3DGDA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
molecule keywords Transthyretin
total genus 27
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3dgdA00
1X7SA 2B14A 2FLMA 2G4GA 1X7TA 3DO4A 3CFTA 3IMUA 3KGTA 4N87A 4PWGA 1ETA1 1IIKA 1TSHA 4Q14A 2QGEA 3CN4A 2GPZA 4IKJA 4Y9FA 5CR1A 2H0FA 3CN0A 3ESNA 4IK7A 5FW8A 5DEJA 4PWJA 1ETB1 3IMRA 1Y1DA 3DJTA 3CFQA 1E4HA 1FHNA 3DJSA 3FCBA 3GLZA 1BM7A 3DJRA 1DVTA 4QYAA 3SSGA 4PM1A 4QXVA 5FW7A 1DVQA 4MRCA 5FO2A 3A4EA 3GRGA 3IMVA 1IIIA 4DEUA 2G3ZA 3D2TA 3BT0A 3OZLA 1TTRA 3P3UA 4FI8A 1SN5A 4HISA 5CLXA 2H0JA 2G3XA 3M1OA 4IKLA 4TLSA 5EZPA 5CM1A 1F41A 3ESOA 4PWKA 5L4MA 1FH2A 5AKVA 3IMTA 4N85A 3CBRA 3GS7A 1OO2A 4TL5A 5DWPA 3I9PA 3GPSA 4Y9BA 3D7PA 4I85A 3QVAA 4ABWA 3DJZA 5HJGA 1GKOA 4HJUA 4ABUA 5BOJA 1IE4A 4YDNA 2H0EA 3BSZA 4TQ8A 5CLZA 2ROYA 5E4OA 3P3RA 3FC8A 4HIQA 1TYRA 3GS4A 5AYTA 5L4JA 3U2JA 3CN2A 1KGJA 2ROXA 3DK2A 1F86A 2H4EA 2QELA 5AL8A 3IPBA 5FW6A 3GS0A 3CXFA 5CNHA 2FBRA 1E5AA 1ZCRA 3NEOA 4DEWA 1U21A 3CN1A 2NOYA 1G1OA 1DVXA 1TTAA 4IK6A 4IKIA 1ZD6A 1GKEA 1TZ8A 1Z7JA 2QPFA 1E3FA 3DK0A 4WO0A 3HJ0A 5CN3A 1TFPA 3IWUA 3Q1EA 5JIMA 3DGDA 4TNEA 4TNFA 4L1TA 5L4FA 3DIDA 4DESA 4TQIA 4N86A 4TLUA 4TLKA 2B77A 2B16A 4D7BA 4ABVA 4PMFA 4TL4A 1BMZA 1TLMA 2F8IA 2TRHA 3IMSA 3NESA 3OZKA 4FI6A 1QABA 2G2PA 3P3SA 4YDMA 1SN0A 5L4IA 3KGSA 5E4AA 4AC2A 1TT6A 1TTBA 2G4EA 2TRYA 4TLTA 3ESPA 4L1SA 1DVSA 4PWFA 2WQAA 4TM9A 2H6UA 3W3BA 5A6IA 1THCA 4IIZA 2IGLA 1RLBA 3A4DA 4PMEA 4TQPA 2G5UA 4PVNA 4QRFA 4MRBA 1DVUA 1SN2A 2G9KA 1BZEA 3A4FA 3I9IA 5E23A 1SOQA 1IJNA 4TNGA 4DETA 5IHHA 3B56A 3TFBA 1BZ8A 4PWIA 5JIQA 5AKSA 4IKKA 5AL0A 3TCTA 2F7IA 2GABA 4Y9GA 3KGUA 4Y9EA 5EN3A 3GRBA 1QWHA 4DERA 4KY2A 1BZDA 2G2NA 1SOKA 4HJSA 4TQHA 5CLYA 4ACTA 4Y9CA 5JIDA 5AKTA 2QGCA 4WNSA 4TKWA 4PWHA 2B9AA 1DVZA 4ABQA 1TTCA 4AC4A 4ANKA 1THAA 2PABA 4I89A 3P3TA 4HJTA 3CFMA 1KGIA 3IWVA 4MASA 5TTRA 1ICTA 4WNJA 3CFNA 2QGBA 3NEEA 4PVLA 5K1NA 4PVMA 3NG5A 3IPEA 4PWEA 1DVYA 5K1JA 3NEXA 3I9AA 4I87A 2QGDA 2B15A 2H1XA 4FI7A 3U2IA 3CN3A 3IMWA
chains in the Genus database with same CATH superfamily
