3DEWA

The structure of a putative tetr family transcriptional regulator from geobacter sulfurreducens pca.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
192
Chain Sequence
DCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The structure of a putative TetR family transcriptional regulator from Geobacter sulfurreducens PCA.
rcsb
source organism Geobacter sulfurreducens
molecule tags Transcription regulator
total genus 69
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17938 TetR_C_29 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3dewA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dewA02
2VPRA 1PUFB 1P7IA 2LVSA 3F0CA 2WUIA 2GUHA 1ZR2A 2CU7A 3VVXA 3OSFA 1JUSA 2JWTA 1TWHJ 1MSFC 2QCOA 3GEUA 2R5YA 1LE8A 1B72A 4IHXA 5EDNA 1O4XA 3GTOJ 5AQCA 3K7AJ 1IG7A 1WH5A 3EGQA 3G1LA 1E3OC 1Z0XA 2CJJA 2PZ9A 3KZ9A 1P7JA 1UMQA 3GTPJ 5IOZA 2R5ZB 4BBRJ 1BW6A 2MSYA 3NXCA 4B4CA 4D7NA 4ICHA 1WPKA 2HXIA 1FIPA 1TWFJ 3HKZN 2ZCMA 5DS9A 2O7TA 5CXIA 1UI6A 3B6CA 3W6VA 3Q0VA 2HI3A 3ZQHA 4BY7J 3B6AA 3ON2A 4CGRA 4CYCA 1ETYA 1U78A 2VUMJ 3MVPA 4LOCA 2W53A 1NK3P 3OSGA 1ENHA 5J1RA 4ME9A 1T33A 2NP3A 5E3LA 2D6YA 2Q24A 5JLWA 4M3GA 2RAEA 3RZDJ 1FEXA 1I3QJ 4AYBN 2LK2A 3V78A 2CUFA 3S1QJ 2HOSA 4JKZA 1XG1A 3JRGA 5EGOB 2LY9A 3NI7A 5M5WJ 4A3DJ 1YRNB 2REKA 1OJLA 5F1JA 1AKHA 2XRLA 1LFUP 3GTGJ 2QIBA 4M3DA 3G1OA 3NPIA 3JRAA 3NNRA 3JRHA 4UUTA 2HQ5A 3VUQA 1K83J 2Y9ZA 5IP9J 5C44J 1JGGA 2VKVA 4AC6A 4QTRA 1GDTA 2EH3A 5BNGA 2DMPA 1OFCX 4JYKA 1ETWA 2MG4A 2CRGA 4FE4A 2FD5A 5D18A 5IP6A 4BY1J 3VPRA 2V57A 1ZKGA 4V2FA 3JRDA 4HKUA 2DA4A 5C3EJ 3I4NJ 1DU0A 4IHVA 2E1OA 2EQRA 5FJ8J 3LSPA 1SANA 3JRBA 1RPWA 4QSHA 3VW0A 5EZHA 2UXHA 3NAUA 3DPJA 2NS7A 3S5RA 3O60A 4NN1A 2XPVA 1IRZA 4XRMA 3BTLA 9ANTA 3HTJA 2H1KA 4C3HJ 4Y52J 1HDPA 3BCGA 2EZHA 3HBLA 3EUPA 2X6OA 5J3LA 2QOPA 3IH4A 1IUFA 3IH3A 2DG7A 2EZIA 1WCMJ 4GCKA 2I10A 5K7ZA 2WGBA 2GFNA 4A3LJ 5CW8A 5E3OA 4DZJA 3PO3J 5J1UA 3CWRA 3FK6A 1MNMC 1GT0C 3TEDA 3BRUA 3DEWA 4GFLA 2M0CA 2WB1N 3CQZJ 3H0GJ 1HF0A 5HAWA 3TW6A 3QPSA 4C3IJ 2XSDC 2ZOZA 1MBFA 3HOZJ 2XB5A 2Y2ZA 1ZTRA 2P81A 4X1EA 5IYDJ 2XPWA 4A93J 2DN0A 2DA1A 2ME6A 3HOYJ 3VW2A 2DJNA 1F43A 3MKLA 2D5VA 3L1PA 3BHQA 2LR8A 3H3VK 2JMWA 3Q3SA 5F0HA 3BTIA 3RKQA 3BG5A 5EG0B 4D7MA 3VOXA 2K9NA 2E2HJ 5C4JJ 4D5FA 2NVQJ 2ECBA 1RR7A 3GTJJ 1R9TJ 2LKXA 4DW6A 1G2HA 3AQSA 1ZR4A 2ID6A 4A3MJ 3NRGA 1WH7A 2HXOA 3HTIA 1B8IA 2YU9J 1ETVA 4A3GJ 2NVTJ 3BG3A 5FKNA 1Q1VA 1QVTA 4V2GA 2F07A 2GM4A 2IAIA 4EEFG 2COBA 1IC8A 1BL0A 2QF7A 2UXUA 5E3NA 2FBQA 3HTAA 2UXOA 4FE7A 2JA7J 1JJ6C 3ZQIA 1IDZA 3CDLA 2DMUA 4YZEA 4I6ZA 4GFBA 2NX4A 2QWTA 1RESA 3M3YJ 3NARA 3SFIA 2W48A 5DTDA 4S0HB 1X58A 1MSEC 3UKGA 1Z77A 5E3MA 3VP5A 1IJWC 2UXIA 2R92J 2ID3A 2ZCXA 1JT6A 3WHCA 3BR2A 4GCTA 4DYRA 4RDUA 3A01B 2AO9A 4XICA 3LHQA 4MO7A 1GV5A 2DA2A 4M6VA 2TRTA 1JUMA 3HDDA 5HBUA 2ELKA 4HNVA 1T56A 4GFKA 1RKTA 2YVEA 3VVZA 2IBDA 1BJZA 1RETA 2HDDA 4FISA 1RKWA 5FLMJ 5FHPA 4I76A 1Y1WJ 1WI3A 2HKUA 3BR1A 4M3EA 3JR9A 1MH3A 2RHAA 5K58A 2NS8A 2Y9YA 3LWJA 1OCPA 3M4OJ 5HSZA 4UUSA 3HOUJ 2GENA 4AF5A 3BTJA 3SJMA 3C2BA 3WHBA 1TWGJ 3LNQA 1JKQC 3HOVJ 5GPCA 4MK6A 4IHYA 3HEFA 5J1YA 4L5EA 2N8GA 5JLXA 5IYCJ 1NK2P 5CXGA 3S2HJ 1SFOJ 2M34A 1ORKA 5F08A 3ZQFA 2JK3A 3CJDA 1VNDA 1JUPA 4ABZA 3GZIA 3TP0A 1QPIA 3TP3A 4AUXA 2R5YB 1LE8B 1B72B 3RQIA 4MFDA 1ETOA 4A3IJ 4KWAA 2ME0A 3E7QA 2HYTA 3OOUA 5IOYA 1BW5A 2O9LA 1GV2A 2R93J 5F27A 2E2IJ 1PUFA 1LFBA 2VI6A 5F04A 3COLA 3RH2A 4J19A 3S15J 1UG2A 3BT9A 2MGQA 3IUVA 3HIMA 5GP9A 5EEAA 2UXPA 4D5CA 2G0EA 3G1MA 4G12A 2Y31A 4DYQA 2PBXA 3OIOA 3HM5A 4A3EJ 4JX4A 3HOWJ 4JX5A 1MBKA 1A6IA 1JTYA 1Y1VJ 3KNWA 2L7MP 1MBHA 5F0CA 2DA5A 4X6AJ 2LFBA 3BR6A 4MIMA 4BKXA 3VVYA 1U9NA 3JRCA 2EZKA 3VOKA 3JRIA 4CYCB 2JJ7A 2L9RA 2O7OA 2DMTA 3VIBA 2NP5A 4JNNA 3IH2A 4ACIA 1JJ8C 1I50J 1TC3C 1AHDP 2AHQA 3PM1A 3Q0WA 2R5ZA 3JREA 2RASA 1JTXA 1ETXA 5FKLA 2K9SA 5M3FJ 4JP0A 3G7RA 3QQAA 3VW1A 2L0KA 2TCTA 3BG9A 2XGEA 3CCYA 1CQTA 1IGNA 3FKIJ 3KKDA 2XGDA 3HGGA 4UUSB 2MW8A 1AKHB 1HLVA 3BQZA 3QKXA 1IDYA 3S14J 1ZQ3P 2OPTA 3S17J 3SDGA 1U9OA 2DTZA 3BR5A 2GLOA 3K2AA 4AC0A 4XRSG 4B3AA 1W0TA 1JT0A 2EZLA 2NOGA 1FIAA 1H8AC 1S7EA 5C4YA 2HYJA 3S1RJ 4A3KJ 2B63J 3ZQLA 2LTPA 2M8GX 1DU6A 1TWCJ 2XGCA 1NTCA 5M5YJ 2LD5A 2QKOA 4C3JJ 5EGOA 3LJLA 3PASA 1EF4A 2Y0SN 3LSGA 4B1RA 5FKOA 1YRNA 3TW7A 3A02A 4RBOA 3ON4A 1SGMA 5C4XJ 5IP7J 2L7ZA 3Q0UA 2LP0A 4XIDA 2DMNA 4M3FA 1JKOC 3C07A 2Y30A 1ETQA 4XK4A 1VFCA 1XC5A 2FJ1A 3HOXJ 3ANPA 3ZQGA 4C2MJ 1FJLA 4L62A 1X2NA 2FX0A 2G7SA 2IEKA 4IHWA 3FRQA 2R7ZJ 2JN6A 2JA8J 5K7HA 3ZQCA 5FGLA 2DA6A 1MBGA 2HOAA 3BNIA 4JX6A 2WAQN 3BR0A 3F1BA 1W0UA 3BTCA 1HDDC 2CQXA 5H9TA 2CQQA 3MN2A 1AU7A 2JA5J 3LSJA 2ECCA 4DZPA 4PXIA 2XB0X 4Y7NJ 2LLKA 2YVHA 2JA6J 2OERA 5M5XJ 5IPAA 2KT0A 3JSJA 1POGA 3S1NJ 5EYRA 2X9DA 2K9QA 3LOCA 2G7LA 4W97A 2ZB9A 3MNLA 4BBSJ 2L7FP 2DA7A 5FMPA 3QPLA 1WGXA 3RZOJ 3G56A 2XPUA 3BQYA 3CMYA 2DA3A 2DMQA 1IV6A 1QVUA 1BA5A 4UDSA 1FTZA 3RD3A 2M2EA 5M3MJ 3P9TA 3HE0A 2CUEA 4NELA 1A5JA 2GBYA 1ETKA 1B8IB 1HCRA 3GTQJ 3S2DJ 3BR3A 1X2MA 2E19A 2HOTA 3FIWA 1JKRC 5EFYA 1HOMA 1GUUA 4MFEA 1FTTA 3E7LA 1I6HJ 3HTHA 2NVYJ 4A3JJ 5EG0A 2R0QC 3IV5A 1ITYA 3S16J 4GCLA 3HB9A 1OCTC 3PPBA 5D19A 4FTHA 2OF7A 1K61A 1TWAJ 1MBJA 1H89C 3GBGA 3S1MJ 2ZOYA 2X48A 5DAJA 2G3BA 1VF9A 3BJBA 3HGYA 2PMZN 4NDLA 1D5YA 3O8GA 3T6NA 4MXMA 2EBIA 1MH4A 3GTLJ 3V6GA 3D1NI 1ZK8A 4M3BA 2YUSA 1VI0A 3A03A 1QRYA 5EF6A 4A3FJ 4W1UA 5FLVA 3GTKJ 3FK7A 2FQ4A 3KKCA 5IYBJ 1GVDA 2VKEA 3I4MJ 2O8KA 3PO2J 3ANGA 5F0FA 1XS9A 3QBMA 2H8RA 2M9HA 3GTMJ 2IU5A 2WV1A 3B81A 4A3BJ 2K40A 5GPAA 2DG8A 3LSRA 5D1RA 2XDNA 2QTQA 1JKPC 3DCFA 4A3CJ 3FISA 1U8BA 2KDZA 4DYCA 4IEJA 2NVXJ 3A01A 5FKMA 1MBEA 2OI8A 1F36A 1H88C 2G7GA 4A69C 2YS9A 5K7FA 1UHSA 2ZCNA 5HODA 5FKKA 3JRFA 4FCYA 1APLC 1UI5A 4XRSA 1ZGWA 4QIWN 4BXXJ 2E2JJ 3AQTA 3CRJA 4JL3A 5EZGA 3O8HA 4MLOA 3ZOBA
chains in the Genus database with same CATH superfamily
3TOBA 3EUAA 2NNNA 4E7ZA 2XAHA 2XIGA 1K78B 5IY5H 5K5RA 4LG0A 4PZJA 2GUHA 3DLLF 4RAZA 3KP5A 1SD4A 3CJRB 3OSFA 4M9XA 4HQEA 5BPIA 1ZREA 4H0EA 4KIBA 3L2UA 2KISA 4HF1A 3LSMA 4U87A 2E7XA 4PSXA 1HSTA 1KU2A 3CUQC 2MH2A 4KN7X 5AQCA 4XSZF 3CLQA 1XCBA 1Z05A 1E3OC 1B9NA 2MD0A 1P7JA 1S5LC 5ED4A 1UMQA 2KJCA 2R5ZB 2XV4S 3KYLA 2MFZA 4B4CA 1WPKA 1P4WA 5DS9A 2O7TA 2HYGD 4JK1X 3RPQA 2VJIA 2L4MA 2HI3A 3CCEI 4J00A 1Z9CA 4CGRA 1Z7LA 4OAZA 2RN7A 3OYAA 1M1EB 2HQRA 5K1YA 2VUMJ 1UB9A 5LRSA 2HU9A 3ZMTA 5D5XB 1EJ9A 4IXAA 2IVMA 1ENHA 5J1RA 1OR7C 2KPMA 1T33A 4ENJA 2ZXHA 2Q24A 3T1BA 2RAEA 3RZDJ 1J59A 1I3QJ 2JUGA 2XSJC 2WY8Q 1BI0A 4RLFA 3S1QJ 3R4KA 2VJ5A 1VQNI 2VE9A 1I1SA 1XB4A 4N9IA 3JTGA 2R7FA 5F1JA 1AKHA 4I0BA 3SXYA 1BI3A 2E71A 2MD5A 4ASNA 3NPIA 4ZDLA 3JRAA 3QWLA 3NNRA 3JRHA 4GRIA 2HQ5A 1Z3YA 3DKXA 1SD5A 3FBNB 5LEKA 2IA1A 4AC6A 1DDNA 4AWXB 2HKXA 2DMPA 2GXGA 2RQQA 5B1AH 4KJZA 2MG4A 4FE4A 3PSFA 1G3YA 4EATA 3N97A 2KZVA 5D18A 3HXLA 4EV0A 5IP6A 1D8JA 2I8DA 1FYLA 1UZCA 2BY2A 3GZ6A 2NS0A 2M30A 3CESA 2DODA 2CFXA 1UHWA 4S05A 4IRGA 4G7ZF 4HKUA 1FP1D 4IZZA 4IHVA 1D8KA 5CPRB 3LMMA 5FJ8J 2C6YA 1IZ1A 3LSPA 4M74A 2CV0A 1P92A 1YE9A 4BAYA 4QSHA 1G3SA 1W36D 3C1DA 5EZHA 5JHUA 1KU9A 3ZR8X 4XRMA 3BTLA 2X6XA 3ECOA 2ZO4A 4PFOA 1VQOI 4IF4A 3HBLA 2M5WA 3IH4A 1MMSA 4EJWA 2VONA 1JE8A 4WK8F 2PMHA 2DG7A 4GCKA 5K7ZA 1QA6A 1SMYF 1EV7A 4A3LJ 1FOYA 5J1UA 2XRNA 3JTHA 3H9JA 2ZFUA 2PJRA 3BRUA 3K70D 4N4NB 1CF7A 3AG1H 5HAWA 4P5OA 4C3IJ 3ABTA 2XSDC 4PCQA 4J01A 5FLXZ 3EYYA 2XUBA 4RS8A 4U0VA 2VJJA 4FQGA 2ME6A 2DJNA 2OC6A 1F43A 2D5VA 2XKOA 4XLPF 3CF5F 3Q3SA 2FBIA 5FFZA 4D7MA 2QBYB 4F3QA 4OMYA 3ZMDA 2ECBA 3BG6A 4N4OB 4ZJZA 4U9LA 1RR7A 1R4NB 1KGSA 3CUQA 1R9TJ 4E70A 1G2HA 3OIPA 5KAFC 2QYOA 2WV0A 3HSFA 3OYDA 1YJWI 4DGWB 4IQ4A 4R1HA 1IF1A 3I58A 2L02A 3OS0A 2YU9J 1S9HA 1I39A 3LQRA 3BG3A 5DCFA 5FKNA 2F07A 1SD7A 5HDNA 4HDVA 2F2EA 2F4MB 3HTSB 2COBA 1IC8A 4WXHA 3CLOA 4BNCA 2A2FX 2E5ZA 2QSGX 4EJTA 2HWVA 2V6CA 1YW7A 2JA7J 5ICEA 5F1RA 1IXSB 1X1CA 4RB2C 3ZQIA 4YZEA 4HDUA 1VTNC 4AU7A 2YU3A 2NX4A 1RZ4A 2QWTA 4ZDPA 3WTYC 1QHHD 2KMUA 3V42A 2K3PA 3UKGA 1O7LA 2DFFA 1YG2A 1OR7A 2DU9A 2ID3A 3R6SA 1R5ID 3BR2A 3S93A 3A01B 4KNYA 3KYDB 4IX7A 1E2XA 2B1EA 3CCQI 5BPDA 3BY6A 1OCRH 4HNVA 1T56A 4GFKA 2YVEA 3ECHA 1LNWA 2DFHA 4FISA 4KDPA 4I76A 5HS8A 2HKUA 1MH3A 5K58A 2AQEA 1ACIA 5HSZA 2IPQX 3COAC 4UUSA 4B43A 2GENA 2E34A 4ANJA 4BH9A 2UZKA 2CWEA 3G2BA 5GPCA 3H3UA 3VOEA 4IHYA 5CXGA 1V5EA 2Y75A 3NEUA 3TL4X 3HC7A 2DPUA 3M1EA 3P9KA 3TP0A 2HTJA 4RA2A 2BGCA 3TP3A 1N77A 3FWEA 1LE8B 1B72B 2HVQA 3IWZA 3RQIA 1ETOA 1D3YA 3EETA 3D0SA 4B47A 4CUGA 3TQNA 1BW5A 1GV2A 2QGUA 2Y0MA 5AIPA 5E17F 1K78A 5CKTA 3COLA 3WU2C 3OYLA 4J19A 2IS1A 3KEYA 3IUVA 5GP9A 3TOAA 2OZUA 2VJ4A 3F72A 3G1MA 4G6QA 4AIKA 3PNYA 1XCVA 2FA5A 3DBHB 4A3EJ 1A6IA 2RQPA 2DYRH 3M07A 3RQ4A 2P7CB 2DA5A 2QSHX 4X6AJ 5FROA 4BKXA 2LH9A 5L3DA 1O3SA 4CYCB 2F6CA 2JJ7A 2L9NA 1U5TB 2NP5A 3ERED 4ACIA 1JJ8C 1YYVA 3SEQA 1RUOA 2VQCA 1I50J 5HS7A 1FOWA 2M7BA 1YX3A 2AHQA 1FLIA 2R5ZA 2RASA 1IXRC 1JTXA 5M3FJ 3G7RA 2K9SA 1B9MA 4HSTA 4JP0A 3V7CA 6PAXA 3SWHA 3VW1A 3OR1C 2YSRA 3PUFA 3BG9A 2QSFX 2XGEA 2YPRA 3AG4H 1IGNA 2XGDA 2MW8A 1HLVA 1T95A 3QKXA 2CFOA 4Q47A 4U9NA 2DBBA 5GTIC 2PFBA 3S17J 3SDGA 1DPRA 4NB5A 3HTUA 5D5UB 2BY3A 2RGVA 2KKOA 1H8AC 1SFEA 4BYYA 2Q1ZB 2B9SA 2BXZA 4ESBA 4A3KJ 2B63J 2M8GX 5L3BA 2DFIA 3DWLE 2QKMB 1TWCJ 3ZN1A 3GFMA 1OMIA 3V8KA 1QU3A 5DEQA 2JPCA 2JT1A 4L18B 3DP7A 3TW7A 3WE3A 3D5LA 5C4XJ 1FZPB 4IRIA 2KDOA 1U0JA 4I02A 1ZAOA 4F93B 1S8NA 1R22A 4PJLA 4A2UA 3C18A 4YIRX 4XLHA 3VWBA 2DMNA 1G6NA 1WQ2A 3WTZA 2QZ8A 2EK5A 3D5RC 1R49A 1EH8A 1FNNA 1Y8QB 1KZHA 2DK8A 4D9JA 1UFMA 4EVIA 3BLYA 3E0JB 1A31A 1X2NA 2HEOA 1E17A 4PK4A 4EJUA 2IEKA 3FXOA 3OYNA 1NH3A 4IHWA 3VSKA 2R7ZJ 3RTRA 5K7HA 3F8NA 5FGLA 1Z6TA 