 2XRLA 3RD3A 2B63J 1Q1VA 3FK6A 3AQTA 4QTRA 3EUPA 3GTQJ 1JTYA 3HIMA 3S1RJ 1T56A 3NPIA 2YVHA 4I76A 2JA6J 4DZPA 2LFBA 3DCFA 1RKTA 2PZ9A 3S5RA 4A93J 2LD5A 4IHXA 1QRYA 5EZHA 1BL0A 4C3HJ 2O9LA 1P7IA 2R5YB 4A3EJ 2H8RA 2NX4A 3GZIA 1ETOA 5IPAA 5EGOA 2UXHA 1UI5A 1F36A 3FKIJ 5F08A 2LP0A 1MBKA 1LE8B 3T6NA 5DTDA 4XICA 3S2DJ 1UHSA 2HYTA 1FJLA 1JTXA 3B6CA 4A3KJ 2DA4A 5M5XJ 5F1JA 2EZHA 2Y0SN 1VNDA 1MBJA 4C2MJ 2EH3A 2VPRA 3K7AJ 3MVPA 5E3OA 2TCTA 3ZQHA 4FE4A 2WB1N 3SDGA 3TW7A 4XRSA 2XGCA 2DMNA 3FISA 2D6YA 1BA5A 3QQAA 3S17J 4JX6A 3HOUJ 5CW8A 2R7ZJ 3I4MJ 1ETYA 4MFDA 3VVXA 2WGBA 3BR3A 2CQXA 3OSFA 3HTIA 3EGQA 4FCYA 1WH5A 1JKRC 3AQSA 2ID3A 4AF5A 2GUHA 4BY1J 5EDNA 3LNQA 2UXIA 2X6OA 3OIOA 2DA3A 2Y31A 1IGNA 2PBXA 4A3JJ 1IUFA 2KT0A 2G7LA 4CYCB 2FJ1A 1CQTA 4A3CJ 3JSJA 4HKUA 1H8AC 4GCKA 3ZQGA 4MFEA 2QIBA 1HF0A 5IP9J 1AU7A 2W53A 2KDZA 2ECCA 4W1UA 2TRTA 3RZDJ 1LFUP 3PASA 2E19A 2HXOA 1DU0A 3S1NJ 3HB9A 4A3MJ 2R5ZA 1ZKGA 3BTLA 2QKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEL A;  2K9N A;  2O7O A;  5D19 A;  4DW6 A;  1HCR A;  1FTZ A;  4PXI A;  1AKH B;  3KNW A;  3RH2 A;  1U8B A;  2MSY A;  2MW8 A;  2M0C A;  1WPK A;  2CU7 A;  4J19 A;  5EG0 B;  5C4Y A;  2JJ7 A;  1WCM J;  1ETK A;  5FKO A;  2WAQ N;  2NVQ J;  3ZQF A;  1MSE C;  1VI0 A;  4JX5 A;  3JRA A;  1OCT C;  3VVZ A;  1WH7 A;  2XSD C;  1ORK A;  5E3L A;  1JGG A;  3GTK J;  3JRG A;  3VUQ A;  3KKC A;  2DMQ A;  4DZJ A;  3JR9 A;  3BR2 A;  2HYJ A;  1IJW C;  3S16 J;  4KWA A;  5H9T A;  3B6A A;  3G1M A;  5IYC J;  4B4C A;  4DYC A;  1B72 B;  1UMQ A;  3TP3 A;  2VI6 A;  2UXO A;  4UUT A;  3V6G A;  3ANG A;  1GT0 C;  5JLX A;  2ZOZ A;  2YUS A;  5FMP A;  1QPI A;  2ZB9 A;  4JP0 A;  4M6V A;  3HOZ J;  4A3F J;  2YU9 J;  3BTJ A;  5FKK A;  3NRG A;  4MXM A;  2HOS A;  1PUF A;  2QF7 A;  3CQZ J;  3LSJ A;  1TWH J;  2JA7 J;  2RAE A;  3B81 A;  1FIP A;  3FRQ A;  2GBY A;  1OCP A;  5J1Y A;  5F27 A;  1I50 J;  4ABZ A;  4B3A A;  2XB0 X;  4A3B J;  3NXC A;  1ZK8 A;  1MNM C;  3M4O J;  3BJB A;  3BQZ A;  3ZQL A;  1JUM A;  4MIM A;  3BR5 A;  5IP6 A;  5IOZ A;  5D18 A;  1IDY A;  4IHY A;  1HOM A;  2WV1 A;  3K2A A;  2O8K A;  3GTG J;  5C44 J;  4JL3 A;  4A3L J;  1I6H J;  3GTO J;  3ZQC A;  2DMP A;  2GFN A;  1Z0X A;  2CRG A;  4MK6 A;  1TWA J;  1EF4 A;  1K83 J;  1B8I B;  1GDT A;  4S0H B;  1XS9 A;  3MNL A;  2QWT A;  1NTC A;  1POG A;  2XGD A;  5FLV A;  2R92 J;  3Q0W A;  3CCY A;  3LSG A;  3G7R A;  3LWJ A;  2ME6 A;  4JKZ A;  1F43 A;  2JA8 J;  5FKM A;  2NVT J;  3Q3S A;  2FD5 A;  3GTL J;  4M3B A;  4Y7N J;  3BNI A;  2DMT A;  1G2H A;  2I10 A;  3RQI A;  4UUS A;  3OSG A;  3LOC A;  4V2F A;  5AQC A;  5J1R A;  1JJ6 C;  5J1U A;  5K58 A;  1YRN A;  1Y1V J;  2P81 A;  1SFO J;  4IHV A;  2RAS A;  3CDL A;  3Q0V A;  4AC0 A;  4M3D A;  3D1N I;  3QPL A;  3S14 J;  4ICH A;  5C4J J;  1S7E A;  3G1L A;  1JKQ C;  3GTM J;  3GBG A;  3LSR A;  3PO2 J;  3G56 A;  3O8H A;  3JRI A;  3IH2 A;  2H1K A;  2LK2 A;  3A02 A;  2EBI A;  2DG7 A;  1APL C;  4X6A J;  2G0E A;  3I4N J;  2CQQ A;  2JK3 A;  3WHC A;  3W6V A;  4UDS A;  2DA6 A;  2ID6 A;  2AO9 A;  4GCL A;  3PPB A;  3VW0 A;  3BG3 A;  3A01 A;  2VKV A;  2OPT A;  2OER A;  2XB5 A;  1GV5 A;  1MBF A;  2XDN A;  3KZ9 A;  2YS9 A;  3BR1 A;  4DYR A;  3FK7 A;  2EQR A;  2JWT A;  2LTP A;  1JUP A;  4BKX A;  1WGX A;  3E7L A;  3ANP A;  2JN6 A;  2E2I J;  1Y1W J;  1JT6 A;  2M8G X;  3QKX A;  4LOC A;  3VPR A;  2E1O A;  2GEN A;  3VOK A;  3NAR A;  3HTA A;  1ETQ A;  1T33 A;  1P7J A;  2HXI A;  3S1M J;  5CXI A;  1TWG J;  5F0C A;  3S1Q J;  1I3Q J;  2ZCN A;  1FIA A;  1X2M A;  3HTJ A;  5EGO B;  4RDU A;  1IC8 A;  1XC5 A;  2Y9Z A;  2QTQ A;  2LY9 A;  4L5E A;  5GP9 A;  2EZK A;  2NP5 A;  5C4X J;  3ZOB A;  2NP3 A;  5FLM J;  3Q0U A;  1MSF C;  4FIS A;  2MGQ A;  3QBM A;  1W0U A;  1NK2 P;  3DEW A;  2XPU A;  5K7H A;  1IG7 A;  2R5Y A;  1SAN A;  2CJJ A;  1MH3 A;  3BTC A;  2DJN A;  3COL A;  1X2N A;  4AYB N;  3S15 J;  5C3E J;  2ZOY A;  5M3M J;  4D7N A;  1RET A;  2QCO A;  1ZGW A;  3O8G A;  1LE8 A;  2NVY J;  1MH4 A;  2VKE A;  2EZI A;  3H0G J;  2UXP A;  2DA7 A;  3PO3 J;  2IAI A;  3PM1 A;  4DYQ A;  3CJD A;  1HDD C;  3HOX J;  4XRM A;  3VIB A;  5HSZ A;  2DN0 A;  3DPJ A;  5FHP A;  2M34 A;  2AHQ A;  2YVE A;  1VF9 A;  1W0T A;  2W48 A;  3P9T A;  2K9S A;  2HKU A;  1FTT A;  3F0C A;  4A3I J;  4BY7 J;  3H3V K;  1U78 A;  3MKL A;  2COB A;  2X9D A;  4RBO A;  3HGG A;  3IH3 A;  4JX4 A;  5HOD A;  1LFB A;  3BG9 A;  4G12 A;  4MLO A;  5IP7 J;  2R5Z B;  5CXG A;  1XG1 A;  4W97 A;  2MG4 A;  1FEX A;  2FQ4 A;  3JRB A;  2Y9Y A;  3HBL A;  2N8G A;  3BHQ A;  4D5F A;  3BR0 A;  2HOA A;  5FKN A;  5JLW A;  2NOG A;  5M5W J;  2LLK A;  4A69 C;  5EEA A;  1ZQ3 P;  4CYC A;  5J3L A;  5IYD J;  2EZL A;  4A3D J;  2IBD A;  4YZE A;  1GUU A;  1MBG A;  3L1P A;  2FBQ A;  2O7T A;  2ZCM A;  3RZO J;  2ELK A;  3CRJ A;  1H88 C;  3F1B A;  2RHA A;  1JUS A;  1JKP C;  3SFI A;  3BRU A;  2G3B A;  1ZR2 A;  2E2J J;  5M5Y J;  3HOW J;  3NNR A;  1DU6 A;  3QPS A;  1AKH A;  5DAJ A;  5DS9 A;  1IDZ A;  5GPC A;  3CMY A;  4GCT A;  1MBE A;  4X1E A;  5EG0 A;  1ENH A;  4D5C A;  4AC6 A;  2HDD A;  4NN1 A;  2G7S A;  2DA1 A;  4GFL A;  1RR7 A;  1U9O A;  3BCG A;  2CUE A;  1GVD A;  2HI3 A;  5EF6 A;  3CWR A;  3ON2 A;  5K7F A;  4XRS G;  4IHW A;  4V2G A;  4JNN A;  3V78 A;  4M3F A;  3LSP A;  1SGM A;  4A3G J;  4D7M A;  3C2B A;  1HLV A;  2VUM J;  1A5J A;  3RKQ A;  2LR8 A;  1X58 A;  2L7Z A;  5FJ8 J;  3JRH A;  3O60 A;  3HEF A;  5EZG A;  4EEF G;  3BTI A;  3HDD A;  1ZR4 A;  1BJZ A;  2NS8 A;  2XPV A;  2F07 A;  4FTH A;  2M2E A;  1PUF B;  3HOY J;  4C3J J;  2L0K A;  2L9R A;  1IRZ A;  1B72 A;  2X48 A;  3HE0 A;  5F04 A;  2DA2 A;  3GTP J;  2G7G A;  4ME9 A;  2D5V A;  4GFK A;  3JRF A;  4MO7 A;  4Y52 J;  2L7M P;  3G1O A;  1TC3 C;  3E7Q A;  2IEK A;  1MBH A;  3ON4 A;  1BW5 A;  3HGY A;  2NVX J;  3C07 A;  3GEU A;  3IUV A;  3HKZ N;  2R0Q C;  3IV5 