2BSTA 1BM3H 4DPRA 2IWEA 3I2CL 4OGYH 4FNQA 1DJIA 2X05A 2P24A 1TJIL 1Q0YH 2NY5L 3A47A 5KZCD 2IFGA 2QQNL 5CO1A 4BHUA 2A77L 3QZPA 5DD3L 3VFTB 2Z4QA 2AEPL 3FFOA 1CLYL 1UH2A 4AKOA 4FMFA 2JF1A 2PTTA 1J0JA 3DOHA 4MD4B 1Q72H 1I8LA 2VE6B 3UX9B 2M83A 1MN4A 1NMBL 2CKBL 5F96H 4HUXA 4XP4H 2AK4E 2FJHB 1JZ7A 2OMYB 2C7UA 3HC3H 3UAAA 4AEFA 4K5OA 4V1DE 1D7CA 4P5TA 5JQ6H 1GS7A 3ARFC 4OJEH 3S34H 1M57B 2PP9A 2FZ3B 1A47A 3RX5A 2TSAA 3KS0J 3NH7H 5BZZA 4CL7A 4LBAA 4KH9A 5I6LA 3NN8B 1CD0A 2OMWB 1NCIA 4A68A 4BFBD 3LRSA 1R3LA 1N4XL 3V0WH 3SE9H 2IPKA 1E5AA 5I5MA 3DVGB 4HW6A 2BHYA 2Y06H 3UTZB 3NEOA 4GUPB 5DD3H 1K6QH 1F2QA 3I9GL 5JMOC 1L9NA 2FQEA 1OTTD 4JO1H 2F7PA 1R17A 2E7HA 2VITB 3BGMA 4Q6KA 2W1NA 4CGTA 5BO1L 4XMZA 2I7SA 3DUUA 1TVHB 4ONOA 2GUOB 4AGOA 1XH1A 3MJ8A 1CDYA 1MAKA 3V4PH 3V4VH 3MRHA 1N5YL 5IK3B 1CGUA 4ZTOL 3HR5B 1MHEB 1NCWH 2VERA 5SV3A 1PLAA 2R69A 2WQSA 2A6DA 3ARDA 3TA3B 2P47B 3EJYD 1KCSL 4NZFA 2XQYA 1G6VK 3IPFA 4K9EC 4ZAKC 2WWNA 2C1OB 1HILA 2P7TA 2X10A 2FX9H 3VFOB 1I9RL 4Z23A 3ZHNA 4DKEL 3DETC 2JXMA 1LEGB 2VSMB 3MQIA 1IO4C 3N9GL 4JN2A 1NAML 5EO0A 1DQMH 4GKSB 2F74A 2W59A 2IQ9H 4U4BA 1I1FB 3NRFA 5H94A 4OD2B 5D1ZD 1HCZA 1KFGA 1RI8A 4QMEA 2NSXA 25C8H 3HG1A 4FLRA 5EU7E 4PRHE 3X13A 4F58L 2R2EB 1T80A 4XXDB 4IRSC 4OLEA 5DRXB 1XGRA 2W9DH 5C09D 1IVTA 5CGMA 4H4NA 4FGMA 2BSDA 2D7TL 3D0VA 4LVEA 4I89A 4X50A 5E8EA 2KS0A 4NC2B 1YN6B 1W72A 1EHXA 1SJVA 1XO8A 1RIHL 2WVTA 1ZVYA 4HV8A 3U9UA 3ULVD 4HK0B 1DJHA 2EACA 4NJAH 1ITBB 2OPCA 4PHXA 3CFTA 2NXYB 3DGGA 4TSAH 3ZR6A 1JHKL 1KG0B 5FUOL 3QJQB 1UVQB 4OI8A 2ZICA 3BAYA 3MV9B 3C08L 3IEAA 4FP8L 2JQAA 1FHNA 1MHPL 3IRCA 4HSAC 2UZYA 3MBEC 2DTML 2I5YH 3O3BA 5EU6A 5I75C 4MB1A 2ADIB 2BIOA 1R24B 3BGFC 1CFNB 3AS2A 4RNRA 1E2ZA 1WSST 4N2DA 4IEFB 2CH8A 3IGUA 1A1NB 3H0TB 4ZO7A 2VLKB 1F00I 3FONB 2J6EH 1G7HB 3ZHDA 1S7QB 3SY6A 4YHZH 4MDIB 2WPGA 1LEKA 5EIIB 4ANVA 3F7PC 4MNGE 4QJ5B 3UP6A 3K2UH 3VQMA 3OMNB 4HCFA 3VFOA 3WXWH 4IRJB 3ZDYE 5GJTL 2DWXA 4JO1L 3CSFA 1YPZA 5TE6H 4LF3B 2EUWA 1TMCB 1OGAA 5G4MA 4YHIB 1T7XA 3TT1H 3PAVA 1I1CA 4GLRH 5LQBL 3G7TA 5T1LD 3ZKSD 2VXQH 1ZXQA 5PAZA 3RDTC 2GKIA 5A2CA 2UVEA 5LGHL 4F1ZA 3M1BB 1IVLA 1IFHH 1UKTA 3FSOA 5F1KC 3ALPA 1BEXA 1JI2A 1S3KH 4G7VH 1MPAH 5E5MB 2K70A 4IJ3C 4XP4L 4O2EA 5GS0L 1CICD 1OGSA 1RUML 3RWIB 2LLNA 3RUGB 3RPBA 2D0FA 4LOVA 5TDNB 5SX5H 1HIMH 5AZ2H 4Y16A 4HFWB 1FZJA 1FZOB 1DDHB 5EDSA 1LJMA 1UEMA 1WF5A 3SY0A 1HH6B 3L7EA 3L7EB 4M6OH 1I7ZB 5G4OA 2HFTA 4KMQA 4J3OC 1IGTB 3VFGH 2IAMB 3QR1A 3S34L 3ZQWA 1N3NB 1TTCA 2XN1A 5EUOE 5D2LF 3UTSD 2F1BA 1W6WA 3V8CA 2Z92A 1I4FA 4P2QE 1QR1A 2MOGA 3JV0A 3VXTB 3IBEA 5DUJA 4AQ1C 4DTGL 3BW9A 2VN4A 3D18B 2EDJA 4YUEH 