2DA6A 3FDYA 3ABMH 1K4SA 2KZGA 2ZXJA 2BE5F 2HOAA 5E1XA 2VOPA 2DK5A 1AWCA 1K79A 1DP7P 1W0UA 3H36A 4LD5A 3GEZA 5JHFA 3MN2A 1AU7A 2JA5J 4DZPA 4HRIA 3F8BA 2XDVA 1SMTA 2ELHA 2LG4A 2JA2A 3MWMA 3JSJA 1R1TA 2KHMA 2Q0OA 1AOYA 1ZRCA 4RGUA 2HPIA 4W97A 4KISA 3MNLA 4BBSJ 4PSWA 1T08B 3E97A 3FHZA 5FMPA 2R7WA 1WGXA 3RZOJ 3BQYA 1I5ZA 3CMYA 2A3SA 2DMQA 1QPMA 3UR3C 4DNCA 2OQGA 1G4DA 2BXYA 4LIUA 2M4KA 2LBFB 4CA0A 3RD3A 5FLXK 4E6KG 4C2MA 1K6OA 1ETKA 5CVUA 2IW5A 1HKQA 3GTQJ 5LHHA 3SEZA 3E5QA 2W4SA 2ZBKA 1HOMA 5B1BH 2EIJH 3E7LA 1B6AA 2UUZA 4II3A 1J09A 1TQIA 2AQFA 3S2WA 2DOFA 4BHPA 3KP2A 2QBYA 3S16J 4GCLA 2XAUA 3HL2A 1R23A 1TWAJ 3K2ZA 1Y0UA 1JGSA 3S1MJ 2HZTA 1BR2A 2VXZA 3JSOA 4B09A 1S6LA 3K10A 1VF9A 3BJOA 5HNFA 2PMZN 1X1BA 3CP8A 1W5CC 4Y33A 2VBXA 2EBIA 3MKWB 2DOEA 2KIFA 3OL3A 4Z2YA 2PMUA 3A03A 1WRJA 4W1UA 4KITB 2L54A 1FT9A 1BN5A 2FQ4A 3RCOA 3PO2J 3KKCA 1FSHA 1AA7A 5HLGA 1FOKA 2H8RA 2R7VA 2W25A 5H2FC 2WV1A 2AS5F 1XX5A 3VYTB 2K40A 4A3BJ 2DG8A 3LSRA 1ZH5A 2PFVA 5D1RA 3W2WA 1IN4A 5DCMB 4BHCA 4L0YB 1G3WA 1KYWA 1QBJA 2CSOA 4BACA 4OOIA 2KDZA 3FM5A 4DYCA 4IEJA 3A01A 3I3LA 2G7GA 2IGMA 3HRSA 4V19K 2OUMA 3KPHA 1UHSA 3GO5A 2DAOA 3WU1B 2WBMA 1FPQA 4DQ2A 1FWZA 2E2JJ 3KEQA 5FGMA 4Y13A 3ML6A 4JL3A 2V9PA 4MTDA 1V4RA 3U1DA 4BU2A 1K7AA 3FXRA 2NYXA 1P7IA 2LVSA 2WAEA 2UXNA 5E79C 2HVRA 4BJ5C 2OTJI 2XVCA 3B02A 1E3HA 2CU7A 4A5NA 1JUSA 1R5HA 3AAFA 3P9IA 2GOMA 3BP8A 4HX4A 1LE8A 1B72A 2LREA 3IKTA 4O3MA 3ABKH 3ZN0A 3QPHA 2VKHA 4HLYA 3ERMA 3K7AJ 3HG9A 3MKYB 3O6BB 1T98A 3H5NA 3EGQA 3IRQA 1LEBA 3IHUA 1Z0XA 2V1NA 2P7VB 4MEYF 2PZ9A 2VQLA 3DLAA 3GTPJ 4A6EA 4YIFA 5ERIA 4XLFA 1BW6A 2MSYA 3IAM2 1XTAA 2QQ8A 3H3ZA 2EPFA 3WG9A 4RB1A 2BHZA 2HXIA 3HKZN 2F4OB 2RC4A 1IN7A 1XGOA 3CCVI 2K7LA 3B6CA 1X1PA 5KNLA 3Q0VA 4HLXA 4HEA2 4BY7J 3KP4A 3ON2A 4HNTA 2EB7A 2IGNA 4CYCA 1U78A 2VQGA 2X85A 3T8TA 1X3ZB 5IT3A 1WJ5A 3QODA 3U2RA 1WWXA 2W53A 3WU0A 3OSGA 5CJ9A 3L2VA 1XSVA 1TNTA 2W57A 3LA7A 4AYBN 1MD0A 3AL0B 4C2UA 2LK2A 3V78A 1Y0NA 3O2PE 1MW7A 4JQFA 4ZZLA 2HOSA 4JKZA 3JRGA 3E6MA 3G4SI 2W84A 3RYPA 1YRNB 2VC0A 2GIZA 3MFKA 1LFUP 2K9LA 4M3DA 3N4MA 3N05A 3FXQA 2VIXA 3IL2A 4PJNA 1K83J 4CCMA 1GDTA 2EH3A 2EIMH 2ESNA 1RIOH 3BCAA 3CMMA 5JVGF 5DDGA 1A04A 4E7KA 3HZJA 3TKYA 1ZKGA 3V7RA 2X1DA 3WTVC 2DA4A 5C3EJ 2ZKZA 2E1OA 4LK1F 4B48A 1V54H 1SC7A 2BBYA 2HNHA 4O6JA 1KQ0A 3JRBA 3HIFA 3K4JA 4XOPA 3IC7A 3A4CA 3HSRA 2IA0A 5HLIA 2LMDA 2NS7A 3S5RA 3O60A 2BW3B 2ZC2A 4BGDA 2Y0SA 3F21A 4Y52J 3GLLA 2DCEA 2STWA 1S7OA 3QOEA 3EUPA 1P6RA 3ZQ7A 4G9YA 4OAYA 3IKVA 4ENNA 1HBXG 1IUFA 2DDAA 2DOAA 3QP6A 2I10A 2GOXB 2GFNA 4HSRA 1W5TA 5CW8A 3REOA 4DZJA 3A0HC 1BIBA 3ZMSA 3IRRA 2B3WA 1G8XA 2GIVA 4EJVA 2QKLB 3DEWA 4P9UA 3CQZJ 3H0GJ 2WWYA 2ZOZA 4I98B 1D5VA 3UNGC 2VPLA 1ZTRA 2PI0A 3RJPA 5IYDJ 4NC6A 4A93J 1GVJA 3VW2A 3BHQA 3A2KA 2WAQA 1JHFA 4G94A 5F0HA 1R71A 3OOPA 2O0YA 2LOOA 4EM0B 5HVQC 2K9NA 2E2HJ 4BE2A 3E5XA 4D5FA 5K5OA 4E7IA 4II2A 3TGNA 4BDZA 3H9GA 3I0TA 1BC7C 1MZBA 1IV8A 1ODDA 3TO7A 3HPHA 2CQNA 1IXCA 3AL0C 1O7FA 3FX3A 2XF5A 2JSPA 1B4AA 1Q1VA 1QVTA 4V2GA 3L7WA 2GM4A 4A6DA 3GX4X 3J81Z 1BL0A 2E5NA 2QF7A 4IKFA 1F5TA 5E3NA 2FBQA 3HTAA 2UXOA 2P5KA 1BIAA 1TW2A 2HQAA 2JSCA 2QQBA 3HOTA 5D4SA 1E0EA 2L3DA 3DBRB 2V1DA 3MZYA 5J40A 2F5FA 1RR8C 3CDLA 4QPQA 4I6ZA 4GFBA 2ZMEB 4YELA 5DTDA 3LSTA 1X58A 1MSEC 3K4KA 3KE2A 2DLLA 5AONA 1KQ9A 1IJWC 4CGZA 1U8RA 2UXIA 5KAIC 3ZPLA 1JT6A 2ZCXA 4GCTA 2O61A 3ZMVA 4L9TA 4M6VA 2TRTA 1JUMA 1P2FA 3BDDA 1BM9A 2M1BA 2H27A 1R7JA 3HDDA 3PNVA 1WZ2A 1RRJA 2FSWA 3EUHC 1MDMB 4AVPA 3VVZA 1X4PA 1BJZA 2KLOA 1XSDA 2HDDA 1MMDA 5FLMJ 1BC8C 4UHTA 5K5QA 4IRHA 3BR1A 3I59B 1XMKA 2NS8A 2G7UA 2Y9YA 3SHFA 3M4OJ 3ZMUA 4CZZA 3BTJA 2FOWA 3LFKA 3WHBA 3ZXSA 1SVOA 3LNQA 5DUIA 1JKQC 1SFKA 4AIJA 4OIQF 4L5EA 2N8GA 3K1NA 4UVCA 3TO6A 1I1GA 2KP6A 1U3EM 1SFOJ 3ZQFA 1UG0A 1VNDA 1JUPA 1R00A 2K86A 1J75A 1QPIA 2JUCA 1YX5A 3FM3A 4ZYGA 5B5EC 2R5YB 1YFHA 1YITI 5ILVA 2VXDA 2L01A 3V8LA 4KWAA 4YFNF 4FASD 2ELJA 1QQIA 4CSWA 1PJRA 2K02A 4IHTA 1SD6A 3W2VA 5CVVA 3PIOF 1LFBA 2FXAA 4MEXF 2FEZA 1LDKB 3RH2A 1MKMA 4KICA 5EEAA 2Y31A 4DYQA 4PGGA 1Z1DA 3BZKA 3CO6C 3OV8A 5DUKA 2MLGA 1YHQI 2OD5A 1ON1A 2HDCA 2EZKA 2A5YB 4LK0F 3GUDA 2VKDA 3VIBA 2W00A 3OYFA 1HKSA 3IH2A 3E3VA 5LHGA 4CH7A 4HW0A 4LLLA 1IN6A 2X51A 5ILSA 3H5AA 2A61A 2VL8A 4RM2A 5FFXA 1AHDP 3Q0WA 3JREA 1DP3A 1ETXA 3ROUA 5FO5A 1MIJA 2L0KA 2ZFWA 3KKDA 3HGGA 1GHCA 1OCCH 3RYRA 3DQVC 1U2WA 2ZMEC 1U9OA 4LMYA 3BR5A 2HYFA 4HF2A 4CCJA 4B3AA 4BJ6C 2FBKA 2H94A 3DFGA 4DIQA 2XAJA 1IAWA 2VLAA 2D1VA 4LB5A 1S7EA 1FMWA 1FYMA 5C4YA 4ZZDA 2L5QA 3ZQLA 2MABA 4K2EA 1DU6A 2XGCA 4M72A 5DM7F 1UHMA 2LD5A 4C3JJ 2QKOA 3PASA 1EF4A 3LQQA 1NG6A 3GZNB 4B1RA 4Y17A 1YRNA 3ZQQA 4NBQA 2UWMA 1D1AA 3CD6I 3A02A 3GW2A 3CO7C 1SGMA 3L00A 4R8HA 2L7ZA 1KYZA 4M3FA 1SVMA 1JKOC 3C07A 3E6CC 1ETQA 5LHIA 1PDNC 3O3KA 3FMSA 2XC7A 1XC5A 3MZ8A 2IA2A 1DGRM 1OLTA 5DD4A 3KX2A 3WE2A 1O57A 3J80Z 4L62A 5BOXA 1VQMI 4ENKA 4Y15A 3FRQA 3CDIA 5AIQA 1FC3A 1SEUA 3L2WA 3EUHA 1MBGA 2EIKH 2RNGA 1F9NA 5KHDA 4U0YA 2JTVA 2P0WA 2LC2A 1R5GA 2Z16A 3EDPA 4XN3A 2Y48A 3TBIA 4OD5A 3G3ZA 2ECCA 2LF7A 2XB0X 2BW3A 2LLKA 4WXDA 3GVAA 4CZCA 2YVHA 5J4YA 1I27A 3OWTA 3EYIA 4U88A 4G7HF 1POGA 1KU7A 2UXXA 5TRDA 2EILH 1S7AA 2KIQA 1RI7A 2K9QA 2X9DA 5B66C 1ONVA 2L9VA 2PN6A 3IWFA 3LOCA 2G7LA 4RB3C 2ZB9A 2L7FP 3RSNA 1I3AA 4YEJA 4BEHB 4ENMA 3G56A 5CVJA 4ZC3A 2AXLA 3KYCB 3I4PA 2PBIA 2ZJQF 1OPCA 3V4GA 1QVUA 4UDSA 5EEGA 4DBQA 3OYHA 2M2EA 5M3MJ 3P7NA 3P9TA 1A5JA 3BOQA 3L9FA 2GBYA 5FRMA 1HW1A 5HLHA 1PP8F 3S2DJ 3BR3A 1X2MA 2E19A 2HOTA 4OIOF 1BI1A 3OMYA 2VASA 4S04A 1FTTA 1WJEA 2NVYJ 1HXDA 4ZYDA 2KL4A 2IGKA 4UNOA 4LGWA 4FTHA 3CC2I 1L0OC 4ZTJA 4PGHA 1V5FA 1H89C 1TTYA 3CCLI 2ZOYA 2X48A 4P55A 2ETHA 5DAJA 2G3BA 1R1UA 2XF6A 1UELB 3OL4A 4CYDA 3FBIB 3M9AA 3LSKA 3T6NA 3FXKA 4KMUX 1OYIA 3D1NI 3J81K 1K4TA 4M3BA 2YUSA 1VI0A 1P9QC 4A3FJ 4B3XA 4ON0A 1BJAA 3GTKJ 5IYBJ 2VKEA 2J5PA 3I4MJ 2O8KA 4IRVA 2BV6A 5F0FA 2QQAA 2ZXWH 4XLEA 3DU5A 4LIVA 3GTMJ 4OU0A 3B81A 2RREA 2ZMEA 5D4RA 1OQYA 3CUOA 5LGNA 2QTQA 4N9HA 1Y6IA 3KEOA 2ZJPF 4A3CJ 4XNFA 4GO1A 4XQFA 1MGTA 4PFPA 1U8BA 1B1BA 5ICCA 5LEJA 2L7KA 3GYHX 1KU3A 2X6YA 2E1MB 1Z7UA 5FKMA 1F36A 1KONA 1H88C 4KN4X 3CJNA 2J5OA 4XBFA 1MDMA 3TMOA 1YIJI 3S8PA 1TP4A 3I59A 5BMZA 3CRJA 5F6FA 1LDJA 2XHKA 3CCRI 3IP4B 5ILUA 2JRMA 1W7PB 2VPRA 3DTEA 2M8EA 3F0CA 3K69A 2WUIA 3K0LA 2CUZA 1PUEE 2HOEA 4WXCA 4IVNA 1ZR2A 4U0WA 1QZYA 3VVXA 1WKMA 3HUGB 2JWTA 1UAAA 1TWHJ 1WJDA 5HOOA 4OIRF 3T0YA 5JI6A 2R5YA 4LB6B 2V6EA 5FD6A 4I99C 4IJAA 3SZPA 2VT2A 4IL6C 1O4XA 3GTOJ 3BWGA 1L3LA 2DT7B 1IG7A 3QOPA 4E4HA 3G1LA 3DPTA 2WADA 4HX7A 4P9FA 5IOZA 3C7JA 4LJZF 5BS6A 2H8WA 3NXCA 4D7NA 4ICHA 1GLNA 1TWFJ 4YFXF 3PFYA 4Q48A 2VBWA 5CXIA 2E36A 1VQ8I 1UI6A 4HV6A 3QU6A 4HAMA 3OYJA 2KJBA 1TT0A 3KZZA 1D0YA 1ETYA 1ZRDA 2E7WA 2M7AA 4WIBA 4NC7A 4EMSA 4PDKA 1JI8A 1FEXA 2R7XA 1U5TC 1TW3A 3NWSA 4TV7A 1LFPA 1WI9A 4O5VA 2Q8KA 2LYCA 1MJAA 3WTTC 5HDGA 5EGOB 4CDGA 2RVCA 4XM3A 3NI7A 2VE8A 5M5WJ 4A3DJ 4I7HA 2REKA 1OJLA 1YI2I 3KP6A 4PJ0C 1IO2A 1YQAA 4H4KC 3GTGJ 2QIBA 2KIMA 4E7LA 3G1OA 1OYWA 2X4HA 2O6GE 3S32A 2A6HF 3HPGA 3U9GA 4P96A 2Y9ZA 3WG7H 5DYMA 5C44J 3OYMA 1JGGA 2F5VA 2Z33A 1PVEA 1TL8A 4JYKA 3WTWC 1QZZA 2CRGA 2E1MC 4FETA 3H35A 5HNHA 2WA0A 2FD5A 2W82A 1VZ0A 3X2QH 2STTA 3EQLF 1N25A 3E6DA 4UVAA 3JRDA 2L2OA 2R7UA 3DEUA 3I4NJ 1DU0A 1HA8A 3LWFA 1TQPA 4G7OF 3KP7A 3K4CA 1DUXC 4XLCA 3DTIA 3BC8A 3B73A 1XPXA 3NAUA 1FBUA 4AM3A 4IHSA 3M8JA 9ANTA 3ABLH 3AG3H 1WHUA 2H1KA 1HDPA 3J80K 4KA4A 2OAZA 2UV1A 3NQOA 2X6OA 2P5VA 3CCJI 4FX4A 5EEHA 1FX7A 2QOPA 3LA2A 3KZYA 3CC7I 3WODF 3IH3A 4F91B 1YW9A 2QENA 2EZIA 3DKWA 2CGPA 1ZN2A 4CXFA 4Q5SF 3H92A 1R1VA 3MQ0A 3PO3J 3NWTA 1N75A 2QLZA 4L9NA 1MNMC 2JVGA 1USSA 1GT0C 4GFLA 5E18F 2M0CA 3E5UA 4CCKA 2WB1N 5CQGA 4G6TB 3TW6A 3PQKA 4HOBA 1MBFA 3DPUA 3HOZJ 2XB5A 2Y2ZA 3F6OA 2XF7A 4X1EA 3RI4A 1DGWY 3QYBA 2XPWA 2DN0A 5HS9A 2DA1A 2K85A 5JR3A 2IT0A 3HOYJ 1LPQA 4XRFA 2X0LA 3T5XA 4RGXA 3H3VK 2FJI1 3BG5A 4BEHA 5EG0B 3CP2A 2DYSH 2EJRA 5IT9Z 2Z1DA 4F7ZA 3LA3A 4CICA 1B59A 1G3TA 3AQSA 1ZR4A 2IS2A 2ID6A 3J7AO 1WH7A 2ZSHB 2TDXA 4JOMA 4KYWA 3HTIA 2ESHA 1YW8A 2Q2EB 4Q4ZF 4PJMA 2BVLA 2VBYA 5D6EA 4AVZA 4XKWA 3F22A 1QGPA 1SAUA 2NOJB 4FE7A 4M6YA 1VQPI 3CTAA 5JVTA 2WY7Q 4C9YA 2VOOA 2EFNA 1ZGAA 4EM2A 3HRMA 2W85A 3M3YJ 3NARA 3IUOA 3SFIA 2VB6A 1J7KA 5GADJ 2IJLA 2CH0A 2PEXA 1VQLI 4M9SA 2R92J 2BZTA 4L9JA 3WHCA 4RDUA 1K6YA 2HZDA 1U5TA 1X4OA 2AO9A 5DD8A 4XICA 3L09A 2DXIA 1GV5A 4CCOA 2ZNZA 2MBFA 1W5SA 2PJRB 5HBUA 2V1XA 2ELKA 4WWCA 1X19A 4I09A 5LBQA 5FD5A 4XONA 3OS1A 3F9KA 1RKWA 2ZJRF 2PMZA 1Y1WJ 1XSXA 1WI3A 2NXNB 4M3EA 4OWRB 3LWJA 4BUPA 3R0AA 2M0MA 1T39A 4A0YA 4CO8A 4EJOA 3HOUJ 1MMGA 4AF5A 3SJMA 3C2BA 4M6XA 1TWGJ 3HOVJ 4E7SA 1T8IA 1MJBA 3RKXA 5JLXA 4C30A 5IYCJ 2HR3A 4BQOA 2KRCA 5CQEA 2PJPA 1ORKA 2DI3A 5F08A 2LNBA 5HLTA 2ADUA 2IS4A 3CJDA 2V1UA 4KFCA 3L2CA 3GZIA 4UXNA 2R7OA 4AUXA 4HQMA 3GWZA 4X0GA 4A3IJ 2WTEA 2HYTA 3BJ6A 3W2AA 1OKRA 5IOYA 2O5RA 2O9LA 1XD7A 4HA8A 5F27A 2R93J 4ESFA 2FQ3A 3KP3A 2VI6A 4OMZA 5F04A 3ZCOA 2W1OA 4R79A 3CF2A 2PLYA 3W3CA 2WB1A 2P6TA 2IRFG 2UXPA 4D5CA 3LL7A 3BROA 3BZCA 2PBXA 5J4VA 3OIOA 4JX4A 4M9ZA 3HUGA 1Z91A 2EV6A 2MH9A 1Y1VJ 2XGXA 1LVKA 5F0CA 2LFBA 2R7QA 3BR6A 1GXQA 2GWRA 4MIMA 4DVYP 1U9NA 4I0AA 3VOKA 4XORA 2LRDA 3GLXA 5E1ZB 2L9RA 1N78A 2DMTA 5H20A 4JNNA 3MMYB 2NAZA 4HF0A 1T38A 2KRFA 2P5LC 1OYYA 3OYBA 1TC3C 1HQCA 1Y39A 2FMLA 5FKLA 4EGYA 3QQAA 2A5WA 1QHGA 1J2XA 3QRFF 4IOCF 3FKIJ 1LQ1A 2K5CA 5CLSA 1X1AA 4UUSB 5D5VB 3BQZA 3S14J 2X1EA 2VBZA 3PQJA 3V8JA 2DTZA 1ZRFA 2GLOA 4XLNF 3K2AA 4XRSG 1T0FC 2FNPA 4IQJA 2OQRA 1JT0A 4RMNA 2EZLA 3A1YA 3HKZA 3VEPA 3EUKL 3S1RJ 1SFUA 2V9KA 1S3JA 3CC4I 1E3PA 3PL8A 5FB2A 3FMRA 2LBFA 1NTCA 5M5YJ 5EGOA 3LJLA 