A;  4JYK A;  5EYR A;  2Y2Z A;  5GPA A;  3VW2 A;  5M3F J;  1OJL A;  2JMW A;  3VW1 A;  1UI6 A;  4NDL A;  2HOT A;  1RPW A;  1O4X A;  3ZQI A;  3S2H J;  3BT9 A;  2PMZ N;  4FE7 A;  4BBS J;  3BG5 A;  4IEJ A;  3VOX A;  5EFY A;  2LVS A;  5IOY A;  2R93 J;  2QOP A;  2OF7 A;  2HQ5 A;  4XID A;  1ETX A;  1ETW A;  3TP0 A;  3JRD A;  4M3E A;  4AUX A;  1RKW A;  1TWF J;  2K9Q A;  5HBU A;  2L7F P;  3HTH A;  4BXX J;  3KKD A;  3VP5 A;  3HOV J;  4UUS B;  2NS7 A;  2ME0 A;  1VFC A;  1JKO C;  2ZCX A;  2XGE A;  3MN2 A;  3NI7 A;  1YRN B;  1UG2 A;  2CUF A;  2IU5 A;  2Y30 A;  1B8I A;  2DA5 A;  2REK A;  5F0H A;  5F0F A;  1GV2 A;  4L62 A;  4M3G A;  3NAU A;  2K40 A;  5IYB J;  4GFB A;  2E2H J;  4I6Z A;  1BW6 A;  3HM5 A;  4CGR A;  1AHD P;  3SJM A;  2XPW A;  4QSH A;  3A03 A;  2JA5 J;  3BR6 A;  1Z77 A;  4ACI A;  1ZTR A;  1TWC J;  3JRC A;  2GM4 A;  1JT0 A;  3M3Y J;  2GLO A;  3OOU A;  3WHB A;  4B1R A;  3UKG A;  3A01 B;  5K7Z A;  3JRE A;  1ETV A;  1K61 A;  2DG8 A;  2FX0 A;  2OI8 A;  1H89 C;  1QVT A;  9ANT A;  3IH4 A;  5E3M A;  1HDP A;  1IV6 A;  2LKX A;  1A6I A;  1D5Y A;  5D1R A;  1RES A;  3FIW A;  5E3N A;  3BQY A;  5FKL A;  1U9N A;  3TW6 A;  1R9T J;  2WUI A;  3VVY A;  1QVU A;  1NK3 P;  4QIW N;  1WI3 A;  5HAW A;  5BNG A;  4BBR J;  2ECB A;  4C3I J;  2DMU A;  1JJ8 C;  2Q24 A;  2UXU A;  1OFC X;  2V57 A;  1ITY A;  2DTZ A;  3LJL A;  1E3O C;  4XK4 A;  2M9H A;  3TED A;  3LHQ A;  3GTJ J;  5FGL A;  4HNV A;  2XRL A;  3RD3 A;  2B63 J;  1Q1V A;  3FK6 A;  3AQT A;  4QTR A;  3EUP A;  3GTQ J;  1JTY A;  3HIM A;  3S1R J;  1T56 A;  3NPI A;  2YVH A;  4I76 A;  2JA6 J;  4DZP A;  2LFB A;  3DCF A;  1RKT A;  2PZ9 A;  3S5R A;  4A93 J;  2LD5 A;  4IHX A;  1QRY A;  5EZH A;  1BL0 A;  4C3H J;  2O9L A;  1P7I A;  2R5Y B;  4A3E J;  2H8R A;  2NX4 A;  3GZI A;  1ETO A;  5IPA A;  5EGO A;  2UXH A;  1UI5 A;  1F36 A;  3FKI J;  5F08 A;  2LP0 A;  1MBK A;  1LE8 B;  3T6N A;  5DTD A;  4XIC A;  3S2D J;  1UHS A;  2HYT A;  1FJL A;  1JTX A;  3B6C A;  4A3K J;  2DA4 A;  5M5X J;  5F1J A;  2EZH A;  2Y0S N;  1VND A;  1MBJ A;  4C2M J;  2EH3 A;  2VPR A;  3K7A J;  3MVP A;  5E3O A;  2TCT A;  3ZQH A;  4FE4 A;  2WB1 N;  3SDG A;  3TW7 A;  4XRS A;  2XGC A;  2DMN A;  3FIS A;  2D6Y A;  1BA5 A;  3QQA A;  3S17 J;  4JX6 A;  3HOU J;  5CW8 A;  2R7Z J;  3I4M J;  1ETY A;  4MFD A;  3VVX A;  2WGB A;  3BR3 A;  2CQX A;  3OSF A;  3HTI A;  3EGQ A;  4FCY A;  1WH5 A;  1JKR C;  3AQS A;  2ID3 A;  4AF5 A;  2GUH A;  4BY1 J;  5EDN A;  3LNQ A;  2UXI A;  2X6O A;  3OIO A;  2DA3 A;  2Y31 A;  1IGN A;  2PBX A;  4A3J J;  1IUF A;  2KT0 A;  2G7L A;  4CYC B;  2FJ1 A;  1CQT A;  4A3C J;  3JSJ A;  4HKU A;  1H8A C;  4GCK A;  3ZQG A;  4MFE A;  2QIB A;  1HF0 A;  5IP9 J;  1AU7 A;  2W53 A;  2KDZ A;  2ECC A;  4W1U A;  2TRT A;  3RZD J;  1LFU P;  3PAS A;  2E19 A;  2HXO A;  1DU0 A;  3S1N J;  3HB9 A;  4A3M J;  2R5Z A;  1ZKG A;  3BTL A;  2QKO A; 
#chains in the Genus database with same CATH topology
 4UUV A;  2O7O A;  4DW6 A;  4KN7 X;  3RH2 A;  1IZ1 A;  4AYB A;  4XKC A;  1U8B A;  2M0C A;  2ACJ A;  1VQ7 I;  1YG2 A;  1T2K A;  2VC1 A;  5JI6 A;  1N75 A;  3PUB A;  4BL0 B;  2YPR A;  5DEQ A;  4R8H A;  3CUQ A;  4M72 A;  1LUJ B;  1ERD A;  3BP8 A;  4BJ5 C;  1YLF A;  2NVQ J;  1UB9 A;  2LSO A;  4OAZ A;  4AM3 A;  1ONV A;  3JRA A;  1B59 A;  1V54 H;  1OCT C;  3VVZ A;  2GXA A;  2XSD C;  3JRG A;  4A6D A;  3VUQ A;  3KKC A;  2DMQ A;  4DZJ A;  2XC7 A;  1SD4 A;  1L3L A;  5JHU A;  5K5Q A;  2OA4 A;  4PFO A;  3VDX A;  3R6S A;  3TDZ C;  1K4S A;  3RYR A;  2FA5 A;  4HA8 A;  5IYC J;  4DYC A;  3TP3 A;  2VI6 A;  4UUT A;  2OV7 A;  1VQ9 I;  1F1Z A;  2BVL A;  3V6G A;  2FSW A;  2RDP A;  1DUX C;  1BOB A;  1U5T C;  2IS1 A;  5JLX A;  4WXH A;  5FMP A;  1BIB A;  1QPI A;  4A12 A;  3H5N A;  4L5I A;  3FBI B;  2JT1 A;  4ENK A;  5TJJ A;  3DPL C;  2DJI A;  2L9V A;  3HSF A;  1E3P A;  1KU2 A;  3B81 A;  2RAE A;  4HF1 A;  2EIN H;  5CQG A;  3FRQ A;  2V79 A;  5J1Y A;  3LA3 A;  1DGR M;  5FD5 A;  1I50 J;  4B3A A;  4A3B J;  2DW4 A;  3MKY B;  3CC7 I;  1MNM C;  3M4O J;  2K85 A;  1IRX A;  3BQZ A;  3ZQL A;  5IOZ A;  4YIR X;  3H3Z A;  4ZDO A;  2M87 A;  2JZY A;  1F5T A;  3GFL A;  1I6H J;  3F72 A;  4BU2 A;  1VQM I;  1RC9 A;  1EF4 A;  4Z6Y A;  4CO8 A;  3G73 A;  3NQO A;  3MNL A;  2E7X A;  1R58 A;  1FLI A;  4LG0 A;  5FLV A;  1U3E M;  1KON A;  3F23 A;  2WB1 A;  2ME6 A;  3H9G A;  2L9N A;  2A6E F;  4BJ6 C;  3RJP A;  3H9Q A;  3Q3S A;  4YEJ A;  4M6X A;  3HC7 A;  4C2T A;  2V9K A;  3BNI A;  4UXN A;  1YHQ I;  4S05 A;  4MEX F;  4UUS A;  2OD5 A;  3O6B B;  2LKS A;  3ABM H;  3OS2 A;  2ZJQ F;  5J1U A;  4XOP A;  1W7P D;  1YRN A;  2P81 A;  3IWZ A;  3Q0V A;  3HKZ A;  1TQP A;  5J8F A;  3QPL A;  5CVJ A;  4PGG A;  2JTV A;  4ICH A;  3G56 A;  4CIC A;  3GBG A;  3V7S A;  1YX5 A;  2ZXI A;  3O8H A;  3IH2 A;  2HDC A;  2EBI A;  5L3G A;  4XNF A;  5E8I A;  4X6A J;  2PMZ A;  5HLT A;  2O0Y A;  3FHZ A;  3KP2 A;  1T98 A;  1H9G A;  3MD2 A;  2A3S A;  3BJO A;  2PFB A;  1VTN C;  2V1U A;  4UDS A;  2ID6 A;  3PPB A;  1T8I A;  3A01 A;  5B1B H;  2OPT A;  3VFZ A;  2A61 A;  2W00 A;  5LHG A;  1MBF A;  4OMY A;  4KN4 X;  3OYA A;  2YS9 A;  2L3D A;  1FMW A;  1BOA A;  2PLY A;  4HYE A;  1GLN A;  4CCM A;  1JUP A;  4RAG A;  4HSR A;  2Y0M A;  1WZ2 A;  3N4M A;  4NC6 A;  1P2F A;  3K2Z A;  4EM1 A;  3VPR A;  2P0W A;  2EB7 A;  1J2X A;  3E0J B;  4QLC U;  3NAR A;  1FOK A;  2X0L A;  4OU0 A;  3HTA A;  2IA2 A;  2ESH A;  4CA0 A;  2CYY A;  3WTS C;  3FM3 A;  3ZMZ A;  2Q1Z B;  1JGS A;  1TWG J;  3S1Q J;  1I3Q J;  1X2M A;  2QBY A;  3WU2 C;  2OQG A;  2Z99 A;  4RDU A;  2VOO A;  3JW4 A;  2VQH A;  3D5R C;  2IGK A;  1N77 A;  4I0A A;  3ZOB A;  2L4A A;  2ZSI B;  3S93 A;  1MSF C;  4KIB A;  3SDB A;  4KDP A;  1H9T A;  1ZLJ A;  2V6C A;  1NK2 P;  2HYF A;  5CVU A;  1MMA A;  1PVE A;  4RMN A;  3JSO A;  2KJB A;  5K7H A;  2VON A;  3ABU A;  1RUN A;  3BTC A;  2DJN