4FNLL 4FJZA 3DURB 3RZCA 2CIIB 4UQBA 2Q7YA 2VLKA 3AY2A 4L1DA 4IMKC 5I66B 5DEJA 4JS7A 1W8NA 1MCWM 3VFRA 5DEFB 2UYLA 5EEUA 3MXVH 3SODB 4ZXBC 4Y7OC 1A66A 2B3RA 1BOGA 1ZS8B 5C0JB 4HH8A 2PO6B 4OLYL 1G5AA 5KEZA 3GMPA 1MCSA 1UB5A 4P2OC 2R29L 1A65A 3LNFA 4LOUC 3K72A 3U7WH 1IQWL 3GSOB 1XGUB 1OSZB 4UQDA 5IMOB 4BH8B 2W65B 2WVVA 4PRBA 5AB9A 2H2PD 1LEIB 4WFGE 4IDLA 1KIUB 2YJQA 3BEWA 4H8WC 1N5AB 3MLZL 3BEWB 3MJ9H 4YE4L 1TZGH 5FM5M 5KVFE 3E1F1 4JLRB 3MV01 5CEZH 2OULB 3IT8D 3KYAA 4P3WA 3JQOB 4HIEB 1MCKA 2VXVL 3DHPA 2Q9OA 4D9QD 4TTDC 2XXCB 2WAQA 3CN1A 3WKYA 1KCSH 1NUFA 3BWSA 1V3JA 4OCWL 4TSCL 1EHLL 1QSFE 3KL0A 3NQKA 4DKAA 3V10A 2WLIB 1I3GH 1PQZA 4HUUB 5E1IA 4G71B 4N9OB 1HEJC 3EDKA 4XPAL 2FATH 5LLIC 1ILUA 2LTQB 1UWXH 4PWFA 4FQXD 4HKZB 4UIKL 4K3JH 4NPJA 1EAJA 4PJ9C 3C8HA 5JQHC 3K4AA 4MYPA 2EEFA 4PD4K 2GG1A 4XNZC 1JSYA 4KQ4H 5D7EA 3AQZA 1P7KA 3TH2T 3WN5B 5CCJA 2DWTA 1N2RB 1U2YA 3CX5K 3ETSA 4WIQA 4HFWA 3D8MA 5DZ9A 2Q7YB 4KJWD 1FZOA 3CH8A 1HQ4A 2F15A 3K1DA 2XIDA 5FKPA 4MVBD 1LD9B 1IGFL 5GGVL 1GW0A 4U6VL 4FQ2L 3RB5A 4M7LT 3A23A 2YBGA 3I6LD 4MJ4A 1ITCA 3RWFA 2VDNH 2A6IB 2I60L 1IGFH 2DH3A 2V3EA 2LGNA 2OQJB 2VXSL 4XPHH 5HYSB 3BIKB 2NY3C 2BM3A 1FAIH 2OTUB 3TC9A 2AQQA 1LTXA 2H6PB 4LSRL 4PJ7A 3WNLA 3ZHLA 4XN7A 5HHNA 4Y5XA 1UZGA 4Q6IC 3EJSA 2BOBB 3EJRA 5D7IE 4MHHI 1SFHA 1W2KT 3N85L 3W9DA 5FW8A 1UA7A 5AOKA 4C57C 1WBXB 4AIOA 3GIVA 2YEZA 1CIDA 4TNVK 3CFDA 1JF5A 4HQQL 3ZE0B 4A7GA 3ZTNH 2AP2A 1CFQA 2YQ3A 1QPXA 2W9LA 5JPMC 1RIUH 4ODTH 4BK5A 1ZHLA 2YZ8A 1MCIA 5D6CB 1TQCC 3OG4B 3HRZA 2XG5A 2WYIA 1NJ9B 1KY6A 1MZZA 4F37F 1AC0A 1MLCB 1JPST 3UEQA 1CT8A 1IAMA 3CVDA 5CEZL 1KEML 1EXUB 1LILA 3VFPB 3R4DA 4E9SA 2WYZA 4MD0B 3R8BB 1PCXA 4Z0BH 2WOBA 4HIEA 4YHNA 4DEWA 3FB7B 1N26A 1AS8A 3SKJH 1FGNH 4RDQG 2JCCF 4MJIB 3RAJH 3VI4E 1J0KA 1SZNA 2G0LA 5I6OA 1GKEA 2GIMA 1YECL 1J05A 3LZPA 1TPXC 3VE0B 3AUWB 4OQTH 4QWWD 2WTOA 1JPTL 4PMFA 1VFOA 3NVQA 2NT0A 2ZCKH 2DRUA 3B3IA 1NC2A 4F9PA 1G0XA 3HMXH 4V33A 5A2AA 5JW4M 3HG1E 3JWDL 3UABA 3GIZL 3IS0X 1GTNA 4XVUD 2NY0D 3F83A 2WUBH 9PCYA 2IOIA 3TTYA 2NDFA 1E4JA 3LKPA 4UB0H 3U4AA 2DQIL 5BOZG 2V3DA 5ANMA 1OLLA 5BV7H 3HUJE 2O5YL 4MFHA 5HDBB 5J5EA 1BZDA 4NP4H 1B0WA 4XZUB 1XF2A 5AAMA 5FKAB 3FQNB 4NKMB 4OGXL 4R90L 4NAJA 1RSFA 2AQSA 2YS4A 3PCYA 3PDGA 5C0NC 2ZOUA 5EEYA 2MQCA 2YEZB 2EC8A 3CVHA 1LK3L 3F85A 2WCGA 3VFGL 3V55A 4XGZB 4DCQB 1XT5A 3T4AA 