3DFEA

Crystal structure of a putative pii-like signaling protein (yp_323533.1) from anabaena variabilis atcc 29413 at 2.35 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
82
Chain Sequence
SKRANKLVIVTEKVLLKKVAKIIEEAGATGYTVVDTGGSNVKFEVLTENREMAEKIADQVAIKFFTDYAGIIYICEAEVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative Pii-Like Signaling Protein (YP_323533.1) from ANABAENA VARIABILIS ATCC 29413 at 2.35 A resolution
rcsb
molecule keywords Putative Pii-Like Signaling Protein
molecule tags Signaling protein
source organism Anabaena variabilis atcc 29413
total genus 18
structure length 82
sequence length 100
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dfeA00
4AFFA 1HWUA 1NAQA 1O51A 1V3SA 2EG2A 4R25A 3L7PA 1GNKA 2GNKA 2CZ4A 4CO5A 3AA9A 3BZQA 2GX8A 1V9OA 4CO2A 3LF0A 3NCRA 3AH6A 4NYOA 4OZLA 3O8WA 2ZOMA 1V3RA 3MHYA 1UMJA 4E98A 2J9DE 2E66A 3TA2A 1UL3A 2XZWA 5D4NA 4RLEA 5DRKA 5D4PA 2XULA 2VD3A 1QY7A 2J9CA 1VHFA 4YB7A 4Y6IA 1PILA 4CO0A 1NH8A 1P1LA 2RD5C 3TA0A 3AHPA 4CO1A 4OZJA 2GW8A 4YB6A 5D4LA 1UKUA 2Z0GA 4USIA 2J9DA 4CO4A 1J2VA 1NH7A 1NZAA 5DS7A 4RWWA 2JJ4D 4WK3A 4C3MA 2J9EA 2O66A 4NYPA 4YB5A 4C3KA 4OZNA 4USHA 4CO3A 2XG8A 3NCQA 4IYQA 3DFEA 3X3UA 4CNYA 4D3GA 2O67A 1UFLA 3TA1A 2ZFHA 1XK8A 1H3DA 3NCPA 4ZK7M 1Q1KA 3GSDA 1V6HA 2DCLA 2EG1A 5D4OA 2NUHA 3T9ZA 4USJC 3AA8A 1O5JA 3N5BA 2XBPA 4RWXA 4RX6A 3HLUA 4CNZA 4D3HA 3M05A 2V5HG 3OPKA 1VFJA 2NUUG 2PIIA 3O5TB 4C3LA 4WK1A 3CE8A 1KR4A 2NS1B 4Y65A 5L9NA 1OSCA
chains in the Genus database with same CATH superfamily
3H2LA 2F1FA 4EMDA 1EKRA 1NPPA 4BS2A 2W9BA 3THPA 2IRYA 4A8YA 3M1VB 2XQCA 3QJLA 1FRMA 1V9OA 1ZZNA 3NCRA 4ZMMA 1YTYA 4K4TA 2H5JB 2CQ4A 3ULHA 1REVB 1IBCB 5G0RA 1YITS 4J9NA 3PJXA 4OYWA 3L7UA 3H90A 4TYBA 1WKLA 3SDEB 4X62F 1QE1A 5HBMB 4I0WA 1PSDA 2M70A 3EPIA 3DRRA 4ZPCA 2UVRA 3LA0A 3A8JA 2W9CA 1FD2A 2QIFA 2CIMA 2H5EA 4I6AA 2R7RA 2IJFA 4AL6A 2PEHA 4KB7A 2GVDA 2GQCA 2HFUA 3RBEA 1U4BA 1NJYA 3BH6B 5LSRA 4CYUB 3IMQJ 2L9WA 3A8IA 1WOOA 3JSRA 3BQ1A 2JEJA 4Q8EA 4KGMA 2B8QA 2RHQB 3HVAA 3EVOA 4DSEA 1ITPA 1WF2A 2RJZA 3QRPA 3SXLA 3ZNUA 1I1GA 1Q16B 1RBOB 1RAAB 2NXNA 3MPVA 4MIWA 4Q7AA 5K14B 1U6BA 2IMWP 1VC0A 1E6YB 4NLYA 1Z1ZA 4FKXA 1C2PA 3MECA 4X66J 1CQNA 2ZHBA 4OZ5A 4CI0B 3KMQA 2MLXA 2F8HA 5DZ6A 3MEDA 1DTQB 3OV7A 2MZTA 1X4BA 3IRWP 2FJEB 4LR7A 3DC2A 4DV2F 4ZVPB 4CLKA 4KHMA 3QIPB 2PFDA 1EZZB 5JMNA 1VCTA 4NPOA 5KFRA 4OI0A 3FBBA 3DLGB 1SXLA 2OFGX 4NLSA 4DF4A 3EM1A 1K0VA 2DCUB 3D4JA 5DQGA 3OR2A 4AE5A 2QJ3A 1H3DA 3ADAC 1AA1B 4IH7A 1NK0A 4OYAA 1FCAA 4LJMA 1NJWA 1PC4A 2E5LF 2O01C 2AJ2A 5EDWA 3JAMU 4TY9A 3K89A 3M05A 3EGVA 4B3SJ 3GTYX 3BGLA 1QTMA 2KT5A 4RNMA 4LF8F 2W7OA 2B9EA 5IV4A 4A8WA 3SCKE 1VYAA 3AOCA 4NCGA 4UTGA 1G6BA 5FDLB 4RW6B 1HNXJ 5F9NA 5KG2A 4X4PA 2RDJA 2DYAA 2HKEA 4ZCMA 4RUBA 4RZRA 1TL1B 4RLEA 5DRKA 1HQEB 2P6SA 3N5FA 2QLJB 2ROEA 3IC1A 4RUHA 3ZTRA 2ZJPQ 4J7CA 3KK1A 3BGUA 4WP9A 3D6HB 2FZKB 3KLHA 2B5JB 1U25A 2DGVA 2MQPA 1XERA 3KTQA 3R7BB 3GYNA 2DHXA 3IS9A 5KG1A 2UVWA 4JI7F 3CCZA 3I56S 4QBUA 3Q24A 1F5CA 5C7PA 3FEYB 1RT1A 2RU9A 2DT9A 4RW8A 3VGUA 4HVZA 4I6WA 5LXYA 2AD9A 2RQCA 3TJ9A 4KT0C 2OJ3A 4OI2A 1U8WA 3FK4A 4NLDA 1RT3A 3HVWA 2BQRA 4LF9F 1JNRB 5L46A 1TTHB 3O5TB 5KFNA 5IQQA 2AYGA 1VISA 3N6NA 5M2RA 4BCAA 2LMIA 2CAJA 1Q8LA 2K1RA 3MM8B 4RO0A 2EKYA 4K0KF 2E9ZA 2HRTA 2IAJA 2E7XA 4K4UA 2BE2B 4DV4F 2CVIA 3CD6S 1OY8A 1RXOB 4PG4A 1SKUB 2MY8A 4I7FA 1DAXA 2E5IA 3ISNC 3RRHA 2BXJA 4YMEA 2XLJA 3CB4A 5H9FJ 3CJ2A 2CNLB 3DOLA 1NH8A 2BUNA 2AMCB 3G8SA 2XM3A 3DYAA 4RW7B 4WYWA 1M90T 2KT3A 5CYQB 5D15A 3O44A 2HHHF 2J9EA 1PC5A 1PG5B 4YB5A 4X4RA 1QAYA 3GIRA 1RTZA 4JI4J 3KK2A 1TL3A 5KT3A 3K59A 4L76A 3MMAB 3NGDA 2KO1A 2NPIA 2PO4A 2DNMA 3HXMA 5LSLA 4GKKF 3PFEA 3TVYA 1RTHA 4MMOA 4LF5F 3HLUA 5F8JA 2FPHX 3D54A 4YHHF 2YKQA 4OYOA 3T1YF 1VBKA 2VKRA 1UP1A 1JIHA 1PKUA 3FCVA 1I94J 1YJWS 2GFFA 3MEKA 3ILOA 4DSLA 3DN9A 5K8OA 4ZP6A 1HIYA 5HVHA 2QMXA 3JQJA 2XEXA 1YWXA 4XDDA 1BHNA 1S48A 2XZWA 2XYGB 4J9SA 1KTQA 3AJDA 3OFHA 2CJ9A 6FDRA 2QFJA 3LP2A 2W8KA 3OQ2A 4Z7CA 5HJXA 3H42A 2APOA 2LECA 3G9CA 5L1LA 4QWCA 1NK7A 2QEXS 2VC0A 4M5LA 3G8TA 4EBDA 4PYAA 3C6TB 3GV5B 2ASDA 3PYFA 3PO4A 4KH0B 2GJFA 4PXDA 1L5UA 3W2VB 2CNKB 1PJ5A 2C2EA 1T7PA 2E1MC 3Q8SB 1TK5A 3A8KA 4ES1A 1NKEA 4ZVHA 2XHWA 1WWHA 2XMUA 2C3PA 2IIHA 4ZN3A 3UNYA 4IFYA 4CLSA 2XLKA 4F2RA 2CPYA 2D1CA 4A4JA 1R6YA 2PD1A 3D5MA 3VVUA 4ZCKA 4I2QA 1L3UA 4ERDA 1HBMB 3IR5B 5CD4H 4N47A 4C8KA 5HLFB 5I3QA 1HQUB 4RNOA 1EHWA 4YP3A 2Q6BA 1VQ6S 4LBIA 3C6UB 3QZ7A 1VBZA 1DLOA 4Q0BA 2E9TA 1XMQF 4Y00A 1QTNB 1K73T 2R9LA 1RTIB 1R89A 4JI1F 4DI6A 1PJ7A 4UOFA 1CSJA 1LOUA 4WCEQ 3KKFA 3I0RA 3CO0P 3DM2B 3JTPA 4DL7A 1YHQS 4YB6A 1T8EA 1RWWB 3VWSA 3OFGA 3V81A 5K8NA 2Y3YA 3G6VA 1IWGA 5AXLA 1YGYA 1FKOB 2ACYA 2Y0SD 1S72S 3MOJB 3CO9A 2QX0A 3BGRB 2W2NP 4DR2F 4KO0B 1NLKL 1XN9A 3UVJA 4RW4A 3A1YG 4F8RA 4LBPA 2HVEA 4FS1A 1FA0A 2HFNA 4F36A 5B0BA 2HRUA 3EUNA 4U96A 3QGGA 1X5SA 3C14A 1N34F 4KV8A 3CCLS 2DNOA 2LXIA 4E8UA 2DEJA 1QVGR 3HVTA 1FO1A 1PBUA 1N33F 3K5MA 2AT1B 3BR8A 1C4CA 4B9TA 4R8UA 5HL7Q 1F9HA 1VQOS 4JYAJ 4AXIA 4ZJLA 1KONA 4NLOA 4DU8A 1PYOB 2YNFA 