A;  4Q48 A;  3COL A;  3DBR B;  3QPH A;  2XAJ A;  3S15 J;  1TP4 A;  1ZGA A;  1SMT A;  2PG4 A;  4FAS D;  1RET A;  2V26 A;  1KYW A;  1LE8 A;  2NVY J;  2HZD A;  3H0G J;  4EJO A;  2AXT C;  4E7S A;  2VC0 A;  2BYV E;  4DYQ A;  4YFK F;  3CJD A;  4NC7 A;  3J7Z I;  3W3C A;  4KIF A;  4EMS A;  2KHM A;  1MJ9 A;  1R00 A;  3A1Y A;  5E20 A;  2K3P A;  3OYF A;  3KZI C;  3ASO H;  3CCE I;  1W0T A;  2HQN A;  2O6G E;  3H35 A;  4PDK A;  3KP5 A;  3DXJ F;  3DP7 A;  2M7A A;  3HGG A;  3EQL F;  1ON1 A;  2EFP A;  2BHY A;  5KAI C;  2QKM B;  1Z91 A;  3E3V A;  4DIQ A;  2HOE A;  4W97 A;  2MG4 A;  2OUM A;  1SMY F;  4IZZ A;  2KFD A;  4XLF A;  2Z3Y A;  4HX4 A;  2CW0 F;  5FKN A;  1HKT A;  3W6K B;  3RSN A;  1ZQ3 P;  2EZL A;  3BPV A;  2WA0 A;  5KK1 A;  4LG3 A;  2IVM A;  1MW7 A;  2CW7 A;  2HYG D;  1WHU A;  1H88 C;  2V1N A;  1JUS A;  1JKP C;  4HRI A;  2GZW A;  3LQR A;  3F21 A;  1FSH A;  2HVS A;  3DTK A;  3ONQ A;  1UJ8 A;  2JUC A;  1AKH A;  4UHT A;  1LDJ A;  1IDZ A;  2R7T A;  1P4A A;  5DCM B;  4X1E A;  2DFE A;  4B8X A;  4AC6 A;  2HDD A;  3KEO A;  2DA1 A;  4BEH B;  1U9O A;  5LD2 C;  4ZYH A;  2HI3 A;  3ON2 A;  4XRS G;  4IHW A;  4GRI A;  4BAY A;  3V78 A;  1B9N A;  5ILV A;  1DQU A;  3HHG A;  4J00 A;  4A3G J;  2PX9 A;  2L02 A;  2QA4 I;  3FM5 A;  2QZ8 A;  2L7Z A;  2VT3 A;  5EZG A;  4E7L A;  1XCB A;  2QEN A;  1ACI A;  3HOY J;  1RI7 A;  2X48 A;  2WTE A;  3HE0 A;  1LJ9 A;  2VL8 A;  5H2F C;  2FUG 2;  1HC8 A;  2DA2 A;  5K5R A;  4ENJ A;  2NOJ B;  4GFK A;  5CVV A;  4MO7 A;  3CTA A;  4Y52 J;  3E7Q A;  2QEX I;  1KU7 A;  4UV8 A;  3RI4 A;  3WGI A;  4Y17 A;  2K86 A;  1JHH A;  3RPQ A;  1S7A A;  3SQN A;  4HV6 A;  4P1W A;  3FHN A;  3C2H A;  4LFU A;  3WG9 A;  5M3F J;  4BQO A;  2ISZ A;  1UI6 A;  4G9Y A;  1HST A;  2E60 A;  3ZQI A;  4HQE A;  2GWR A;  2X1E A;  4LLG F;  4BBS J;  4IEJ A;  3NWT A;  1X1D A;  2X6Y A;  2R93 J;  2WV0 A;  1KQ9 A;  1ETX A;  1M1E B;  2K4J A;  3HSE A;  4XSX F;  3BOQ A;  4WWC A;  4AUX A;  1GXQ A;  2MA3 A;  3DTE A;  1HXD A;  2HKO A;  2K9Q A;  4RGU A;  2L7F P;  3HTH A;  5DM6 F;  1DP7 P;  3VSK A;  4A0Y A;  2WY8 Q;  1F9N A;  3F8M A;  2IA0 A;  3ML6 A;  4YII A;  2P5V A;  2RRE A;  2YR2 A;  4BJT A;  1TW2 A;  4Q4Z F;  2REK A;  2DA5 A;  1W36 D;  2ZME C;  3WTX C;  3VOD A;  1P4W A;  1GV2 A;  3ZMT A;  2ISY A;  4LJZ F;  3E6C C;  4HF0 A;  4HST A;  5IYB J;  4GFB A;  4ESJ A;  2OU2 A;  1YJ9 I;  2EV0 A;  5HNH A;  2LNB A;  2G7U A;  2E35 A;  2IGN A;  2D1H A;  4DNC A;  4L9V A;  1Z77 A;  3BJ6 A;  2DU9 A;  2V9P A;  4PGH A;  1IF1 A;  2Z5U A;  3UKG A;  5F1R A;  3JRE A;  1K61 A;  3M7G A;  1NH3 A;  4XKW A;  2OI8 A;  4HF2 A;  1MMN A;  2LKX A;  5J8C A;  1D5Y A;  3R0J A;  1OR7 C;  5D1R A;  2L54 A;  3U9G A;  2DT5 A;  5BOX A;  3OIQ A;  3BQY A;  4A2U A;  2EV6 A;  5FFZ A;  1CF7 A;  3G4S I;  5FB2 A;  2CQ7 A;  1NK3 P;  1WI3 A;  3H1C A;  4BBR J;  4UB6 C;  2ECB A;  2DMU A;  3ECH A;  2UXU A;  1U5T A;  3M8E A;  4A6E A;  4XK4 A;  1VQN I;  2M9H A;  2MC3 A;  2YU3 A;  3GX4 X;  1HKS A;  3AG4 H;  3OWT A;  3GTJ J;  1R71 A;  4L9N A;  4GXO A;  1Q1V A;  3OOP A;  1DPR A;  1MJB A;  3EUP A;  3LSM A;  3P9I A;  3OR1 C;  1YOV B;  3TOA A;  1JTY A;  1V3F A;  3DFG A;  3HIM A;  4BGD A;  1X1C A;  4A5M A;  2YVH A;  3ZN0 A;  4AVZ A;  2LFB A;  3SZP A;  3DCF A;  1D8K A;  2UZK A;  1FZP B;  3CJR B;  2VT2 A;  2FU4 A;  2KRF A;  2F5D A;  3BG6 A;  1D8J A;  2V4J C;  4C3H J;  2WAD A;  5ED4 A;  1P7I A;  2R4G A;  3GWZ A;  2E1M B;  1TQI A;  4BDY A;  1ETO A;  3M1C A;  1R22 A;  3SFZ A;  5IPA A;  4U7D A;  2UXH A;  4PJL A;  4IPA A;  1UI5 A;  2ZFW A;  4ESB A;  2LP0 A;  1MBK A;  2X4H A;  1LVK A;  3T6N A;  4IKF A;  3IWF A;  1QNT A;  2Z2S B;  2BBY A;  1A36 A;  2HFH A;  2IXS A;  1VND A;  4YFX F;  3HOS A;  1MBJ A;  1XMX A;  4IO9 F;  2EH3 A;  3ZMV A;  2K9L A;  2VQL A;  4I2O A;  1XGO A;  2DK8 A;  3PNV A;  4XSZ F;  2TCT A;  4CCJ A;  3NRV A;  5FFX A;  1Z6T A;  3QQA A;  4Q47 A;  3TO9 A;  3ABT A;  4MFD A;  2RNJ A;  5B3S H;  3OSF A;  4HW0 A;  4FCY A;  3A4C A;  3W2V A;  4KNY A;  4AF5 A;  2W4S A;  4LK0 F;  1DPU A;  2BXZ A;  4BHP A;  5D8L B;  1X3Z B;  3VOE A;  2UXI A;  4B47 A;  4EV0 A;  4MHG A;  1AOY A;  4NNJ A;  3F3X A;  3J7A O;  5E18 F;  1WI9 A;  4A3C J;  2CWE A;  1UZC A;  1HF0 A;  2KDZ A;  5FO5 A;  4W1U A;  1TLH B;  4NQW B;  1YJW I;  3FMS A;  3HRT A;  2K5C A;  5CKT A;  1UHM A;  1RRJ A;  2HXO A;  1DU0 A;  3HB9 A;  1FX7 A;  4BE0 A;  4I99 C;  4O6J A;  4RAY A;  2XAG A;  2KRC A;  3BTL A;  2DA4 A;  3GME A;  1O7L A;  4EJW A;  4HEA 2;  4RB0 A;  2K9N A;  3WGH A;  2QSH X;  4OAY A;  1U0J A;  4G8X A;  1YE9 A;  1ZG1 A;  3I53 A;  2QLZ A;  1WPK A;  2CU7 A;  2NVU B;  5CPR B;  2Y48 A;  3W6J B;  2PMU A;  2XAH A;  4MEY F;  2VLA A;  2F4I A;  3L2R A;  2WAQ N;  3BLY A;  3HXL A;  3VSL A;  4YRV A;  1YJN I;  5FRN A;  2XKP A;  3ZQF A;  3NEU A;  2R7V A;  2RN7 A;  3GFJ A;  2CUJ A;  1OMI A;  2GOX B;  2FMY A;  3DLA A;  2NXN B;  1Y56 A;  2HYJ A;  3HUG B;  3BDD A;  1YW9 A;  5TRD A;  2MLK A;  1CGP A;  2P4W A;  4KWA A;  5H9T A;  3G1M A;  4B4C A;  1B72 B;  2K3F A;  4NUB A;  2HVQ A;  4HX8 A;  3CJQ B;  3GUD A;  3FXL A;  3ANG A;  3R4K A;  3FXR A;  1GT0 C;  3M8J A;  4M6V A;  2DDB A;  5CYV A;  2F6C A;  3QOE A;  4EQQ A;  2XUB A;  3BTJ A;  2MD5 A;  4BUP A;  4BXF A;  1MZB A;  1VZ0 A;  3NRG A;  3PSI A;  2RQQ A;  3OYD A;  5HDK A;  1PUF A;  3CQZ J;  3FX3 A;  4WIB A;  4HPQ A;  5FRM A;  1FIP A;  4H0E A;  2QSG X;  4D9J A;  2GBY A;  2A5W A;  1OCP A;  3KCC A;  4OD5 A;  5HLI A;  2PMH A;  3V7C A;  3IP4 B;  2XB0 X;  2DDA A;  1RNL A;  3NXC A;  2JA2 A;  1B1B A;  2BW3 A;  2O03 A;  1OIS A;  5L3E A;  4MIM A;  5IP6 A;  3FKJ A;  5ERI A;  3DPT A;  2FF4 A;  3QYE A;  2BY3 A;  3QU3 A;  1UHW A;  1NHA A;  4IHY A;  1TBX A;  3GTG J;  3Q9V A;  5C44 J;  3KEQ A;  3K4B A;  4JL3 A;  4UV9 A;  1IO2 A;  2HKX A;  2KIS A;  2X1C A;  4UVC A;  3GTO J;  3JAM K;  2GFN A;  4KFC A;  2CRG