1OTTC 3S8WA 1FBIH 3LS5H 3P0YL 3D3VA 1JMXA 4POUB 4DP2X 4FXKC 3BYTA 4LPCA 4OZFG 3V8OA 4GQ9H 5E9NA 1E0OB 1WWCA 3KPRA 5HHNB 3U7YL 5K9QG 2G60H 4ODVL 3TA3C 4M8RA 2PP8A 4ZS6C 1FE8L 2JB5H 5T5FA 5C2BH 3JV6A 1RMFH 3Q5YA 4MNHA 5D9SB 2VGLM 4MZ2A 1Y1DA 4WWPA 1E4HA 1NWOA 3NJKA 4F3FA 1T20B 1W0YT 3DXAA 4P5TC 1AZCA 1ZV9A 3L4CA 2XWTA 1EK3A 3ABGA 4K55A 3VU2A 4BUHA 2NLJA 2AJSH 2H32B 4R4BA 2BSRA 2EZ0C 4JFXB 2JELL 4BWTA 4OD1L 3GRWA 3L45A 4NKIH 4JRXE 1C8QA 2R2BB 3FTGA 2XN2A 5FYLE 5I5JA 3FOMA 3B7RL 2GJ6B 2C4FT 4XO3A 4NAMA 1QSFB 2ZUUA 5AVUB 2XQ0A 3BFWA 4MXQD 4YDZA 4R2GC 2GVYA 4WJ5B 4QOKA 3AGVA 2ATKA 4Z7OE 4X6BB 4WU5A 4OLZL 3I75B 2H4EA 5E0QA 4FNUA 4LLAA 3U46A 2XN9D 1U93B 4KX7A 2VDLB 3FH5A 5DFTA 1PZ5B 1G7PA 2J1YA 1T1YB 1ZANH 1ES0A 3TV8A 3GSUA 4XPTL 1NCJA 5HYJD 2ZP9A 5FHAH 1HL4A 4PW9A 1ZLWH 1MIMH 1I3RA 3IWUA 2WCPA 3FF8A 2NY0B 4PJCA 4QKTA 5C0DA 5KS9B 2B16A 3KPSD 4N2LA 1O6SB 1MIEL 2BXZA 1A0QL 1GC1C 3MBWB 1MRCH 3JSSA 3MNMA 1XMWA 3UBHA 4HQQH 2XQBH 3DPBB 4JJ5A 2P5EB 1H15B 3BH4A 2ISDA 2HJFB 3RIKA 3UL4A 4PP2A 5DDHB 1OY3B 4WFGD 2ITCA 4RDBA 4UAOC 1MCQA 3ZDYB 3ETTA 3T1FB 3N85H 3T0EC 3IDGB 3T8XB 3BJLA 3SDAD 2BDNH 3F58L 2ITDB 1IQWH 2Q7AA 3QPQD 3U36A 5EUOA 3WEXB 4L4JA 2JCCE 1BECA 1U41A 3QWQB 3WN6A 4FRWA 3RVUD 4PRNB 4PJ5A 3NABH 2HFEB 2X3BA 3ULUF 5JR1H 1BQHA 1LE5B 5HJ3B 4GH7B 1UUNA 3O2WL 1IE5A 4BRVA 2B1OA 2R27A 4EI6B 1AO7A 2GJRA 2HT4C 2GSGA 4L8DB 2WBWB 5C0CB 4IIQB 2YFNA 3TZVD 1YEFH 3O8XB 2Y7LA 4PLJC 3CSTA 4LLMA 3II2A 3DTUB 4PWHA 2V5YA 3BUYB 3OBAA 3I6KB 1WAAA 1YEIH 1NPJA 2BCMA 2QADC 3SO3C 1EJOH 5GSRA 2NTFB 4OGZA 3RFZB 4HEME 1RUPL 2NTFA 3VYPA 4ALAC 1GS6X 3OZ9H 2R2HB 3D87B 3MV9D 4ELMA 1ID2A 1T1XA 4MNQB 4UM9B 1BPLB 1TO5A 4HIIB 4HWBH 4JR9H 5E4EB 3QIUC 3T08A 4FFYH 5B7FA 4APQA 3HI6L 3JUZA 5LCVL 3QJZA 4XWOD 5K1VA 2OX5A 1XF5A 3BVDB 1F2XK 4U1GC 2OL3B 4LESA 4CJ0A 4WW2A 4MNHB 4NKOB 1KJVA 1W91A 2OP4H 1FWXA 1KCUL 3FMGL 4QHKJ 4ENZA 1MRDH 3KNBA 1C7TA 3UJTH 1M05B 3VTTA 4WTWA 3U46B 1U3ZA 4UTBL 1NEZA 4MRCA 2MRYA 1BOYA 4PUBL 4WV1B 5FO2A 2XTSA 1KGXA 4FL4C 1SXNA 5KVDE 5FF6A 2C9QA 5J12C 3U0TB 3WFCL 5J0BA 2X87A 4UTBH 3JTTA 1EDHA 2OW7A 4L9LA 3H4HA 3N44F 5I74B 1T22A 35C8H 5T1KD 2VDLL 5BMFL 5DHVA 3B6SB 5T3ZL 4S2SB 5C6WH 4B9JA 1A7QL 2EVGA 2GY7B 3FQXA 4OFQA 3RWDB 3FQXB 1UD8A 2F7QA 4Q4EA 4KHXL 4OCXL 2HKFL 2FHFA 1CBVL 1UACL 4YFLI 3CFUA 1JCVA 4WWID 2KZBA 1Q9WB 4NZUH 3C6LA 1RXLA 2CNYA 3HPLB 2NR6C 