1TT5B 4B8XA 4NQWB 5FKOA 2B7EA 4XKCA 4PUSA 4RBOA 2OTLI 3ON4A 4U7BA 1SFXA 4XL9A 4G6DA 1FOXA 3R61A 5E1WA 3Q0UA 2LP0A 4XIDA 3KLNA 1Y56A 1W7PD 4AYBA 1VQ7I 2Y30A 1X1DA 1IRFA 2Y69H 2Z3YA 1S72I 3F8FA 1VFCA 3OR2C 4UV9A 2BYVE 3ANPA 3QYFA 1ZARA 1FJLA 2FX0A 2H6CA 3F3XA 3SQNA 3I56I 3CCUI 2BY0A 2B0LA 2JN6A 2MYSA 3FXMA 2NNYA 2JA8J 3ZQCA 3GCMA 2FOKA 1JXSA 1A6QA 3I54A 2O03A 3C3WA 2CO5A 4D0PA 2WAFA 4JX6A 1R4MB 4EQQA 1HDDC 1XMAA 2IP2A 3ELKA 5CYVA 1A36A 5H9TA 4PXIA 3OYGA 3L2RA 4AIHA 3LSJA 5KCMA 2A69F 4Y7NJ 2JA6J 2GXAA 2OERA 2X1CA 5IPAA 2P8TA 3M8FA 3OYIA 4ETSA 4P1WA 4QWQA 5DCMA 5EYRA 3FF5A 4BXFA 4JBAA 2GA1A 2DA7A 2L9SA 3VYSB 3LSIA 3RIRA 2V26A 2XPUA 4IOAF 5D8KB 2HTSA 2W24A 3KLOA 5BQTA 1IV6A 3QYEA 3F23A 1ZELA 1BA5A 3K4NA 3ZMZA 3WTUC 5E8GA 4NELA 1B8IB 4E7HA 2FNAA 4RGSA 3OS2A 2DT5A 2G9WA 3P5JA 2EINH 2DTRA 3FIWA 1Z3XA 4KT5C 1GUUA 4MFEA 3TDZC 1I6HJ 3HTHA 3W6JB 3Q9VA 4AIDA 5EG0A 2JPBA 2R0QC 3I5UA 2A6TA 2EWNA 3I9V2 3HB9A 5IT9K 4KIGA 3HYIA 4XKVA 1PP7U 1REPC 3CCSI 3MD2A 3GBGA 3I64A 4L5IA 4RM3A 4Y3OA 4Y4RA 4BQAA 3ZP5A 4BQQA 1LUJB 2MC4A 3VYUB 1D5YA 2O8XA 3GFIA 5H6RA 3I71A 3H0DA 2Q2EA 1WJBA 4MXMA 1MH4A 1FBQA 2K4JA 5DV5A 3V6GA 4NNJA 1QRYA 1QO0D 3DTKA 1FP2A 1NG7A 2XASA 3JAMZ 3RPUA 1XGSA 3HJEA 2W7NA 1MJ9A 3ANGA 1XS9A 2D2WA 3QBMA 3KZIC 2BHYA 2M9HA 2PG4A 3F8MA 4BDYA 2IU5A 4LITA 5J47A 3KFWX 2XDNA 1T0FA 4UY8I 3DCFA 2R7SA 3JW4A 4M71A 3FISA 1UCRA 2COMA 2HVSA 5LGUA 2K4BA 3DU6A 2OI8A 4L5JA 5K7FA 2IS6A 2CUJA 2ZCNA 5HODA 1J9IA 3CCMI 1VQ9I 5FKKA 3CZ6A 4FCYA 2GZWA 4XRSA 4BXXJ 1DPUA 1GXPA 2MC3A 1EKEA 3VDXA 5EZGA 3O8HA 4MLOA 5EJCA 2BEOA 4MQVA 1Z6RA 4A5MA 4ESJA 4HPQA 5L3GA 2XAQA 1HKTA 3SFZA 3L2QA 1PUFB 3F8CA 4LFUA 1LDDA 4GGGA 2EFWA 5GAHJ 2K27A 3HHHA 4L9VA 5LLQA 1OISA 4HYEA 4RAGA 4ZYEA 4KMFA 2DQLA 2A07F 2CW8A 2BY1A 5D5WB 1EH6A 3FXUA 2ISYA 1YO5C 1ZLJA 1MSFC 2QCOA 3GEUA 3K8PC 3K1MA 2K3FA 4XMYA 4HZFA 1ZG5A 4IHXA 3LFUA 1EH7A 5EDNA 5L3EA 2QQ9A 1J5YA 2CV2A 2OBPA 1WH5A 2CS3A 2R7DA 4UVBA 4F52A 3WGIA 3S3OA 2CJJA 3KZ9A 2GXBA 3FMQA 3CMAI 1R36A 4GYIA 3FHNA 3NRVA 3G73A 2YX4A 5TISC 4BBRJ 3J7AY 4I01A 4N0BA 1FIPA 2ZCMA 1P4XA 3RPUD 4RAYA 2VT3A 3W6VA 4CHUA 3G71I 2V9VA 3ZQHA 3B6AA 3DPLC 2YX7A 3PJRA 3G6EI 4GDFA 3ONQA 5J6XA 2CQKA 3MVPA 1QNTA 1Q1HA 4LOCA 2FMYA 1NK3P 3Q9SA 5LGTA 5L3CA 2DW4A 2Z99A 3LSHA 4ME9A 3K9TA 2NP3A 5TJJA 5E3LA 2D6YA 5JLWA 4M3GA 4BS9A 2CUFA 1XG1A 4F92B 2G7HA 2K9MA 2LY9A 3SYTA 1LB2A 2F5DA 3BZ6A 5FRNA 1TZLA 5LRRA 1O3TA 2XRLA 1VQ4I 3PIPF 2EV5A 3RDIA 4UUTA 3VUQA 2KIUA 2XAFA 5IP9J 4QLCU 2NRAC 4MHGA 2VKVA 4QTRA 1TNSA 5B3SH 5BNGA 5LFAA 1OFCX 1ON2A 1WJFA 1LEAA 4RAFA 4XKBA 1ETWA 2BVMA 4XSXF 2E1NA 2QM3A 4OIPF 4BY1J 3VPRA 1KQ8A 2V57A 2VODA 2FU4A 2XAGA 2LKSA 2EA4A 4NQWA 4V2FA 2QUFA 4LLGF 1D1BA 1VQ5I 2EQRA 3GFJA 1CGPA 1D1CA 2HFHA 1SANA 1RPWA 1Z21A 4NC8A 3VW0A 3DXJF 1A35A 3WTSC 2UXHA 3DPJA 5L3FA 4NN1A 2XPVA 1IRZA 4NHJA 4RB0A 3HTJA 4C3HJ 3BCGA 1D0XA 1JHHA 2EZHA 1LKXA 1HW2A 1BI2A 2JQ7A 2ICWG 4DJAA 5J3LA 4FHTA 5HDKA 3SZTA 3K4LA 1YS6A 1WCMJ 4ZDOA 2V7FA 4YFKF 2WGBA 1XGMA 4F55A 5E3OA 5H6QA 3CWRA 3CMEI 2GQQA 3FK6A 3QU3A 3JSPA 3VTIA 2EFQA 3TEDA 3DV8A 2HGCA 1HF0A 2IGOA 5D8LB 1KA8A 3QPSA 4BE1A 1FY7A 1UJ8A 1IRGA 5JFRA 5GAEJ 3D5SC 2P81A 3EPZA 3T8RA 1HSJA 2HPMA 3J7ZI 1XN7A 2P6SA 1XDUA 3MKLA 3L1PA 3ASOH 2LR8A 3E1SA 2X6WA 2JMWA 3BTIA 3RKQA 2MLKA 3BJAA 2VN2A 3VOXA 1IUYA 5C4JJ 4BJTA 2NVQJ 1WJCA 3DBLB 5ICFA 1R58A 1X3WB 3GTJJ 2LKXA 5A2QZ 2AXTC 3DEEA 4DW6A 1BR4A 2EV0A 4KUMA 3Q5FA 3MEXA 4A3MJ 3NRGA 2HXOA 4MTEA 4WCGA 1B8IA 5CVIA 1ETVA 5E20A 3OYEA 1T6SA 4A3GJ 4YG2F 4DOZA 2NVTJ 1WFXA 4I2OA 1BR1A 3K4BA 3KETA 2H6BA 2IAIA 4EEFG 4A0XA 2UXUA 3R0JA 2LSOA 3FKJA 3HOSA 2LF8A 4HX8A 2A68F 2OU2A 2OJED 5DM6F 3RKYA 1JJ6C 1EA3A 1XMXA 3R60A 3S3MA 1IDZA 3BPVA 2DMUA 2LY1A 4HBLA 1RESA 2W48A 2GA2A 4S0HB 4GCVA 5J8CA 4UV8A 3AKZA 1HW5A 1Z77A 5E3MA 3VP5A 2ACJA 3OYCA 1IRXA 4DYRA 3H5RA 1H0MA 3LHQA 4MO7A 2DA2A 4A0ZA 1YJ9I 2OV7A 2E1CA 3JAMK 1RKTA 2IBDA 4LLNA 1RETA 3F6VA 3C2GA 1OCZH 5FHPA 4NUBA 2I5UA 3FXLA 3JR9A 1ERDA 2RHAA 4FT8A 1OCPA 4M73A 4D1QA 3BCBA 4XOTA 3GF2A 3ZGKA 1ZG3A 1O3RA 1Y8RB 2JVHA 4AD9A 2QWWA 2MA3A 4ZYHA 1XGNA 2KQRA 1F4KA 4MK6A 3SDBA 1TQMA 2CQ7A 3HEFA 5J1YA 5CVRA 1NK2P 2P4WA 1S29A 4LG0B 2ZNYA 3S2HJ 2M34A 1WVRA 1USTA 5KVRA 2JK3A 4ABZA 3V7SA 1P4AA 3HHGA 2DFEA 1ULYA 1ZHFA 2IXSA 3BPXA 3VYRB 4MFDA 3AG2H 1F1ZA 1IN8A 2ME0A 4KT6A 3ABUA 3E7QA 1IN5A 3OOUA 4HV5A 1PYVA 4YRVA 2E2IJ 2FE3A 1PUFA 3C2HA 3KIOA 3U1KA 4ZH4F 3J7YJ 2D45A 1I6XA 3S15J 1UG2A 3BT9A 3ISPA 2MGQA 3HIMA 4ZYAA 2G0EA 4G12A 2R7RA 2LKPA 5GTHC 3E6BA 3HM5A 3HOWJ 4JX5A 1MBKA 1JTYA 3HRTA 3KNWA 4XR6A 1D0ZA 4MNUA 2L7MP 1MBHA 3VVYA 3U21A 2H1LA 3JRCA 4FX0A 4BHBA 2F5EA 1G59A 3JRIA 3SZGA 2OZ6A 3GMEA 1YOVB 2ZCWA 2O7OA 3MAJA 5GAGJ 2E35A 2VC1A 3S3NA 1YLFA 3CDHA 1T2KA 4EM1A 3FZVA 4ITVA 3MZHA 3P9CA 3PM1A 3WTXC 2HKOA 2PQ8A 4E7JA 2LDUA 3GFLA 1YIOA 1U6GA 2OCCH 2TCTA 3ESWB 3M8EA 1YS7A 3CCYA 1CQTA 4UB6C 3ULQB 5KK1A 1AKHB 2FRHA 2YVXA 1IDYA 2NVUB 3K4MA 3MKZA 5E8IA 1ZQ3P 2LY2A 2OPTA 2DJIA 3K1PA 2M45A 2Z2SB 2JRTA 4CCNA 1R6RA 1RC9A 3FXJA 4AC0A 3PNTA 1W0TA 1STZA 2NOGA 4LG3A 2YR2A 1FIAA 1FSEA 4XLAA 2FF4A 4ZTFA 1OCOH 1ZG1A 2CYYA 2F4IA 1BOAA 2HYJA 4U7DA 2DT6A 2ZY9A 2M4GA 2LTPA 4BE0A 3HRUA 1X3UA 3OIQA 2DO7A 3TO9A 2BOLA 1HC8A 2EA2A 2Y0SN 3LSGA 4UB8C 4GXOA 2M87A 3VSLA 2DDBA 1NHAA 3QAHA 5IP7J 2OA4A 2RNJA 1W4MA 2QVOA 1MMNA 2CG4A 2Z5UA 2CW0F 2WC2A 4HNUA 3M1CA 1FMVA 5F64A 5LD2C 1ZGJA 1BOBA 4XK4A 2FJ1A 3HOXJ 2CMPA 4IPAA 4CCLA 3ZQGA 4C2MJ 4BL0B 3IAS2 2G7SA 4OD4A 1J0RA 2F5CA 2A6EF 4YIIA 3VFZA 4B44A 1QZEA 3BNIA 2WAQN 3BR0A 4A12A 3F1BA 2RKHA 3RKWA 3BTCA 1V5GA 2XKPA 2E60A 2CQXA 1CF7B 2CQQA 2HS5A 3LAJA 2DQRA 1W36C 2ZSIB 4XN0A 2KFDA 2ISZA 5M5XJ 1YJNI 2ZJ2A 2ZXIA 2KT0A 3PUBA 4L0ZB 3S1NJ 1H9GA 3ASNH 1LJ9A 4BXUA 3H1CA 4UUVA 3ZRGA 3QPTA 4RGRA 1IW7F 2R3SA 4DBRA 3MCZA 3QPLA 1YTYA 3QP5A 2M3AA 3CJTB 2DA3A 3CUQB 4Z6YA 4HG2A 2XROA 3K70C 3GZ5A 1FTZA 3DF8A 3HE0A 2CUEA 2D1HA 2FUG2 1HCRA 1V3FA 4OINF 1XDSA 3OY9A 5EFYA 1JKRC 3DKYA 1RUNA 4MGRA 1W7PA 3CJQB 1O3QA 2H09A 2EFOA 4A3JJ 2V4JC 3IV5A 4KIFA 1ITYA 4MQ9F 1OCTC 3PPBA 5D19A 1BBYA 2OF7A 3K6GA 4IO9F 1K61A 2A05A 1FBSA 1MBJA 5J8FA 1RNLA 3W6KB 1MNEA 3WGHA 5A2QK 2QA4I 2R4GA 1MMAA 2FBHA 2HDWA 1WJAA 4PJJA 1FYKA 4QPOA 3BG7A 3PFIA 3HGYA 1ZLKA 3BJBA 3I53A 5D6FA 4NDLA 3O8GA 4WF2A 1MNDA 2VQHA 4G8XA 1DQUA 2HQNA 3GTLJ 2QEXI 1ZK8A 2L4AA 1V55H 1Z67A 5FLVA 5EF6A 3FK7A 3OYKA 3GXOA 1GVDA 3VODA 4BQNA 3H9QA 3I55I 4C2TA 1C0WA 2CW7A 3AFHA 3VB2A 1TLHB 3PSIA 3A0BC 5GPAA 1SVLA 1JKPC 1VQ6I 2RDPA 2JZYA 2O3FA 1ZYRF 3HSEA 2GAUA 2V79A 5ICGA 3TDUC 2NVXJ 3NS4A 3M7GA 1MBEA 1H9TA 2OCEA 4GYGA 2PX9A 2EFPA 4A69C 1SAXA 2YS9A 2R7TA 5TGTA 2F48A 1TBXA 4WX9A 2DPDA 1LVAA 3KCCA 3WGGA 3JRFA 3JCUC 3LAPA 1APLC 2Z9OA 1UI5A 1ZGWA 1W1WE 4QIWN 3AQTA 2RV8A 2CV1A 1VQKI 1WSUA 4RLQA 3ZOBA 2KRHA 4EGZA
chains in the Genus database with same CATH topology
2VPRA 1PUFB 1P7IA 2LVSA 3F0CA 2WUIA 2GUHA 1ZR2A 2CU7A 3VVXA 3OSFA 1JUSA 2JWTA 1TWHJ 1MSFC 2QCOA 3GEUA 2R5YA 1LE8A 1B72A 4IHXA 5EDNA 1O4XA 3GTOJ 5AQCA 3K7AJ 1IG7A 1WH5A 3EGQA 3G1LA 1E3OC 1Z0XA 2CJJA 2PZ9A 3KZ9A 1P7JA 1UMQA 3GTPJ 5IOZA 2R5ZB 4BBRJ 1BW6A 2MSYA 3NXCA 4B4CA 4D7NA 4ICHA 1WPKA 2HXIA 1FIPA 1TWFJ 3HKZN 2ZCMA 5DS9A 2O7TA 5CXIA 1UI6A 3B6CA 3W6VA 3Q0VA 2HI3A 3ZQHA 4BY7J 3B6AA 3ON2A 4CGRA 4CYCA 1ETYA 1U78A 2VUMJ 3MVPA 4LOCA 2W53A 1NK3P 3OSGA 1ENHA 5J1RA 4ME9A 1T33A 2NP3A 5E3LA 2D6YA 2Q24A 5JLWA 4M3GA 2RAEA 3RZDJ 1FEXA 1I3QJ 4AYBN 2LK2A 3V78A 2CUFA 3S1QJ 2HOSA 4JKZA 1XG1A 3JRGA 5EGOB 2LY9A 3NI7A 5M5WJ 4A3DJ 1YRNB 2REKA 1OJLA 5F1JA 1AKHA 2XRLA 1LFUP 3GTGJ 2QIBA 4M3DA 3G1OA 3NPIA 3JRAA 3NNRA 3JRHA 4UUTA 2HQ5A 3VUQA 1K83J 2Y9ZA 5IP9J 5C44J 1JGGA 2VKVA 4AC6A 4QTRA 1GDTA 2EH3A 5BNGA 2DMPA 1OFCX 4JYKA 1ETWA 2MG4A 2CRGA 4FE4A 2FD5A 5D18A 5IP6A 4BY1J 3VPRA 2V57A 1ZKGA 4V2FA 3JRDA 4HKUA 2DA4A 5C3EJ 3I4NJ 1DU0A 4IHVA 2E1OA 2EQRA 5FJ8J 3LSPA 1SANA 3JRBA 1RPWA 4QSHA 3VW0A 5EZHA 2UXHA 3NAUA 3DPJA 2NS7A 3S5RA 3O60A 4NN1A 2XPVA 1IRZA 4XRMA 3BTLA 9ANTA 3HTJA 2H1KA 4C3HJ 4Y52J 1HDPA 3BCGA 2EZHA 3HBLA 3EUPA 2X6OA 5J3LA 2QOPA 3IH4A 1IUFA 3IH3A 2DG7A 2EZIA 1WCMJ 4GCKA 2I10A 5K7ZA 2WGBA 2GFNA 4A3LJ 5CW8A 5E3OA 4DZJA 3PO3J 5J1UA 3CWRA 3FK6A 1MNMC 1GT0C 3TEDA 3BRUA 3DEWA 4GFLA 2M0CA 2WB1N 3CQZJ 3H0GJ 1HF0A 5HAWA 3TW6A 3QPSA 4C3IJ 2XSDC 2ZOZA 1MBFA 3HOZJ 2XB5A 2Y2ZA 1ZTRA 2P81A 4X1EA 5IYDJ 2XPWA 4A93J 2DN0A 2DA1A 2ME6A 3HOYJ 3VW2A 2DJNA 1F43A 3MKLA 2D5VA 3L1PA 3BHQA 2LR8A 3H3VK 2JMWA 3Q3SA 5F0HA 3BTIA 3RKQA 3BG5A 5EG0B 4D7MA 3VOXA 2K9NA 2E2HJ 5C4JJ 4D5FA 2NVQJ 2ECBA 1RR7A 3GTJJ 1R9TJ 2LKXA 4DW6A 1G2HA 3AQSA 1ZR4A 2ID6A 4A3MJ 3NRGA 1WH7A 2HXOA 3HTIA 1B8IA 2YU9J 1ETVA 4A3GJ 2NVTJ 3BG3A 5FKNA 1Q1VA 1QVTA 4V2GA 2F07A 2GM4A 2IAIA 4EEFG 2COBA 1IC8A 1BL0A 2QF7A 2UXUA 5E3NA 2FBQA 3HTAA 2UXOA 4FE7A 2JA7J 1JJ6C 3ZQIA 1IDZA 3CDLA 2DMUA 4YZEA 4I6ZA 4GFBA 2NX4A 2QWTA 1RESA 3M3YJ 3NARA 3SFIA 2W48A 5DTDA 4S0HB 1X58A 1MSEC 3UKGA 1Z77A 5E3MA 3VP5A 1IJWC 2UXIA 2R92J 2ID3A 2ZCXA 1JT6A 3WHCA 3BR2A 4GCTA 4DYRA 4RDUA 3A01B 2AO9A 4XICA 3LHQA 4MO7A 1GV5A 2DA2A 4M6VA 2TRTA 1JUMA 3HDDA 5HBUA 2ELKA 4HNVA 1T56A 4GFKA 1RKTA 2YVEA 3VVZA 2IBDA 1BJZA 1RETA 2HDDA 4FISA 1RKWA 5FLMJ 5FHPA 4I76A 1Y1WJ 1WI3A 2HKUA 3BR1A 4M3EA 3JR9A 1MH3A 2RHAA 5K58A 2NS8A 2Y9YA 3LWJA 1OCPA 3M4OJ 5HSZA 4UUSA 3HOUJ 2GENA 4AF5A 3BTJA 3SJMA 3C2BA 3WHBA 1TWGJ 3LNQA 1JKQC 3HOVJ 5GPCA 4MK6A 4IHYA 3HEFA 5J1YA 4L5EA 2N8GA 5JLXA 5IYCJ 1NK2P 5CXGA 3S2HJ 1SFOJ 2M34A 1ORKA 5F08A 3ZQFA 2JK3A 3CJDA 1VNDA 1JUPA 4ABZA 3GZIA 3TP0A 1QPIA 3TP3A 4AUXA 2R5YB 1LE8B 1B72B 3RQIA 4MFDA 1ETOA 4A3IJ 4KWAA 2ME0A 3E7QA 2HYTA 3OOUA 5IOYA 1BW5A 2O9LA 1GV2A 2R93J 5F27A 2E2IJ 1PUFA 1LFBA 2VI6A 5F04A 3COLA 3RH2A 4J19A 3S15J 1UG2A 3BT9A 2MGQA 3IUVA 3HIMA 5GP9A 5EEAA 2UXPA 4D5CA 