A;  3IC7 A;  3QP6 A;  3GYH X;  1FWZ A;  2MD0 A;  2GA1 A;  4BYY A;  4S0H B;  3KET A;  1XS9 A;  2QWT A;  2AQE A;  3QOP A;  2OCC H;  4XL9 A;  3LSG A;  3G7R A;  3T8T A;  3LWJ A;  4JKZ A;  4O5V A;  1F43 A;  4OIP F;  4I98 B;  1MNE A;  2VAS A;  3TL4 X;  2MLG A;  3AKZ A;  2FD5 A;  1G8X A;  1S29 A;  3F8C A;  3GTL J;  2K4B A;  3OYH A;  3E1S A;  2I10 A;  3RPU D;  2BV6 A;  4A5N A;  3LOC A;  3I5U A;  5K58 A;  2EFO A;  2ELH A;  2E5N A;  5LRR A;  2DOD A;  4XLC A;  3CDL A;  3ABL H;  4AC0 A;  3I3L A;  2CV0 A;  5C4J J;  5AIP A;  3JRI A;  1GXP A;  3D5L A;  3PNY A;  2LK2 A;  2DG7 A;  1QQI A;  5B66 C;  5FD6 A;  1I1G A;  1LDD A;  2QSF X;  2CQQ A;  2XV4 S;  1W36 C;  2BVM A;  2HPM A;  4XLE A;  1XMA A;  2DA6 A;  2FE3 A;  3VW0 A;  3BG3 A;  2FBH A;  1EV7 A;  2VKV A;  1D1B A;  4EAT A;  1V55 H;  3BR1 A;  4DYR A;  2H94 A;  3FK7 A;  3GFI A;  2IW5 A;  5TGT A;  2R7S A;  2K02 A;  1K78 A;  3K8P C;  2JWT A;  2LTP A;  1WJA A;  1Y8R B;  3DEU A;  4ZTF A;  1SD7 A;  3RYP A;  2DQR A;  5DUI A;  4HAM A;  3KLN A;  3S32 A;  3GO5 A;  2IS6 A;  4M71 A;  3VOK A;  4RB2 C;  3HTU A;  1T33 A;  1D3Y A;  4ESF A;  2OCE A;  5CXI A;  1B6A A;  2ZCN A;  3L7W A;  2DXI A;  1FIA A;  2KLO A;  3LA7 A;  4UVA A;  1LVA A;  5EGO B;  4CGZ A;  3HTJ A;  2F48 A;  2H6C A;  2E1M C;  2Y9Z A;  1PUE E;  4U9L A;  2LY9 A;  4DGW B;  4G94 A;  2EZK A;  5CLS A;  2QUF A;  3MCZ A;  3P9C A;  3Q0U A;  1YIJ I;  2MGQ A;  4P55 A;  4XLN F;  3MKW B;  3IRQ A;  3VYS B;  1RZ4 A;  2RV8 A;  1ON2 A;  5CVR A;  5H20 A;  2F5F A;  4EM2 A;  1SAN A;  3WTV C;  5BPI A;  2LKP A;  2Q2E A;  2DQL A;  1X2N A;  4AYB N;  4DBR A;  4ZDL A;  2GXG A;  3K0L A;  1ZGW A;  2E1N A;  4QWQ A;  4XMY A;  1MH4 A;  1XGS A;  2EA4 A;  5KCM A;  4IRH A;  2NNN A;  1HDD C;  1A31 A;  3HOX J;  1BR2 A;  4L18 B;  1A6Q A;  4WX9 A;  2M34 A;  3S3N A;  2KP6 A;  5A2Q Z;  3OYB A;  1VF9 A;  1YW8 A;  3OYG A;  4CZZ A;  2ZME A;  3RKY A;  1NG7 A;  2W48 A;  1FTT A;  2RQP A;  3F0C A;  2EIM H;  1T39 A;  3S3M A;  3KP6 A;  3EYI A;  1SD5 A;  2STW A;  2CH0 A;  3MKL A;  1ZG3 A;  2X9D A;  1BN5 A;  5L3B A;  4G12 A;  4HBL A;  4MLO A;  4EJU A;  3MFK A;  2R5Z B;  2AXL A;  3QPT A;  3OY9 A;  2N8G A;  1STZ A;  4D5F A;  4WCG A;  3BHQ A;  1QGP A;  1D0Y A;  2VQC A;  3PUF A;  3L2W A;  2LLK A;  4KJZ A;  4RGX A;  1YQA A;  1R4N B;  5EEH A;  1Y39 A;  1S8N A;  1FNN A;  3CUQ B;  4M74 A;  1KYZ A;  3F1B A;  4OMZ A;  3ASN H;  2RHA A;  1W7P A;  2E2J J;  5M5Y J;  3NNR A;  1DU6 A;  2M8E A;  3LFU A;  5LHI A;  2ZJR F;  3CD6 I;  3QPS A;  1T95 A;  1ULY A;  4OIQ F;  2JPC A;  5DAJ A;  3WTU C;  1KA8 A;  3GLL A;  4H4K C;  3CMY A;  1MND A;  1BI1 A;  2HEO A;  5EG0 A;  1I6X A;  1XTA A;  5DDG A;  4NN1 A;  2G7S A;  2Y69 H;  4UB8 C;  4GFL A;  3BCG A;  3CWR A;  5EF6 A;  5LLQ A;  5FRO A;  3F22 A;  3DKX A;  4V2G A;  1K7A A;  4M3F A;  3LSP A;  3ZMU A;  4KYW A;  3BCA A;  2VXZ A;  2BY2 A;  4MNU A;  2QGU A;  1BM9 A;  2F4M B;  5EEG A;  3JRH A;  4BE1 A;  2B3W A;  3HEF A;  4EEF G;  4XLP F;  1ZR4 A;  2XPV A;  2CS3 A;  2NS8 A;  3IHU A;  5A2Q K;  2R7R A;  1IV8 A;  1OCZ H;  2R7O A;  1G3W A;  4C3J J;  1IRZ A;  3HHH A;  3T0Y A;  2Q8K A;  4I7H A;  1OYY A;  4KA4 A;  3DF8 A;  3OYM A;  3BZ6 A;  4AIK A;  2IEK A;  1MDM A;  3I64 A;  3ON4 A;  4L9J A;  1XD7 A;  4F7Z A;  1QU3 A;  3K10 A;  2W1O A;  4RA2 A;  1BW5 A;  2NVX J;  2EPF A;  5GTI C;  3IUV A;  3HKZ N;  2R0Q C;  4JYK A;  2XAF A;  3IL2 A;  1OJL A;  4A0X A;  5LEK A;  1SFK A;  3CDH A;  3LSH A;  3IKV A;  1FOX A;  1T08 B;  1R1T A;  3S2H J;  2PMZ N;  3I59 A;  4LG0 B;  5IOY A;  2QOP A;  5D6F A;  1R5G A;  2OF7 A;  4IQ4 A;  1ETW A;  1OCO H;  3TP0 A;  3NS4 A;  3SWH A;  5HVQ C;  3SYT A;  1MMG A;  3I56 I;  1FYL A;  1QZY A;  4IHT A;  2YSR A;  4BXX J;  3EET A;  1G3T A;  4OIN F;  3VP5 A;  1WQ2 A;  4UUS B;  2NS7 A;  5H6Q A;  2ME0 A;  6PAX A;  4BH9 A;  2XGE A;  3NI7 A;  1YTY A;  1YRN B;  1VQ4 I;  1UG2 A;  2CUF A;  5HS7 A;  2Y30 A;  3QOD A;  1B8I A;  2J5P A;  2X6X A;  1ODD A;  1LEB A;  5F0F A;  2MBF A;  2LBF A;  4M3G A;  1GVJ A;  1SFX A;  3T1B A;  1R1V A;  2W24 A;  4GCV A;  2E2H J;  2DBB A;  3U21 A;  2LF8 A;  4KIC A;  4OD4 A;  2XPW A;  4U88 A;  1IN7 A;  4E4H A;  2JA5 J;  1O3T A;  3CP2 A;  3BR6 A;  2CFX A;  1IXC A;  3A01 B;  5K7Z A;  2H6B A;  3RIR A;  1ETV A;  5HOO A;  1S7O A;  3HPG A;  4RLQ A;  1Y8Q B;  1QVT A;  1FYM A;  5E3M A;  3CLQ A;  9ANT A;  1A6I A;  2VBW A;  3MZ8 A;  3OS0 A;  3FIW A;  2VKH A;  5E3N A;  2DYS H;  2XRO A;  2OTL I;  2OQR A;  3LL7 A;  1LDK B;  3DPU A;  2DOA A;  3TW6 A;  1ZRC A;  3VVY A;  3CF5 F;  4ZYA A;  4B3X A;  2HS5 A;  4C3I J;  2Q24 A;  1ITY A;  2DTZ A;  4BQA A;  5J4V A;  4CSW A;  3IAS 2;  1WJB A;  3LJL A;  4UVB A;  3HPH A;  3LHQ A;  2ETH A;  4M9S A;  2QBY B;  4HNV A;  5JFR A;  3RD3 A;  1X1B A;  5D8K B;  3FK6 A;  3BC8 A;  3AQT A;  4QTR A;  3K4M A;  4XOR A;  4DBQ A;  4AD9 A;  4PJ0 C;  1K4T A;  5FLX K;  2JA6 J;  2W57 A;  4HV5 A;  2KRH A;  3HL2 A;  1XCV A;  1Z1D A;  2J5O A;  4L0Z B;  3FBN B;  3FXJ A;  3BG7 A;  4P5O A;  3IKT A;  3CCJ I;  4IHX A;  2HZT A;  3VWB A;  2O9L A;  1BR4 A;  1JI8 A;  4GDF A;  3F9K A;  3T8R A;  2KQR A;  2NX4 A;  3GZI A;  1D1A A;  2GOM A;  4G7O F;  3OL3 A;  3MAJ A;  3H5R A;  4XLH A;  4B44 A;  1LE8 B;  2E1C A;  5E79 C;  5DTD A;  3S2D J;  1UHS A;  4LGW A;  2HYT A;  3CJN A;  3B6C A;  3E5X A;  4BHB A;  4E70 A;  4A3K J;  2QWW A;  5M5X J;  2EZH A;  2Y0S N;  1UG0 A;  2D45 A;  3TGN A;  2PJR A;  1OCC H;  3L09 A;  3U1D A;  5DYM A;  2HU9 A;  5L3F A;  5E3O A;  4FE4 A;  2R7F A;  3SDG A;  1FBU A;  2ZO4 A;  5AIQ A;  4LLL A;  3SHF A;  2NAZ A;  4CCK A;  2IRF G;  1Z7U A;  3HOU J;  1VQ8 I;  2R7Z J;  3I4M J;  1ETY A;  3VVX A;  1UCR A;  2ZCW A;  4MTE A;  2WGB A;  3BR3 A;  2CQX A;  1AWC A;  3AG3 H;  4KIG A;  1WH5 A;  5ILS A;  1JKR C;  2EIJ H;  2ID3 A;  1TTY A;  4M6Y A;  3TO7 A;  3ZCO A;  4BY1 J;  4AIH A;  2BEO A;  3KFW X;  1R5I D;  