4I3SL 1ZLUK 2CKBH 4IJ3B 5JHDB 3HI5H 4ONGL 2GC7C 3QYMA 3C6SA 2H8PB 2IOMA 2B77A 3R1GH 2DL2A 4EN2A 2HUHA 3FU9A 4RSVA 3CC5B 4BE6A 2HLFD 5GS1B 4QRTB 1CF1A 1TZIB 4PV9B 5J56B 3BN9C 4LLMB 1YQ2A 3VD7A 2C7FA 1URLA 3BAEH 3OKKA 4ZX6A 5E2VL 4UNVA 2CMRH 3QQ3A 4XOCA 1T7WA 3APNA 4TUJA 1BZEA 2A1WL 5E6IA 1QHPA 3L4VA 2IDSA 1R47A 4BSWB 1L0XA 1F4AA 1OCWL 2DY2A 5IHHA 5DLMH 3AXHA 3HAEB 4PRNA 1PJ9A 2FQDA 1QWHA 2PPFA 2ZWSA 4X7FC 2QPUA 3KJ4B 1G9MH 4TN9A 3VDBA 4NQSA 2WXRA 4RGND 3THMH 1UADC 1EERB 3RZCC 4TSAL 3C2SA 2UZXB 1CDIA 3FT9A 1VEPA 1Q0YL 2NY5H 1E27A 4MA3A 1T66D 1PG7H 2EC9U 3JWNE 4IOFD 1U8OB 4OCRH 3ULAB 5FOBB 1WFTA 1ZTXE 3MRRB 4NHCH 3ZXAC 1UWGH 3TJHC 1P7BA 1X5YA 1AXTL 2C4FU 3N42F 1KLFB 2TAAA 2VKWA 1YYMH 4KKZA 3AREC 3CZGA 2P80D 3MGAA 2Q10A 3ABLB 5CIPB 3T2NL 2IQAB 3GXFA 3BE1H 3CN0A 5C08D 2NSQA 3UCRA 4PG9A 4HSQA 1QBMH 4HD9A 1RURH 1INEH 1BM7A 5LKNA 3CXHJ 3ZZSA 4K9JA 1G9NH 4WSKA 4DF9A 2EECA 2AJVL 3C60B 1N6QH 3LTVA 1F5WA 3TBYB 2R0LL 3EYQC 4XE0A 5F44A 4W4NA 1CG9A 4B6ZA 1KJ2L 2QVMA 3DHJA 2CIIA 1MUJB 1VLXA 3HHSB 2YAHA 3O6KL 4NFBA 1IGJA 4D7PA 1KCLA 5KSUA 3UBXB 2J8OA 3VA6A 1KG0A 4UDUA 3TFKD 1DSWA 3TBTA 5T1MA 1RZGB 4EQ2A 4J3OG 1H8NA 5C7XH 1CPUA 4WO4C 4ZTPL 3ZSTA 5I6KA 3X2QB 5JXED 3K6DA 3BKJL 3LH2L 1CICA 2AK1H 3O3EB 1FC1A 1H3XA 3Q2VA 2VW7A 4LAQL 4EN3C 4M43H 2G0KA 1DVXA 3L4UA 5AUMA 3ZDWA 4HUWA 3HPLA 1SVCP 4NRZA 4J4PA 5EF3A 2EE0A 1S8DB 4LIQH 4QRQA 3L3HA 4FL4B 2R39A 5IFAH 3VGHA 3EJCA 1R9FA 2EIEA 4XX1G 3MLTB 5FYKL 4F24A 1UOWA 4FZEL 2Q87A 3VFUA 5IGXL 5T1LB 3H2WA 4EDWL 4Y2DA 3G6DH 1KTJA 1NMBH 2FH6A 4TNGA 1DO6A 4IHOA 5DGRA 4PWIA 4NHUB 3EOTH 5I9QC 1NFDA 4W9CC 3LNEA 2QR0B 4NHUA 4I3GA 3O2WH 1P84K 3B2VL 4XMWA 1V7MH 2QV4A 3D3VE 5D1ZI 1G9NC 4PIBA 4R7LA 2XKUA 4WU7A 4ZYKB 3VUAA 3FCSB 4FQLL 1FJ1A 4Z7OF 2MWCA 1ZVSB 2FK9A 4KROB 4XMTA 5EU5A 1RZ7H 4DQOH 4C4KT 1ASPA 4R4ND 4Y8AA 1E9PB 1ETZA 3RPIA 4ATTA 4OGYL 1ZHKA 4Q6IA 4YPGB 4WKZB 1A1OB 1FCGA 2HTLD 3DO7A 1KGIA 3ECWA 4K4KA 4RAHA 4HIPA 1EHAA 1HE7A 1NCBH 3EXJA 3VVWA 1FYHB 5FCUL 4ZOBA 3NJLA 4IIQC 3X3FH 3CHQA 1GZPB 2AJ3A 1YVLA 3ZU8A 1JNNH 4LRIA 3IDMB 4FFWD 3DO4A 1GYUA 3FW6A 1DFXA 2NZ9C 4G6JL 5FGRA 2R7EB 4KKLC 2EDLA 1TEGA 3B9KB 4FQQA 4J6RL 2OSWA 4NFDA 4J5VA 1CLOL 4JFZL 1DBAL 5FUZL 2NY2C 3NTCH 4JQIL 4G8GD 4A7SA 1L9OA 4Y5VA 3V6OA 3N55A 4EBQL 4FYRA 3AT9A 3P9MA 2IANE 5D70L 4KJQD 4FDWA 5HHMD 1P7QD 1XGUA 2F8VA 5JR1L 1BFVH 2ESVD 3DROA 