2MJUA 1RACB 2W25A 5K5MA 2J7WA 4B3RF 1XR7A 5L38A 3QRQA 2VKZG 1SI9A 3HX9A 2HNYA 2O1PA 4CCHA 3JSMB 1RADB 2G9OA 5KFHA 2HHUA 1IQZA 2K8GA 2IA6A 3PRVA 1T94A 2CPFA 2QGFB 5CD4A 2N7CA 3TJAA 1QAIA 3K17A 2IM1A 2WRMA 1RT7B 4WU2A 1RAEB 4QU6A 1LQ9A 3AXMA 3QO9A 2MSTA 1SC6A 3EE3A 1HMVB 1N56A 2JNJA 1S97A 3DLBA 4LF7J 4DR5J 4LR9A 1N0VC 2KRBA 4JI8F 3HULA 1ZM9A 3QAUA 3JYTB 4QWDA 3T5LA 2DITA 3SSRA 1VFJA 2HRYA 4WK1A 3LQVA 1Q8IA 5FLXY 4FBTA 2QN6B 1L3KA 3LP0A 1JJCB 4FYWB 3LPEA 2SXLA 3NS7B 3O8WA 2CUYA 4KAIA 3IR6B 1VQMS 1DTTA 3ZZTA 1SJ3P 4LBHA 4P75A 1UVMA 2VICA 3WHIA 3UDLA 4ILRA 3NL0A 3ZTPA 1R27B 1BQNB 1RK8A 2OIHA 1WKKA 2OD6A 3NS6A 2PMHA 3TYTA 5ETVA 2JWNA 2GMJA 2WB4A 3DOKA 2MLZA 3R2CJ 2RHSB 1TAUA 2CA9A 2VU5A 1T9UA 3QNWB 2KYZA 1FX4A 2JFDA 2PGCA 3OL7A 4QQBA 3K2YA 4PPDA 5J1EA 1U0HA 4ZLPA 1QLNA 2A6OA 1VMBA 2F8EX 2G2ZA 4NA2A 2UU9F 4FNIA 3KYLA 3ZZYA 1LW0A 3CCTA 4RUAA 3ISZA 4CIOA 3P8BB 3GP9A 3M8PA 2LQ8A 2N7YA 2MZ1A 1AROP 3ISND 1RTJA 2H9ZA 1DURA 2R8HA 1MMLA 5LL6d 3DLLQ 4EZ9A 1X9MA 4NLVA 2PA3A 1V5VA 3M8RA 2MQNA 5DLFA 2DR5A 4IG0B 3UWTA 2ZH1A 3M6WA 1NZAA 2BJ7A 4JI3J 4KSEB 1Q53A 3G6YA 4WBFA 3I0SA 3NGTA 2LEBA 2DR9A 5CABA 3W62A 3DDKA 3TW0A 4O44B 4TN2A 3MZIA 1HWKA 2KM8B 1FRXA 4GC7A 1DZ5A 2IHR1 3M8QB 4JV5F 3RG6A 1T11A 3M6VA 3UCUP 2YQ3A 1B0PA 1JLAA 2VC1A 5AT1B 2LLZA 2EC2A 5I3UA 1BY9A 4TQRA 5B0AA 1CJKB 1SL2A 1S1XA 4RBVA 2GVZA 2VONA 4ES3A 1HYSB 2VPYB 3ITHA 1EETA 2IJRA 2H3EB 4FDFA 4DR7F 2AW0A 3A3PB 3H8YA 4KYZA 2ZEJA 5IS2A 2OPQA 1N8RT 2RT3A 2ZH5A 3N4WA 2XNQA 2V2ZA 5HROB 3MCNA 1IBMJ 4WKYA 3J81Y 2YX1A 2MQOA 4U9RA 3THVA 1UFKA 2DIUA 1RAHB 3C66A 2EK1A 2ZBIA 4CRJA 3H59A 5J2NA 3M2VB 1HNZF 4QU7A 1OQ3A 3KHRA 4KHRA 2IY5B 5HI7A 2NLWA 1CQMA 2DO0A 1JLCA 5IC6B 3F44A 4OLPA 3LAKA 4RW9A 4ED7A 4M5KA 2ZH9A 5KFQA 3UI3A 4X65J 2NUUG 2C2DA 1KS2A 4UY8T 2DXFA 3D1OA 2B6AA 3DLEB 5D8HB 4Q8FA 2IYGA 3BSOA 2FC8A 1SJ1A 3T3FA 4F4AA 2F8MA 4PZVA 1HR0J 2LQJA 4C98A 5HMZA 3BS9A 2XMMA 4LRBA 4LF6J 2I38A 2OI2A 4IH5A 1PIEA 4P2MA 3BQ0A 1AUDA 2POKA 4KGZB 4OFZA 4BC7A 1EKSA 3MD3A 3TO8A 4N7TA 3W3SA 2QL9B 2XG8A 2V6AA 2CDRB 1SV5A 2GGPA 5KFFA 5HMYA 3W8PA 3VAIA 4OYZA 1JKHB 4V19J 2CQIA 3Q8QB 2AZ3A 3W64A 4ITSA 5CYMA 2R2UA 1HNIA 1LWCB 3OSPA 4DV3F 1V3SA 3E51A 2CJYB 3W2WB 2RU3A 4QYZK 2FHMA 1JLBA 5BXIA 3ZNJ1 3IP0A 1JB0C 1S0NA 3LF0A 3BF4A 4GRSA 3W60A 4CTAB 4YY3J 1GMWA 4ED1A 2AJ1A 1X5PA 1B7YB 2I5JB 2B9WA 2H48B 3PDNA 3W9HA 3JQMA 1P8GA 4LT6A 4ZVEA 5KFIA 4F02A 1H73A 4DFMA 1Y10A 3PV8A 3SSQA 1MNEA 2C2NA 1O6XA 3T5HA 5T41A 3ENVA 3TWZA 1VRTB 3S8SA 4TU9A 3Q8RB 3ZC4A 3WIVA 1UCNA 4ANDA 2V2QA 2HNDB 1ZM4A 4RKUC 1AFJA 3CC4S 2EK6A 4TY8A 1O5JA 3WZ0A 3DXSX 3ET6A 4QIGA 3MXHP 2L9DA 1H72C 5AJ3J 4IG3A 2D9PA 1TP7A 2PFFB 4LSLA 5F8GA 3NNCA 4HH1A 1Q4RA 1VI7A 1TKXB 4DR3F 5M2UA 4QIVA 3IBWA 1WSVA 3M6XA 4ZIVA 1NZ8A 2FY1A 3AD8C 1HHSA 5D4PA 4OZ1A 4F4WA 1BGXT 3E8OA 2Y1RI 3BN7A 4QYZJ 1M5KC 1VQKS 5IC4B 3CIMA 4NE9C 5B7WA 4C8OA 1JNZB 3EXYA 3OTOJ 3J80U 4TLRA 3UNGC 1ZH5A 4OYPA 3MR6A 4LREA 3BM7A 2W01A 3BDEA 2N3OA 2XS2A 4CLZA 1F3FA 4GVBA 4OV1A 3R1HA 2F40A 2NUHA 3MEEA 2ZH3A 4MT1A 4ZCIA 3IRXB 2J0WA 1R8CA 3H40A 3TAQA 1J5OA 3DNCA 2DY1A 1KBRA 3TR5A 4YS2A 3G71S 1M1KT 1N0UA 7FDRA 2XY6A 1S9GA 2CG8A 3BBFA 3MF5A 4PEOA 2PEBA 3PW7A 2NYIA 3PEHA 1OYDA 5AE1A 4ED8A 2IJNA 4HT5A 4FXDA 1KN6A 4DQPA 4WP3A 2AP6A 3HP6A 5CQGA 3TA2A 3RAQA 2J6SA 2OLWA 1YRUA 1SPBP 4PABA 3GILA 3MI7X 4CT8A 3OL6A 2NQPA 2RIJA 3I9V9 4Y28C 1FE4A 3NS5A 3UR0A 1S5ZA 5J1NA 4OZJA 3EDQB 5CAAA 5C25B 3MR2A 3M2UB 1CC8A 4IH6A 3EGNA 3H25A 1N6QB 3OVBA 2IM0A 4M5JA 4QZVB 3KHHA 4IDKB 2G2YA 5J2QB 1JK9B 3EVMA 4E0DA 3N01A 4A8SA 2RE1A 3IBCB 3GSDA 3ETOA 3QPIA 5H9EJ 3OUYA 2BV3A 2MQQA 1VLYA 2VFTA 2ADCA 4WZMA 3KDOA 1RKJA 2GQQA 2NXCA 2OTLS 4C3LA 1FK9B 3R5DA 2F9DA 1LWFB 5BR8F 1SBRA 2DR8A 2CPIA 3AD7C 4DL5A 3UN2A 3J7YI 2YKNB 1TU0B 1BQXA 4F3OA 3EYZA 2YNIB 4P7VA 1EP4A 4W92B 1KVJA 4IOBA 1XEZA 2VJUA 5CXTA 4DU7A 5GADI 4OZ3A 4MK9A 3IFEA 5HVGA 1E6VA 2OHDA 5E3CA 4NLGA 1CULA 4P6QA 4H4OB 3M32A 2LEAA 5AE3A 1Y5NB 2Z57B 1Z4UA 2W4PA 3ZZOA 4DV6J 4AL7A 4HDGA 4NI2B 1RWUA 2M4MA 4LFCJ 4J9PA 2RSQA 2BM1A 3QGIA 4CNYA 2FVQA 1VC6A 1NRKA 3TEHB 2DXDA 1N5VA 5B0FA 5IV3A 2R7TA 3GJQB 4PYDA 2XHCA 2KT2A 1RWKB 2HLUA 1P6TA 3OXGA 4Y34A 1R8BA 2WOMB 3FSIA 4HACB 4NZ6A 2DGTA 3GFYA 3TQEA 2V9KA 2C1EB 4ANEA 3KJVA 4QPXA 2LQ9A 3DOMB 3R8YA 4C97A 1BC6A 4ZVRB 1TELA 2JVRA 5EWGA 4K7QA 3L7PA 5T7LA 4XIUA 1RT5A 3JSYA 1UVJA 2C3UA 4B17A 2L3MA 2YKPA 2LU1A 4H4MB 4WF9Q 3MDFA 3DI6B 2Z8QA 1ZTWA 3GFZA 2EFVA 3BYPA 4LFBJ 5F0WA 3TVZA 4WWSA 4USUA 2EPIA 4LF1A 4DPUA 4USIA 2A1BA 2X1AA 4NCAA 2CADA 1NBEB 3PR4A 5FD1A 2B4PA 3I5CA 1WC0A 4KPYA 3WX4A 4MFBA 3A12A 2WW4A 4DEZA 4B9UA 1X5OA 4Y2AA 4WFXA 2RS8A 4O3PA 1OQ6A 3TRGA 3D0GE 1R0BG 3VR1A 4B9LA 1FDBA 4M63A 4QW8A 4U7UD 1KQSR 2XMWA 1D8YA 3AB4B 1C0UB 2CDQA 5KFTA 5KFLA 5AXNA 2WONA 3G82B 2WBMA 3PACA 5L9NA 3PO5A 5C24B 2MY7A 3MM6A 5GAEU 1IN0A 4IO9Q 3UD5A 3M30B 2E1AA 4M8LA 4OI1A 2WSFC 4OYXA 4KQZA 2JZ5A 1UMJA 4PG5A 5D0EA 3CIZA 4DUYF 3Q83A 1IKYB 1SH0A 2W2QP 1S0MA 2XSJB 3LALA 2ZKUA 1XQIA 3LOUA 5G0RB 2ZH7A 4ICLB 1UEVA 1X4DA 3BSAA 4RU9A 2Y1JA 1RCOB 8ATCB 2BZ2A 3MMBA 1XR5A 5KT2A 2EVZA 1XR6A 1QE1B 1NDPA 2LXFA 3KUGA 