2EFW A;  2BZT A;  2WWY A;  2L01 A;  4AWX B;  4LMY A;  5BQT A;  2PBX A;  4A3J J;  1X4O A;  2I8D A;  4HKU A;  1CQT A;  4GCK A;  1J9I A;  3ROU A;  2W53 A;  2VKD A;  3MZH A;  2ECC A;  3RZD J;  3PAS A;  3PNT A;  4V19 K;  3E6B A;  2UXN A;  2LC2 A;  3CUQ C;  5B5E C;  3OS1 A;  3GW2 A;  5HSZ A;  4NEL A;  2O8X A;  5E1Z B;  1ZAO A;  1HCR A;  1FTZ A;  2BGC A;  3K4J A;  4XBF A;  1AKH B;  3KNW A;  2GQQ A;  3H9J A;  4J19 A;  1LNW A;  1XGM A;  3C1D A;  3ESW B;  3CCR I;  5C4Y A;  3DWL E;  2JJ7 A;  1WCM J;  1ETK A;  1T0F A;  4CDG A;  4QPO A;  1BJA A;  2UWM A;  4C2M A;  1Z67 A;  1MD0 A;  4HLY A;  1S9H A;  4BXU A;  3BPX A;  1SVO A;  1MSE C;  1UST A;  1VI0 A;  2A6T A;  2G9W A;  4JX5 A;  2B0L A;  4L9T A;  5IY5 H;  1Z3Y A;  5D5V B;  3GTK J;  4Q5S F;  4PFP A;  2COM A;  3B02 A;  2HR3 A;  2QYO A;  3JR9 A;  2LH9 A;  2ZXW H;  3BR2 A;  2MAB A;  1IJW C;  2FQ3 A;  1O3S A;  3S16 J;  2XF7 A;  3SXY A;  1UMQ A;  3PQJ A;  2UXO A;  2GIZ A;  3LQQ A;  2DK5 A;  3DTI A;  2DCE A;  4G7Z F;  2ZOZ A;  4JBA A;  5DV5 A;  2A05 A;  2ZB9 A;  3TQN A;  4JP0 A;  4GYI A;  2L4M A;  3CCS I;  1OYW A;  3R0A A;  3HOZ J;  2G7H A;  5HDG A;  1LB2 A;  4A3F J;  3Q5F A;  2YU9 J;  4IRV A;  2IGM A;  5FKK A;  3VTI A;  4IXA A;  1KU9 A;  2H27 A;  4MXM A;  3K4N A;  3UNG C;  4ZYG A;  2HOS A;  2QF7 A;  3LSJ A;  1TWH J;  2JA7 J;  1S3J A;  4HNU A;  4JQF A;  1FP1 D;  2JSP A;  2FOW A;  1J7K A;  4IX7 A;  5F27 A;  2XGX A;  3ZGK A;  2UXX A;  4GYG A;  3X2Q H;  3D0S A;  3I9V 2;  3BJB A;  3GF2 A;  2X85 A;  4NC8 A;  2DOE A;  5HDN A;  1MMD A;  1QZE A;  1JUM A;  2Z16 A;  3ZMS A;  4BNC A;  2DLL A;  2VPL A;  1IDY A;  4NBQ A;  2L9S A;  5HNF A;  2WV1 A;  1HOM A;  4M9Z A;  2RGV A;  4XKB A;  1BI0 A;  1V5E A;  1VQ6 I;  3MWM A;  4U7B A;  3ZQC A;  2DMP A;  3I4P A;  3MMY B;  1Z0X A;  3ULQ B;  4MK6 A;  1SD6 A;  3E5U A;  4AID A;  1GDT A;  2R7U A;  4N9H A;  3I54 A;  2K9M A;  2XGD A;  2R92 J;  4IRG A;  2KJC A;  3CCY A;  2NS0 A;  2V1D A;  3KP4 A;  3QYB A;  3WGG A;  1YIT I;  3OYK A;  3AL0 B;  3TBI A;  3PIO F;  2NVT J;  1EH7 A;  3PFI A;  4M3B A;  4HOB A;  5GAH J;  3ZXS A;  4Y7N J;  1G2H A;  2X51 A;  3RQI A;  4U0Y A;  3OSG A;  2BE5 F;  1VQ5 I;  5AQC A;  2BY1 A;  4IHV A;  2RAS A;  2JVH A;  1SFO J;  1ZG5 A;  3OYC A;  2CV2 A;  1USS A;  3KX2 A;  4F92 B;  1S7E A;  1X1A A;  3BWG A;  3GTM J;  3QWL A;  2CW8 A;  2VBX A;  2H1K A;  2ZNY A;  3A02 A;  3HIF A;  2L2O A;  2K7L A;  1APL C;  1CF7 B;  2G0E A;  1XPX A;  3I4N J;  2JK3 A;  4CCL A;  3WHC A;  5FGM A;  4F55 A;  3LAJ A;  3W6V A;  3TDU C;  1O3Q A;  1U5T B;  4GCL A;  4LB5 A;  2OER A;  3ZRG A;  5JVT A;  1GV5 A;  2XDN A;  2WAE A;  1MKM A;  1I27 A;  4LLN A;  1W5S A;  3OR2 C;  4ZZL A;  2F5C A;  2WC2 A;  1R4M B;  3GZ6 A;  1WFX A;  1FOW A;  1WGX A;  3E7L A;  1IUY A;  3ANP A;  2F5V A;  2PFV A;  1Y1W J;  2RC4 A;  3QKX A;  2UV1 A;  2E1O A;  3AFH A;  4C2U A;  3MZY A;  2GEN A;  3ABK H;  3K69 A;  1P7J A;  3JAM Z;  3FMR A;  1W4M A;  2R7X A;  1IC8 A;  1O57 A;  5IT9 Z;  1XC5 A;  1P92 A;  3CMM A;  3GEZ A;  4L5E A;  2H09 A;  2LOO A;  2NP5 A;  5ICF A;  3EUH C;  5FLM J;  2NP3 A;  2QKO A;  1A35 A;  3HRM A;  4FIS A;  3QBM A;  1XSD A;  4Z2Y A;  1G6N A;  2XPU A;  3GCM A;  2RVC A;  3F8F A;  2R5Y A;  2CJJ A;  4Y4R A;  3H36 A;  2QQB A;  3EPZ A;  3WTW C;  1FP2 A;  1Z9C A;  3I0T A;  5C3E J;  2CO5 A;  5M3M J;  3I71 A;  1PP8 F;  3O8G A;  2VKE A;  2DA7 A;  4N4O B;  3PO3 J;  4XN0 A;  5E1X A;  1IN4 A;  4ZDP A;  3M9A A;  2P6T A;  5JHF A;  3DPJ A;  3RQ4 A;  4I02 A;  2GAU A;  3EDP A;  1D0Z A;  4E7I A;  1S5L C;  2A6H F;  2JUG A;  3PJR A;  3P9T A;  3HTS B;  5HLH A;  1U8R A;  4QPQ A;  4A3I J;  4BY7 J;  1IRG A;  1KQ8 A;  1U78 A;  1FBQ A;  2FBK A;  4KT5 C;  4II3 A;  2COB A;  4RBO A;  2UUZ A;  3IH3 A;  4JX4 A;  1LFB A;  4KUM A;  1L0O C;  5CXG A;  3S2W A;  2FQ4 A;  3JRB A;  2Z9O A;  1FT9 A;  3HBL A;  4IOA F;  2O61 A;  2QVO A;  2HOA A;  1FBS A;  4XKV A;  1FMV A;  3U2R A;  5JLW A;  1MIJ A;  2LMD A;  2NOG A;  4WXC A;  4Y3O A;  4CYC A;  5J3L A;  2IBD A;  2WBM A;  3OIP A;  1K6Y A;  1Q1H A;  1XDS A;  5IT9 K;  2FBQ A;  1PP7 U;  2O7T A;  2M5W A;  3RZO J;  4RAF A;  2ZCM A;  3OL4 A;  3RPU A;  4CYD A;  3DLL F;  3G6E I;  3WTY C;  1JHF A;  1ZR2 A;  4ZZD A;  3O2P E;  3HRS A;  1YS7 A;  4I0B A;  4LIU A;  2P8T A;  3K4L A;  3H0D A;  3M8F A;  3L2U A;  5GPC A;  1YYV A;  2O5R A;  3HRU A;  1RUO A;  5LGN A;  2WAF A;  4D5C A;  2VJI A;  2JSC A;  1MJA A;  2OZU A;  1RR7 A;  2D1V A;  4ITV A;  1HW2 A;  4KMU X;  2A5Y B;  1WKM A;  1SFE A;  4BDZ A;  2MH9 A;  1OQY A;  3JSP A;  1HLV A;  2VUM J;  1A5J A;  3RKQ A;  2I5U A;  2LR8 A;  5ICG A;  3CMA I;  4XOT A;  5FJ8 J;  1XMK A;  2EWN A;  4C30 A;  1OKR A;  1D5V A;  4MQV A;  4HNT A;  2EK5 A;  3MEX A;  4FTH A;  2M2E A;  3KZY A;  1PUF B;  3CME I;  2L0K A;  2ZNZ A;  2L9R A;  1HKQ A;  1X3U A;  3RTR A;  2Y75 A;  5DD4 A;  2G7G A;  5CQE A;  4ASN A;  3JRF A;  1HA8 A;  3G1O A;  3KEY A;  3HJE A;  5CJ9 A;  1MBH A;  2KZV A;  2LDU A;  2BW3 B;  3KLO A;  1J5Y A;  5GTH C;  1MGT A;  1X1P A;  1YO5 C;  5L3D A;  4KMF A;  3L9F A;  4JK1 X;  2IS2 A;  4DVY P;  2XF6 A;  3S8P A;  1JE8 A;  4N4N B;  3IV5 A;  5EYR A;  1FOY A;  3F6V A;  2Y2Z A;  5GPA A;  4NHJ A;  1REP C;  1BC7 C;  1SVM A;  2JMW A;  3R61 A;  1RR8 C;  1ZRE A;  4B09 A;  4NDL A;  4ZYE A;  2HOT A;  1RPW A;  3SEQ A;  1J09 A;  1D1C A;  1O4X A;  1I5Z A;  3BT9 A;  4PSX A;  4RB3 C;  3BG5 A;  2TDX A;  1HBX G;  3N97 A;  1R49 A;  2HQ5 A;  3JRD A;  2VJ4 A;  2ESN A;  4M3E A;  4N9I A;  2ZY9 A;  1A04 A;  2LRD A;  4JOM A;  5D5X B;  3AL0 C;  3G3Z A;  3VB2 A;  5CVI A;  3J81 K;  3HOV J;  1ZN2 A;  5AON A;  3IAM 2;  3CP8 A;  4XRF A;  1E0E A;  4U87 A;  1VFC A;  1JKO C;  2ZCX A;  1QA6 A;  3S3O A;  2C6Y A;  2P5L C;  1Z21 A;  1XB4 A;  3AG2 H;  4CHU A;  3ECO A;  3BZK A;  3NAU A;  2DFF A;  2BXY A;  3D5S C;  3WG7 H;  2M45 A;  1ZAR A;  4CGR A;  1AHD P;  