4HOWA 4OM0L 1V10A 4UT6H 4PGBB 2LABA 4N90D 2F5AH 3D6GA 1IC4H 4QY8A 2WC7A 1ED3A 1I8IA 3DX3A 4DEPC 3I85A 2OCJA 5KAQF 1OEZW 1AMXA 1LE9A 1KJMA 2KUTA 3SPGA 1KXQE 2VZOA 3ARZA 3A6CH 3EG9B 4JZNA 4JG9A 1S9KC 1RK1A 1VACB 2F1EA 2RH0A 5CNHA 5AQ0A 4BFJA 2HVJA 1BLNB 2B4CH 4LP5A 2AGJL 4MSWA 1U21A 5DD0L 5E8NB 2HB0A 2FLBT 5D1XC 2EIJB 3U82B 5J1AA 4DFHA 4M3JA 4JDZB 1U30A 3MJ7B 4D9RE 1URIA 1PKOA 2DIBA 4ZFOB 3TPKA 1EGJL 5B3JF 2H26A 1Q38A 4KFZC 2WMPA 3IMSA 3T2QA 3WU1A 1F90L 1NC4D 1NEPA 1NWPA 2C9XA 5D1QE 3BQUA 4Q6IB 4YPGA 3UO1L 5ADPH 3IDIB 3DBXA 2X6BA 2EC9T 5EEXA 3L54A 3KYOB 2CPUA 2DDQH 2WNXA 2YXFA 3E8UH 3KLAB 4DFIA 4YHYC 3NAAL 2XWJB 3KJ6H 3MRIB 5E7BA 1J9CT 5FA3A 1JZ3A 3MRGB 4W70A 1U0QA 1CD1A 3BDYL 2A74A 1L6PA 2OMTA 1GZPA 1Z3GH 1NFDB 2AJ3B 2BFGA 5KOMC 2OW6A 1NMAH 3QAZC 4I18B 4OF8A 1FZJB 3FO2B 4BQBA 1AD0B 1GGCH 4PBXA 5F72S 4RMSA 3VH8G 4JFSA 3IKKA 1EVTC 3MRFA 4F7PB 1BPVA 4GRWE 3FB6B 2HVBA 3ML8A 3AVEA 4WI4A 4IBQA 3NJVA 1E40A 1D5MA 1YEDA 3E2HB 3UZEA 2J3SA 1PAZA 3CK0L 2Z92B 4KHTL 4FLSA 4U7KA 4DW2L 4ZMQA 3AQXA 3RRQA 5HDQL 4ELDA 4Z5RA 1NOLA 4K7PL 3QORD 3V4UL 1T5KA 3F7KA 1KJ2B 4MMXA 3WSQH 4Y5XB 1N2RA 3FS9A 3BDXA 3TH4T 1V3MA 3WHE1 4BDVB 3QS3A 1EEZA 1W8EA 2FLMA 5AVTB 1ODAA 5DXWA 2K8QA 4R5TA 4M48H 1QA9A 3WL9A 3ZIYA 4UM8B 2IF7A 1GGBL 4S1RH 2EDWA 3UPRA 3NJJA 4YC2C 4MNQE 3I02B 1HXMB 1K4DB 3CX2A 2AEQH 1XL6A 3X11A 3SDDB 2JTDA 5E8NA 1OE1A 4L29B 4U4IA 3KWUA 3U9PH 1OIOA 4MAYD 1O7VA 1E8XA 5JA9A 1YEGH 1H0DA 1D5XB 3LKRB 4QLRA 1M7IB 4M6NL 4X9IA 5F1IB 1QTSA 1OLZA 1H8LA 4QY8B 4KNUA 3OJVC 1KIQB 4HKBA 3BZ4B 4ZK8A 4K7PY 2OI9C 3HE6B 1MCWW 3FTUA 5C86A 4P2YA 1G7QA 4GFXA 2ICEB 3S5LB 2J5WA 3SN6N 3W81A 2E7DA 5CILL 3EADA 4GKNB 5E24E 4MCZA 5DUBB 4ISVA 2N7SA 2X9YA 4P5RA 4P9HL 3SGJA 4ZD3H 3K5RA 1DUYA 1OAXL 4MJIA 1RZJH 1DUYB 2BJML 2NNCA 3JWOH 1F8TL 3TX4A 4KK8D 1OW0C 2ZOWA 3X3GH 2A9DA 1BVNP 1S5HA 4NZTH 3BHBA 1M7DA 4K9EH 3VG0L 4X99A 8PAZA 3IJ8A 4N86A 4N1EA 3RL1A 2W5PA 3UG3A 1JIBA 2PWHA 1NGXA 3O0LA 2JB6A 2CU9A 5HHQA 3IJHA 1DE4A 4MJ5B 4MA1B 4GG8B 4Z0XB 2CCWA 2DMGA 2X6MA 5ABAA 3S35X 5CJ5A 4O9HH 2QLYA 1WP6A 1DVFA 1TNMA 4FQ2H 5MEQB 3MUY1 4GQZA 5IVXF 5HVHC 3GSUB 2CO1A 1I8UA 4X6FA 3B9VA 4WW1B 5D72L 4H8HA 3HZKB 3O9WD 1I75A 1IM3A 3RE0A 4ES9A 4YE0A 1V7ML 3LEYH 4POYA 1HZHH 3AWEA 1E42A 1T0NA 2HRPL 3OGCB 4OTXL 4A2HA 2VL5B 3KWTA 2XTLA 3VRLF 3B7TA 1MFBH 2HA1A 4APQC 4WFED 2MCPH 1R5WB 2PPCA 3WHXA 4P3CL 