4I1TA 3HFKA 1V6HA 3JS9A 2HQ3A 1GEHA 1G7CB 3W8GA 1JLEB 2MEWA 3IWNC 2VQEF 2MQLA 2UXBF 3UW1A 1R43A 2DJWA 2OGUA 4X4UA 5KG6A 3MCSA 4B9NA 1RT6A 2LQ5A 1TL5A 3M8WA 3OL8A 4HHUA 3U27A 3GIMA 2C2OB 1X9SA 2AJ0A 4ALZA 4F2SA 3L9ZA 2NSBA 1S6PA 3RRGA 1S0VA 1NUEA 5A2QY 4FS2A 3TUZC 3UCGA 1Q82T 1NK8A 4X84A 2VG7A 4OZ2A 3MWBA 4M5IA 1ZM3A 1TUGB 3CCQS 1SH2A 3HHLB 5A8RA 2RS2A 1PILA 1TKTA 2ZNZA 2ZOFA 2WBRA 3PKMA 2HNZB 2XS7A 4PXBA 5D3GB 4WXOA 4YUDA 4OJ1A 3AXKA 4OI3A 2VV5A 1N5QA 3KG4A 4GKJF 1K44A 4X4SA 2AJ4A 2QSWA 3L95X 3MEDB 4GO5X 3T41A 4X4OA 1D9AA 5KFGA 1FFSB 4USMA 3HKWA 2M0GB 5F3TA 3EPGA 1ROFA 1VIXA 1FTRA 2XLIA 4YN3B 1U1MA 5ETMA 3ILLA 3VAGA 4ZLNA 4DZ6A 3R7SB 5DG9A 1BLUA 1KLMB 1RAFB 3NNHA 3A13A 2I2YA 2ASJA 2OFHX 2RB7A 1VQLS 2RILA 2XMAA 3O3LA 2XTJP 2UV8A 4XO0A 1YBUA 2GV1A 2VJVA 1I6JA 3ZXWA 5GMEA 4J37A 4WXWA 1K0TA 5LSOA 1UPPA 2OD4A 1TFYA 1K9MT 1Y9OA 4F3QA 4QR1A 1C1BA 1S9EA 1IR1A 4DV7J 3VGSA 4W4MA 1N4LA 1FFWB 4UZCA 1Q79A 1A6LA 4B3TF 3CJKA 1T03A 4J9VA 3T9NA 5BYQA 4BDPA 2XZTB 4RL1A 4L74A 2NR0A 4OJ3A 3KLIA 1HBNA 3ELHA 2Z58B 2B4UA 4DF8A 3KK1B 1AUSL 3KLHB 2YNHA 3ENWA 1TK0A 2DD8S 2AGOA 2NREA 4ECTA 1HPZA 2A2DA 5HVFA 1SH3A 4DXLA 1Q7LB 1RT1B 3U7JA 2VG5A 4NA1A 3MGJA 1Q81T 2WVDA 2DGQA 2E5GA 1SL1A 2YX4A 3MFIA 4ZHRB 1R31A 2KHCA 2M52A 3MEGA 3OJUA 4P73A 1IWAA 2LKZA 4B3MJ 4DV0J 3ZTQA 4X4QA 2HS0A 1HNVB 4MKAA 4NASA 2VG6A 2CWKA 2IAJB 4AUKA 2BJEA 1YJVA 3CMES 4F25A 3VGVA 2VOPA 2LQBA 1LK5A 1NJXA 4I7FB 5I3PA 2VBWA 3DHWC 4FVMA 2IVFB 2H51B 2MKYA 5T14A 2ZBRA 4AQYJ 3FJ2A 5KFMA 1IVZA 1VK3A 3FSYA 4ENOA 2ZBPA 3IG1A 2KTQA 4MK7A 4YQWA 1FDAA 4UOHA 1FRHA 5ETTA 1DRZA 4ZK7M 1B0TA 3C46A 1UVIA 2HZVA 2HHQA 3DRSA 4UOCA 2BJDA 1S76D 5BYSA 3TZYA 3IM9A 1Q0NA 4FN5A 3VZHA 2G13A 1WF1A 2VODA 4DCPB 3CCSS 1FI4A 3SV4A 2B4VA 3DRPB 2V4RA 2WVFA 1RTHB 4U8YA 1CS4B 3ENAA 3OBIA 4HH0A 4LQ3A 1C1CA 3SFUA 2XY5A 2QLFB 1VBXA 4C11A 4WP8A 2LEPA 3EVWA 1RHQB 2CQDA 5KFAA 1NPKA 5HN0A 5D4LA 2J9DA 1XMOJ 5IT4A 4DJBA 2RAQA 4IO1A 3BKUA 3HSZA 4XK8C 2AU0A 3H5XA 1U48A 4HI1A 3H5YA 5F8MA 3B54A 3FCHA 5SZTA 3EMTA 4O3QA 5BJRA 1H2UX 5B08A 4YEAA 3M9MB 3T9ZA 1NK9A 3SFGA 3R9LA 5D0RA 1Q78A 4ZVFA 1VHIA 4PUOB 2OP5A 3OFEA 3CJRA 1FX2A 1JLGB 3OPKA 4NXMJ 3FNNA 1RT4A 3KG0A 4USTA 2F4VF 2AYEA 3Q8VA 5RUBA 3P4UB 1R6VA 3NG8A 1XJWB 1XNRJ 2FJDB 3GJTB 1Q86T 2E9RX 4BWJA 4ZS6A 2D3ZA 3HSGA 3QWUA 3M1VA 4CLFA 4ID5B 2YQ0A 2Y1LB 2KRRA 5KT4A 3BQ2A 2JLGA 5GAHU 4I2QB 1REVA 4KPCA 2QT7A 3GV8B 1A0OB 1FJ7A 4F4KA 2U1AA 3CCES 3UDVA 1TL7A 3SDEA 1DLOB 4E2FB 1J2VA 5HBMA 2ATCB 1GMUA 1GXTA 2ATLA 4NXNJ 2E5JA 1RB0A 1QJHA 1VRUB 1GTHA 3HPOA 3I32A 4RU2A 3UD3P 3I0RB 2V2VA 3V6HA 4EBEA 1LFPA 1YK9A 2ZWOA 3NGUA 3BJYA 3V4IB 2RNEA 2J0QD 4AD6A 3P5BP 4BLGA 3HJFA 2ZM6J 1X4HA 1F6TA 2DNRA 3LGMA 3EWGA 1VQ7S 1BQMB 3UVJB 4RW4B 3B82A 5JJBA 1KLNA 2VH7A 2HEKA 4LFAF 4M5HA 4C8YA 3OL9A 1E6YA 2B7CB 2BJ8A 3R97A 4ZN1A 1S1UA 3SYZA 3GONA 4R8UB 3KUHA 3GPAA 5IFMA 2Y1IA 1HI1A 4DUZJ 2B0GA 2ZHOA 2ZHAA 4FPRA 2QV6A 3TAMA 3AHPA 4Z7YA 2A2CA 3UN3A 1PAUB 2BM0A 2DBBA 5CCLA 1OWXA 1RU1A 2HHVA 1SJFA 3QMQA 1PCAA 4A8MP 2HNYB 2BX6A 4DL4A 4IYQA 1FF2A 1Q95G 5HSPA 2BRKA 1X8DA 4ZCLA 4NLWA 1ZA2B 1T0TV 2KXNB 3HD2A 2UVUA 4AXJA 4G1QB 4BHQA 2C2MB 1JJ2R 4N77A 2HAFA 3QO9B 1U1NA 3GYGA 2HWIA 2ZVIA 3GLJA 3LP1B 4KJIA 4OX9F 4R5PA 1JLQB 4L75A 3EICA 2L48A 2MGZB 3NMRA 4C48A 2RRBA 2GO9A 4FPIA 3JXOA 4RW6A 1HBUA 3EZ5A 1TL1A 4P9SA 2B9XA 2GHPA 2ACMA 2ZD1A 1KQKA 2Q43A 3MM5A 2LYVA 1ZETA 2KVIA 4JV0A 1Y7PA 2UUBJ 1F3VA 2M3DA 2B5JA 3CWJA 1NH7A 4WFNQ 2IM3A 4WTYA 4NMLA 4DL0C 4OZNA 3BYRA 3CTRA 2AF6A 2OKQA 2IYIA 2G0CA 4EO8A 1U1PA 2GC8A 3W61A 1QUVA 5GVQA 4JI0F 1TQLA 5C2CA 1CJUB 3PEJA 3TI0A 2DNYA 2KM8C 1N32J 2CQ3A 2DNZA 2HFOA 1S1VB 1H2TZ 2YXLA 1CPZA 2A18A 1ZBTA 4P2XA 3MM8A 2KFNA 4YR2A 2OO4A 1LWEB 2BE2A 5D0HA 2MKIA 2K06A 2DH8A 1SC4B 2NXEA 4WPAA 3M8SA 1EIYB 5J1EB 5DQIA 2D3UA 2DPJA 2J5AA 1U0HB 2FY8A 2OPPA 1O8BA 3E01B 1UL3A 2UUCJ 1WDTA 3MURP 3BV8A 2YPZA 4F4XA 4HT7A 1TKDA 2R7XA 1LW0B 5IZHA 4DV5J 1XBWA 1N5YB 3PCOB 4ZOSA 1UKUA 4RW7A 4NRTA 3IAM9 3DU5A 3QAEA 1S6QB 2FD2A 4FF4A 2ALZA 1T3NA 4ZKAA 2BW7A 2EKNA 3KOAA 1IXKA 2JSXA 2D3O1 1RCXB 4EFAC 5JUMA 3MMAA 5B09A 4ZVUB 3HHNB 3LPYA 1HD0A 1S49A 1EQMA 4ZVSB 4GVLA 4RR5A 3AJ2A 3GJSB 1KR4A 2EFQA 2FHOB 2Q79A 2RH3A 2LXUA 1HWUA 4HI2A 3SIPB 3Q89A 4UY85 2PMWA 2G2OA 2NCKL 2FLLA 1Y3KA 4QJVA 3CEDA 4IRDA 3AH6A 5I3UB 2YBVA 3CJQA 1I5OB 3BGOP 4DQQA 1U02A 1W25A 3L7OA 4X64J 3CCMS 2GCFA 1WC3A 2DRBA 4BBYA 2G0IA 1XNQJ 4GO7X 2RDIA 4JOUA 1U47A 2ZZNA 2GW8A 1IKVB 4CO4A 1S1WB 2HFZA 5DETA 1YJ9S 3B4DA 1VQPS 2BR0A 3C6TA 5THWA 4X66F 4QIFA 3CC7S 4J90A 3W2VA 1Y5IB 1YBTA 4C0BA 1XK8A 3HJVA 4ZP8A 3H2UB 5IT9Y 1VIOA 4PWUA 5DDPC 1XWLA 4UT4A 3V6JA 1F9EB 1MU2B 1C0TA 3TEGA 3IGNA 1JLCB 4AFFA 3DDIA 2X51A 4RW9B 4O3NA 2AQ4A 2DNQA 5HLFA 2CPJA 2J0XA 3OSNA 4FF2A 2UV8G 3FMBA 4K4YA 4K5RA 3QWPA 3ZO7A 1JX4A 3ILJA 3DRYA 2VIHA 3KHLA 2E7VA 2Z56B 3SQOP 4B3SF 3MMJA 2ZBCA 4M5MA 2QA4S 3N0VA 2FJXA 3DM2A 2Z0GA 4GMKA 4X4NA 3HMJG 4OI6A 1TR0A 4C3KA 1QSYA 1NKCA 1HNXF 3NCQA 1FKOA 2VHGA 3HSJA 1NNDA 5KG4A 2R7QA 2YWFA 4HL9A 3KLGB 3BGRA 1ZOTA 1RT2B 4PRFA 2OPSA 3MTJA 2FGOA 4DQSA 3BPDA 4OYIA 5KFZA 5KFVA 2COLA 4PPZA 2ZKTA 4RNFA 