2G0EA 3G1MA 4G12A 2Y31A 4DYQA 2PBXA 3OIOA 3HM5A 4A3EJ 4JX4A 3HOWJ 4JX5A 1MBKA 1A6IA 1JTYA 1Y1VJ 3KNWA 2L7MP 1MBHA 5F0CA 2DA5A 4X6AJ 2LFBA 3BR6A 4MIMA 4BKXA 3VVYA 1U9NA 3JRCA 2EZKA 3VOKA 3JRIA 4CYCB 2JJ7A 2L9RA 2O7OA 2DMTA 3VIBA 2NP5A 4JNNA 3IH2A 4ACIA 1JJ8C 1I50J 1TC3C 1AHDP 2AHQA 3PM1A 3Q0WA 2R5ZA 3JREA 2RASA 1JTXA 1ETXA 5FKLA 2K9SA 5M3FJ 4JP0A 3G7RA 3QQAA 3VW1A 2L0KA 2TCTA 3BG9A 2XGEA 3CCYA 1CQTA 1IGNA 3FKIJ 3KKDA 2XGDA 3HGGA 4UUSB 2MW8A 1AKHB 1HLVA 3BQZA 3QKXA 1IDYA 3S14J 1ZQ3P 2OPTA 3S17J 3SDGA 1U9OA 2DTZA 3BR5A 2GLOA 3K2AA 4AC0A 4XRSG 4B3AA 1W0TA 1JT0A 2EZLA 2NOGA 1FIAA 1H8AC 1S7EA 5C4YA 2HYJA 3S1RJ 4A3KJ 2B63J 3ZQLA 2LTPA 2M8GX 1DU6A 1TWCJ 2XGCA 1NTCA 5M5YJ 2LD5A 2QKOA 4C3JJ 5EGOA 3LJLA 3PASA 1EF4A 2Y0SN 3LSGA 4B1RA 5FKOA 1YRNA 3TW7A 3A02A 4RBOA 3ON4A 1SGMA 5C4XJ 5IP7J 2L7ZA 3Q0UA 2LP0A 4XIDA 2DMNA 4M3FA 1JKOC 3C07A 2Y30A 1ETQA 4XK4A 1VFCA 1XC5A 2FJ1A 3HOXJ 3ANPA 3ZQGA 4C2MJ 1FJLA 4L62A 1X2NA 2FX0A 2G7SA 2IEKA 4IHWA 3FRQA 2R7ZJ 2JN6A 2JA8J 5K7HA 3ZQCA 5FGLA 2DA6A 1MBGA 2HOAA 3BNIA 4JX6A 2WAQN 3BR0A 3F1BA 1W0UA 3BTCA 1HDDC 2CQXA 5H9TA 2CQQA 3MN2A 1AU7A 2JA5J 3LSJA 2ECCA 4DZPA 4PXIA 2XB0X 4Y7NJ 2LLKA 2YVHA 2JA6J 2OERA 5M5XJ 5IPAA 2KT0A 3JSJA 1POGA 3S1NJ 5EYRA 2X9DA 2K9QA 3LOCA 2G7LA 4W97A 2ZB9A 3MNLA 4BBSJ 2L7FP 2DA7A 5FMPA 3QPLA 1WGXA 3RZOJ 3G56A 2XPUA 3BQYA 3CMYA 2DA3A 2DMQA 1IV6A 1QVUA 1BA5A 4UDSA 1FTZA 3RD3A 2M2EA 5M3MJ 3P9TA 3HE0A 2CUEA 4NELA 1A5JA 2GBYA 1ETKA 1B8IB 1HCRA 3GTQJ 3S2DJ 3BR3A 1X2MA 2E19A 2HOTA 3FIWA 1JKRC 5EFYA 1HOMA 1GUUA 4MFEA 1FTTA 3E7LA 1I6HJ 3HTHA 2NVYJ 4A3JJ 5EG0A 2R0QC 3IV5A 1ITYA 3S16J 4GCLA 3HB9A 1OCTC 3PPBA 5D19A 4FTHA 2OF7A 1K61A 1TWAJ 1MBJA 1H89C 3GBGA 3S1MJ 2ZOYA 2X48A 5DAJA 2G3BA 1VF9A 3BJBA 3HGYA 2PMZN 4NDLA 1D5YA 3O8GA 3T6NA 4MXMA 2EBIA 1MH4A 3GTLJ 3V6GA 3D1NI 1ZK8A 4M3BA 2YUSA 1VI0A 3A03A 1QRYA 5EF6A 4A3FJ 4W1UA 5FLVA 3GTKJ 3FK7A 2FQ4A 3KKCA 5IYBJ 1GVDA 2VKEA 3I4MJ 2O8KA 3PO2J 3ANGA 5F0FA 1XS9A 3QBMA 2H8RA 2M9HA 3GTMJ 2IU5A 2WV1A 3B81A 4A3BJ 2K40A 5GPAA 2DG8A 3LSRA 5D1RA 2XDNA 2QTQA 1JKPC 3DCFA 4A3CJ 3FISA 1U8BA 2KDZA 4DYCA 4IEJA 2NVXJ 3A01A 5FKMA 1MBEA 2OI8A 1F36A 1H88C 2G7GA 4A69C 2YS9A 5K7FA 1UHSA 2ZCNA 5HODA 5FKKA 3JRFA 4FCYA 1APLC 1UI5A 4XRSA 1ZGWA 4QIWN 4BXXJ 2E2JJ 3AQTA 3CRJA 4JL3A 5EZGA 3O8HA 4MLOA 3ZOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPR A;  1PUF B;  1P7I A;  2LVS A;  3F0C A;  2WUI A;  2GUH A;  1ZR2 A;  2CU7 A;  3VVX A;  3OSF A;  1JUS A;  2JWT A;  1TWH J;  1MSF C;  2QCO A;  3GEU A;  2R5Y A;  1LE8 A;  1B72 A;  4IHX A;  5EDN A;  1O4X A;  3GTO J;  5AQC A;  3K7A J;  1IG7 A;  1WH5 A;  3EGQ A;  3G1L A;  1E3O C;  1Z0X A;  2CJJ A;  2PZ9 A;  3KZ9 A;  1P7J A;  1UMQ A;  3GTP J;  5IOZ A;  2R5Z B;  4BBR J;  1BW6 A;  2MSY A;  3NXC A;  4B4C A;  4D7N A;  4ICH A;  1WPK A;  2HXI A;  1FIP A;  1TWF J;  3HKZ N;  2ZCM A;  5DS9 A;  2O7T A;  5CXI A;  1UI6 A;  3B6C A;  3W6V A;  3Q0V A;  2HI3 A;  3ZQH A;  4BY7 J;  3B6A A;  3ON2 A;  4CGR A;  4CYC A;  1ETY A;  1U78 A;  2VUM J;  3MVP A;  4LOC A;  2W53 A;  1NK3 P;  3OSG A;  1ENH A;  5J1R A;  4ME9 A;  1T33 A;  2NP3 A;  5E3L A;  2D6Y A;  2Q24 A;  5JLW A;  4M3G A;  2RAE A;  3RZD J;  1FEX A;  1I3Q J;  4AYB N;  2LK2 A;  3V78 A;  2CUF A;  3S1Q J;  2HOS A;  4JKZ A;  1XG1 A;  3JRG A;  5EGO B;  2LY9 A;  3NI7 A;  5M5W J;  4A3D J;  1YRN B;  2REK A;  1OJL A;  5F1J A;  1AKH A;  2XRL A;  1LFU P;  3GTG J;  2QIB A;  4M3D A;  3G1O A;  3NPI A;  3JRA A;  3NNR A;  3JRH A;  4UUT A;  2HQ5 A;  3VUQ A;  1K83 J;  2Y9Z A;  5IP9 J;  5C44 J;  1JGG A;  2VKV A;  4AC6 A;  4QTR A;  1GDT A;  2EH3 A;  5BNG A;  2DMP A;  1OFC X;  4JYK A;  1ETW A;  2MG4 A;  2CRG A;  4FE4 A;  2FD5 A;  5D18 A;  5IP6 A;  4BY1 J;  3VPR A;  2V57 A;  1ZKG A;  4V2F A;  3JRD A;  4HKU A;  2DA4 A;  5C3E J;  3I4N J;  1DU0 A;  4IHV A;  2E1O A;  2EQR A;  5FJ8 J;  3LSP A;  1SAN A;  3JRB A;  1RPW A;  4QSH A;  3VW0 A;  5EZH A;  2UXH A;  3NAU A;  3DPJ A;  2NS7 A;  3S5R A;  3O60 A;  4NN1 A;  2XPV A;  1IRZ A;  4XRM A;  3BTL A;  9ANT A;  3HTJ A;  2H1K A;  4C3H J;  4Y52 J;  1HDP A;  3BCG A;  2EZH A;  3HBL A;  3EUP A;  2X6O A;  5J3L A;  2QOP A;  3IH4 A;  1IUF A;  3IH3 A;  2DG7 A;  2EZI A;  1WCM J;  4GCK A;  2I10 A;  5K7Z A;  2WGB A;  2GFN A;  4A3L J;  5CW8 A;  5E3O A;  4DZJ A;  3PO3 J;  5J1U A;  3CWR A;  3FK6 A;  1MNM C;  1GT0 C;  3TED A;  3BRU A;  3DEW A;  4GFL A;  2M0C A;  2WB1 N;  3CQZ J;  3H0G J;  1HF0 A;  5HAW A;  3TW6 A;  3QPS A;  4C3I J;  2XSD C;  2ZOZ A;  1MBF A;  3HOZ J;  2XB5 A;  2Y2Z A;  1ZTR A;  2P81 A;  4X1E A;  5IYD J;  2XPW A;  4A93 J;  2DN0 A;  2DA1 A;  2ME6 A;  3HOY J;  3VW2 A;  2DJN A;  1F43 A;  3MKL A;  2D5V A;  3L1P A;  3BHQ A;  2LR8 A;  3H3V K;  2JMW A;  3Q3S A;  5F0H A;  3BTI A;  3RKQ A;  3BG5 A;  5EG0 B;  4D7M A;  3VOX A;  2K9N A;  2E2H J;  5C4J J;  4D5F A;  2NVQ J;  2ECB A;  1RR7 A;  3GTJ J;  1R9T J;  2LKX A;  4DW6 A;  1G2H A;  3AQS A;  1ZR4 A;  2ID6 A;  4A3M J;  3NRG A;  1WH7 A;  2HXO A;  3HTI A;  1B8I A;  2YU9 J;  1ETV A;  4A3G J;  2NVT J;  3BG3 A;  5FKN A;  1Q1V A;  1QVT A;  4V2G A;  2F07 A;  2GM4 A;  2IAI A;  4EEF G;  2COB A;  1IC8 A;  1BL0 A;  2QF7 A;  2UXU A;  5E3N A;  2FBQ A;  3HTA A;  2UXO A;  4FE7 A;  2JA7 J;  1JJ6 C;  3ZQI A;  1IDZ A;  3CDL A;  2DMU A;  4YZE A;  4I6Z A;  4GFB A;  2NX4 A;  2QWT A;  1RES A;  3M3Y J;  3NAR A;  3SFI A;  2W48 A;  5DTD A;  4S0H B;  1X58 A;  1MSE C;  3UKG A;  1Z77 A;  5E3M A;  3VP5 A;  1IJW C;  2UXI A;  2R92 J;  2ID3 A;  2ZCX A;  1JT6 A;  3WHC A;  3BR2 A;  4GCT A;  4DYR A;  4RDU A;  3A01 B;  2AO9 A;  4XIC A;  3LHQ A;  4MO7 A;  1GV5 A;  2DA2 A;  4M6V A;  2TRT A;  1JUM A;  3HDD A;  5HBU A;  2ELK A;  4HNV A;  1T56 A;  4GFK A;  1RKT A;  2YVE A;  3VVZ A;  2IBD A;  1BJZ A;  1RET A;  2HDD A;  4FIS A;  1RKW A;  5FLM J;  5FHP A;  4I76 A;  1Y1W J;  1WI3 A;  2HKU A;  3BR1 A;  4M3E A;  3JR9 A;  1MH3 A;  2RHA A;  5K58 A;  2NS8 A;  2Y9Y A;  3LWJ A;  1OCP A;  3M4O J;  5HSZ A;  4UUS A;  3HOU J;  2GEN A;  4AF5 A;  3BTJ A;  3SJM A;  3C2B A;  3WHB A;  1TWG J;  3LNQ A;  1JKQ C;  3HOV J;  5GPC A;  4MK6 A;  4IHY A;  3HEF A;  5J1Y A;  4L5E A;  2N8G A;  5JLX A;  5IYC J;  1NK2 P;  5CXG A;  3S2H J;  1SFO J;  2M34 A;  1ORK A;  5F08 A;  3ZQF A;  2JK3 A;  3CJD A;  1VND A;  1JUP A;  4ABZ A;  3GZI A;  3TP0 A;  1QPI A;  3TP3 A;  4AUX A;  2R5Y B;  1LE8 B;  1B72 B;  3RQI A;  4MFD A;  1ETO A;  4A3I J;  4KWA A;  2ME0 A;  3E7Q A;  2HYT A;  3OOU A;  5IOY A;  1BW5 A;  2O9L A;  1GV2 A;  2R93 J;  5F27 A;  2E2I J;  1PUF A;  1LFB A;  2VI6 A;  5F04 A;  3COL A;  3RH2 A;  4J19 A;  3S15 J;  1UG2 A;  3BT9 A;  2MGQ A;  3IUV A;  3HIM A;  5GP9 A;  5EEA A;  2UXP A;  4D5C A;  2G0E A;  3G1M A;  4G12 A;  2Y31 A;  4DYQ A;  2PBX A;  3OIO A;  3HM5 A;  4A3E J;  4JX4 A;  3HOW J;  4JX5 A;  1MBK A;  1A6I A;  1JTY A;  1Y1V J;  3KNW A;  2L7M P;  1MBH A;  5F0C A;  2DA5 A;  4X6A J;  2LFB A;  3BR6 A;  4MIM A;  4BKX A;  3VVY A;  1U9N A;  3JRC A;  2EZK A;  3VOK A;  3JRI A;  4CYC B;  2JJ7 A;  2L9R A;  2O7O A;  2DMT A;  3VIB A;  2NP5 A;  4JNN A;  3IH2 A;  4ACI A;  1JJ8 C;  1I50 J;  1TC3 C;  1AHD P;  2AHQ A;  3PM1 A;  3Q0W A;  2R5Z A;  3JRE A;  2RAS A;  1JTX A;  1ETX A;  5FKL A;  2K9S A;  5M3F J;  4JP0 A;  3G7R A;  3QQA A;  3VW1 A;  2L0K A;  2TCT A;  3BG9 A;  2XGE A;  3CCY A;  1CQT A;  1IGN A;  3FKI J;  3KKD A;  2XGD A;  3HGG A;  4UUS B;  2MW8 A;  1AKH B;  1HLV A;  3BQZ A;  3QKX A;  1IDY A;  3S14 J;  1ZQ3 P;  2OPT A;  3S17 J;  3SDG A;  1U9O A;  2DTZ A;  3BR5 A;  2GLO A;  3K2A A;  4AC0 A;  4XRS G;  4B3A A;  1W0T A;  1JT0 A;  2EZL A;  2NOG A;  1FIA A;  1H8A C;  1S7E A;  5C4Y A;  2HYJ A;  3S1R J;  4A3K J;  2B63 J;  3ZQL A;  2LTP A;  2M8G X;  1DU6 A;  1TWC J;  2XGC A;  1NTC A;  5M5Y J;  2LD5 A;  2QKO A;  4C3J J;  5EGO A;  3LJL A;  3PAS A;  1EF4 A;  2Y0S N;  3LSG A;  4B1R A;  5FKO A;  1YRN A;  3TW7 A;  3A02 A;  4RBO A;  3ON4 A;  1SGM A;  5C4X J;  5IP7 J;  2L7Z A;  3Q0U A;  2LP0 A;  4XID A;  2DMN A;  4M3F A;  1JKO C;  3C07 A;  2Y30 A;  1ETQ A;  4XK4 A;  1VFC A;  1XC5 A;  2FJ1 A;  3HOX J;  3ANP A;  3ZQG A;  4C2M J;  1FJL A;  4L62 A;  1X2N A;  2FX0 A;  2G7S A;  2IEK A;  4IHW A;  3FRQ A;  2R7Z J;  2JN6 A;  2JA8 J;  5K7H A;  3ZQC A;  5FGL A;  2DA6 A;  1MBG A;  2HOA A;  3BNI A;  4JX6 A;  2WAQ N;  3BR0 A;  3F1B A;  1W0U A;  3BTC A;  1HDD C;  2CQX A;  5H9T A;  2CQQ A;  3MN2 A;  1AU7 A;  2JA5 J;  3LSJ A;  2ECC A;  4DZP A;  4PXI A;  2XB0 X;  4Y7N J;  2LLK A;  2YVH A;  2JA6 J;  2OER A;  5M5X J;  5IPA A;  2KT0 A;  3JSJ A;  1POG A;  3S1N J;  5EYR A;  2X9D A;  2K9Q A;  3LOC A;  2G7L A;  4W97 A;  2ZB9 A;  3MNL A;  4BBS J;  2L7F P;  2DA7 A;  5FMP A;  3QPL A;  1WGX A;  3RZO J;  3G56 A;  2XPU A;  3BQY A;  3CMY A;  2DA3 A;  2DMQ A;  1IV6 A;  1QVU A;  1BA5 A;  4UDS A;  1FTZ A;  3RD3 A;  2M2E A;  5M3M J;  3P9T A;  3HE0 A;  2CUE A;  4NEL A;  1A5J A;  2GBY A;  1ETK A;  1B8I B;  1HCR A;  3GTQ J;  3S2D J;  3BR3 A;  1X2M A;  2E19 A;  2HOT A;  3FIW A;  1JKR C;  5EFY A;  1HOM A;  1GUU A;  4MFE A;  1FTT A;  3E7L A;  1I6H J;  3HTH A;  2NVY J;  4A3J J;  5EG0 A;  2R0Q C;  3IV5 A;  1ITY A;  3S16 J;  4GCL A;  3HB9 A;  1OCT C;  3PPB A;  5D19 A;  4FTH A;  2OF7 A;  1K61 A;  1TWA J;  1MBJ A;  1H89 C;  3GBG A;  3S1M J;  2ZOY A;  2X48 A;  5DAJ A;  2G3B A;  1VF9 A;  3BJB A;  3HGY A;  2PMZ N;  4NDL A;  1D5Y A;  3O8G A;  3T6N A;  4MXM A;  2EBI A;  1MH4 A;  3GTL J;  3V6G A;  3D1N I;  1ZK8 A;  4M3B A;  2YUS A;  1VI0 A;  3A03 A;  1QRY A;  5EF6 A;  4A3F J;  4W1U A;  5FLV A;  3GTK J;  3FK7 A;  2FQ4 A;  3KKC A;  5IYB J;  1GVD A;  2VKE A;  3I4M J;  2O8K A;  3PO2 J;  3ANG A;  5F0F A;  1XS9 A;  3QBM A;  2H8R A;  2M9H A;  3GTM J;  2IU5 A;  2WV1 A;  3B81 A;  4A3B J;  2K40 A;  5GPA A;  2DG8 A;  3LSR A;  5D1R A;  2XDN A;  2QTQ A;  1JKP C;  3DCF A;  4A3C J;  3FIS A;  1U8B A;  2KDZ A;  4DYC A;  4IEJ A;  2NVX J;  3A01 A;  5FKM A;  1MBE A;  2OI8 A;  1F36 A;  1H88 C;  2G7G A;  4A69 C;  2YS9 A;  5K7F A;  1UHS A;  2ZCN A;  5HOD A;  5FKK A;  3JRF A;  4FCY A;  1APL C;  1UI5 A;  4XRS A;  1ZGW A;  4QIW N;  4BXX J;  2E2J J;  3AQT A;  3CRJ A;  4JL3 A;  5EZG A;  3O8H A;  4MLO A;  3ZOB A; 