2YHGA 2WZPA 4MXWL 2HKHL 3S48A 4D0CA 1WHOA 2H6PA 4HS3A 2YA2A 5EFIB 3P4OB 3P9LA 6CGTA 1F3RB 4FI7A 1L0PA 2ZSVA 4WUUE 3RNKA 3DRTB 3RQ3A 1SPDA 5EA0H 1N7MH 2DQCH 4DKTA 1X4YA 1RZJC 3TCLA 3FFCD 1IKNA 2ATPB 4XNZB 3S6CA 1I9IH 3F8UB 3V0HA 1JGEA 4F1SA 5E1HB 3R19A 4UCFA 3RFZA 4H2CA 3NFNB 4PJXB 3VXMA 1E5UI 4NBYB 2YWYA 1L9RA 2FSEB 2P5WB 2BNQE 3MUGA 3P11H 4JQIH 5JHMA 2NY4B 5L7XL 4Y2DD 4ZAKD 5EZPA 5GZOD 3EAKA 1D5IL 2AAVA 3UFIA 3UZVA 4IBUA 1U8QB 1E6JL 3BH8A 3HB3D 2RFXB 4XVSH 2WLNA 1HNGA 5GISH 2VZ1A 3N1FC 4I85A 3CMGA 5A2IH 3VB8A 5BOJA 4QRPA 5LGJA 2XIBA 5CZRA 1MI5E 1YDPB 3C6LC 4QHMB 5F7NC 4LO9A 3KPQB 3MODH 1OZTG 2FEDD 3BESR 5D1ZC 1T66C 4NCC1 4P2QA 5GIRA 7FABL 3REWA 5KJRH 4YHLH 5I1DA 3GDCA 1Q94A 2HYMA 3VJ6B 3BVVA 3D4CA 4GYBA 3GK8L 3EYFB 3ZUCA 1NCBL 4KKBD 2P44B 4H8QA 4FKEA 4AH2B 1Z5LB 3FB7A 4LDLB 5D2LA 5F3HB 1EHLH 3F6LA 2X42A 2C3VB 2AXWA 4GP8B 1TTFA 3B2UC 1XB3A 4MCMA 4PHZA 4QHKI 4F2EA 3F7VB 5CJXC 3TZVA 3F7VA 3CZFA 1TG8A 3OF6A 4JQVC 3C60C 1OL0A 5I19L 5JPNA 2HWZH 5CSZB 2G4EA 43C9A 5JPMB 4OUUB 4ZS7L 1IBHA 1QQDB 2H6UA 3PABA 1UWEL 5D1XB 2G9HB 2LVEA 1KUMA 3MUUA 4J1UB 3LKOA 4N9GB 5CZVH 4JPWH 3NSXA 1JWUA 2I25N 1CC3A 1BIIA 2DBJA 3DNKA 5MEQA 1ORSB 3P4MA 5DD6A 1JRHI 3OHMB 2Z93B 4KAQL 3LKPB 1MFEL 3NJNA 3GKZA 1WA2X 5DRNA 3VRIA 1ZJBA 3BDYH 4B60A 4Z7NF 4JFHD 3U4EA 1BW8A 5KSAC 2C9UA 3LS4L 4CN6A 2O72A 5IVZB 3LMJL 1OM3L 5J1TC 1P1ZB 4KI5E 1B9ZA 1B4LA 1NANH 4QHUA 3QDAA 3OLGA 5IK3A 4A7QA 5CJQH 3H3KA 3FSWA 4JJ5B 3B5GA 3CSPA 3H1ZA 3UIYA 1SXBA 4Z95H 2WJ5A 4EN3D 4E5XA 1QPPA 5ETUB 1EV2E 1M1XA 4LAQH 5L2JA 5ILTH 2FR4B 4DGVL 5KVGE 2GY5A 4XMLL 2D7NA 4X4YA 2EABA 1IGYB 1ZPUA 4XVTL 4A7GF 1AG0A 2DIEA 5AYQA 5T1KA 4Y2OB 1BWMA 1JBJA 5AVZB 3E3QE 5CGYD 1U9KA 4U6YA 1MH5A 3LKNA 1DJXA 5JOPE 4Q9QH 2VDQL 4HHAB 2PR4L 3KYKL 4HOMA 3EDJA 3PGFH 2OYPA 4YL9A 2OZ4L 5HP5A 3G5ZB 1KN4H 5J9PA 3RDTD 3G5YA 3D0VB 4A04A 1NAKL 2PCFB 3KW7A 4M1CC 1J1XH 4PJHF 4HGWB 4UQAA 1UA6H 2XWBB 1QRKA 4Q58C 3TM6A 2XVKA 4NUMA 3ZJAA 4G1EB 4URTB 3LZQA 1QMUA 5DZAA 4H8WH 1Z5LA 2FSEA 5FFLA 1WFOA 1UXWB 2PPAA 3WJMB 4LSSL 1DJZA 2E0PA 2F5AL 1FVDB 5BQDA 5I1EH 2ADYA 4AM0B 1QR4A 1CICC 5J3HD 4GKSA 2MPVA 2VM9A 1U8HA 4ONFL 2WSKA 5CLZA 3QWRD 3QCVH 2Z3FA 1I3GL 2NY6B 1QBBA 3KG5A 4MMZB 1H3PH 1AIFB 3OKEA 2FWUA 1F11A 4PUBH 2Y7SA 4KO9A 5FYJE 4B5EA 5L8JB 2OJZH 1PY9A 1ACYL 3VMNA 5ICXB 2OMBA 4F7TA 4Y4FD 3VXSB 2AQPA 3DX9A 3LZOA 3MFGB 4KRPB 