3SJM A;  4QSH A;  1EA3 A;  1R1U A;  4ACI A;  1ZTR A;  3JRC A;  1R36 A;  3GZN B;  2GM4 A;  4KIS A;  3M3Y J;  1V5F A;  2LYC A;  2GLO A;  3OYN A;  3WHB A;  1I39 A;  2HNH A;  3DBH B;  4B1R A;  4RB1 A;  2FX0 A;  3K70 D;  1R6R A;  3CCV I;  5E17 F;  1YIO A;  2KDO A;  3C3W A;  4CH7 A;  1YFH A;  3GVA A;  1K78 B;  2FML A;  1SVL A;  1R7J A;  5DUK A;  5FKL A;  1R9T J;  2CMP A;  4D1Q A;  1QVU A;  4RS8 A;  4FHT A;  5HAW A;  2JRT A;  1P6R A;  2F4O B;  1EH6 A;  4FT8 A;  1U2W A;  4BQN A;  3I55 I;  2V57 A;  2LY1 A;  2ZC2 A;  3IRR A;  1E3O C;  2ZJ2 A;  2QQA A;  2NRA C;  3TED A;  4PK4 A;  3J80 K;  4IQJ A;  2F2E A;  1FY7 A;  5FGL A;  1OR7 A;  3BY6 A;  4ZTJ A;  2ADU A;  2VE8 A;  3FMQ A;  3TKY A;  4ZJZ A;  3GTQ J;  4R79 A;  3COA C;  4ANJ A;  3S1R J;  3FF5 A;  1T56 A;  4XR6 A;  3NPI A;  2A07 F;  2Q0O A;  1RKT A;  2PZ9 A;  3S5R A;  4A93 J;  3CCU I;  1XN7 A;  4IJA A;  2LD5 A;  1BBY A;  2GXB A;  2XHK A;  4RGR A;  1TT0 A;  1BL0 A;  4FET A;  5J47 A;  1B4A A;  5KHD A;  4A3E J;  2H8R A;  4KT6 A;  2Q2E B;  3L2V A;  2L5Q A;  3LMM A;  2OAZ A;  4G6D A;  3FKI J;  5F08 A;  2XF5 A;  2DPD A;  1WJ5 A;  1JTX A;  5LGU A;  1I3A A;  3A2K A;  2IPQ X;  1H0M A;  3RKX A;  1G59 A;  4B43 A;  1PYV A;  2E7W A;  2YX7 A;  3MVP A;  3A0B C;  3FXQ A;  3ZQH A;  2WB1 N;  1SC7 A;  3L2Q A;  3TW7 A;  2IS4 A;  2XGC A;  2LRE A;  2ZME B;  2DMN A;  3E5Q A;  1OPC A;  3S17 J;  2HGC A;  4JX6 A;  1LFP A;  2VIX A;  1QBJ A;  5CW8 A;  4NB5 A;  4O3M A;  4Y13 A;  5J40 A;  2PBI A;  2FEZ A;  1RIO H;  5K1Y A;  2X1D A;  3EYY A;  2XAU A;  3DEE A;  1Y0N A;  1PDN C;  5LHH A;  3A0H C;  5EDN A;  1WJE A;  4RGS A;  4P9U A;  3LNQ A;  2DI3 A;  2CUZ A;  2DA3 A;  2Y31 A;  3FXO A;  1IGN A;  4B48 A;  1IUF A;  1X19 A;  3DU5 A;  5DD8 A;  4IOC F;  3DKW A;  3JSJ A;  4F93 B;  3KP7 A;  3ZQG A;  2QIB A;  2M30 A;  5IP9 J;  1AU7 A;  3P9K A;  2QKL B;  1G3Y A;  1LQ1 A;  4PJJ A;  3H3U A;  3V8J A;  4U0V A;  1LFU P;  1FPQ A;  4E7J A;  3S1N J;  1W7P B;  3FXM A;  1B9M A;  1HSJ A;  3TMO A;  5D19 A;  2STT A;  2R7W A;  5FLX Z;  5ICE A;  4PXI A;  2MSY A;  2MW8 A;  5H6R A;  3K1M A;  2NNY A;  4PZJ A;  1ZHF A;  2GIV A;  2PJP A;  5EG0 B;  3CDI A;  4IL6 C;  2V9V A;  3KIO A;  1FYK A;  3FXK A;  2E5Z A;  5FKO A;  3SEZ A;  2DPU A;  4YG2 F;  4M73 A;  3KP3 A;  1WJF A;  4PUS A;  4E7Z A;  1QZZ A;  1WH7 A;  1ORK A;  5E3L A;  3DBL B;  3U1K A;  1JGG A;  1X4P A;  1P9Q C;  2HTJ A;  4XM3 A;  4IF4 A;  2DTR A;  3T5X A;  3MQ0 A;  5BPD A;  4UY8 I;  2XIG A;  1BC8 C;  1OCR H;  2VBZ A;  3TO6 A;  2Z1D A;  3VYT B;  5DCM A;  1K79 A;  1GHC A;  2EV5 A;  3B6A A;  1IN8 A;  1Z6R A;  4BEH A;  3DKY A;  4KIT B;  3ZPL A;  3H5A A;  5K5O A;  2P5K A;  3EUH A;  1MDM B;  2YUS A;  3FZV A;  1W1W E;  4I01 A;  3CO6 C;  3CF2 A;  5BS6 A;  1TW3 A;  3M1E A;  2KIQ A;  3KYL A;  3CC2 I;  4YEL A;  5D6E A;  1WJD A;  2MC4 A;  1DDN A;  3K9T A;  2KKO A;  3E6M A;  3PSF A;  1WJC A;  3I58 A;  3EUA A;  3FWE A;  4P9F A;  3GFM A;  3MKZ A;  3F6O A;  2FXA A;  4WXD A;  3LAP A;  4ABZ A;  2EIK H;  3I59 B;  3SZT A;  1YI2 I;  1ZK8 A;  1S6L A;  3GLX A;  3UR3 C;  5D4S A;  1TT5 B;  1E2X A;  4LB6 B;  3CCM I;  3CCL I;  2EFQ A;  4IVN A;  4J01 A;  3BR5 A;  2RNG A;  1XGN A;  4GGG A;  2XVC A;  3WE3 A;  5D18 A;  1QPM A;  4E6K G;  4YFN F;  4M9X A;  3K2A A;  2O8K A;  4GO1 A;  2EA2 A;  2PI0 A;  5D5W B;  4A3L J;  2OZ6 A;  2P7C B;  4D0P A;  4RLF A;  2VN2 A;  1SEU A;  4P96 A;  3AAF A;  3QAH A;  4L0Y B;  1TWA J;  1K83 J;  4HZF A;  2Y0S A;  3QRF F;  1B8I B;  1R23 A;  3KE2 A;  2KL4 A;  2W85 A;  1NTC A;  2MFZ A;  3CC4 I;  1POG A;  2A69 F;  1TZL A;  2LBF B;  3IUO A;  3Q0W A;  2E71 A;  1QHH D;  3WU0 A;  5LBQ A;  2JA8 J;  5FKM A;  3ZQQ A;  2KPM A;  2DMT A;  4LIV A;  1EH8 A;  5HS9 A;  4OIR F;  5BMZ A;  3ZQ7 A;  2H8W A;  3N05 A;  4V2F A;  2RKH A;  5J1R A;  1JJ6 C;  1T38 A;  3OV8 A;  1Y1V J;  2M3A A;  4XON A;  2DT6 A;  4M3D A;  3D1N I;  3LST A;  3S14 J;  3G1L A;  1JKQ C;  3PO2 J;  2ZBK A;  3LSR A;  2W82 A;  2M7B A;  3KYD B;  3ZMD A;  3B73 A;  1ZRF A;  3V42 A;  4FX4 A;  3JTH A;  2P6S A;  2AO9 A;  4EM0 B;  4PJM A;  3ZR8 X;  4G6T B;  4G7H F;  1YX3 A;  4XQF A;  3M07 A;  3PIP F;  2XB5 A;  2HTS A;  1J0R A;  1JXS A;  2XAQ A;  3KZ9 A;  1UFM A;  2CFO A;  2DYR H;  5HLG A;  3WE2 A;  3AG1 H;  2EQR A;  4BKX A;  1QHG A;  2DFI A;  2WY7 Q;  3DQV C;  3E97 A;  3SZG A;  2JN6 A;  2E2I J;  4EJT A;  1JT6 A;  2M8G X;  2M4G A;  4HLX A;  4ZYD A;  3VYR B;  4LOC A;  3K70 C;  1SAU A;  3WTZ A;  1BR1 A;  1N25 A;  1Y6I A;  1XSX A;  2LF7 A;  2P7V B;  1ETQ A;  5HS8 A;  2QQ8 A;  4LD5 A;  2HXI A;  3S1M J;  5LRS A;  1O7F A;  5F0C A;  2VE9 A;  5E8G A;  3TOB A;  2V1X A;  3KYC B;  4F91 B;  3OYJ A;  1SFU A;  2CV1 A;  2QTQ A;  1T6S A;  5GP9 A;  2FNA A;  4F3Q A;  5C4X J;  2ZXH A;  1D0X A;  3K4K A;  2LY2 A;  4E7H A;  4ON0 A;  2OC6 A;  2PJR B;  2A2F X;  1EKE A;  1W0U A;  3F8N A;  4LIT A;  3DEW A;  4AIJ A;  1IG7 A;  2JRM A;  2VBY A;  3DU6 A;  1MH3 A;  4A0Z A;  1WSU A;  1KU3 A;  2CQN A;  2VXD A;  2ZOY A;  4D7N A;  2QCO A;  3ISP A;  2XKO A;  2B1E A;  2EZI A;  3CCQ I;  2M0M A;  2UXP A;  3QYF A;  2IAI A;  3PM1 A;  4DQ2 A;  2B9S A;  4XRM A;  3VIB A;  2DN0 A;  3PFY A;  4EVI A;  5FHP A;  1XDU A;  2AHQ A;  5F64 A;  5GAE J;  2YVE A;  2F5E A;  2LG4 A;  2FBI A;  2W84 A;  2K9S A;  3P5J A;  4RM2 A;  5B1A H;  2HKU A;  1G3S A;  2MH2 A;  3H3V K;  3HG9 A;  4AVP A;  4TV7 A;  4HX7 A;  5HOD A;  3BG9 A;  4FQG A;  5IP7 J;  1XG1 A;  2HWV A;  4XN3 A;  1FEX A;  2X6W A;  2Y9Y A;  3J7A Y;  3CZ6 A;  4RM3 A;  5J6X A;  1U6G A;  3JTG A;  2ZJP F;  4IHS A;  3BR0 A;  2W7N A;  3QU6 A;  2W25 A;  5M5W J;  4A69 C;  5EEA A;  3G71 I;  1ZH5 A;  2BOL A;  5IYD J;  4A3D J;  4YZE A;  1GUU A;  4PSW A;  3DV8 A;  1VQP I;  1HQC A;  1MBG A;  3J7Y J;  2L7K A;  3L1P A;  3CRJ A;  1E3H A;  4NQW A;  2ELK A;  3ERM A;  1XX5 A;  4EGY A;  2XAS A;  2MYS A;  1IRF A;  3SFI A;  