#chains in the Genus database with same CATH topology
 3TOB A;  3EUA A;  2NNN A;  4E7Z A;  2XAH A;  2XIG A;  1K78 B;  5IY5 H;  5K5R A;  4LG0 A;  4PZJ A;  2GUH A;  3DLL F;  4RAZ A;  3KP5 A;  1SD4 A;  3CJR B;  3OSF A;  4M9X A;  4HQE A;  5BPI A;  1ZRE A;  4H0E A;  4KIB A;  3L2U A;  2KIS A;  4HF1 A;  3LSM A;  4U87 A;  2E7X A;  4PSX A;  1HST A;  1KU2 A;  3CUQ C;  2MH2 A;  4KN7 X;  5AQC A;  4XSZ F;  3CLQ A;  1XCB A;  1Z05 A;  1E3O C;  1B9N A;  2MD0 A;  1P7J A;  1S5L C;  5ED4 A;  1UMQ A;  2KJC A;  2R5Z B;  2XV4 S;  3KYL A;  2MFZ A;  4B4C A;  1WPK A;  1P4W A;  5DS9 A;  2O7T A;  2HYG D;  4JK1 X;  3RPQ A;  2VJI A;  2L4M A;  2HI3 A;  3CCE I;  4J00 A;  1Z9C A;  4CGR A;  1Z7L A;  4OAZ A;  2RN7 A;  3OYA A;  1M1E B;  2HQR A;  5K1Y A;  2VUM J;  1UB9 A;  5LRS A;  2HU9 A;  3ZMT A;  5D5X B;  1EJ9 A;  4IXA A;  2IVM A;  1ENH A;  5J1R A;  1OR7 C;  2KPM A;  1T33 A;  4ENJ A;  2ZXH A;  2Q24 A;  3T1B A;  2RAE A;  3RZD J;  1J59 A;  1I3Q J;  2JUG A;  2XSJ C;  2WY8 Q;  1BI0 A;  4RLF A;  3S1Q J;  3R4K A;  2VJ5 A;  1VQN I;  2VE9 A;  1I1S A;  1XB4 A;  4N9I A;  3JTG A;  2R7F A;  5F1J A;  1AKH A;  4I0B A;  3SXY A;  1BI3 A;  2E71 A;  2MD5 A;  4ASN A;  3NPI A;  4ZDL A;  3JRA A;  3QWL A;  3NNR A;  3JRH A;  4GRI A;  2HQ5 A;  1Z3Y A;  3DKX A;  1SD5 A;  3FBN B;  5LEK A;  2IA1 A;  4AC6 A;  1DDN A;  4AWX B;  2HKX A;  2DMP A;  2GXG A;  2RQQ A;  5B1A H;  4KJZ A;  2MG4 A;  4FE4 A;  3PSF A;  1G3Y A;  4EAT A;  3N97 A;  2KZV A;  5D18 A;  3HXL A;  4EV0 A;  5IP6 A;  1D8J A;  2I8D A;  1FYL A;  1UZC A;  2BY2 A;  3GZ6 A;  2NS0 A;  2M30 A;  3CES A;  2DOD A;  2CFX A;  1UHW A;  4S05 A;  4IRG A;  4G7Z F;  4HKU A;  1FP1 D;  4IZZ A;  4IHV A;  1D8K A;  5CPR B;  3LMM A;  5FJ8 J;  2C6Y A;  1IZ1 A;  3LSP A;  4M74 A;  2CV0 A;  1P92 A;  1YE9 A;  4BAY A;  4QSH A;  1G3S A;  1W36 D;  3C1D A;  5EZH A;  5JHU A;  1KU9 A;  3ZR8 X;  4XRM A;  3BTL A;  2X6X A;  3ECO A;  2ZO4 A;  4PFO A;  1VQO I;  4IF4 A;  3HBL A;  2M5W A;  3IH4 A;  1MMS A;  4EJW A;  2VON A;  1JE8 A;  4WK8 F;  2PMH A;  2DG7 A;  4GCK A;  5K7Z A;  1QA6 A;  1SMY F;  1EV7 A;  4A3L J;  1FOY A;  5J1U A;  2XRN A;  3JTH A;  3H9J A;  2ZFU A;  2PJR A;  3BRU A;  3K70 D;  4N4N B;  1CF7 A;  3AG1 H;  5HAW A;  4P5O A;  4C3I J;  3ABT A;  2XSD C;  4PCQ A;  4J01 A;  5FLX Z;  3EYY A;  2XUB A;  4RS8 A;  4U0V A;  2VJJ A;  4FQG A;  2ME6 A;  2DJN A;  2OC6 A;  1F43 A;  2D5V A;  2XKO A;  4XLP F;  3CF5 F;  3Q3S A;  2FBI A;  5FFZ A;  4D7M A;  2QBY B;  4F3Q A;  4OMY A;  3ZMD A;  2ECB A;  3BG6 A;  4N4O B;  4ZJZ A;  4U9L A;  1RR7 A;  1R4N B;  1KGS A;  3CUQ A;  1R9T J;  4E70 A;  1G2H A;  3OIP A;  5KAF C;  2QYO A;  2WV0 A;  3HSF A;  3OYD A;  1YJW I;  4DGW B;  4IQ4 A;  4R1H A;  1IF1 A;  3I58 A;  2L02 A;  3OS0 A;  2YU9 J;  1S9H A;  1I39 A;  3LQR A;  3BG3 A;  5DCF A;  5FKN A;  2F07 A;  1SD7 A;  5HDN A;  4HDV A;  2F2E A;  2F4M B;  3HTS B;  2COB A;  1IC8 A;  4WXH A;  3CLO A;  4BNC A;  2A2F X;  2E5Z A;  2QSG X;  4EJT A;  2HWV A;  2V6C A;  1YW7 A;  2JA7 J;  5ICE A;  5F1R A;  1IXS B;  1X1C A;  4RB2 C;  3ZQI A;  4YZE A;  4HDU A;  1VTN C;  4AU7 A;  2YU3 A;  2NX4 A;  1RZ4 A;  2QWT A;  4ZDP A;  3WTY C;  1QHH D;  2KMU A;  3V42 A;  2K3P A;  3UKG A;  1O7L A;  2DFF A;  1YG2 A;  1OR7 A;  2DU9 A;  2ID3 A;  3R6S A;  1R5I D;  3BR2 A;  3S93 A;  3A01 B;  4KNY A;  3KYD B;  4IX7 A;  1E2X A;  2B1E A;  3CCQ I;  5BPD A;  3BY6 A;  1OCR H;  4HNV A;  1T56 A;  4GFK A;  2YVE A;  3ECH A;  1LNW A;  2DFH A;  4FIS A;  4KDP A;  4I76 A;  5HS8 A;  2HKU A;  1MH3 A;  5K58 A;  2AQE A;  1ACI A;  5HSZ A;  2IPQ X;  3COA C;  4UUS A;  4B43 A;  2GEN A;  2E34 A;  4ANJ A;  4BH9 A;  2UZK A;  2CWE A;  3G2B A;  5GPC A;  3H3U A;  3VOE A;  4IHY A;  5CXG A;  1V5E A;  2Y75 A;  3NEU A;  3TL4 X;  3HC7 A;  2DPU A;  3M1E A;  3P9K A;  3TP0 A;  2HTJ A;  4RA2 A;  2BGC A;  3TP3 A;  1N77 A;  3FWE A;  1LE8 B;  1B72 B;  2HVQ A;  3IWZ A;  3RQI A;  1ETO A;  1D3Y A;  3EET A;  3D0S A;  4B47 A;  4CUG A;  3TQN A;  1BW5 A;  1GV2 A;  2QGU A;  2Y0M A;  5AIP A;  5E17 F;  1K78 A;  5CKT A;  3COL A;  3WU2 C;  3OYL A;  4J19 A;  2IS1 A;  3KEY A;  3IUV A;  5GP9 A;  3TOA A;  2OZU A;  2VJ4 A;  3F72 A;  3G1M A;  4G6Q A;  4AIK A;  3PNY A;  1XCV A;  2FA5 A;  3DBH B;  4A3E J;  1A6I A;  2RQP A;  2DYR H;  3M07 A;  3RQ4 A;  2P7C B;  2DA5 A;  2QSH X;  4X6A J;  5FRO A;  4BKX A;  2LH9 A;  5L3D A;  1O3S A;  4CYC B;  2F6C A;  2JJ7 A;  2L9N A;  1U5T B;  2NP5 A;  3ERE D;  4ACI A;  1JJ8 C;  1YYV A;  3SEQ A;  1RUO A;  2VQC A;  1I50 J;  5HS7 A;  1FOW A;  2M7B A;  1YX3 A;  2AHQ A;  1FLI A;  2R5Z A;  2RAS A;  1IXR C;  1JTX A;  5M3F J;  3G7R A;  2K9S A;  1B9M A;  4HST A;  4JP0 A;  3V7C A;  6PAX A;  3SWH A;  3VW1 A;  3OR1 C;  2YSR A;  3PUF A;  3BG9 A;  2QSF X;  2XGE A;  2YPR A;  3AG4 H;  1IGN A;  2XGD A;  2MW8 A;  1HLV A;  1T95 A;  3QKX A;  2CFO A;  4Q47 A;  4U9N A;  2DBB A;  5GTI C;  2PFB A;  3S17 J;  3SDG A;  1DPR A;  4NB5 A;  3HTU A;  5D5U B;  2BY3 A;  2RGV A;  2KKO A;  1H8A C;  1SFE A;  4BYY A;  2Q1Z B;  2B9S A;  2BXZ A;  4ESB A;  4A3K J;  2B63 J;  2M8G X;  5L3B A;  2DFI A;  3DWL E;  2QKM B;  1TWC J;  3ZN1 A;  3GFM A;  1OMI A;  3V8K A;  1QU3 A;  5DEQ A;  2JPC A;  2JT1 A;  4L18 B;  3DP7 A;  3TW7 A;  3WE3 A;  3D5L A;  5C4X J;  1FZP B;  4IRI A;  2KDO A;  1U0J A;  4I02 A;  1ZAO A;  4F93 B;  1S8N A;  1R22 A;  4PJL A;  4A2U A;  3C18 A;  4YIR X;  4XLH A;  3VWB A;  2DMN A;  1G6N A;  1WQ2 A;  3WTZ A;  2QZ8 A;  2EK5 A;  3D5R C;  1R49 A;  1EH8 A;  1FNN A;  1Y8Q B;  1KZH A;  2DK8 A;  4D9J A;  1UFM A;  4EVI A;  3BLY A;  3E0J B;  1A31 A;  1X2N A;  2HEO A;  1E17 A;  4PK4 A;  4EJU A;  2IEK A;  3FXO A;  3OYN A;  1NH3 A;  4IHW A;  3VSK A;  2R7Z J;  3RTR A;  5K7H A;  3F8N A;  5FGL A;  1Z6T A;  2DA6 A;  3FDY A;  3ABM H;  1K4S A;  2KZG A;  2ZXJ A;  2BE5 F;  2HOA A;  5E1X A;  2VOP A;  2DK5 A;  1AWC A;  1K79 A;  1DP7 P;  1W0U A;  3H36 A;  4LD5 A;  3GEZ A;  5JHF A;  3MN2 A;  1AU7 A;  2JA5 J;  4DZP A;  4HRI A;  3F8B A;  2XDV A;  1SMT A;  2ELH A;  2LG4 A;  2JA2 A;  3MWM A;  3JSJ A;  1R1T A;  2KHM A;  2Q0O A;  1AOY A;  1ZRC A;  4RGU A;  2HPI A;  4W97 A;  4KIS A;  3MNL A;  4BBS J;  4PSW A;  1T08 B;  3E97 A;  3FHZ A;  5FMP A;  2R7W A;  1WGX A;  3RZO J;  3BQY A;  1I5Z A;  3CMY A;  2A3S A;  2DMQ A;  1QPM A;  3UR3 C;  4DNC A;  2OQG A;  1G4D A;  2BXY A;  4LIU A;  2M4K A;  2LBF B;  4CA0 A;  3RD3 A;  5FLX K;  4E6K G;  4C2M A;  1K6O A;  1ETK A;  5CVU A;  2IW5 A;  1HKQ A;  3GTQ J;  5LHH A;  3SEZ A;  3E5Q A;  2W4S A;  2ZBK A;  1HOM A;  5B1B H;  2EIJ H;  3E7L A;  1B6A A;  2UUZ A;  4II3 A;  1J09 A;  1TQI A;  2AQF A;  3S2W A;  2DOF A;  4BHP A;  3KP2 A;  2QBY A;  3S16 J;  4GCL A;  2XAU A;  3HL2 A;  1R23 A;  1TWA J;  3K2Z A;  1Y0U A;  1JGS A;  3S1M J;  2HZT A;  1BR2 A;  2VXZ A;  3JSO A;  4B09 A;  1S6L A;  3K10 A;  1VF9 A;  3BJO A;  5HNF A;  2PMZ N;  1X1B A;  3CP8 A;  1W5C C;  4Y33 A;  2VBX A;  2EBI A;  3MKW B;  2DOE A;  2KIF A;  3OL3 A;  4Z2Y A;  2PMU A;  3A03 A;  1WRJ A;  4W1U A;  4KIT B;  2L54 A;  1FT9 A;  1BN5 A;  2FQ4 A;  3RCO A;  3PO2 J;  3KKC A;  1FSH A;  1AA7 A;  5HLG A;  1FOK A;  2H8R A;  2R7V A;  2W25 A;  5H2F C;  2WV1 A;  2AS5 F;  1XX5 A;  3VYT B;  2K40 A;  4A3B J;  2DG8 A;  3LSR A;  1ZH5 A;  2PFV A;  5D1R A;  3W2W A;  1IN4 A;  5DCM B;  4BHC A;  4L0Y B;  1G3W A;  1KYW A;  1QBJ A;  2CSO A;  4BAC A;  4OOI A;  2KDZ A;  3FM5 A;  4DYC A;  4IEJ A;  3A01 A;  3I3L A;  2G7G A;  2IGM A;  3HRS A;  4V19 K;  2OUM A;  3KPH A;  1UHS A;  3GO5 A;  2DAO A;  3WU1 B;  2WBM A;  1FPQ A;  4DQ2 A;  1FWZ A;  2E2J J;  3KEQ A;  5FGM A;  4Y13 A;  3ML6 A;  4JL3 A;  2V9P A;  4MTD A;  1V4R A;  3U1D A;  4BU2 A;  1K7A A;  3FXR A;  2NYX A;  1P7I A;  2LVS A;  2WAE A;  2UXN A;  5E79 C;  2HVR A;  4BJ5 C;  2OTJ I;  2XVC A;  3B02 A;  1E3H A;  2CU7 A;  4A5N A;  1JUS A;  1R5H A;  3AAF A;  3P9I A;  2GOM A;  3BP8 A;  4HX4 A;  1LE8 A;  1B72 A;  2LRE A;  3IKT A;  4O3M A;  3ABK H;  3ZN0 A;  3QPH A;  2VKH A;  4HLY A;  3ERM A;  3K7A J;  3HG9 A;  3MKY B;  3O6B B;  1T98 A;  3H5N A;  3EGQ A;  3IRQ A;  1LEB A;  3IHU A;  1Z0X A;  2V1N A;  2P7V B;  4MEY F;  2PZ9 A;  2VQL A;  3DLA A;  3GTP J;  4A6E A;  4YIF A;  5ERI A;  4XLF A;  1BW6 A;  2MSY A;  3IAM 2;  1XTA A;  2QQ8 A;  3H3Z A;  2EPF A;  3WG9 A;  4RB1 A;  2BHZ A;  2HXI A;  3HKZ N;  2F4O B;  2RC4 A;  1IN7 A;  1XGO A;  3CCV I;  2K7L A;  3B6C A;  1X1P A;  5KNL A;  3Q0V A;  4HLX A;  4HEA 2;  4BY7 J;  3KP4 A;  3ON2 A;  4HNT A;  2EB7 A;  2IGN A;  4CYC A;  1U78 A;  2VQG A;  2X85 A;  3T8T A;  1X3Z B;  5IT3 A;  1WJ5 A;  3QOD A;  3U2R A;  1WWX A;  2W53 A;  3WU0 A;  3OSG A;  5CJ9 A;  3L2V A;  1XSV A;  1TNT A;  2W57 A;  3LA7 A;  4AYB N;  1MD0 A;  3AL0 B;  4C2U A;  2LK2 A;  3V78 A;  1Y0N A;  3O2P E;  1MW7 A;  4JQF A;  4ZZL A;  2HOS A;  4JKZ A;  3JRG A;  3E6M A;  3G4S I;  2W84 A;  3RYP A;  1YRN B;  2VC0 A;  2GIZ A;  3MFK A;  1LFU P;  2K9L A;  4M3D A;  3N4M A;  3N05 A;  3FXQ A;  2VIX A;  3IL2 A;  4PJN A;  1K83 J;  4CCM A;  1GDT A;  2EH3 A;  2EIM H;  2ESN A;  1RIO H;  3BCA A;  3CMM A;  5JVG F;  5DDG A;  1A04 A;  4E7K A;  3HZJ A;  3TKY A;  1ZKG A;  3V7R A;  2X1D A;  3WTV C;  2DA4 A;  5C3E J;  2ZKZ A;  2E1O A;  4LK1 F;  4B48 A;  1V54 H;  1SC7 A;  2BBY A;  2HNH A;  4O6J