3CE8A 1VQSA 4ECQA 3RBZA 1MWQA 1DARA 3OTBA 4F3MA 1UW4A 2CJKA 2CKWA 3IGVA 1L3TA 3EGWB 4R25A 4FYXB 3PX0A 3DMJB 3JTOA 3W5ZA 4V1Ak 3RTVA 3MAAB 4XAKA 2ZJRQ 1HNIB 4DV1J 3KNAA 4I64A 2HIYA 3GIIA 3AQPA 2XULA 1JLBB 1H7WA 3CD0A 2JLEA 2P9GA 4KHPJ 2CNNB 5DGAA 4MJKA 3FKBA 2MZQA 1SJQA 3NXZA 2ZITA 2MXYA 4C0OC 4PQUB 4DR6J 2EEYA 2FDNA 1JMTA 5A0YB 2EXUA 1HMVA 1FWLA 2Q1LA 3NBPB 2HFVA 5M2PA 3HZEA 2CQ0A 4I2PB 1X0FA 4UUWA 3H7HB 4W98A 1FEEA 2HHSA 1YBAA 3CXCR 2EBGA 2AGQA 4I68A 2KXHA 1PYTA 2A6MA 4ATNA 1WELA 4JI4F 3ET6B 2AEFA 1IM6A 3H2VE 3T19A 1S12A 1RBLA 2IC3A 3D68A 2UXCJ 3R3TA 4LSLB 4DX5A 1YSJA 5C5JA 3M6UA 5D78A 3Q0AA 4IOAQ 1EARA 1S10A 2FJVA 1D0EA 5KFOA 1I94F 4IR1A 4ZDNA 1BQNA 3BKFA 3G4SS 3GR1A 2VPWB 4DSJA 4HTIA 1H0HB 2JOQA 4PR6A 1YDLA 4ECUA 5F0UA 4K4SA 2R7VA 3K5PA 2X1FA 5H9FK 2AX1A 3H4DA 4KGKA 3AJ1A 1N36J 4UOGA 2DH9A 4GVBB 1WORA 1ZYQA 3TVKA 3ZZPA 2EWHA 3BSCA 1Q7YT 2QYGA 2QZ8A 1FRLA 1SL0A 1J5OB 1SKWA 3EX7B 4IQXA 4L72B 2DB1A 2LU2A 2GAHC 3KJFB 3C8YA 4OHYA 4F26A 2PI4A 1Y0HA 1YIJS 4IG0A 1FJGJ 1AZSA 1OPIA 3TP2A 4PKDB 3P96A 1U6ZA 5U47A 1NDKA 2ZE2B 4PG8A 4KKOB 3GG1A 3TARA 5A8KA 4Z37A 1LNQA 5DQHA 5KOWA 2JL9A 4O44A 3HT3A 1R3NA 2V4JB 3UDEA 3HD1A 3DHXA 4USJC 1KP6A 3M8QA 5LXRA 1BMQB 1BE4A 4ILLA 4ZPBA 3CJ8A 3PVXA 3LUYA 1VJWA 2XSFA 1IM4A 4QR0A 1CJKA 2VPXB 2PSZA 3MM7A 1RWOB 3OUYB 2R4FA 4LUBA 4Q2LA 2HK2A 3RGIA 1MLAA 1F2HA 4HDHA 2FB0A 3GQCA 4DPWA 1EB0A 2M2BA 1FD8A 3GJRB 3DLJA 1BD6A 3O6QA 2CZ9A 2F5GA 1HNWJ 1SQFA 5HROA 3NOGA 3AFGA 1HARA 2DNPA 3HHDA 5KFJA 2W7AA 1EP4B 4KGXB 1GXUA 1ACMB 1QUPA 3A4TA 3TQ1A 4LRFA 4KRWA 4WK3A 4ZVOB 3MR7A 2AEMA 4CP5A 4JYAF 3FFIB 5CH7B 3M2VA 3HT0A 1D9DA 1S6OA 5ETPA 1QDUB 1JLFA 3KHGA 1LXJA 1WG5A 1PYSB 1FNXH 4Y2CA 2U2FA 4JI2J 4CLTA 3J80Y 2M5YA 2M8DB 2RF2A 2E5HA 3BDPA 1SCJB 1HHTP 5J2PB 2C2KB 1I3OB 4K2JA 1ICEB 3HF5A 1TUWA 2FZGB 3DLEA 4JI5J 2V0NA 2VBXA 4Q44A 5LMUJ 1R8AA 3N9UC 4LF7F 4WFBQ 2QL7B 2DIVA 2F4FA 1KOHA 4DR5F 1X9WA 3EDRB 5CCMA 2B56A 2MQ8A 1T9YA 1FJEB 3RB6A 2HYIB 2D74B 4TQSA 4J9UE 3NGRA 1FTCA 1T05B 4XPEA 1RBAA 3NGKA 5GAEI 2C3MA 3C19A 1K1QA 3QT7A 4J5OA 2Z2LA 3VZIA 1X7VA 2R2RA 3QFHA 1HKAA 3T1HJ 2GQ2A 4OJHA 2GHVC 2OEMA 4KE5A 5IT0A 1YG0A 4DMZA 3MFHA 2P2CB 1JKHA 3CDUA 5C42B 1U49A 3E2EA 4MFBB 2BABA 1MMNA 4Y65A 1LWCA 2EBEA 5B0GA 3FUYA 1YJTA 1V5IB 4DR4J 3W2WA 5KT7A 1YX2A 1JXLA 3OD2A 3LANA 5JXSA 4CTAA 2FVRA 2OELA 4DPXA 4NLQA 2V94A 1KFSA 2I5JA 1NU4A 2ILZA 4M1KA 2ROGA 5A6PA 4ECYA 3CCUS 2GIRA 1JXEA 4XDCA 5K8MA 3HHLC 2HQFA 4UZBA 1KC8T 1S59A 2KI2A 2HZCA 4DPOA 2YH1A 3TOQA 1VRTA 1RDRA 3P3DA 2F65A 3W63A 1LW2A 5D77A 1D8ZA 3KK3B 2MZSA 3MAHA 3PFOA 3AOAA 2B51A 3Q8PB 4K2XA 1S1TB 4JI3F 4OX6A 2YWEA 3K57A 4B08A 4PG7A 1KOOA 2OSRA 4J9QA 2R2SA 2CPHA 3LH2S 1TKXA 1D3WA 2R7WA 3CDBA 1H74A 3D6FB 1IQTA 4MIBA 1FDNA 4F4ZA 4JB8B 4ED4A 2VOOA 5HQMA 2HK3A 5KFPA 3G6XA 4OV6A 2MMYA 4NLTA 3C15B 3HHKA 1RSCA 4Y6IA 4NLXA 4Q2MA 1P1LA 5A6WA 4CLWA 2DH7A 3FBEA 3US5A 4OZ0A 1U24A 1R0CB 4NCBA 3Q2SC 3GV7B 2MKSA 1RGVA 4I56A 2C2RA 4HR2A 2G4BA 2WCXA 3I31A 3D6TB 5F8NA 3DGPB 1UJ6A 5K20B 1IBMF 5J2MA 4KIAA 4M5DB 4O4GB 4P2FA 5E5NA 4FNHA 3IRXA 4OHWA 1VGYA 5IWAJ 4ZP9A 2VBYA 1IJFB 1U2FA 3D0IE 4YR3A 2XGQA 2O3DA 1NAQA 1ZPVA 2RRAA 4OIXA 3LAMA 3MOZA 1OY9A 1SQGA 5ITHA 2OTJS 2YH0A 1MN9A 4LF4J 4X4VA 4O4RA 5K9FA 5KFDA 4N5SA 3GZ7A 1FE0A 4X65F 3VALA 4U67Q 2IBKA 5E0OA 3M9NB 5K8PA 1GXLA 2EFGA 1TMMA 1FERA 1VS3A 1CJTB 1R0AB 1FT8A 1IBLJ 1C1BB 3CT9A 5C25A 3M2UA 1KRPA 4KGVB 1HR0F 3SQGB 2GAGC 3FSXA 2YY3A 4IDKA 3CJKB 2IFXA 4ANCA 4LF6F 1BWVA 3KLFB 2BYCA 3UO0A 4ID8A 1NDLA 1WC5A 4D3HA 5HQLA 4DX8H 3RAMA 3IN5A 3U1MA 1FK9A 4ZPDA 3MMCB 4LRCA 1LWFA 3UQSA 2UVVA 1HPZB 2YNGA 3V6DB 3NMAA 3MM9A 1YRTA 2DNHA 2EFPA 2RMLA 2ABYA 2YNIA 3MHYA 3JTNA 2N4DA 3GFHA 3N6LA 3MAQA 3TANA 1K47A 1DQAA 1KQGB 1ELOA 4H4OA 4P7TA 2IPOB 2CPDA 2GO8A 2DISA 4CLYA 2ZDPA 1CJVB 2YKAA 3QT6A 3E3XA 5L39A 4DR1J 3FZ2A 3X1LB 3NAIA 2FVPA 4NI2A 3CCVS 3OTEA 4YY3F 1NB2A 4TLQA 2PI5A 5DM6Q 3W66A 3I87A 1G1XA 1N52B 2W1BA 2HVIA 1H2VZ 1UWBB 3GCWP 3OTCA 2HQDA 1SQEA 3I96A 2WOMA 1T02A 1GAOA 4HACA 1NEEA 2UUAJ 2DR7A 5JVGQ 5JVHQ 1NM2A 4DLGA 1ULRA 4C8ZA 2YKMB 3DOMA 2EG2A 2D7SA 5L1IA 4A8OA 1FHTA 4H54A 1IBKJ 5A2QU 4DFKA 2FHJD 5DG7A 1HBOB 5IOLA 2P9CA 2WB1D 5DM7Q 2XNRA 2QC3A 4UUXA 4H4MA 1FRKA 4FF3A 3DI6A 1NCLA 4TYAA 2DNKA 2I1RA 1QAJA 2JVOA 3DKDA 5AJ3F 1H98A 2YTCA 2R42A 4ZJOA 1KNZA 2KVQE 4MIAA 4JP8A 2M9KA 3KNGA 5GAHI 1SJRA 2VFVA 1RWVB 2K7KA 1KEKA 4DHVA 3RBXA 2HURA 2W2MP 2UXDJ 5DGBA 1MW7A 2HZAA 2JX2A 1GH8A 2XBPA 3D3BJ 3QZ8A 2BACA 5GMDA 1S4EA 3OTOF 2HG4A 1YRXA 3EZOA 4LSNB 1IKXB 1C0UA 2ZUGA 4O23A 1AFIA 5LOQA 4K8RA 3JQKA 3W9IA 3C16B 2YVSA 3ZFVA 5LMNJ 2FHJA 5C24A 3HCXA 3AOBA 2VUGA 1U8SA 1M5OC 3BB5A 1RT4B 2FLNA 1Z2ZA 3M30A 2HFSA 3CPWR 4E98A 4J9KA 2W7PA 2KDOA 4QWEA 2G1HA 1UVNA 1IKYA 1O0PA 2DRAA 2VD3A 3GCXP 4R0EA 3M9OB 1Q5YA 2XSJA 1F1BB 1WC6A 1Y11A 2GJ2A 1NPRA 4CLUA 5F3ZA 2YWGA 3QLHB 3HHLD 4ICLA 1G2EA 4ELVA 4CWBA 1HW9A 1GX6A 3HFZB 1Q8KA 3DLKB 3ETMA 1TL7B 3G6ES 4EBCA 2FVCA 4K4WA 4DSFA 3FZBA 5KAKA 3N5BA 5H1SV 1JLEA 1KHWA 1P9QC 1RABB 2VQFJ 1TVRB 4I69A 5HO4A 4QCLA 1UA1A 1GQEA 1U09A 3PYGA 4MKVA 2HMIB 4JI6F 1REGX 3IAS9 3JB9k 2FUG9 3RW7A 1UVLA 