1P4X A;  3BRU A;  2G3B A;  1X3W B;  3QP5 A;  2CGP A;  1IXR C;  1ZRD A;  3HOW J;  1IN5 A;  1YS6 A;  2OBP A;  4HG2 A;  3OYL A;  2QM3 A;  3LWF A;  3KPH A;  2ZXJ A;  1EJ9 A;  4U0W A;  2YX4 A;  3K1N A;  5DS9 A;  4F52 A;  2FNP A;  1ZLK A;  4GCT A;  1Z3X A;  3ZP5 A;  1MBE A;  5JVG F;  3H92 A;  1ENH A;  3HYI A;  2KIU A;  4C9Y A;  4BE2 A;  1LKX A;  3K4C A;  1AA7 A;  2CUE A;  1GVD A;  3HOT A;  5K7F A;  3NWS A;  3REO A;  1HW5 A;  4JNN A;  1SGM A;  2VOP A;  2ZSH B;  4D7M A;  3C2B A;  3LSI A;  1J59 A;  4MQ9 F;  2BHZ A;  3V4G A;  1X58 A;  2HVR A;  1VQO I;  1BIA A;  4II2 A;  4ETS A;  4HDV A;  2IT0 A;  3O60 A;  4OWR B;  3HUG A;  3BTI A;  3HDD A;  1BJZ A;  1ZGJ A;  2KIM A;  3G2B A;  1WVR A;  5LFA A;  2F07 A;  1W5T A;  5D5U B;  4EJV A;  5GAD J;  1B72 A;  5DCF A;  3CO7 C;  5F04 A;  4LK1 F;  1Y0U A;  3RDI A;  5ICC A;  3ERE D;  3GTP J;  4ME9 A;  4U9N A;  2D5V A;  4CXF A;  3OYI A;  3GXO A;  2XRN A;  2L7M P;  4WK8 F;  1TC3 C;  2YVX A;  1WWX A;  4ZC3 A;  5JR3 A;  2R3S A;  2V6E A;  1OLT A;  4DJA A;  2IP2 A;  4CCN A;  4UNO A;  3HGY A;  3LA2 A;  3L00 A;  4K2E A;  3C07 A;  1IW7 F;  1OYI A;  1IAW A;  3GEU A;  2AS5 F;  2WAQ A;  3BRO A;  2B7E A;  1C0W A;  5D4R A;  4X0G A;  3VW2 A;  2EJR A;  2GA2 A;  3VW1 A;  1HW1 A;  4ZH4 F;  1G4D A;  1UAA A;  4L5J A;  2VOD A;  2ICW G;  3VEP A;  2KIF A;  4BAC A;  4FE7 A;  3KZZ A;  3CLO A;  5DM7 F;  4R1H A;  3HZJ A;  5EFY A;  3VOX A;  2LVS A;  2HPI A;  4XID A;  2BY0 A;  2R7Q A;  4CZC A;  3F8B A;  3JCU C;  2HDW A;  4HDU A;  3R60 A;  4ENN A;  1RKW A;  1TWF J;  5HBU A;  1KGS A;  4WF2 A;  3KKD A;  3GZ5 A;  2K27 A;  3WU1 B;  5IT3 A;  1R5H A;  2XDV A;  3WOD F;  4BQQ A;  4AU7 A;  1Z05 A;  3MN2 A;  3PQK A;  1IN6 A;  2IU5 A;  3FDY A;  2VB6 A;  4MTD A;  5ILU A;  5F0H A;  5LEJ A;  3C7J A;  2E36 A;  5KNL A;  4L62 A;  2EFN A;  3BCB A;  3ELK A;  3OMY A;  2K40 A;  5KAF C;  1E17 A;  1DP3 A;  4I6Z A;  1BW6 A;  1IXS B;  3HM5 A;  1J75 A;  3VYU B;  1FSE A;  3ZN1 A;  4HQM A;  1MMS A;  4ENM A;  3A03 A;  3P7N A;  5J4Y A;  1O3R A;  2IJL A;  1TL8 A;  1TWC J;  5EJC A;  2FRH A;  2ZFU A;  1JT0 A;  2IA1 A;  3OOU A;  3FXU A;  1ZEL A;  3RCO A;  2Z33 A;  2DG8 A;  2DOF A;  1H89 C;  3IH4 A;  1HDP A;  1IV6 A;  1BI3 A;  2HQR A;  2DO7 A;  4YIF A;  1N78 A;  1LEA A;  1RES A;  1WRJ A;  1K6O A;  1S72 I;  2AQF A;  5E1W A;  2DAO A;  1TNT A;  1U9N A;  2OJE D;  2WUI A;  4XLA A;  2CG4 A;  3K6G A;  4QIW N;  2FJI 1;  5BNG A;  4CCO A;  1JJ8 C;  1QO0 D;  2CQK A;  2H1L A;  2O3F A;  3W2A A;  1OFC X;  2ZKZ A;  3EUK L;  1ZYR F;  3CES A;  2VJJ A;  1KZH A;  1NG6 A;  2XRL A;  2B63 J;  4BS9 A;  2A68 F;  1Z7L A;  1BI2 A;  4E7K A;  2JVG A;  2M1B A;  4G6Q A;  4S04 A;  3Q9S A;  3CUO A;  1SAX A;  3LFK A;  1I1S A;  3RKW A;  4I76 A;  2R7D A;  4DZP A;  1KQ0 A;  1F4K A;  3WTT C;  4FX0 A;  4OIO F;  1VQK I;  2CSO A;  5F6F A;  1QRY A;  5EZH A;  3J81 Z;  4PJN A;  2R5Y B;  2DFH A;  1YW7 A;  2KZG A;  5TIS C;  4OOI A;  5EGO A;  2DT7 B;  1VQL I;  1XSV A;  1F36 A;  4Y33 A;  4Y15 A;  1W5C C;  4IRI A;  2ELJ A;  5L3C A;  1PJR A;  4XIC A;  2QQ9 A;  1V5G A;  5KVR A;  1FJL A;  3C18 A;  5F1J A;  2OTJ I;  2XSJ C;  2V7F A;  4RAZ A;  4BHC A;  4C2M J;  2VPR A;  3W2W A;  3K7A J;  5GAG J;  2VJ5 A;  4MGR A;  4XRS A;  2IGO A;  4I09 A;  3FIS A;  2PEX A;  1BA5 A;  2D6Y A;  4PCQ A;  2HQA A;  1TQM A;  3HTI A;  3EGQ A;  3C2G A;  1TNS A;  3AQS A;  2FOK A;  2KMU A;  1UEL B;  1LPQ A;  2GUH A;  3E6D A;  2JQ7 A;  3OYE A;  1V4R A;  2X6O A;  5LGT A;  3OIO A;  3K1P A;  4EGZ A;  3PL8 A;  2M4K A;  2KT0 A;  3BZC A;  2G7L A;  3V8L A;  2FJ1 A;  2PN6 A;  3HSR A;  4CYC B;  1H8A C;  4MFE A;  1DGW Y;  2VQG A;  4DOZ A;  4N0B A;  2JPB A;  2TRT A;  2NYX A;  2D2W A;  2E34 A;  2E19 A;  3L2C A;  4CUG A;  3O3K A;  3J80 Z;  3V8K A;  3BJA A;  2PQ8 A;  1T0F C;  3CJT B;  3LSK A;  4A3M J;  1FC3 A;  3V7R A;  2R5Z A;  1ZKG A;  2EIL H; 
#chains in the Genus database with same CATH homology
 4NEL A;  2K9N A;  2O7O A;  5D19 A;  4DW6 A;  1HCR A;  1FTZ A;  4PXI A;  1AKH B;  3KNW A;  3RH2 A;  1U8B A;  2MSY A;  2MW8 A;  2M0C A;  1WPK A;  2CU7 A;  4J19 A;  5EG0 B;  5C4Y A;  2JJ7 A;  1WCM J;  1ETK A;  5FKO A;  2WAQ N;  2NVQ J;  3ZQF A;  1MSE C;  1VI0 A;  4JX5 A;  3JRA A;  1OCT C;  3VVZ A;  1WH7 A;  2XSD C;  1ORK A;  5E3L A;  1JGG A;  3GTK J;  3JRG A;  3VUQ A;  3KKC A;  2DMQ A;  4DZJ A;  3JR9 A;  3BR2 A;  2HYJ A;  1IJW C;  3S16 J;  4KWA A;  5H9T A;  3B6A A;  3G1M A;  5IYC J;  4B4C A;  4DYC A;  1B72 B;  1UMQ A;  3TP3 A;  2VI6 A;  2UXO A;  4UUT A;  3V6G A;  3ANG A;  1GT0 C;  5JLX A;  2ZOZ A;  2YUS A;  5FMP A;  1QPI A;  2ZB9 A;  4JP0 A;  4M6V A;  3HOZ J;  4A3F J;  2YU9 J;  3BTJ A;  5FKK A;  3NRG A;  4MXM A;  2HOS A;  1PUF A;  2QF7 A;  3CQZ J;  3LSJ A;  1TWH J;  2JA7 J;  2RAE A;  3B81 A;  1FIP A;  3FRQ A;  2GBY A;  1OCP A;  5J1Y A;  5F27 A;  1I50 J;  4ABZ A;  4B3A A;  2XB0 X;  4A3B J;  3NXC A;  1ZK8 A;  1MNM C;  3M4O J;  3BJB A;  3BQZ A;  3ZQL A;  1JUM A;  4MIM A;  3BR5 A;  5IP6 A;  5IOZ A;  5D18 A;  1IDY A;  4IHY A;  1HOM A;  2WV1 A;  3K2A A;  2O8K A;  3GTG J;  5C44 J;  4JL3 A;  4A3L J;  1I6H J;  3GTO J;  3ZQC A;  2DMP A;  2GFN A;  1Z0X A;  2CRG A;  4MK6 A;  1TWA J;  1EF4 A;  1K83 J;  1B8I B;  1GDT A;  4S0H B;  1XS9 A;  3MNL A;  2QWT A;  1NTC A;  1POG A;  2XGD A;  5FLV A;  2R92 J;  3Q0W A;  3CCY A;  3LSG A;  3G7R A;  3LWJ A;  2ME6 A;  4JKZ A;  1F43 A;  2JA8 J;  5FKM A;  2NVT J;  3Q3S A;  2FD5 A;  3GTL J;  4M3B A;  4Y7N J;  3BNI A;  2DMT A;  1G2H A;  2I10 A;  3RQI A;  4UUS A;  3OSG A;  3LOC A;  4V2F A;  5AQC A;  5J1R A;  1JJ6 C;  5J1U A;  5K58 A;  1YRN A;  1Y1V J;  2P81 A;  1SFO J;  4IHV A;  2RAS A;  3CDL A;  3Q0V A;  4AC0 A;  4M3D A;  3D1N I;  3QPL A;  3S14 J;  4ICH A;  5C4J J;  1S7E A;  3G1L A;  1JKQ C;  3GTM J;  3GBG A;  3LSR A;  3PO2 J;  3G56 A;  3O8H A;  3JRI A;  3IH2 A;  2H1K A;  2LK2 A;  3A02 A;  2EBI