A;  1KQ0 A;  3JRB A;  3HIF A;  3K4J A;  4XOP A;  3IC7 A;  3A4C A;  3HSR A;  2IA0 A;  5HLI A;  2LMD A;  2NS7 A;  3S5R A;  3O60 A;  2BW3 B;  2ZC2 A;  4BGD A;  2Y0S A;  3F21 A;  4Y52 J;  3GLL A;  2DCE A;  2STW A;  1S7O A;  3QOE A;  3EUP A;  1P6R A;  3ZQ7 A;  4G9Y A;  4OAY A;  3IKV A;  4ENN A;  1HBX G;  1IUF A;  2DDA A;  2DOA A;  3QP6 A;  2I10 A;  2GOX B;  2GFN A;  4HSR A;  1W5T A;  5CW8 A;  3REO A;  4DZJ A;  3A0H C;  1BIB A;  3ZMS A;  3IRR A;  2B3W A;  1G8X A;  2GIV A;  4EJV A;  2QKL B;  3DEW A;  4P9U A;  3CQZ J;  3H0G J;  2WWY A;  2ZOZ A;  4I98 B;  1D5V A;  3UNG C;  2VPL A;  1ZTR A;  2PI0 A;  3RJP A;  5IYD J;  4NC6 A;  4A93 J;  1GVJ A;  3VW2 A;  3BHQ A;  3A2K A;  2WAQ A;  1JHF A;  4G94 A;  5F0H A;  1R71 A;  3OOP A;  2O0Y A;  2LOO A;  4EM0 B;  5HVQ C;  2K9N A;  2E2H J;  4BE2 A;  3E5X A;  4D5F A;  5K5O A;  4E7I A;  4II2 A;  3TGN A;  4BDZ A;  3H9G A;  3I0T A;  1BC7 C;  1MZB A;  1IV8 A;  1ODD A;  3TO7 A;  3HPH A;  2CQN A;  1IXC A;  3AL0 C;  1O7F A;  3FX3 A;  2XF5 A;  2JSP A;  1B4A A;  1Q1V A;  1QVT A;  4V2G A;  3L7W A;  2GM4 A;  4A6D A;  3GX4 X;  3J81 Z;  1BL0 A;  2E5N A;  2QF7 A;  4IKF A;  1F5T A;  5E3N A;  2FBQ A;  3HTA A;  2UXO A;  2P5K A;  1BIA A;  1TW2 A;  2HQA A;  2JSC A;  2QQB A;  3HOT A;  5D4S A;  1E0E A;  2L3D A;  3DBR B;  2V1D A;  3MZY A;  5J40 A;  2F5F A;  1RR8 C;  3CDL A;  4QPQ A;  4I6Z A;  4GFB A;  2ZME B;  4YEL A;  5DTD A;  3LST A;  1X58 A;  1MSE C;  3K4K A;  3KE2 A;  2DLL A;  5AON A;  1KQ9 A;  1IJW C;  4CGZ A;  1U8R A;  2UXI A;  5KAI C;  3ZPL A;  1JT6 A;  2ZCX A;  4GCT A;  2O61 A;  3ZMV A;  4L9T A;  4M6V A;  2TRT A;  1JUM A;  1P2F A;  3BDD A;  1BM9 A;  2M1B A;  2H27 A;  1R7J A;  3HDD A;  3PNV A;  1WZ2 A;  1RRJ A;  2FSW A;  3EUH C;  1MDM B;  4AVP A;  3VVZ A;  1X4P A;  1BJZ A;  2KLO A;  1XSD A;  2HDD A;  1MMD A;  5FLM J;  1BC8 C;  4UHT A;  5K5Q A;  4IRH A;  3BR1 A;  3I59 B;  1XMK A;  2NS8 A;  2G7U A;  2Y9Y A;  3SHF A;  3M4O J;  3ZMU A;  4CZZ A;  3BTJ A;  2FOW A;  3LFK A;  3WHB A;  3ZXS A;  1SVO A;  3LNQ A;  5DUI A;  1JKQ C;  1SFK A;  4AIJ A;  4OIQ F;  4L5E A;  2N8G A;  3K1N A;  4UVC A;  3TO6 A;  1I1G A;  2KP6 A;  1U3E M;  1SFO J;  3ZQF A;  1UG0 A;  1VND A;  1JUP A;  1R00 A;  2K86 A;  1J75 A;  1QPI A;  2JUC A;  1YX5 A;  3FM3 A;  4ZYG A;  5B5E C;  2R5Y B;  1YFH A;  1YIT I;  5ILV A;  2VXD A;  2L01 A;  3V8L A;  4KWA A;  4YFN F;  4FAS D;  2ELJ A;  1QQI A;  4CSW A;  1PJR A;  2K02 A;  4IHT A;  1SD6 A;  3W2V A;  5CVV A;  3PIO F;  1LFB A;  2FXA A;  4MEX F;  2FEZ A;  1LDK B;  3RH2 A;  1MKM A;  4KIC A;  5EEA A;  2Y31 A;  4DYQ A;  4PGG A;  1Z1D A;  3BZK A;  3CO6 C;  3OV8 A;  5DUK A;  2MLG A;  1YHQ I;  2OD5 A;  1ON1 A;  2HDC A;  2EZK A;  2A5Y B;  4LK0 F;  3GUD A;  2VKD A;  3VIB A;  2W00 A;  3OYF A;  1HKS A;  3IH2 A;  3E3V A;  5LHG A;  4CH7 A;  4HW0 A;  4LLL A;  1IN6 A;  2X51 A;  5ILS A;  3H5A A;  2A61 A;  2VL8 A;  4RM2 A;  5FFX A;  1AHD P;  3Q0W A;  3JRE A;  1DP3 A;  1ETX A;  3ROU A;  5FO5 A;  1MIJ A;  2L0K A;  2ZFW A;  3KKD A;  3HGG A;  1GHC A;  1OCC H;  3RYR A;  3DQV C;  1U2W A;  2ZME C;  1U9O A;  4LMY A;  3BR5 A;  2HYF A;  4HF2 A;  4CCJ A;  4B3A A;  4BJ6 C;  2FBK A;  2H94 A;  3DFG A;  4DIQ A;  2XAJ A;  1IAW A;  2VLA A;  2D1V A;  4LB5 A;  1S7E A;  1FMW A;  1FYM A;  5C4Y A;  4ZZD A;  2L5Q A;  3ZQL A;  2MAB A;  4K2E A;  1DU6 A;  2XGC A;  4M72 A;  5DM7 F;  1UHM A;  2LD5 A;  4C3J J;  2QKO A;  3PAS A;  1EF4 A;  3LQQ A;  1NG6 A;  3GZN B;  4B1R A;  4Y17 A;  1YRN A;  3ZQQ A;  4NBQ A;  2UWM A;  1D1A A;  3CD6 I;  3A02 A;  3GW2 A;  3CO7 C;  1SGM A;  3L00 A;  4R8H A;  2L7Z A;  1KYZ A;  4M3F A;  1SVM A;  1JKO C;  3C07 A;  3E6C C;  1ETQ A;  5LHI A;  1PDN C;  3O3K A;  3FMS A;  2XC7 A;  1XC5 A;  3MZ8 A;  2IA2 A;  1DGR M;  1OLT A;  5DD4 A;  3KX2 A;  3WE2 A;  1O57 A;  3J80 Z;  4L62 A;  5BOX A;  1VQM I;  4ENK A;  4Y15 A;  3FRQ A;  3CDI A;  5AIQ A;  1FC3 A;  1SEU A;  3L2W A;  3EUH A;  1MBG A;  2EIK H;  2RNG A;  1F9N A;  5KHD A;  4U0Y A;  2JTV A;  2P0W A;  2LC2 A;  1R5G A;  2Z16 A;  3EDP A;  4XN3 A;  2Y48 A;  3TBI A;  4OD5 A;  3G3Z A;  2ECC A;  2LF7 A;  2XB0 X;  2BW3 A;  2LLK A;  4WXD A;  3GVA A;  4CZC A;  2YVH A;  5J4Y A;  1I27 A;  3OWT A;  3EYI A;  4U88 A;  4G7H F;  1POG A;  1KU7 A;  2UXX A;  5TRD A;  2EIL H;  1S7A A;  2KIQ A;  1RI7 A;  2K9Q A;  2X9D A;  5B66 C;  1ONV A;  2L9V A;  2PN6 A;  3IWF A;  3LOC A;  2G7L A;  4RB3 C;  2ZB9 A;  2L7F P;  3RSN A;  1I3A A;  4YEJ A;  4BEH B;  4ENM A;  3G56 A;  5CVJ A;  4ZC3 A;  2AXL A;  3KYC B;  3I4P A;  2PBI A;  2ZJQ F;  1OPC A;  3V4G A;  1QVU A;  4UDS A;  5EEG A;  4DBQ A;  3OYH A;  2M2E A;  5M3M J;  3P7N A;  3P9T A;  1A5J A;  3BOQ A;  3L9F A;  2GBY A;  5FRM A;  1HW1 A;  5HLH A;  1PP8 F;  3S2D J;  3BR3 A;  1X2M A;  2E19 A;  2HOT A;  4OIO F;  1BI1 A;  3OMY A;  2VAS A;  4S04 A;  1FTT A;  1WJE A;  2NVY J;  1HXD A;  4ZYD A;  2KL4 A;  2IGK A;  4UNO A;  4LGW A;  4FTH A;  3CC2 I;  1L0O C;  4ZTJ A;  4PGH A;  1V5F A;  1H89 C;  1TTY A;  3CCL I;  2ZOY A;  2X48 A;  4P55 A;  2ETH A;  5DAJ A;  2G3B A;  1R1U A;  2XF6 A;  1UEL B;  3OL4 A;  4CYD A;  3FBI B;  3M9A A;  3LSK A;  3T6N A;  3FXK A;  4KMU X;  1OYI A;  3D1N I;  3J81 K;  1K4T A;  4M3B A;  2YUS A;  1VI0 A;  1P9Q C;  4A3F J;  4B3X A;  4ON0 A;  1BJA A;  3GTK J;  5IYB J;  2VKE A;  2J5P A;  3I4M J;  2O8K A;  4IRV A;  2BV6 A;  5F0F A;  2QQA A;  2ZXW H;  4XLE A;  3DU5 A;  4LIV A;  3GTM J;  4OU0 A;  3B81 A;  2RRE A;  2ZME A;  5D4R A;  1OQY A;  3CUO A;  5LGN A;  2QTQ A;  4N9H A;  1Y6I A;  3KEO A;  2ZJP F;  4A3C J;  4XNF A;  4GO1 A;  4XQF A;  1MGT A;  4PFP A;  1U8B A;  1B1B A;  5ICC A;  5LEJ A;  2L7K A;  3GYH X;  1KU3 A;  2X6Y A;  2E1M B;  1Z7U A;  5FKM A;  1F36 A;  1KON A;  1H88 C;  4KN4 X;  3CJN A;  2J5O A;  4XBF A;  1MDM A;  3TMO A;  1YIJ I;  3S8P A;  1TP4 A;  3I59 A;  5BMZ A;  3CRJ A;  5F6F A;  1LDJ A;  2XHK A;  3CCR I;  3IP4 B;  5ILU A;  2JRM A;  1W7P B;  2VPR A;  3DTE A;  2M8E A;  3F0C A;  3K69 A;  2WUI A;  3K0L A;  2CUZ A;  1PUE E;  2HOE A;  4WXC A;  4IVN A;  1ZR2 A;  4U0W A;  1QZY A;  3VVX A;  1WKM A;  3HUG B;  2JWT A;  1UAA A;  1TWH J;  1WJD A;  5HOO A;  4OIR F;  3T0Y A;  5JI6 A;  2R5Y A;  4LB6 B;  2V6E A;  5FD6 A;  4I99 C;  4IJA A;  3SZP A;  2VT2 A;  4IL6 C;  1O4X A;  3GTO J;  3BWG A;  1L3L A;  2DT7 B;  1IG7 A;  3QOP A;  4E4H A;  3G1L A;  3DPT A;  2WAD A;  4HX7 A;  4P9F A;  5IOZ A;  3C7J A;  4LJZ F;  5BS6 A;  2H8W A;  3NXC A;  4D7N A;  4ICH A;  1GLN A;  1TWF J;  4YFX F;  3PFY A;  4Q48 A;  2VBW A;  5CXI A;  2E36 A;  1VQ8 I;  1UI6 A;  4HV6 A;  3QU6 A;  4HAM A;  3OYJ A;  2KJB A;  1TT0 A;  3KZZ A;  1D0Y A;  1ETY A;  1ZRD A;  2E7W A;  2M7A A;  4WIB A;  4NC7 A;  4EMS A;  4PDK A;  1JI8 A;  1FEX A;  2R7X A;  1U5T C;  1TW3 A;  3NWS A;  4TV7 A;  1LFP A;  1WI9 A;  4O5V A;  2Q8K A;  2LYC A;  1MJA A;  3WTT C;  5HDG A;  5EGO B;  4CDG A;  2RVC A;  4XM3 A;  3NI7 A;  2VE8 A;  5M5W J;  4A3D J;  4I7H A;  2REK A;  1OJL A;  1YI2 I;  3KP6 A;  4PJ0 C;  1IO2 A;  1YQA A;  4H4K C;  3GTG J;  2QIB A;  2KIM A;  4E7L A;  3G1O A;  1OYW A;  2X4H A;  2O6G E;  3S32 A;  2A6H F;  3HPG A;  3U9G A;  4P96 A;  2Y9Z A;  3WG7 H;  5DYM A;  5C44 J;  3OYM A;  1JGG A;  2F5V A;  2Z33 A;  1PVE A;  1TL8 A;  4JYK A;  3WTW C;  1QZZ A;  2CRG A;  2E1M C;  4FET A;  3H35 A;  5HNH A;  2WA0 A;  2FD5 A;  2W82 A;  1VZ0 A;  3X2Q H;  2STT A;  3EQL F;  1N25 A;  3E6D A;  4UVA A;  3JRD A;  2L2O A;  2R7U A;  3DEU A;  3I4N J;  1DU0 A;  1HA8 A;  3LWF A;  1TQP A;  4G7O F;  3KP7 A;  3K4C A;  1DUX C;  4XLC A;  3DTI A;  3BC8 A;  3B73 A;  1XPX A;  3NAU A;  1FBU A;  4AM3 A;  4IHS A;  3M8J A;  9ANT A;  3ABL H;  3AG3 H;  1WHU A;  2H1K A;  1HDP A;  3J80 K;  4KA4 A;  2OAZ A;  2UV1 A;  3NQO A;  2X6O A;  2P5V A;  3CCJ I;  4FX4 A;  5EEH A;  1FX7 A;  2QOP A;  3LA2 A;  3KZY A;  3CC7 I;  3WOD F;  3IH3 A;  4F91 B;  1YW9 A;  2QEN A;  2EZI A;  3DKW A;  2CGP A;  1ZN2 A;  4CXF A;  4Q5S F;  3H92 A;  1R1V A;  3MQ0 A;  3PO3 J;  3NWT A;  1N75 A;  2QLZ A;  4L9N A;  1MNM C;  2JVG A;  1USS A;  1GT0 C;  4GFL A;  5E18 F;  2M0C A;  3E5U A;  4CCK A;  2WB1 N;  5CQG A;  4G6T B;  3TW6 A;  3PQK A;  4HOB A;  1MBF A;  3DPU A;  3HOZ J;  2XB5 A;  2Y2Z A;  3F6O A;  2XF7 A;  4X1E A;  3RI4 A;  1DGW Y;  3QYB A;  2XPW A;  2DN0 A;  5HS9 A;  2DA1 A;  2K85 A;  5JR3 A;  2IT0 A;  3HOY J;  1LPQ A;  4XRF A;  2X0L A;  3T5X A;  4RGX A;  3H3V K;  2FJI 1;  3BG5 A;  4BEH A;  5EG0 B;  3CP2 A;  2DYS H;  2EJR A;  5IT9 Z;  2Z1D A;  4F7Z A;  3LA3 A;  4CIC A;  1B59 A;  1G3T A;  3AQS A;  1ZR4 A;  2IS2 A;  2ID6 A;  3J7A O;  1WH7 A;  2ZSH B;  2TDX A;  4JOM A;  4KYW A;  3HTI A;  2ESH A;  1YW8 A;  2Q2E B;  4Q4Z F;  4PJM A;  2BVL A;  2VBY A;  5D6E A;  4AVZ A;  4XKW A;  3F22 A;  1QGP A;  1SAU A;  2NOJ B;  4FE7 A;  4M6Y A;  1VQP I;  3CTA A;  5JVT A;  2WY7 Q;  4C9Y A;  2VOO A;  2EFN A;  1ZGA A;  4EM2 A;  3HRM A;  2W85 A;  3M3Y J;  3NAR A;  3IUO A;  3SFI A;  2VB6 A;  1J7K A;  5GAD J;  2IJL A;  2CH0 A;  2PEX A;  1VQL I;  4M9S A;  2R92 J;  2BZT A;  4L9J A;  3WHC A;  4RDU A;  1K6Y A;  2HZD A;  1U5T A;  1X4O A;  2AO9 A;  5DD8 A;  4XIC A;  3L09 A;  2DXI A;  1GV5 A;  4CCO A;  2ZNZ A;  2MBF A;  1W5S A;  2PJR B;  5HBU A;  2V1X A;  2ELK A;  4WWC A;  1X19 A;  4I09 A;  5LBQ A;  5FD5 A;  4XON A;  3OS1 A;  3F9K A;  1RKW A;  2ZJR F;  2PMZ A;  1Y1W J;  1XSX A;  1WI3 A;  2NXN B;  4M3E A;  4OWR B;  3LWJ A;  4BUP A;  3R0A A;  2M0M A;  1T39 A;  4A0Y A;  4CO8 A;  4EJO A;  3HOU J;  1MMG A;  4AF5 A;  3SJM A;  3C2B A;  4M6X A;  1TWG J;  3HOV J;  4E7S A;  1T8I A;  1MJB A;  3RKX A;  5JLX A;  4C30 A;  5IYC J;  2HR3 A;  4BQO A;  2KRC A;  5CQE A;  2PJP A;  1ORK A;  2DI3 A;  5F08 A;  2LNB A;  5HLT A;  2ADU