3R5CA 5HAOA 1NSKL 4N41A 2YKOA 1K1SA 2OMLA 4Y3CA 1YZ6A 2C3OA 1NK6A 3HK2A 4DFPA 3R6LB 2XMTA 4PAAA 4O0IA 3HHLA 1SUQB 1PJ6A 1UAWA 5EWFA 1TV6B 2HNZA 1GMVA 3OVAA 5D3GA 4DS5A 4UQGA 3S01A 4MTPA 1S1UB 2W2OP 2QSFA 3AT1B 4J9MA 4USHA 3LGHA 2E29A 2L41A 3Q23A 3TAMB 1VOMA 3I9ZA 5DJBA 4USVA 3NGSA 1MWZA 3LTOA 1U2RA 2BW2A 4DV6F 1KLMA 4L73A 3PW0A 3SSSA 4LFCF 2B8PA 1EAYC 1APSA 2HBZB 5E7OB 4AYBD 2OPRA 5H9EK 3MUMP 2P9EA 3MCMA 4CH7A 5D4NA 1GFWB 4R5PB 3D2WA 1VHFA 1WUUA 1JJHA 2V8HA 2N82B 1QVFR 3OR1B 4LVNP 1PGZA 5KFCA 5ADZA 3VAJA 1KHVA 1VBYA 1HBUB 4PWDA 1J5EJ 4PCQA 4ILMA 6FD1A 2ZD1B 4CO3A 4YDDB 1RWPB 3MM5B 3KJNB 1U0SA 4IR9A 2EI5A 4HEA9 2F9JA 5HP1B 3RBDA 4F0MA 2FVSA 4LFBF 1S7HA 4CNZA 2E1RA 3BN4A 4A47A 3I82A 2MB0B 3PKYA 3PNIA 5GMKa 2DEIA 3QGPA 3BPSP 3BO4A 3VAHA 3PTWA 4ZHRA 4QOTA 3UDCA 2MSSA 1EQ0A 4X62J 4YFUA 3D67A 4C8LA 3D28A 2XC9A 1HFEL 3PXGa 2F7VA 4IRCA 1IR0A 4NYOA 1V3RA 2BE9B 4DL2A 1HNVA 3VAFA 4ETZA 1BUXA 4ZITA 2J7UA 4JI6J 2HQGA 3GSIA 4NEZA 3KWMA 3N6MA 2RD5C 2OPPB 2ZOGA 4ECVA 1W2BR 1M5SA 2V69A 4TNOA 2X1BA 1FDDA 4LQ9A 7FD1A 2AHOB 1ZTTA 4PQAA 4G1IA 1Q1KA 4TKTA 3FEXB 1RWXB 4KFBA 5D6GA 2UUTA 5L1JA 1M1GA 4ED6A 2V5HG 1KFDA 2VFUA 2CRLA 2K2PA 3PJWA 4DV2J 4URSA 3DRPA 5E3QA 2IVYA 3NNAA 3Q8UA 2WHOA 4QR2A 2GNKA 3QIDA 1KQFB 2FJWA 2BEFA 1CS4A 3WDOA 1WHWA 1S6UA 3NEKA 4MYUA 2DGSA 3K5NA 1IUJA 5KFUA 3OW2R 4UQTA 1IKWB 2P6TA 2E5LJ 1AXQA 2JEIA 4EK2A 4Y2KA 2V68A 5CZXA 2D3OR 4DQIA 1QD1A 2BRLA 2PT0A 3VVTA 4U6PA 4LF8J 2MKKA 4CM2A 3W9JA 2CG4A 1MN7A 2BANB 4DLEA 3PX6A 2QLBB 3CJ0A 4URQU 1RTDB 3GIJA 3I4HX 4PUOA 4G65A 4LSZB 4EI2A 4FYVB 2PIIA 1JLGA 3PZPA 1P9YA 2W4CA 2FLPA 3CDWA 2MDAA 2BA9A 3FDSA 4KH1B 3QRRA 4IRKA 3POTB 1IR2A 4F7VA 3ENQA 3K0JA 2E1PA 4BWMA 3PRBA 2EFNA 4Y2IA 3M8YA 4J9LA 1C0TB 4JI7J 2ZOMA 1G4CA 4ID5A 5BYRA 1HL6A 2DHSA 2KFZA 4YB7A 1YZ7A 3DGVA 4HHHA 3I6PA 4LF9J 1RHMB 2J7KA 1UVKA 5ETRA 1KDNA 2RKIB 2XI2A 1HA1A 3HO1A 2H1YA 2Q3PA 1ZM2A 3HSDA 5L8RC 5I42B 2ZZTA 1WI6A 4YDXA 4K0KJ 3PIOQ 1VRUA 4EZ6A 3R1LA 3DFEA 3KLEB 4DV4J 2N3LA 3GU0A 3ONQA 3CD7A 3RB0A 3DCAA 4DG1B 4DV7F 1NK5A 3GB0A 1XMBA 2ASYA 2EG1A 4C6AA 4B3OB 3V4IA 2JHEA 3HI9A 4IFVA 2OAUA 3UCZP 3DXBA 1FVQA 4L3KA 4EU0A 1UWAA 2RQKA 2GIQA 4J91A 1BQMA 2R2TA 2D9OA 1TMJA 1WEXA 4TU7A 2X1GA 2EC0A 2OPSB 2W9BB 2VFSA 3BSNA 3JSBA 4K4VA 2HHHJ 2ILYA 2BVZA 4DOZA 3WBZA 2KG1A 5GAGU 1QY7A 1LXNA 5LJ3Y 4ZPTR 4CM0A 3KUEA 4QW9A 4GKKJ 4LF5J 4P10A 5LJ5Y 4B9VA 4RPFA 3DRRB 4U7UK 2J6TA 2VF3A 3J7AN 4B3MF 4YHHJ 2W9CB 3T1YJ 4DV0F 2CJBA 4NYZA 1HWLA 4OLOA 3HHEA 2HGNA 4ZPWR 1QSLA 2PE8A 4YR0A 2GVDB 2UZAA 2ADBA 4DN0A 8AT1B 3MUTP 3ICLA 2CJXB 2DRDA 3PY8A 4G1QA 3TUIC 4LIRA 1B7FA 4WE1A 3K5LA 4AQYF 2UUWA 3FMWA 2CQBA 4C4WA 1KWMA 3OLBA 2LDYA 1UTAA 3LP1A 4NZ0A 3OXFA 1GK8A 1OIAA 8RUCA 3P5TL 1TZ0A 1JLQA 1GNKA 3GIKA 2RQMA 4DCOB 1MROA 1U6FA 3EXCX 3PM9A 2MGZA 2KZMA 3MECB 4CLPA 1RHKB 2KKHA 4NMXA 1NHUA 1MG7A 2CJAA 2UP1A 3CSKA 2MHNA 2ZH4A 3CJ5A 1JXVA 2XI3A 4RNHA 2R8GA 2IC3B 3R27A 1AYEA 2BE7D 3CNQP 2DNNA 3S6EA 2G0JA 3KMSA 1RAIB 3OR2B 3TA1A 4C7QA 5HMWA 5FJ4A 2ASLA 1VJQA 4U95A 3EGZA 4ER8A 1XC9A 4DBQA 5IT9U 3SI8A 5EX0A 1CJUA 2CQ1A 1XMQJ 1XMOF 3WIUA 2GMHA 2AKWB 4FXWA 1S1VA 5IM0A 4JI1J 1DQ9A 2HPUA 3CJTA 5KG3A 2PN6A 1A7GE 4OJGA 4XTTA 3CC2S 2CYYA 2HHXA 1LWEA 1WG1A 4NCGB 4FKYA 4WKRA 3BR9A 2GX8A 3C2PA 4DFJA 2HHPA 3AODA 2K3IA 1R8HA 4CH1A 3AAWB 3E01A 4NXMF 4DSKA 1NKBA 1CLFA 4DR2J 5A8WA 1N5YA 2KN4A 1XNRF 3F0NA 3P49B 4CDIA 1SC1B 4WYLA 1S4FA 3NY0A 4QIWD 5AXMA 3OXLA 4IUFA 1TKZA 1RJJA 3W5XA 5DG8A 3V2UC 3IS9B 1U1QA 1U1RA 5KFYA 1N34J 1S6QA 3J81j 4C8NA 2OUGA 3KFWX 1RHJB 4RW8B 4OYMA 1DQ8A 1N33J 4A8KA 3HM9A 4A8QA 1AZSB 4EEYA 4WFAQ 3VQSA 4IOCQ 2YWKA 3RU0A 1RT3B 2KXFA 2CZVC 2HS4A 1XTZA 2MKJA 2VASA 3J7ZT 4B3RJ 5A8KB 4NXNF 4ZLLA 2NS1B 2J8AA 2K1RB 2Z2ZA 4H4KC 4RUCA 1YQHA 2XB2D 5EN1A 3LGNA 3G2XA 2B7BB 4P2SA 4W90B 3M4XA 1WF0A 4CLLA 2KFYA 2Z2YB 3VV2B 1WEZA 2ZNYA 1YLXA 4K59A 1NSPA 5L9XA 1T3OA 2XY7A 2E7WA 5F8LA 2ZM6F 3MM7B 4LMZA 3OHAA 2JEGA 1T9WA 3SEOA 3QJPA 1M0SA 3B6BA 4WIQA 2MTLA 4DDFA 3DOLB 3NP5A 3R5GA 2K7JA 4JI8J 3EZUA 1W2IA 3ZZUA 4J9RA 2NZCA 3DYAB 4MKBA 1IKVA 4ZPVR 1S1WA 2FLOA 3EJMA 2J6UA 1FEHA 3QT8A 4PXEA 2V8VA 3KK2B 3H4BA 1WJ9A 1TL3B 3NCPA 1F2GA 4PG6A 1NSQA 3RUBL 1YJ7A 4DUZF 3RR7A 2L9NA 3KLVA 4NLPA 2WVBA 2DHGA 3JAMY 2XO6A 2V8DA 2JFKA 1JLFB 4L6V3 1MU2A 1T9TA 1HD1A 2GMLA 1WTBA 5MLCV 2Z30B 2HVZA 2CQHA 5E3RA 3DU6A 3OJSA 5D0GA 2RUSA 2CPEA 2ZJQQ 3D7SB 2RF2B 3SCLE 3D3CJ 2MLYA 1OYEA 4LR8A 5E3PA 4LF2A 4NLRA 1D09B 4UW2A 1FKPA 4YB1P 1U1KA 3UR3C 2AYMA 3BBCA 3CVKA 3D66A 2CQGA 3LP2B 3W7BA 2FGCA 1F9FA 2KH9A 3AB2B 3PYDA 2D41A 3K8VA 3M2RA 1Y3JA 1WHVA 1B4SA 2WW8A 5CZVA 1DBDA 2JJ4D 3GFXA 3VTIA 2XS5A 2MKHA 2BOPA 2UU9J 2HGLA 1Q8BA 3QQCD 1YJNS 1MSWD 1GMWD 3KLGA 4MAKA 2DGUA 5KG7A 4IFYB 1RT2A 2UUBF 5KTQA 1UZHA 2GJIA 3RB4A 3IBFB 2Q6CA 1OSCA 2DPIA 3K7RA 1M1HA 2C22A 2R8JA 1ZPWX 3MPWA 3DMJA 4F04B 2CQPA 4OX8A 2RDDA 3MAAA 2W4DA 2D69A 3BO2A 2BQ3A 4Q0BB 2FZCB 2IRUA 1N32F 1FESA 2LFVA 4CT9A 2PA8D 4QWAA 1X4EA 2O5DA 4JV5J 2ZVSA 4CO0A 1NHVA 1VK8A 4WJBA 2JDJA 3V81B 1WEYA 5DS7A 1QM9A 3SZ2A 3VAKA 3K8WA 1S57A 3KJQB 3VF0B 4CYUA 5AXKA 1UFLA 4PQUA 2UUCF 5A0YA 4DR7J 5DDRC 