A;  2DG7 A;  1APL C;  4X6A J;  2G0E A;  3I4N J;  2CQQ A;  2JK3 A;  3WHC A;  3W6V A;  4UDS A;  2DA6 A;  2ID6 A;  2AO9 A;  4GCL A;  3PPB A;  3VW0 A;  3BG3 A;  3A01 A;  2VKV A;  2OPT A;  2OER A;  2XB5 A;  1GV5 A;  1MBF A;  2XDN A;  3KZ9 A;  2YS9 A;  3BR1 A;  4DYR A;  3FK7 A;  2EQR A;  2JWT A;  2LTP A;  1JUP A;  4BKX A;  1WGX A;  3E7L A;  3ANP A;  2JN6 A;  2E2I J;  1Y1W J;  1JT6 A;  2M8G X;  3QKX A;  4LOC A;  3VPR A;  2E1O A;  2GEN A;  3VOK A;  3NAR A;  3HTA A;  1ETQ A;  1T33 A;  1P7J A;  2HXI A;  3S1M J;  5CXI A;  1TWG J;  5F0C A;  3S1Q J;  1I3Q J;  2ZCN A;  1FIA A;  1X2M A;  3HTJ A;  5EGO B;  4RDU A;  1IC8 A;  1XC5 A;  2Y9Z A;  2QTQ A;  2LY9 A;  4L5E A;  5GP9 A;  2EZK A;  2NP5 A;  5C4X J;  3ZOB A;  2NP3 A;  5FLM J;  3Q0U A;  1MSF C;  4FIS A;  2MGQ A;  3QBM A;  1W0U A;  1NK2 P;  3DEW A;  2XPU A;  5K7H A;  1IG7 A;  2R5Y A;  1SAN A;  2CJJ A;  1MH3 A;  3BTC A;  2DJN A;  3COL A;  1X2N A;  4AYB N;  3S15 J;  5C3E J;  2ZOY A;  5M3M J;  4D7N A;  1RET A;  2QCO A;  1ZGW A;  3O8G A;  1LE8 A;  2NVY J;  1MH4 A;  2VKE A;  2EZI A;  3H0G J;  2UXP A;  2DA7 A;  3PO3 J;  2IAI A;  3PM1 A;  4DYQ A;  3CJD A;  1HDD C;  3HOX J;  4XRM A;  3VIB A;  5HSZ A;  2DN0 A;  3DPJ A;  5FHP A;  2M34 A;  2AHQ A;  2YVE A;  1VF9 A;  1W0T A;  2W48 A;  3P9T A;  2K9S A;  2HKU A;  1FTT A;  3F0C A;  4A3I J;  4BY7 J;  3H3V K;  1U78 A;  3MKL A;  2COB A;  2X9D A;  4RBO A;  3HGG A;  3IH3 A;  4JX4 A;  5HOD A;  1LFB A;  3BG9 A;  4G12 A;  4MLO A;  5IP7 J;  2R5Z B;  5CXG A;  1XG1 A;  4W97 A;  2MG4 A;  1FEX A;  2FQ4 A;  3JRB A;  2Y9Y A;  3HBL A;  2N8G A;  3BHQ A;  4D5F A;  3BR0 A;  2HOA A;  5FKN A;  5JLW A;  2NOG A;  5M5W J;  2LLK A;  4A69 C;  5EEA A;  1ZQ3 P;  4CYC A;  5J3L A;  5IYD J;  2EZL A;  4A3D J;  2IBD A;  4YZE A;  1GUU A;  1MBG A;  3L1P A;  2FBQ A;  2O7T A;  2ZCM A;  3RZO J;  2ELK A;  3CRJ A;  1H88 C;  3F1B A;  2RHA A;  1JUS A;  1JKP C;  3SFI A;  3BRU A;  2G3B A;  1ZR2 A;  2E2J J;  5M5Y J;  3HOW J;  3NNR A;  1DU6 A;  3QPS A;  1AKH A;  5DAJ A;  5DS9 A;  1IDZ A;  5GPC A;  3CMY A;  4GCT A;  1MBE A;  4X1E A;  5EG0 A;  1ENH A;  4D5C A;  4AC6 A;  2HDD A;  4NN1 A;  2G7S A;  2DA1 A;  4GFL A;  1RR7 A;  1U9O A;  3BCG A;  2CUE A;  1GVD A;  2HI3 A;  5EF6 A;  3CWR A;  3ON2 A;  5K7F A;  4XRS G;  4IHW A;  4V2G A;  4JNN A;  3V78 A;  4M3F A;  3LSP A;  1SGM A;  4A3G J;  4D7M A;  3C2B A;  1HLV A;  2VUM J;  1A5J A;  3RKQ A;  2LR8 A;  1X58 A;  2L7Z A;  5FJ8 J;  3JRH A;  3O60 A;  3HEF A;  5EZG A;  4EEF G;  3BTI A;  3HDD A;  1ZR4 A;  1BJZ A;  2NS8 A;  2XPV A;  2F07 A;  4FTH A;  2M2E A;  1PUF B;  3HOY J;  4C3J J;  2L0K A;  2L9R A;  1IRZ A;  1B72 A;  2X48 A;  3HE0 A;  5F04 A;  2DA2 A;  3GTP J;  2G7G A;  4ME9 A;  2D5V A;  4GFK A;  3JRF A;  4MO7 A;  4Y52 J;  2L7M P;  3G1O A;  1TC3 C;  3E7Q A;  2IEK A;  1MBH A;  3ON4 A;  1BW5 A;  3HGY A;  2NVX J;  3C07 A;  3GEU A;  3IUV A;  3HKZ N;  2R0Q C;  3IV5 A;  4JYK A;  5EYR A;  2Y2Z A;  5GPA A;  3VW2 A;  5M3F J;  1OJL A;  2JMW A;  3VW1 A;  1UI6 A;  4NDL A;  2HOT A;  1RPW A;  1O4X A;  3ZQI A;  3S2H J;  3BT9 A;  2PMZ N;  4FE7 A;  4BBS J;  3BG5 A;  4IEJ A;  3VOX A;  5EFY A;  2LVS A;  5IOY A;  2R93 J;  2QOP A;  2OF7 A;  2HQ5 A;  4XID A;  1ETX A;  1ETW A;  3TP0 A;  3JRD A;  4M3E A;  4AUX A;  1RKW A;  1TWF J;  2K9Q A;  5HBU A;  2L7F P;  3HTH A;  4BXX J;  3KKD A;  3VP5 A;  3HOV J;  4UUS B;  2NS7 A;  2ME0 A;  1VFC A;  1JKO C;  2ZCX A;  2XGE A;  3MN2 A;  3NI7 A;  1YRN B;  1UG2 A;  2CUF A;  2IU5 A;  2Y30 A;  1B8I A;  2DA5 A;  2REK A;  5F0H A;  5F0F A;  1GV2 A;  4L62 A;  4M3G A;  3NAU A;  2K40 A;  5IYB J;  4GFB A;  2E2H J;  4I6Z A;  1BW6 A;  3HM5 A;  4CGR A;  1AHD P;  3SJM A;  2XPW A;  4QSH A;  3A03 A;  2JA5 J;  3BR6 A;  1Z77 A;  4ACI A;  1ZTR A;  1TWC J;  3JRC A;  2GM4 A;  1JT0 A;  3M3Y J;  2GLO A;  3OOU A;  3WHB A;  4B1R A;  3UKG A;  3A01 B;  5K7Z A;  3JRE A;  1ETV A;  1K61 A;  2DG8 A;  2FX0 A;  2OI8 A;  1H89 C;  1QVT A;  9ANT A;  3IH4 A;  5E3M A;  1HDP A;  1IV6 A;  2LKX A;  1A6I A;  1D5Y A;  5D1R A;  1RES A;  3FIW A;  5E3N A;  3BQY A;  5FKL A;  1U9N A;  3TW6 A;  1R9T J;  2WUI A;  3VVY A;  1QVU A;  1NK3 P;  4QIW N;  1WI3 A;  5HAW A;  5BNG A;  4BBR J;  2ECB A;  4C3I J;  2DMU A;  1JJ8 C;  2Q24 A;  2UXU A;  1OFC X;  2V57 A;  1ITY A;  2DTZ A;  3LJL A;  1E3O C;  4XK4 A;  2M9H A;  3TED A;  3LHQ A;  3GTJ J;  5FGL A;  4HNV A;  2XRL A;  3RD3 A;  2B63 J;  1Q1V A;  3FK6 A;  3AQT A;  4QTR A;  3EUP A;  3GTQ J;  1JTY A;  3HIM A;  3S1R J;  1T56 A;  3NPI A;  2YVH A;  4I76 A;  2JA6 J;  4DZP A;  2LFB A;  3DCF A;  1RKT A;  2PZ9 A;  3S5R A;  4A93 J;  2LD5 A;  4IHX A;  1QRY A;  5EZH A;  1BL0 A;  4C3H J;  2O9L A;  1P7I A;  2R5Y B;  4A3E J;  2H8R A;  2NX4 A;  3GZI A;  1ETO A;  5IPA A;  5EGO A;  2UXH A;  1UI5 A;  1F36 A;  3FKI J;  5F08 A;  2LP0 A;  1MBK A;  1LE8 B;  3T6N A;  5DTD A;  4XIC A;  3S2D J;  1UHS A;  2HYT A;  1FJL A;  1JTX A;  3B6C A;  4A3K J;  2DA4 A;  5M5X J;  5F1J A;  2EZH A;  2Y0S N;  1VND A;  1MBJ A;  4C2M J;  2EH3 A;  2VPR A;  3K7A J;  3MVP A;  5E3O A;  2TCT A;  3ZQH A;  4FE4 A;  2WB1 N;  3SDG A;  3TW7 A;  4XRS A;  2XGC A;  2DMN A;  3FIS A;  2D6Y A;  1BA5 A;  3QQA A;  3S17 J;  4JX6 A;  3HOU J;  5CW8 A;  2R7Z J;  3I4M J;  1ETY A;  4MFD A;  3VVX A;  2WGB A;  3BR3 A;  2CQX A;  3OSF A;  3HTI A;  3EGQ A;  4FCY A;  1WH5 A;  1JKR C;  3AQS A;  2ID3 A;  4AF5 A;  2GUH A;  4BY1 J;  5EDN A;  3LNQ A;  2UXI A;  2X6O A;  3OIO A;  2DA3 A;  2Y31 A;  1IGN A;  2PBX A;  4A3J J;  1IUF A;  2KT0 A;  2G7L A;  4CYC B;  2FJ1 A;  1CQT A;  4A3C J;  3JSJ A;  4HKU A;  1H8A C;  4GCK A;  3ZQG A;  4MFE A;  2QIB A;  1HF0 A;  5IP9 J;  1AU7 A;  2W53 A;  2KDZ A;  2ECC A;  4W1U A;  2TRT A;  3RZD J;  1LFU P;  3PAS A;  2E19 A;  2HXO A;  1DU0 A;  3S1N J;  3HB9 A;  4A3M J;  2R5Z A;  1ZKG A;  3BTL A;  2QKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...