A;  2IS4 A;  3CJD A;  2V1U A;  4KFC A;  3L2C A;  3GZI A;  4UXN A;  2R7O A;  4AUX A;  4HQM A;  3GWZ A;  4X0G A;  4A3I J;  2WTE A;  2HYT A;  3BJ6 A;  3W2A A;  1OKR A;  5IOY A;  2O5R A;  2O9L A;  1XD7 A;  4HA8 A;  5F27 A;  2R93 J;  4ESF A;  2FQ3 A;  3KP3 A;  2VI6 A;  4OMZ A;  5F04 A;  3ZCO A;  2W1O A;  4R79 A;  3CF2 A;  2PLY A;  3W3C A;  2WB1 A;  2P6T A;  2IRF G;  2UXP A;  4D5C A;  3LL7 A;  3BRO A;  3BZC A;  2PBX A;  5J4V A;  3OIO A;  4JX4 A;  4M9Z A;  3HUG A;  1Z91 A;  2EV6 A;  2MH9 A;  1Y1V J;  2XGX A;  1LVK A;  5F0C A;  2LFB A;  2R7Q A;  3BR6 A;  1GXQ A;  2GWR A;  4MIM A;  4DVY P;  1U9N A;  4I0A A;  3VOK A;  4XOR A;  2LRD A;  3GLX A;  5E1Z B;  2L9R A;  1N78 A;  2DMT A;  5H20 A;  4JNN A;  3MMY B;  2NAZ A;  4HF0 A;  1T38 A;  2KRF A;  2P5L C;  1OYY A;  3OYB A;  1TC3 C;  1HQC A;  1Y39 A;  2FML A;  5FKL A;  4EGY A;  3QQA A;  2A5W A;  1QHG A;  1J2X A;  3QRF F;  4IOC F;  3FKI J;  1LQ1 A;  2K5C A;  5CLS A;  1X1A A;  4UUS B;  5D5V B;  3BQZ A;  3S14 J;  2X1E A;  2VBZ A;  3PQJ A;  3V8J A;  2DTZ A;  1ZRF A;  2GLO A;  4XLN F;  3K2A A;  4XRS G;  1T0F C;  2FNP A;  4IQJ A;  2OQR A;  1JT0 A;  4RMN A;  2EZL A;  3A1Y A;  3HKZ A;  3VEP A;  3EUK L;  3S1R J;  1SFU A;  2V9K A;  1S3J A;  3CC4 I;  1E3P A;  3PL8 A;  5FB2 A;  3FMR A;  2LBF A;  1NTC A;  5M5Y J;  5EGO A;  3LJL A;  1TT5 B;  4B8X A;  4NQW B;  5FKO A;  2B7E A;  4XKC A;  4PUS A;  4RBO A;  2OTL I;  3ON4 A;  4U7B A;  1SFX A;  4XL9 A;  4G6D A;  1FOX A;  3R61 A;  5E1W A;  3Q0U A;  2LP0 A;  4XID A;  3KLN A;  1Y56 A;  1W7P D;  4AYB A;  1VQ7 I;  2Y30 A;  1X1D A;  1IRF A;  2Y69 H;  2Z3Y A;  1S72 I;  3F8F A;  1VFC A;  3OR2 C;  4UV9 A;  2BYV E;  3ANP A;  3QYF A;  1ZAR A;  1FJL A;  2FX0 A;  2H6C A;  3F3X A;  3SQN A;  3I56 I;  3CCU I;  2BY0 A;  2B0L A;  2JN6 A;  2MYS A;  3FXM A;  2NNY A;  2JA8 J;  3ZQC A;  3GCM A;  2FOK A;  1JXS A;  1A6Q A;  3I54 A;  2O03 A;  3C3W A;  2CO5 A;  4D0P A;  2WAF A;  4JX6 A;  1R4M B;  4EQQ A;  1HDD C;  1XMA A;  2IP2 A;  3ELK A;  5CYV A;  1A36 A;  5H9T A;  4PXI A;  3OYG A;  3L2R A;  4AIH A;  3LSJ A;  5KCM A;  2A69 F;  4Y7N J;  2JA6 J;  2GXA A;  2OER A;  2X1C A;  5IPA A;  2P8T A;  3M8F A;  3OYI A;  4ETS A;  4P1W A;  4QWQ A;  5DCM A;  5EYR A;  3FF5 A;  4BXF A;  4JBA A;  2GA1 A;  2DA7 A;  2L9S A;  3VYS B;  3LSI A;  3RIR A;  2V26 A;  2XPU A;  4IOA F;  5D8K B;  2HTS A;  2W24 A;  3KLO A;  5BQT A;  1IV6 A;  3QYE A;  3F23 A;  1ZEL A;  1BA5 A;  3K4N A;  3ZMZ A;  3WTU C;  5E8G A;  4NEL A;  1B8I B;  4E7H A;  2FNA A;  4RGS A;  3OS2 A;  2DT5 A;  2G9W A;  3P5J A;  2EIN H;  2DTR A;  3FIW A;  1Z3X A;  4KT5 C;  1GUU A;  4MFE A;  3TDZ C;  1I6H J;  3HTH A;  3W6J B;  3Q9V A;  4AID A;  5EG0 A;  2JPB A;  2R0Q C;  3I5U A;  2A6T A;  2EWN A;  3I9V 2;  3HB9 A;  5IT9 K;  4KIG A;  3HYI A;  4XKV A;  1PP7 U;  1REP C;  3CCS I;  3MD2 A;  3GBG A;  3I64 A;  4L5I A;  4RM3 A;  4Y3O A;  4Y4R A;  4BQA A;  3ZP5 A;  4BQQ A;  1LUJ B;  2MC4 A;  3VYU B;  1D5Y A;  2O8X A;  3GFI A;  5H6R A;  3I71 A;  3H0D A;  2Q2E A;  1WJB A;  4MXM A;  1MH4 A;  1FBQ A;  2K4J A;  5DV5 A;  3V6G A;  4NNJ A;  1QRY A;  1QO0 D;  3DTK A;  1FP2 A;  1NG7 A;  2XAS A;  3JAM Z;  3RPU A;  1XGS A;  3HJE A;  2W7N A;  1MJ9 A;  3ANG A;  1XS9 A;  2D2W A;  3QBM A;  3KZI C;  2BHY A;  2M9H A;  2PG4 A;  3F8M A;  4BDY A;  2IU5 A;  4LIT A;  5J47 A;  3KFW X;  2XDN A;  1T0F A;  4UY8 I;  3DCF A;  2R7S A;  3JW4 A;  4M71 A;  3FIS A;  1UCR A;  2COM A;  2HVS A;  5LGU A;  2K4B A;  3DU6 A;  2OI8 A;  4L5J A;  5K7F A;  2IS6 A;  2CUJ A;  2ZCN A;  5HOD A;  1J9I A;  3CCM I;  1VQ9 I;  5FKK A;  3CZ6 A;  4FCY A;  2GZW A;  4XRS A;  4BXX J;  1DPU A;  1GXP A;  2MC3 A;  1EKE A;  3VDX A;  5EZG A;  3O8H A;  4MLO A;  5EJC A;  2BEO A;  4MQV A;  1Z6R A;  4A5M A;  4ESJ A;  4HPQ A;  5L3G A;  2XAQ A;  1HKT A;  3SFZ A;  3L2Q A;  1PUF B;  3F8C A;  4LFU A;  1LDD A;  4GGG A;  2EFW A;  5GAH J;  2K27 A;  3HHH A;  4L9V A;  5LLQ A;  1OIS A;  4HYE A;  4RAG A;  4ZYE A;  4KMF A;  2DQL A;  2A07 F;  2CW8 A;  2BY1 A;  5D5W B;  1EH6 A;  3FXU A;  2ISY A;  1YO5 C;  1ZLJ A;  1MSF C;  2QCO A;  3GEU A;  3K8P C;  3K1M A;  2K3F A;  4XMY A;  4HZF A;  1ZG5 A;  4IHX A;  3LFU A;  1EH7 A;  5EDN A;  5L3E A;  2QQ9 A;  1J5Y A;  2CV2 A;  2OBP A;  1WH5 A;  2CS3 A;  2R7D A;  4UVB A;  4F52 A;  3WGI A;  3S3O A;  2CJJ A;  3KZ9 A;  2GXB A;  3FMQ A;  3CMA I;  1R36 A;  4GYI A;  3FHN A;  3NRV A;  3G73 A;  2YX4 A;  5TIS C;  4BBR J;  3J7A Y;  4I01 A;  4N0B A;  1FIP A;  2ZCM A;  1P4X A;  3RPU D;  4RAY A;  2VT3 A;  3W6V A;  4CHU A;  3G71 I;  2V9V A;  3ZQH A;  3B6A A;  3DPL C;  2YX7 A;  3PJR A;  3G6E I;  4GDF A;  3ONQ A;  5J6X A;  2CQK A;  3MVP A;  1QNT A;  1Q1H A;  4LOC A;  2FMY A;  1NK3 P;  3Q9S A;  5LGT A;  5L3C A;  2DW4 A;  2Z99 A;  3LSH A;  4ME9 A;  3K9T A;  2NP3 A;  5TJJ A;  5E3L A;  2D6Y A;  5JLW A;  4M3G A;  4BS9 A;  2CUF A;  1XG1 A;  4F92 B;  2G7H A;  2K9M A;  2LY9 A;  3SYT A;  1LB2 A;  2F5D A;  3BZ6 A;  5FRN A;  1TZL A;  5LRR A;  1O3T A;  2XRL A;  1VQ4 I;  3PIP F;  2EV5 A;  3RDI A;  4UUT A;  3VUQ A;  2KIU A;  2XAF A;  5IP9 J;  4QLC U;  2NRA C;  4MHG A;  2VKV A;  4QTR A;  1TNS A;  5B3S H;  5BNG A;  5LFA A;  1OFC X;  1ON2 A;  1WJF A;  1LEA A;  4RAF A;  4XKB A;  1ETW A;  2BVM A;  4XSX F;  2E1N A;  2QM3 A;  4OIP F;  4BY1 J;  3VPR A;  1KQ8 A;  2V57 A;  2VOD A;  2FU4 A;  2XAG A;  2LKS A;  2EA4 A;  4NQW A;  4V2F A;  2QUF A;  4LLG F;  1D1B A;  1VQ5 I;  2EQR A;  3GFJ A;  1CGP A;  1D1C A;  2HFH A;  1SAN A;  1RPW A;  1Z21 A;  4NC8 A;  3VW0 A;  3DXJ F;  1A35 A;  3WTS C;  2UXH A;  3DPJ A;  5L3F A;  4NN1 A;  2XPV A;  1IRZ A;  4NHJ A;  4RB0 A;  3HTJ A;  4C3H J;  3BCG A;  1D0X A;  1JHH A;  2EZH A;  1LKX A;  1HW2 A;  1BI2 A;  2JQ7 A;  2ICW G;  4DJA A;  5J3L A;  4FHT A;  5HDK A;  3SZT A;  3K4L A;  1YS6 A;  1WCM J;  4ZDO A;  2V7F A;  4YFK F;  2WGB A;  1XGM A;  4F55 A;  5E3O A;  5H6Q A;  3CWR A;  3CME I;  2GQQ A;  3FK6 A;  3QU3 A;  3JSP A;  3VTI A;  2EFQ A;  3TED A;  3DV8 A;  2HGC A;  1HF0 A;  2IGO A;  5D8L B;  1KA8 A;  3QPS A;  4BE1 A;  1FY7 A;  1UJ8 A;  1IRG A;  5JFR A;  5GAE J;  3D5S C;  2P81 A;  3EPZ A;  3T8R A;  1HSJ A;  2HPM A;  3J7Z I;  1XN7 A;  2P6S A;  1XDU A;  3MKL A;  3L1P A;  3ASO H;  2LR8 A;  3E1S A;  2X6W A;  2JMW A;  3BTI A;  3RKQ A;  2MLK A;  3BJA A;  2VN2 A;  3VOX A;  1IUY A;  5C4J J;  4BJT A;  2NVQ J;  1WJC A;  3DBL B;  5ICF A;  1R58 A;  1X3W B;  3GTJ J;  2LKX A;  5A2Q Z;  2AXT C;  3DEE A;  4DW6 A;  1BR4 A;  2EV0 A;  4KUM A;  3Q5F A;  3MEX A;  4A3M J;  3NRG A;  2HXO A;  4MTE A;  4WCG A;  1B8I A;  5CVI A;  1ETV A;  5E20 A;  3OYE A;  1T6S A;  4A3G J;  4YG2 F;  4DOZ A;  2NVT J;  1WFX A;  4I2O A;  1BR1 A;  3K4B A;  3KET A;  2H6B A;  2IAI A;  4EEF G;  4A0X A;  2UXU A;  3R0J A;  2LSO A;  3FKJ A;  3HOS A;  2LF8 A;  4HX8 A;  2A68 F;  2OU2 A;  2OJE D;  5DM6 F;  3RKY A;  1JJ6 C;  1EA3 A;  1XMX A;  3R60 A;  3S3M A;  1IDZ A;  3BPV A;  2DMU A;  2LY1 A;  4HBL A;  1RES A;  2W48 A;  2GA2 A;  4S0H B;  4GCV A;  5J8C A;  4UV8 A;  3AKZ A;  1HW5 A;  1Z77 A;  5E3M A;  3VP5 A;  2ACJ A;  3OYC A;  1IRX A;  4DYR A;  3H5R A;  1H0M A;  3LHQ A;  4MO7 A;  2DA2 A;  4A0Z A;  1YJ9 I;  2OV7 A;  2E1C A;  3JAM K;  1RKT A;  2IBD A;  4LLN A;  1RET A;  3F6V A;  3C2G A;  1OCZ H;  5FHP A;  4NUB A;  2I5U A;  3FXL A;  3JR9 A;  1ERD A;  2RHA A;  4FT8 A;  1OCP A;  4M73 A;  4D1Q A;  3BCB A;  4XOT A;  3GF2 A;  3ZGK A;  1ZG3 A;  1O3R A;  1Y8R B;  2JVH A;  4AD9 A;  2QWW A;  2MA3 A;  4ZYH A;  1XGN A;  2KQR A;  1F4K A;  4MK6 A;  3SDB A;  1TQM A;  2CQ7 A;  3HEF A;  5J1Y A;  5CVR A;  1NK2 P;  2P4W A;  1S29 A;  4LG0 B;  2ZNY A;  3S2H J;  2M34 A;  1WVR A;  1UST A;  5KVR A;  2JK3 A;  4ABZ A;  3V7S A;  1P4A A;  3HHG A;  2DFE A;  1ULY A;  1ZHF A;  2IXS A;  3BPX A;  3VYR B;  4MFD A;  3AG2 H;  1F1Z A;  1IN8 A;  2ME0 A;  4KT6 A;  3ABU A;  3E7Q A;  1IN5 A;  3OOU A;  4HV5 A;  1PYV A;  4YRV A;  2E2I J;  2FE3 A;  1PUF A;  3C2H A;  3KIO A;  3U1K A;  4ZH4 F;  3J7Y J;  2D45 A;  1I6X A;  3S15 J;  1UG2 A;  3BT9 A;  3ISP A;  2MGQ A;  3HIM A;  4ZYA A;  2G0E A;  4G12 A;  2R7R A;  2LKP A;  5GTH C;  3E6B A;  3HM5 A;  3HOW J;  4JX5 A;  1MBK A;  1JTY A;  3HRT A;  3KNW A;  4XR6 A;  1D0Z A;  4MNU A;  2L7M P;  1MBH A;  3VVY A;  3U21 A;  2H1L A;  3JRC A;  4FX0 A;  4BHB A;  2F5E A;  1G59 A;  3JRI A;  3SZG A;  2OZ6 A;  3GME A;  1YOV B;  2ZCW A;  2O7O A;  3MAJ A;  5GAG J;  2E35 A;  2VC1 A;  3S3N A;  1YLF A;  3CDH A;  1T2K A;  4EM1 A;  3FZV A;  4ITV A;  3MZH A;  3P9C A;  3PM1 A;  3WTX C;  2HKO A;  2PQ8 A;  4E7J A;  2LDU A;  3GFL A;  1YIO A;  1U6G A;  2OCC H;  2TCT A;  3ESW B;  3M8E A;  1YS7 A;  3CCY A;  1CQT A;  4UB6 C;  3ULQ B;  5KK1 A;  1AKH B;  2FRH A;  2YVX A;  1IDY A;  2NVU B;  3K4M A;  3MKZ A;  5E8I A;  1ZQ3 P;  2LY2 A;  2OPT A;  2DJI A;  3K1P A;  2M45 A;  2Z2S B;  2JRT A;  4CCN A;  1R6R A;  1RC9 A;  3FXJ A;  4AC0 A;  3PNT A;  1W0T A;  1STZ A;  2NOG A;  4LG3 A;  2YR2 A;  1FIA A;  1FSE A;  4XLA A;  2FF4 A;  4ZTF A;  1OCO H;  1ZG1 A;  2CYY A;  2F4I A;  1BOA A;  2HYJ A;  4U7D A;  2DT6 A;  2ZY9 A;  2M4G A;  2LTP A;  4BE0 A;  3HRU A;  1X3U A;  3OIQ A;  2DO7 A;  3TO9 A;  2BOL A;  1HC8 A;  2EA2 A;  2Y0S N;  3LSG A;  4UB8 C;  4GXO A;  2M87 A;  3VSL A;  2DDB A;  1NHA A;  3QAH A;  5IP7 J;  2OA4 A;  2RNJ A;  1W4M A;  2QVO A;  1MMN A;  2CG4 A;  2Z5U A;  2CW0 F;  2WC2 A;  4HNU A;  3M1C A;  1FMV A;  5F64 A;  5LD2 C;  1ZGJ A;  1BOB A;  4XK4 A;  2FJ1 A;  3HOX J;  2CMP A;  4IPA A;  4CCL A;  3ZQG A;  4C2M J;  4BL0 B;  3IAS 2;  2G7S A;  4OD4 A;  1J0R A;  2F5C A;  2A6E F;  4YII A;  3VFZ A;  4B44 A;  1QZE A;  3BNI A;  2WAQ N;  3BR0 A;  4A12 A;  3F1B A;  2RKH A;  3RKW A;  3BTC A;  1V5G A;  2XKP