3GWCA 2AGPA 4DV5F 3NKYA 3NBPA 5EGYA 1RUSA 4BC9A 4I2PA 1VLOA 5K14A 4ECSA 1Y00A 4MKYA 3C14B 3FBFA 4KV8B 3OVSA 1LW2B 2QYCA 2C2ZB 4HLBA 3KDNA 3HVTB 1N48A 4RJVA 2Y0BB 3LWLA 1ZAWA 3BREA 4X2BA 4RBUA 4ZVGA 3L3CA 2VA3A 3M7VA 4ZA1A 4JUZA 3I4PA 2DHAA 4F67A 1DTQA 2AWZA 2CQ2A 2V2KA 1T95A 2HAIA 2XCAA 3TX8A 1HNZJ 1J27A 2YNFB 2DGXA 3QIPA 3MD1A 1EJ7L 4RNNA 3DLGA 2V8GA 2NSCA 1U26A 2P8IA 5B0CA 3CMAS 3OTDA 5EUHA 4M95A 2QL5B 1YJUA 3QFWA 4ZP7A 4RWWA 3S7RA 5LT5A 2HWHA 4NEYA 2CFXA 1PAEX 2K3KA 4NA3A 1VQ5S 1B70B 1YKWA 4X64F 2GIFA 2ZFHA 2GS8A 2OSQA 4KTQA 3R7NB 1XNQF 4AT1B 1VQ9S 3MTKA 6AT1B 1GT8A 2QRRA 1SVDA 1RP5A 4Z2XA 5FDLA 2BQUA 3FRYA 4A48A 3N28A 1T9VA 1JJ4A 2KYXA 2VZ9A 4K4ZA 1IJEB 2BKOA 3LP0B 5J2MB 1WHXA 1D1UA 4DS4A 1HQEA 2AV5A 4N76A 1KVKA 2WAQD 2PMZD 1UETA 4C2MA 2MZJA 4NLUA 3ZTOA 1DTTB 2QMUB 2KJWA 1FRIA 3QYYA 3GE9A 3H20A 3CD5A 1N54B 4P71A 1FJCA 2WSEC 4NZ7A 4EO6A 3ILIA 4WFZA 4DQRA 1X4GA 5LM7E 3DOKB 3CJSA 2ZE2A 1SIWB 2HLTA 3QGHA 5ETOA 4DV3J 4KKOA 1PO6A 1WKJA 5KFEA 1HI8A 2BKNA 3T6BA 2B43A 2LP4A 2XCPA 3IR7B 2V4JA 2ZH2A 2JC0A 1NJZA 3AA8A 5HQ8A 1BWEA 1X0PA 5B0EA 3VAMA 2VDHA 1N5TA 3OT9A 2J0SD 3PX4A 3FQKA 1WD6A 2IBOA 5KFKA 4DX7A 1VQNS 4B9SA 3BEGB 3PHTA 2KB2A 4M5NA 4LRDA 3T5JA 1FFGB 2H5IB 1UZDA 1YI2S 3M8PB 3NWGA 2LVWA 3NOCA 5KFBA 1HHQA 1WNEA 2BKPA 1RTJB 2LDIA 3FBCA 5CYQA 1VQ4S 4PWWA 2YNGB 2KHDA 2CVEA 2J9CA 3MM9B 3TJ8A 4QYRA 4G6VB 1W7WA 3THTA 4JV2A 5C2GA 4ZLJA 2VL1A 1RLDA 4DV1F 3FRZA 5EHHA 3I0SB 3FFIA 2R8IA 4QPTA 1FWPA 2HBRB 1HI0P 1H38A 4GC6A 3UFCX 2A0FB 3TZWA 2VA2A 4DR3J 2DCLA 4KHPF 4URGA 4C8MA 2A10A 2OMOA 2XWXA 4H4KA 1JLAB 1RAJA 2C42A 3PW2A 2HW3A 5J2PA 4O3RA 2ERRA 1S1XB 1L3SA 2MQMA 2GVZB 2NPFA 3GG0A 3ITHB 1EETB 3CCRS 4DR6F 2H4WB 1N88A 4NL5A 4F0HA 3QSYB 5FIIA 1F60B 3O1LA 1B3TA 2KJVA 3OHBA 2OPQB 2GHWA 3F41A 3R5JB 2JEFA 3RB3A 3I55S 2XYHB 4ECRA 1X5TA 5DLGA 3V4MA 3LW5C 4HKQA 2V50A 1T05A 3H0PA 3L4BC 1UFWA 2J8SA 2DKOB 1X60A 2VFRA 2AJQA 2CQCA 4ZVTB 5F8IA 1UJ5A 4C3MA 3QATA 5F9LA 2O66A 5J2NB 2UXCF 3IA0A 2EW9A 4ELTA 3H98A 4Y0FA 2M7SA 2NYHA 9ATCB 1H6KX 2WK4A 1WOPA 5FLXU 2QLWA 5D4OA 4N56A 2H65B 4X4TA 1HBMA 1NHKL 1R8PA 5C42A 1HQUA 3GYXB 4TU8A 1ZAXA 1G3OA 2ALYB 1YVFA 4OQJA 3C6UA 3B78A 3Q22A 3R5AA 2B6AB 2E44A 3CMQA 1NSAA 1F5BA 1LWXA 2DGWA 1TK8A 1RTIA 4P72A 4CO5A 3AA9A 3CDAA 1OSDA 4U7CA 5E41A 3MUVP 2FQQB 1N36F 1KVIA 3HZGA 4Q45A 2JC1A 4HYKA 2GZOA 2NZ4A 1F5AA 2QMWA 3PYEA 3D6MB 4WFYA 2DY9A 5KG5A 2MJNA 2HVHA 4KO0A 1WSRA 3BGFA 1SV5B 1NMEB 2WVCA 2GGPB 5BR8J 1OO0B 1MMDA 2V67A 3WC2A 3A3OB 2P5VA 4PXCA 1RI7A 3TZZA 5KFSA 3KK3A 1KKHA 4XPCA 3G8QA 2YQ1A 1SB6A 4K5SA 3CULA 2DHHA 1FJGF 5CYMB 1S1TA 1FKAF 3CW2C 2C3YA 2HGMA 2B9YA 2RUGA 4NRUA 2W2PP 2XMJA 1VC5A 2PC6A 2MPUA 2Y9HA 1WOSA 4RBTA 3TUJC 3OFFA 3JSMA 2HHTA 3SBMA 3Q8YA 3RR8A 2EFOA 3NLCA 2WSCC 1FXDA 3U1LA 4DPYA 1OJ4A 2AZ1A 4UF4A 1SJ4P 3G96A 4DWIA 3C15A 3TNVA 1RT7A 4A46A 1WC4A 4U8VA 4C9DA 4QWBA 3PW5A 1B64A 1WDDA 3FVYA 3PR5B 1FNMA 1RA7A 3JYTA 2ZUAA 5E2QA 3DLHA 1L3VA 3X3UA 3VHQA 4D3GA 1TL4A 3W65A 1U45A 3GR0A 2QA4G 3S1TA 5KFWA 1HNWF 3DGPA 4TY8B 4O4GA 4M5DA 3ZZZA 3AQOA 2QLXA 3VQTA 2AIRB 2YWWA 2KL8A 2WVEA 3SCIE 4IG3B 3WQPA 2DVIA 2BJ3A 4OHVA 5KFXA 1FXLA 3J81U 1U1OA 5ETNA 9RUBA 4JI2F 1UA0A 2KU7A 3P6YC 1CG2A 1FNOA 3R2DJ 4O0NA 3NRBA 4FYYB 2XWYA 3NAHA 4USWA 4ELUA 2OPRB 4JI5F 1CJTA 3O2IA 1R0AA 4ED0A 2BBEA 5LMUF 1M5VC 2DTJA 2IDEA 5HATA 4ECWA 2CNOB 3SQGA 1LKZA 2LA4A 1P1TA 2I0XA 3KLFA 4OHZA 3N79A 4PWDB 3MEEB 2Z2MA 4MH8A 5J1PA 1RAGB 2IDLA 1RHRB 4ED5A 1HWIA 2ROPA 2OEKA 1RA6A 3V6KA 4DUYJ 1FVSA 4I4BA 3U02A 2NXJA 3MR3A 2YX7A 4OX7A 1SIZA 2WTFA 2CJQA 1S9GB 2IA0A 5DDQC 3T1HF 3MMCA 1SKSA 3TX0A 1VQ8S 3V6DA 1EX8A 4ECZA 1RHUB 3BBBA 3VCDA 2OEJA 3TUPA 2RVJA 3CDEA 4OZLA 2AEJA 3UPFA 1D9FA 1LEOA 5E33A 4JBCA 2FTRA 4LVOP 4A8XA 3AY0A 1MWYA 4QIEA 5ETLA 2ZH6A 3Q86A 4DR4F 2VQEJ 2UXBJ 4IQMA 2R3VA 4ECXA 2CPXA 2ZBQA 4DL6A 1CJVA 4N8NA 2V34A 4NYPA 2DO4A 1AW0A 2QFIA 5ETSA 1TFWA 1WTFA 3IM8A 5F41A 5HK4A 5IQ6A 1RWNB 4EUVA 3SV3A 1GTEA 4CH0S 1HYSA 4DSIA 3FGVA 1UWBA 3CUNA 4L3NA 2AJFE 2IVMA 2WZ1A 1JWWA 3UE2A 2Y8YA 2ZZMA 2CWXA 3NWRA 1B99A 4K50A 5KT5A 1URRA 5KOXA 2YKMA 4KFBB 5CYJA 1KTVA 2CZ4A 4WIIA 2J76E 3B8HA 3CJ4A 4Q5VA 4GKJJ 1U2CA 2QE5A 1HBOA 2FC9A 2DNLA 2NXUA 3PJ9A 1E6VB 3FCWA 1CULB 1VR6A 3Q2TC 3M32B 3G87A 1UW9A 2FYXA 3AD9C 2BJ9A 2BDPA 2LA6A 2CPZA 2ZC3A 2VDIA 4F4YA 1A9NB 4ZPAA 3HVRA 2ZDOA 3IO1A 4EYIB 2B4OA 3HDSA 2L08A 4ZJQA 2X3GA 3D0HE 5SUHA 3BKTA 3CF5Q 5CHCB 4FZVA 2ZWPA 3MPDA 4FXVA 2G1DA 4MYTA 3P45B 3QBCA 4IKAA 2DR6A 1GX5A 4LSNA 3KJVB 1IKXA 2HS3A 3I5BA 2F63A 3IWXA 1NJIT 4B3TJ 3C16A 2MZRA 3A8EA 2PDAA 3TZXA 4AL5A 1Y4ZB 2M8HA 3CGIA 4CZCA 5T7LB 1RT5B 2R7UA 2W8LA 2HBQB 4M94A 2HWTA 1S7IA 5IWAF 2N4CA 1M5HA 2R7SA 2R8KA 3QSIA 4HTJA 4OMFG 1WI8A 4FVCA 1RYRA 3QLHA 1DY3A 4LF4F 1FXRA 1HWJA 3DRXA 2AYBA 1SKRA 2F3JA 3RRKA 4NX9A 2R7OA 1TAQA 5B0DA 2FHKA 5GAGI 3DLKA 2KG0A 2V63A 4M5GA 1DJ0A 2IMOA 2QA2A 4P74A 2V8PA 4DL3A 2RRNA 3RAXA 3SCJE 2HQCA 4ED2A 2Q66A 3DDNA 2JLFA 2XGPA 1IBLF 4KC5A 1TVRA 4JV1A 2WONB 4EYHB 2E1CA 1CBKA 2HMIA 4G1PA 2HQIA 3MCOA 3T6JA 3IXQA 3MM6B 1CEZA 2XZDB 5G4DA 4IFVB 3T1AA 1NDCA 1M5PC 1N5SA 2BOAA 1V3ZA 3C3LA 3KG1A 1C4AA 2V9WA 2LCWA 5E3AA 1HQ2A 2I9SA 5ETQA 1FRJA 1X31C 3ZTSA 2ZC4A 1SUQA 3ZZ0A 1TV6A 4OHXA 1X4FA 2HNDA 2FJBB 1OS5A 5HMXA 2H54B 3WX8A 3I5AA 2O67A 3MMBB 1HLWA 2MHEA 1OY6A 4NWBA 2XMKA 3PRDA 4WZQA 5KG0A 1AB8A 2Y8WA 5HANA 4ETXA 3RZAA 4ED3A 2HVDA 2IRXA 4YOEA 4RX6A 2DXEA 3QT5A 2XO7A 5HJYA 2YWHA 3PG9A 1Q5VA 3FC9A 1VRQC 1K8AT 1U7LA 2DK2A 1RT6B 4DR1F 1T9XA 4EGLA 1ZS6A 1O51A 4V19X 4Y2MA 1RYSA 2CXEA 1R7IA 3H5SA 1WC1A 4N8OA 1S6PB 2M88A 1WG4A 4WE1B 1NXIA 4CO2A 5MAOA 1BXNA 1RZMA 2VG7B 2J9DE 3WC0A 2ZH8A 1P27B 4DPTA 1B0VA 1OMSA 2UUAF 3PW4A 2HSEB 5A76A 5A8RB 1TKTB 1LK7A 4P52A 1W26A 4ZVQB 2HBYB 1MROB 3OR1A 2HHWA 3TAPA 4MK8A 1QAXA 3HFVA 2F4VJ 3H5UA 1IBKF 1X4AA 1UEUA 5KT6A 1RQ0A 2QO3A 1ZZFA 3GMGA 2AX0A 3MPUB 4LIWA 3FEZA 1AT1B 2GA7A 3D1QA 5HP1A 2B3TB 2MKCA 1JQGA 1S9FA 1WACA 3G86A 2I8EA 3CCWA 3J7Z5 4G3IA 4LRAA 3UD4P 5DZ7A 1SC3B 2I6WA 3RYLA 2UXDF 3R6GB 3RW6A 3PIPQ 5IM0B 4DN9A 4FP9A 1DFDA 4B9MA 2E66A 1S9EB 7AT1B 2Z4PA 1N6QA 4KR0B 5EX3A 3LWMA 1T03B 1TUVA 3FQLA 1H7XA 1CC7A 5J2QA 5LMNF 3TA0A 4USKA 1KD1T 3K5OA 1NK4A 3VGTA 5CA5A 3KLIB 1HBNB 1RKIA 1NB7A 4WU3A 5A8WB 4I6YA 3UN5A 3LO3A 2YNHB 4WTOB 2W9AA 4LFAJ 2X3DA 4OL8A 1TKZB 3A3NB 1HW8A 4EWTA 2V4QA 2QG9B 2KZZA 4RWXA 2YKNA 2VG5B 4FF1A 3J7A1 4I67A 1Z2LA 3U1NA 5L1KA 2JRSA 4HHJA 2BMBA 1LFWA 1S99A 1UPMB 4OI4A 3MEGB 3BH7B 3V5RA 4ZIWA 3F56A 3M8ZA 2QA1A 4O3SA 2VB6A 1XIQA 2FIUA 1S77D 2VG6B 3RJMB 5DO2A 4S0MA 4DX6A 4K4XA 1RWMB 3D9BA 4FBUA 2VQFF 2XMVA 2X7IA 3T5KA 1IKWA 3L09A 2HIQA 3QJJA 1NO8A 4TXSA 1ZAVA 2C28A 5F8HA 1WHYA 4F50A 1Y5LB 1YJRA 2DGOA 3IG1B 4OYBA 4DZDA 3W1YC 4Q43A 4OX9J 4B02A 2RQ4A 4KY3A 3CJ3A 4CQ1A 3D1HA 4F0KA 3J7YU 3DRSB 1I51B 3BO3A 1VDHA 2IM2A 1RLCL 1RE1B 2BANA 1RTDA 3K58A 3ZZRA 1CVJA 3SMZA 4ES2A 5GADU 3MPYA 3CCJS 1QSSA 2XYPB 4O3OA 4DUTA 3POTA 4A8FA 3F73A 2JH3A 4KBIA 1RU2A 3IWLA 1S79A 2VBZA 3R5BA 4NOHA 3BZQA 3W5YA 1X4CA 5IXUA 1C1CB 5AE2A 1URNA 1FWKA 1VQYA 4FYDA 1S0OA 4C11B 4C0HA 1F0XA 2YPYA 3HKZD 1UJ4A 4R0JA 2DNGA 4JI0J 2MYFA 2FJAB 3KXDA 4CO1A 3OLAA 2H4YB 1PBAA 1FKPB 5DDOC 2BJ1A 2RKIA 5EWEA 5I42A 1U1LA 2OH2A 1RISA 2A3JA 3KLEA 1DHMA 3M2RB 4DG1A 3G82A 1ZA1B 4J9OA 5ETKA 2VPZB 1LV5A 1UEKA 4B3OA 1OPZA 3PHEA 2QTWA 4TVAB 1RAOA 3MR5A 5I4MA 2W24A 1J5EF 1KSPA 3B4MA 4DCJB
chains in the Genus database with same CATH topology
2DPIA 3H2LA 3K7RA 5C24B 5B0GA 2F1FA 2MY7A 1YJTA 2C22A 3MM6A 3W2WA 2R8JA 1ZPWX 3MPWA 4BS2A 3DMJA 5GAEU 1IN0A 2W9BA 4IO9Q 2CQPA 3THPA 2IRYA 4OX8A 4A8YA 3M1VB 3QJLA 3M30B 1FRMA 1V9OA 2E1AA 4M8LA 4OI1A 5KT7A 1ZZNA 2W4DA 3NCRA 1JXLA 2WSFC 4KQZA 4ZMMA 1YTYA 3BO2A 2JZ5A 3LANA 5JXSA 4CTAA 2BQ3A 1UMJA 4Q0BB 4PG5A 4K4TA 2FVRA 2CQ4A 3ULHA 1REVB 2IRUA 4NLQA 3CIZA 1N32F 5G0RA 4DUYF 1YITS 1IKYB 1FESA 2V94A 1KFSA 4J9NA 4CT9A 2PA8D 4QWAA 2I5JA 1NU4A 1SH0A 1X4EA 2ILZA 3PJXA 4M1KA 1S0MA 2O5DA 2XSJB 3LALA 2ZKUA 2ZVSA 4CO0A 2ROGA 1NHVA 1VK8A 5A6PA 4WJBA 4TYBA 4ECYA 3CCUS 2GIRA 3SDEB 1JXEA 2JDJA 4X62F 4EZ6A 4XDCA 1QE1A 5K8MA 5HBMB 3V81B 4I0WA 1PSDA 2M70A 3HHLC 1WEYA 3LOUA 5DS7A 1QM9A 1KC8T 3SZ2A 5G0RB 3EPIA 3DRRA 4ZPCA 4ICLB 2ZH7A 1UEVA 2UVRA 2KI2A 2HZCA 4DPOA 1X4DA 3VAKA 2YH1A 3K8WA 3BSAA 2W9CA 4RU9A 3TOQA 2Y1JA 1FD2A 2QIFA 3VF0B 2CIMA 5AXKA 2BZ2A 2H5EA 4I6AA 1UFLA 1VRTA 3MMBA 4PQUA 1RDRA 2UUCF 1XR5A 3P3DA 2R7RA 5KT2A 2EVZA 2IJFA 5A0YA 1XR6A 4AL6A 1QE1B 5DDRC 3GWCA 2LXFA 1LW2A 2PEHA 1D8ZA 4I1TA 4KB7A 5D77A 3KK3B 2AGPA 3HFKA 2MZSA 1V6HA 4DV5F 2HQ3A 3NKYA 3NBPA 3MAHA 3PFOA 5EGYA 2GQCA 1G7CB 4BC9A 1JLEB 3RBEA 1U4BA 1NJYA 2B51A 3IWNC 3Q8PB 4K2XA 5LSRA 4I2PA 2VQEF 1S1TB 2MQLA 2UXBF 2L9WA 5K14A 4JI3F 3JSRA 3UW1A 3BQ1A 4ECSA 1R43A 4OX6A 2DJWA 1Y00A 2YWEA 4X4UA 5KG6A 3K57A 4B08A 2JEJA 3MCSA 4MKYA 4PG7A 4KV8B 4Q8EA 4B9NA 3OVSA 4KGMA 1LW2B 2QYCA 1RT6A 3HVAA 4DSEA 1KOOA 1WF2A 2LQ5A 1TL5A 2RJZA 4HLBA 3SXLA 3OL8A 3HVTB 2OSRA 3U27A 1N48A 4J9QA 3GIMA 3LWLA 1I1GA 1Q16B 1ZAWA 2R2SA 3BREA 4X2BA 2CPHA 4RBUA 4ZVGA 3MPVA 4MIWA 3LH2S 3L3CA 2VA3A 1TKXA 1X9SA 1D3WA 2AJ0A 4ZA1A 4JUZA 4ALZA 3I4PA 2DHAA 2NSBA 1S6PA 4Q7AA 5K14B 3RRGA 4F2SA 2R7WA 1S0VA 4F67A 5A2QY 1DTQA 4FS2A 1U6BA 2IMWP 1VC0A 2AWZA 3CDBA 1E6YB 3TUZC 2CQ2A 2V2KA 1IQTA 1T95A 4MIBA 1FDNA 1Z1ZA 2HAIA 4NLYA 2XCAA 4F4ZA 3UCGA 1Q82T 2VOOA 1C2PA 3TX8A 3MECA 1NK8A 1CQNA 2ZHBA 2YNFB 4X84A 5KFPA 2DGXA 4OZ5A 3G6XA 2VG7A 2MMYA 3QIPA 3MD1A 3MWBA 4NLTA 1ZM3A 4CI0B 3KMQA 3CCQS 4RNNA 3DLGA 1SH2A 2F8HA 3HHLB 2V8GA 3HHKA 5A8RA 2RS2A 4Y6IA 1PILA 1TKTA 2NSCA 1U26A 5B0CA 2ZNZA 3MEDA 4NLXA 2ZOFA 2WBRA 3CMAS 1DTQB 3PKMA 3OTDA 4Q2MA 5EUHA 3OV7A 1P1LA 2MZTA 2HNZB 5A6WA 1X4BA 3IRWP 4PXBA 5D3GB 2XS7A 4M95A 2FJEB 3DC2A 4DV2F 2DH7A 4WXOA 4YUDA 1YJUA 3US5A 4OZ0A 1U24A 4KHMA 4OJ1A 3QIPB 4RWWA 4OI3A 4ZP7A 3S7RA 5LT5A 2HWHA 2VV5A 1N5QA 4NPOA 5KFRA 4OI0A 4NCBA 3Q2SC 3KG4A 3GV7B 3DLGB 1SXLA 4X4SA 4GKJF 2CFXA 2AJ4A 2OFGX 2MKSA 4NLSA 4DF4A 2QSWA 3L95X 1RGVA 4I56A 2C2RA 3MEDB 2K3KA 4NA3A 4GO5X 4X4OA 1K0VA 1D9AA 2G4BA 2DCUB 2WCXA 5DQGA 5KFGA 1VQ5S 4X64F 3I31A 3OR2A 4AE5A 2ZFHA 5F8NA 2OSQA 3HKWA 1H3DA 2M0GB 4KTQA 5F3TA 3EPGA 1ROFA 1UJ6A 1IBMF 1VIXA 4IH7A 1NK0A 1XNQF 1FTRA 5J2MA 2XLIA 1VQ9S 1FCAA 4KIAA 4M5DB 4O4GB 4LJMA 1NJWA 1PC4A 2E5LF 5E5NA 1U1MA 2O01C 