A;  2E60 A;  2CQX A;  1CF7 B;  2CQQ A;  2HS5 A;  3LAJ A;  2DQR A;  1W36 C;  2ZSI B;  4XN0 A;  2KFD A;  2ISZ A;  5M5X J;  1YJN I;  2ZJ2 A;  2ZXI A;  2KT0 A;  3PUB A;  4L0Z B;  3S1N J;  1H9G A;  3ASN H;  1LJ9 A;  4BXU A;  3H1C A;  4UUV A;  3ZRG A;  3QPT A;  4RGR A;  1IW7 F;  2R3S A;  4DBR A;  3MCZ A;  3QPL A;  1YTY A;  3QP5 A;  2M3A A;  3CJT B;  2DA3 A;  3CUQ B;  4Z6Y A;  4HG2 A;  2XRO A;  3K70 C;  3GZ5 A;  1FTZ A;  3DF8 A;  3HE0 A;  2CUE A;  2D1H A;  2FUG 2;  1HCR A;  1V3F A;  4OIN F;  1XDS A;  3OY9 A;  5EFY A;  1JKR C;  3DKY A;  1RUN A;  4MGR A;  1W7P A;  3CJQ B;  1O3Q A;  2H09 A;  2EFO A;  4A3J J;  2V4J C;  3IV5 A;  4KIF A;  1ITY A;  4MQ9 F;  1OCT C;  3PPB A;  5D19 A;  1BBY A;  2OF7 A;  3K6G A;  4IO9 F;  1K61 A;  2A05 A;  1FBS A;  1MBJ A;  5J8F A;  1RNL A;  3W6K B;  1MNE A;  3WGH A;  5A2Q K;  2QA4 I;  2R4G A;  1MMA A;  2FBH A;  2HDW A;  1WJA A;  4PJJ A;  1FYK A;  4QPO A;  3BG7 A;  3PFI A;  3HGY A;  1ZLK A;  3BJB A;  3I53 A;  5D6F A;  4NDL A;  3O8G A;  4WF2 A;  1MND A;  2VQH A;  4G8X A;  1DQU A;  2HQN A;  3GTL J;  2QEX I;  1ZK8 A;  2L4A A;  1V55 H;  1Z67 A;  5FLV A;  5EF6 A;  3FK7 A;  3OYK A;  3GXO A;  1GVD A;  3VOD A;  4BQN A;  3H9Q A;  3I55 I;  4C2T A;  1C0W A;  2CW7 A;  3AFH A;  3VB2 A;  1TLH B;  3PSI A;  3A0B C;  5GPA A;  1SVL A;  1JKP C;  1VQ6 I;  2RDP A;  2JZY A;  2O3F A;  1ZYR F;  3HSE A;  2GAU A;  2V79 A;  5ICG A;  3TDU C;  2NVX J;  3NS4 A;  3M7G A;  1MBE A;  1H9T A;  2OCE A;  4GYG A;  2PX9 A;  2EFP A;  4A69 C;  1SAX A;  2YS9 A;  2R7T A;  5TGT A;  2F48 A;  1TBX A;  4WX9 A;  2DPD A;  1LVA A;  3KCC A;  3WGG A;  3JRF A;  3JCU C;  3LAP A;  1APL C;  2Z9O A;  1UI5 A;  1ZGW A;  1W1W E;  4QIW N;  3AQT A;  2RV8 A;  2CV1 A;  1VQK I;  1WSU A;  4RLQ A;  3ZOB A;  2KRH A;  4EGZ A; 
#chains in the Genus database with same CATH homology
 2VPR A;  1PUF B;  1P7I A;  2LVS A;  3F0C A;  2WUI A;  2GUH A;  1ZR2 A;  2CU7 A;  3VVX A;  3OSF A;  1JUS A;  2JWT A;  1TWH J;  1MSF C;  2QCO A;  3GEU A;  2R5Y A;  1LE8 A;  1B72 A;  4IHX A;  5EDN A;  1O4X A;  3GTO J;  5AQC A;  3K7A J;  1IG7 A;  1WH5 A;  3EGQ A;  3G1L A;  1E3O C;  1Z0X A;  2CJJ A;  2PZ9 A;  3KZ9 A;  1P7J A;  1UMQ A;  3GTP J;  5IOZ A;  2R5Z B;  4BBR J;  1BW6 A;  2MSY A;  3NXC A;  4B4C A;  4D7N A;  4ICH A;  1WPK A;  2HXI A;  1FIP A;  1TWF J;  3HKZ N;  2ZCM A;  5DS9 A;  2O7T A;  5CXI A;  1UI6 A;  3B6C A;  3W6V A;  3Q0V A;  2HI3 A;  3ZQH A;  4BY7 J;  3B6A A;  3ON2 A;  4CGR A;  4CYC A;  1ETY A;  1U78 A;  2VUM J;  3MVP A;  4LOC A;  2W53 A;  1NK3 P;  3OSG A;  1ENH A;  5J1R A;  4ME9 A;  1T33 A;  2NP3 A;  5E3L A;  2D6Y A;  2Q24 A;  5JLW A;  4M3G A;  2RAE A;  3RZD J;  1FEX A;  1I3Q J;  4AYB N;  2LK2 A;  3V78 A;  2CUF A;  3S1Q J;  2HOS A;  4JKZ A;  1XG1 A;  3JRG A;  5EGO B;  2LY9 A;  3NI7 A;  5M5W J;  4A3D J;  1YRN B;  2REK A;  1OJL A;  5F1J A;  1AKH A;  2XRL A;  1LFU P;  3GTG J;  2QIB A;  4M3D A;  3G1O A;  3NPI A;  3JRA A;  3NNR A;  3JRH A;  4UUT A;  2HQ5 A;  3VUQ A;  1K83 J;  2Y9Z A;  5IP9 J;  5C44 J;  1JGG A;  2VKV A;  4AC6 A;  4QTR A;  1GDT A;  2EH3 A;  5BNG A;  2DMP A;  1OFC X;  4JYK A;  1ETW A;  2MG4 A;  2CRG A;  4FE4 A;  2FD5 A;  5D18 A;  5IP6 A;  4BY1 J;  3VPR A;  2V57 A;  1ZKG A;  4V2F A;  3JRD A;  4HKU A;  2DA4 A;  5C3E J;  3I4N J;  1DU0 A;  4IHV A;  2E1O A;  2EQR A;  5FJ8 J;  3LSP A;  1SAN A;  3JRB A;  1RPW A;  4QSH A;  3VW0 A;  5EZH A;  2UXH A;  3NAU A;  3DPJ A;  2NS7 A;  3S5R A;  3O60 A;  4NN1 A;  2XPV A;  1IRZ A;  4XRM A;  3BTL A;  9ANT A;  3HTJ A;  2H1K A;  4C3H J;  4Y52 J;  1HDP A;  3BCG A;  2EZH A;  3HBL A;  3EUP A;  2X6O A;  5J3L A;  2QOP A;  3IH4 A;  1IUF A;  3IH3 A;  2DG7 A;  2EZI A;  1WCM J;  4GCK A;  2I10 A;  5K7Z A;  2WGB A;  2GFN A;  4A3L J;  5CW8 A;  5E3O A;  4DZJ A;  3PO3 J;  5J1U A;  3CWR A;  3FK6 A;  1MNM C;  1GT0 C;  3TED A;  3BRU A;  3DEW A;  4GFL A;  2M0C A;  2WB1 N;  3CQZ J;  3H0G J;  1HF0 A;  5HAW A;  3TW6 A;  3QPS A;  4C3I J;  2XSD C;  2ZOZ A;  1MBF A;  3HOZ J;  2XB5 A;  2Y2Z A;  1ZTR A;  2P81 A;  4X1E A;  5IYD J;  2XPW A;  4A93 J;  2DN0 A;  2DA1 A;  2ME6 A;  3HOY J;  3VW2 A;  2DJN A;  1F43 A;  3MKL A;  2D5V A;  3L1P A;  3BHQ A;  2LR8 A;  3H3V K;  2JMW A;  3Q3S A;  5F0H A;  3BTI A;  3RKQ A;  3BG5 A;  5EG0 B;  4D7M A;  3VOX A;  2K9N A;  2E2H J;  5C4J J;  4D5F A;  2NVQ J;  2ECB A;  1RR7 A;  3GTJ J;  1R9T J;  2LKX A;  4DW6 A;  1G2H A;  3AQS A;  1ZR4 A;  2ID6 A;  4A3M J;  3NRG A;  1WH7 A;  2HXO A;  3HTI A;  1B8I A;  2YU9 J;  1ETV A;  4A3G J;  2NVT J;  3BG3 A;  5FKN A;  1Q1V A;  1QVT A;  4V2G A;  2F07 A;  2GM4 A;  2IAI A;  4EEF G;  2COB A;  1IC8 A;  1BL0 A;  2QF7 A;  2UXU A;  5E3N A;  2FBQ A;  3HTA A;  2UXO A;  4FE7 A;  2JA7 J;  1JJ6 C;  3ZQI A;  1IDZ A;  3CDL A;  2DMU A;  4YZE A;  4I6Z A;  4GFB A;  2NX4 A;  2QWT A;  1RES A;  3M3Y J;  3NAR A;  3SFI A;  2W48 A;  5DTD A;  4S0H B;  1X58 A;  1MSE C;  3UKG A;  1Z77 A;  5E3M A;  3VP5 A;  1IJW C;  2UXI A;  2R92 J;  2ID3 A;  2ZCX A;  1JT6 A;  3WHC A;  3BR2 A;  4GCT A;  4DYR A;  4RDU A;  3A01 B;  2AO9 A;  4XIC A;  3LHQ A;  4MO7 A;  1GV5 A;  2DA2 A;  4M6V A;  2TRT A;  1JUM A;  3HDD A;  5HBU A;  2ELK A;  4HNV A;  1T56 A;  4GFK A;  1RKT A;  2YVE A;  3VVZ A;  2IBD A;  1BJZ A;  1RET A;  2HDD A;  4FIS A;  1RKW A;  5FLM J;  5FHP A;  4I76 A;  1Y1W J;  1WI3 A;  2HKU A;  3BR1 A;  4M3E A;  3JR9 A;  1MH3 A;  2RHA A;  5K58 A;  2NS8 A;  2Y9Y A;  3LWJ A;  1OCP A;  3M4O J;  5HSZ A;  4UUS A;  3HOU J;  2GEN A;  4AF5 A;  3BTJ A;  3SJM A;  3C2B A;  3WHB A;  1TWG J;  3LNQ A;  1JKQ C;  3HOV J;  5GPC A;  4MK6 A;  4IHY A;  3HEF A;  5J1Y A;  4L5E A;  2N8G A;  5JLX A;  5IYC J;  1NK2 P;  5CXG A;  3S2H J;  1SFO J;  2M34 A;  1ORK A;  5F08 A;  3ZQF A;  2JK3 A;  3CJD A;  1VND A;  1JUP A;  4ABZ A;  3GZI A;  3TP0 A;  1QPI A;  3TP3 A;  4AUX A;  2R5Y B;  1LE8 B;  1B72 B;  3RQI A;  4MFD A;  1ETO A;  4A3I J;  4KWA A;  2ME0 A;  3E7Q A;  2HYT A;  3OOU A;  5IOY A;  1BW5 A;  2O9L A;  1GV2 A;  2R93 J;  5F27 A;  2E2I J;  1PUF A;  1LFB A;  2VI6 A;  5F04 A;  3COL A;  3RH2 A;  4J19 A;  3S15 J;  1UG2 A;  3BT9 A;  2MGQ A;  3IUV A;  3HIM A;  5GP9 A;  5EEA A;  2UXP A;  4D5C A;  2G0E A;  3G1M A;  4G12 A;  2Y31 A;  4DYQ A;  2PBX A;  3OIO A;  3HM5 A;  4A3E J;  4JX4 A;  3HOW J;  4JX5 A;  1MBK A;  1A6I A;  1JTY A;  1Y1V J;  3KNW A;  2L7M P;  1MBH A;  5F0C A;  2DA5 A;  4X6A J;  2LFB A;  3BR6 A;  4MIM A;  4BKX A;  3VVY A;  1U9N A;  3JRC A;  2EZK A;  3VOK A;  3JRI A;  4CYC B;  2JJ7 A;  2L9R A;  2O7O A;  2DMT A;  3VIB A;  2NP5 A;  4JNN A;  3IH2 A;  4ACI A;  1JJ8 C;  1I50 J;  1TC3 C;  1AHD P;  2AHQ A;  3PM1 A;  3Q0W A;  2R5Z A;  3JRE A;  2RAS A;  1JTX A;  1ETX A;  5FKL A;  2K9S A;  5M3F J;  4JP0 A;  3G7R A;  3QQA A;  3VW1 A;  2L0K A;  2TCT A;  3BG9 A;  2XGE A;  3CCY A;  1CQT A;  1IGN A;  3FKI J;  3KKD A;  2XGD A;  3HGG A;  4UUS B;  2MW8 A;  1AKH B;  1HLV A;  3BQZ A;  3QKX A;  1IDY A;  3S14 J;  1ZQ3 P;  2OPT A;  3S17 J;  3SDG A;  1U9O A;  2DTZ A;  3BR5 A;  2GLO A;  3K2A A;  4AC0 A;  4XRS G;  4B3A A;  1W0T A;  1JT0 A;  2EZL A;  2NOG A;  1FIA A;  1H8A C;  1S7E A;  5C4Y A;  2HYJ A;  3S1R J;  4A3K J;  2B63 J;  3ZQL A;  2LTP A;  2M8G X;  1DU6 A;  1TWC J;  2XGC A;  1NTC A;  5M5Y J;  2LD5 A;  2QKO A;  4C3J J;  5EGO A;  3LJL A;  3PAS A;  1EF4 A;  2Y0S N;  3LSG A;  4B1R A;  5FKO A;  1YRN A;  3TW7 A;  3A02 A;  4RBO A;  3ON4 A;  1SGM A;  5C4X J;  5IP7 J;  2L7Z A;  3Q0U A;  2LP0 A;  4XID A;  2DMN A;  4M3F A;  1JKO C;  3C07 A;  2Y30 A;  1ETQ A;  4XK4 A;  1VFC A;  1XC5 A;  2FJ1 A;  3HOX J;  3ANP A;  3ZQG A;  4C2M J;  1FJL A;  4L62 A;  1X2N A;  2FX0 A;  2G7S A;  2IEK A;  4IHW A;  3FRQ A;  2R7Z J;  2JN6 A;  2JA8 J;  5K7H A;  3ZQC A;  5FGL A;  2DA6 A;  1MBG A;  2HOA A;  3BNI A;  4JX6 A;  2WAQ N;  3BR0 A;  3F1B A;  1W0U A;  3BTC A;  1HDD C;  2CQX A;  5H9T A;  2CQQ A;  3MN2 A;  1AU7 A;  2JA5 J;  3LSJ A;  2ECC A;  4DZP A;  4PXI A;  2XB0 X;  4Y7N J;  2LLK A;  2YVH A;  2JA6 J;  2OER A;  5M5X J;  5IPA A;  2KT0 A;  3JSJ A;  1POG A;  3S1N J;  5EYR A;  2X9D A;  2K9Q A;  3LOC A;  2G7L A;  4W97 A;  2ZB9 A;  3MNL A;  4BBS J;  2L7F P;  2DA7 A;  5FMP A;  3QPL A;  1WGX A;  3RZO J;  3G56 A;  2XPU A;  3BQY A;  3CMY A;  2DA3 A;  2DMQ A;  1IV6 A;  1QVU A;  1BA5 A;  4UDS A;  1FTZ A;  3RD3 A;  2M2E A;  5M3M J;  3P9T A;  3HE0 A;  2CUE A;  4NEL A;  1A5J A;  2GBY A;  1ETK A;  1B8I B;  1HCR A;  3GTQ J;  3S2D J;  3BR3 A;  1X2M A;  2E19 A;  2HOT A;  3FIW A;  1JKR C;  5EFY A;  1HOM A;  1GUU A;  4MFE A;  1FTT A;  3E7L A;  1I6H J;  3HTH A;  2NVY J;  4A3J J;  5EG0 A;  2R0Q C;  3IV5 A;  1ITY A;  3S16 J;  4GCL A;  3HB9 A;  1OCT C;  3PPB A;  5D19 A;  4FTH A;  2OF7 A;  1K61 A;  1TWA J;  1MBJ A;  1H89 C;  3GBG A;  3S1M J;  2ZOY A;  2X48 A;  5DAJ A;  2G3B A;  1VF9 A;  3BJB A;  3HGY A;  2PMZ N;  4NDL A;  1D5Y A;  3O8G A;  3T6N A;  4MXM A;  2EBI A;  1MH4 A;  3GTL J;  3V6G A;  3D1N I;  1ZK8 A;  4M3B A;  2YUS A;  1VI0 A;  3A03 A;  1QRY A;  5EF6 A;  4A3F J;  4W1U A;  5FLV A;  3GTK J;  3FK7 A;  2FQ4 A;  3KKC A;  5IYB J;  1GVD A;  2VKE A;  3I4M J;  2O8K A;  3PO2 J;  3ANG A;  5F0F A;  1XS9 A;  3QBM A;  2H8R A;  2M9H A;  3GTM J;  2IU5 A;  2WV1 A;  3B81 A;  4A3B J;  2K40 A;  5GPA A;  2DG8 A;  3LSR A;  5D1R A;  2XDN A;  2QTQ A;  1JKP C;  3DCF A;  4A3C J;  3FIS A;  1U8B A;  2KDZ A;  4DYC A;  4IEJ A;  2NVX J;  3A01 A;  5FKM A;  1MBE A;  2OI8 A;  1F36 A;  1H88 C;  2G7G A;  4A69 C;  2YS9 A;  5K7F A;  1UHS A;  2ZCN A;  5HOD A;  5FKK A;  3JRF A;  4FCY A;  1APL C;  1UI5 A;  4XRS A;  1ZGW A;  4QIW N;  4BXX J;  2E2J J;  3AQT A;  3CRJ A;  4JL3 A;  5EZG A;  3O8H A;  4MLO A;  3ZOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...