3MTKA 4FNHA 3IRXA 1GT8A 4OHWA 1VGYA 3VAGA 5EDWA 2QRRA 4ZP9A 2VBYA 4TY9A 5DG9A 1IJFB 3M05A 1RP5A 1U2FA 4Z2XA 5FDLA 2BQUA 1BLUA 1KLMB 3FRYA 4A48A 3NNHA 3N28A 2I2YA 2ASJA 3D0IE 2OFHX 2RB7A 3BGLA 1JJ4A 1VQLS 4YR3A 2RILA 2KYXA 2VZ9A 3O3LA 2XGQA 2KT5A 4RNMA 1QTMA 4K4ZA 1IJEB 2O3DA 3LP0B 1NAQA 2UV8A 4XO0A 1ZPVA 4LF8F 5J2MB 2W7OA 1WHXA 2RRAA 1D1UA 4OIXA 4DS4A 3LAMA 4A8WA 1HQEA 3SCKE 2AV5A 2GV1A 1I6JA 4N76A 3MOZA 2WAQD 4NCGA 2PMZD 1G6BA 1UETA 2YH0A 5ITHA 2OTJS 4J37A 5FDLB 4WXWA 4C2MA 1K0TA 5LSOA 2MZJA 4NLUA 2OD4A 1TFYA 1K9MT 4X4VA 1Y9OA 4O4RA 4RW6B 5K9FA 5F9NA 5KFDA 1DTTB 5KG2A 4N5SA 4X4PA 4F3QA 2KJWA 2RDJA 3GZ7A 1FRIA 4QR1A 1FE0A 1C1BA 4ZCMA 4X65F 1S9EA 4RZRA 1TL1B 3QYYA 3VALA 4RLEA 5DRKA 1HQEB 2P6SA 3GE9A 3N5FA 4U67Q 2ROEA 3IC1A 3H20A 2IBKA 5E0OA 4RUHA 3M9NB 3CD5A 1N4LA 2ZJPQ 1N54B 5K8PA 1GXLA 2EFGA 3KK1A 3BGUA 1Q79A 1A6LA 1FERA 1VS3A 4B3TF 3CJKA 1T03A 3T9NA 3KLHA 1FJCA 2WSEC 5BYQA 4BDPA 2B5JB 4NZ7A 1U25A 1R0AB 2DGVA 4EO6A 1FT8A 4WFZA 2MQPA 1XERA 1C1BB 3CT9A 5C25A 2NR0A 4DQRA 3KTQA 3M2UA 1X4GA 4OJ3A 1KRPA 1HR0F 3GYNA 2DHXA 3DOKB 3IS9A 3KLIA 3SQGB 2ZE2A 5KG1A 2UVWA 4JI7F 1SIWB 2HLTA 3CCZA 3FSXA 3I56S 1HBNA 4QBUA 3Q24A 1F5CA 2B4UA 3FEYB 1RT1A 3QGHA 4DF8A 3KK1B 2YY3A 4KKOA 2RU9A 1PO6A 4IDKA 3CJKB 2IFXA 5KFEA 2DT9A 4RW8A 1HI8A 3KLHB 4LF6F 3KLFB 2YNHA 4HVZA 3ENWA 4I6WA 3T6BA 5LXYA 2B43A 2XCPA 2AD9A 2RQCA 2BYCA 4KT0C 2OJ3A 3IR7B 4ID8A 2V4JA 4OI2A 2ZH2A 2DD8S 1TK0A 2AGOA 2JC0A 2NREA 1NJZA 3AA8A 4NLDA 1HPZA 4ECTA 1RT3A 3HVWA 2A2DA 2BQRA 4LF9F 1SH3A 1JNRB 1Q7LB 1RT1B 3U7JA 5HQ8A 4D3HA 1BWEA 4DX8H 2VG5A 4NA1A 3MGJA 1Q81T 3O5TB 5KFNA 1X0PA 5IQQA 3N6NA 5B0EA 5M2RA 2AYGA 2DGQA 2E5GA 4BCAA 3VAMA 1SL1A 1N5TA 2LMIA 2YX4A 3RAMA 3MFIA 3MM8B 1Q8LA 2K1RA 4ZHRB 3PX4A 3FQKA 1WD6A 2J0SD 2EKYA 4K0KF 1R31A 3IN5A 2E9ZA 2IBOA 2KHCA 1FK9A 2IAJA 2E7XA 4ZPDA 3U1MA 4K4UA 2BE2B 3MMCB 2M52A 4DV4F 1LWFA 3UQSA 2UVVA 3MEGA 1HPZB 2YNGA 5KFKA 2CVIA 1VQNS 3CD6S 3V6DB 4B9SA 3BEGB 2KB2A 3NMAA 3MM9A 4PG4A 3OJUA 3T5JA 1YRTA 2LKZA 2MY8A 1YI2S 3M8PB 3NWGA 4I7FA 2LVWA 2DNHA 2EFPA 2RMLA 1DAXA 2E5IA 3ISNC 2ABYA 5KFBA 4X4QA 2YNIA 1WNEA 3MHYA 2HS0A 1HNVB 4MKAA 3RRHA 2VG6A 1RTJB 2BXJA 3JTNA 2LDIA 2IAJB 2N4DA 4YMEA 4AUKA 2BJEA 1YJVA 3GFHA 3N6LA 2XLJA 3CMES 5CYQA 4F25A 1VQ4S 3MAQA 3TANA 3CB4A 2YNGB 2LQBA 2KHDA 5H9FJ 2CVEA 2VOPA 1LK5A 3CJ2A 2J9CA 3MM9B 1DQAA 1KQGB 1NJXA 3DOLA 1ELOA 4H4OA 4QYRA 4I7FB 5I3PA 1NH8A 4P7TA 4G6VB 2CPDA 2BUNA 3G8SA 2VBWA 2GO8A 3DHWC 4FVMA 2IVFB 3DYAA 3THTA 4RW7B 4WYWA 4JV2A 5T14A 2DISA 1M90T 2ZDPA 2KT3A 5CYQB 3FJ2A 2YKAA 2VL1A 5KFMA 1VK3A 3O44A 3FSYA 2HHHF 2J9EA 3E3XA 5L39A 1PC5A 4YB5A 4X4RA 3FZ2A 3FRZA 4DV1F 5EHHA 3I0SB 3IG1A 3NAIA 2FVPA 3X1LB 2KTQA 3FFIA 2R8IA 4MK7A 3OTEA 4YQWA 3CCVS 4YY3F 1QAYA 4QPTA 4TLQA 1FDAA 2PI5A 5DM6Q 1HI0P 1H38A 4GC6A 1FRHA 3UFCX 1DRZA 3KK2A 3I87A 4ZK7M 1TL3A 5KT3A 2VA2A 1B0TA 3K59A 3C46A 2DCLA 1G1XA 1UVIA 3MMAB 1N52B 2HHQA 3DRSA 4UOCA 4KHPF 3NGDA 2HVIA 2BJDA 2KO1A 1H2VZ 4URGA 1S76D 1UWBB 2NPIA 4C8MA 2A10A 2OMOA 2XWXA 5BYSA 4FN5A 2PO4A 3OTCA 2DNMA 3HXMA 5LSLA 4GKKF 3PFEA 4H4KA 3TVYA 1RTHA 1SQEA 3I96A 4MMOA 2WOMA 3HLUA 3VZHA 4LF5F 1JLAB 1T02A 1RAJA 2C42A 3PW2A 1GAOA 1NEEA 2HW3A 5F8JA 2G13A 2DR7A 2FPHX 3D54A 1WF1A 5J2PA 4O3RA 5JVGQ 2VODA 4YHHF 2YKQA 5JVHQ 2ERRA 3T1YF 1S1XB 2VKRA 1UP1A 1L3SA 4DLGA 1ULRA 2MQMA 3CCSS 4C8ZA 1JIHA 2NPFA 3GG0A 2YKMB 1EETB 3ITHB 3CCRS 2B4VA 3DOMA 2EG2A 2D7SA 3DRPB 2V4RA 3SV4A 4DR6F 5L1IA 1YJWS 2GFFA 4A8OA 3MEKA 1RTHB 1FHTA 1N88A 4NL5A 4H54A 4DSLA 5FIIA 3DN9A 3OBIA 5K8OA 1F60B 4HH0A 4ZP6A 3O1LA 4DFKA 2FHJD 5DG7A 1HBOB 2QMXA 2XEXA 4LQ3A 2KJVA 1C1CA 2OPQB 3SFUA 3OHBA 1YWXA 2XY5A 2GHWA 3F41A 4XDDA 2P9CA 2JEFA 2WB1D 3RB3A 3I55S 1S48A 5DM7Q 2XNRA 2XZWA 4ECRA 4J9SA 4UUXA 1X5TA 4H4MA 1KTQA 1VBXA 1FRKA 4FF3A 3DI6A 3OFHA 4C11A 4TYAA 5DLGA 3V4MA 2DNKA 2CJ9A 6FDRA 2I1RA 3LW5C 4HKQA 1QAJA 1T05A 2JVOA 2QFJA 3LP2A 2W8KA 5AJ3F 2LEPA 1H98A 3OQ2A 2YTCA 5KFAA 2CQDA 1UFWA 5HN0A 2APOA 1KNZA 5D4LA 2VFRA 2LECA 2AJQA 2CQCA 2J9DA 3G9CA 5IT4A 5F8IA 4DJBA 5L1LA 4MIAA 4QWCA 4IO1A 1UJ5A 1NK7A 4XK8C 2AU0A 3H5XA 4C3MA 1U48A 2QEXS 2VC0A 3G8TA 5F9LA 4HI1A 4EBDA 2O66A 3C6TB 5J2NB 3GV5B 3H5YA 2M9KA 2ASDA 3KNGA 2UXCF 3PO4A 3IA0A 2EW9A 4ELTA 4PXDA 5F8MA 1L5UA 3W2VB 3H98A 3FCHA 4Y0FA 5SZTA 1SJRA 2M7SA 2VFVA 5GAHI 2K7KA 4O3QA 1KEKA 2C2EA 1H6KX 4DHVA 2WK4A 1T7PA 2E1MC 5BJRA 3Q8SB 1TK5A 1H2UX 5B08A 4YEAA 2QLWA 3M9MB 4ES1A 5DGBA 1NKEA 4ZVHA 1MW7A 5D4OA 4N56A 2XHWA 3T9ZA 1WWHA 2XMUA 2C3PA 1NK9A 3SFGA 2JX2A 1Q78A 4ZVFA 1GH8A 4X4TA 1HBMA 4PUOB 2XBPA 2OP5A 3OFEA 4IFYA 2XLKA 1R8PA 3QZ8A 5C42A 1HQUA 3GYXB 4TU8A 1ZAXA 1JLGB 1G3OA 2BACA 2CPYA 3OPKA 4F2RA 3OTOF 2D1CA 2HG4A 1YRXA 1RT4A 3FNNA 3KG0A 4LSNB 4A4JA 2PD1A 1R6YA 1YVFA 4OQJA 1IKXB 2AYEA 3C6UA 1C0UA 2ZUGA 3B78A 3D5MA 4O23A 3Q22A 3R5AA 1AFIA 2B6AB 4ZCKA 2E44A 2YVSA 3NG8A 3ZFVA 2FHJA 1F5BA 2FJDB 5C24A 4I2QA 1L3UA 4ERDA 1Q86T 2E9RX 2DGWA 1HBMB 3IR5B 1TK8A 5CD4H 2VUGA 4N47A 4BWJA 4C8KA 5HLFB 1RTIA 5I3QA 1U8SA 1M5OC 4ZS6A 1HQUB 4CO5A 3BB5A 4RNOA 2D3ZA 3AA9A 3QWUA 3M1VA 1RT4B 3CDAA 1OSDA 1Z2ZA 4YP3A 2Q6BA 2FLNA 3M30A 1VQ6S 3C6UB 3QZ7A 4U7CA