5JIMA 4JHZA 2NYYD 2X4SB 2A9MH 1QWUA 5TE4L 2MH4A 2LT9A 4BUQA 2RAMA 5M95B 5LB1A 5C8JB 5ESVA 3W2DL 4ELKA 5AW3B 3NK4A 2AJYL 2DQTH 3QEQB 5F89A 1I3VA 5LN4A 4RGOL 5GRVL 1M1XB 2ERJB 4N5UA 2QPEB 5FUCE 4M5YH 5CMAA 3BCDA 1NIFA 2X2UA 4JO4H 5F9WB 3V0FA 4DSYA 5DJDA 5CFHA 5LNDA 4H40A 2ADJB 4RFOH 5DJDB 5AOLA 3CX5J 3AITA 5ID0B 4G6KH 1UD6A 1OVZA 4G8EA 4G8EB 4HHAA 2QDWA 4QRRE 4FTVB 4BKTC 1DBJL 2OZNA 4IIQA 2WXNA 5C09E 4G5ZH 4WHTB 4I0PB 4U7MA 1HI6B 3E6FB 5C0AB 3WS6A 2XG4B 1B3JA 4ABQA 1QACA 2GK0A 3ROOA 1FC2D 3OKKB 3VXQA 5IBTL 3VXQB 3J7HA 3VRJB 4LHJB 1T1WA 3MI6A 4PVMA 4MNQA 3MRLA 4Y19B 4KUZH 1KBGH 2EINB 5ALBL 4Q7DA 1ZGLP 2FIKB 1H6FA 1U91A 2P5EE 1MELA 2IGFL 3GZQA 4L3AA 1E5CA 3KGTA 5LNEA 4Y2NA 4PWGA 5D1XE 3P77B 1EJ8A 1XWVA 1KMGA 4LEOA 5CR1A 1K2DB 5BMFH 3FB8A 3ECVA 3DJTA 1FL3A 1OAKH 3QXVA 4H25B 1YLBB 4PI2A 2IAMD 4QRUA 1Q9LB 2YEQA 1KGCE 3V4PL 1N5YH 3ZT5A 3ZMNA 1JN6A 5DFVC 3WEMA 4ELMF 1AKJA 2UUDK 4JVUA 1DVFD 1QLRB 2R0ZL 4NSKA 4BXVA 4G8IA 2JKRM 1KJ2H 2ZOTA 1KB5A 3D3VD 5DJYA 4U1LB 3FFCB 4M7KH 4UV4H 2Y7NA 4LDOB 1OCZB 1UCBH 3AB0C 4UBDC 1T22B 2YGPA 5HVGB 3E2HC 2R7EA 3P69A 1M9SA 3HZMA 1EFXB 2OYMA 1P0SE 1I1RA 3TASA 2Q2EB 2UYLB 4GAGL 1RVFL 5I2IB 4U1MB 2PYEB 5HPOA 5DVKA 3B5TA 3QEQD 4XNUH 5IJCC 4F20A 2DLTA 4U0QB 4F93B 2BP0B 3KPRE 1X5LA 3BQUC 4KROC 4NQDE 2DLFH 1AXTH 1W0WA 3VH8A 3BAJA 5IJBC 5IQ7L 1SXSA 3G08A 1J5DA 1UT9A 5I1JL 3MN8A 3MVSA 5I73C 4YHYB 4L1TA 3HHSA 1G7LA 1L5GB 3FO9B 3QUML 1L5GA 3MNZA 1F3JB 3IFPA 2NZ1A 5MHSD 4W9KC 3FSAA 1U8MA 1QD0A 3ARTA 3AM8C 4ADIA 3EG9A 1NUNB 3CFDB 5J11C 4UZGA 2BY2A 5GZND 2C3GA 2EYSA 2HN7B 2XFGB 1HU8A 4JRXA 4Z95L 3C5SB 3DOIA 5D6DC 1GGIL 3H9SB 4LF3A 5F6IC 3WFBL 4BXSV 1YPZB 3F7LA 1PLGL 2N01B 2RR3A 4NQCE 2NQCA 4P9HH 3QUYD 3IAPA 4YDLC 4HUCA 3MACL 1BREA 4X98A 3RJDA 3WS3B 2XQBL 2W9EL 1BQLL 1PQZB 4HUUA 5CKAA 3L1GA 4ACTA 3QWOB 3WKQA 2P48B 4GRWF 2V2WB 5FUOH 4HKZA 5DD1H 2QQLL 4DN3L 3K6NA 4JFYB 5SX5K 1OTUC 2CRYA 1KF9B 1F4XL 3D4YA 3LRGA 1AGCB 4KK8C 3GSRA 1JUFB 1JWMB 4X7DC 3CZNA 3MRGA 1MNUH 2QKIB 5HGDA 2R23A 2EIDA 3FTSA 4GFTB 1IGIH 4WHCA 5CLTA 2F5BH 3SGEH 4BD4A 2B14A 3NMEA 2X4QA 4NUQA 4WFFD 5J1SC 3JWDC 4BJLA 4L5FE 1FCCA 2NUPA 3LZLA 3MO1B 3N91A 2X7LA 3IDUA 4JFFB 4CC1A 1LWRA 4OCXH 4QRPE 1AC6A 4KDVA 4GG6E 3JWNC 3QIWB 1JZEA 2FB4L 2VMDA 1AR1C 2IMNA 3QIWD 2WTRB 1XQ4A 4JO8A 3KCPB 2GITA 5FO9A 5J06A 3PAUA 3QI9C 4Q74A 3NCJL 5E8DL 4QNPE 4KHTH 1OAYH 3O2VH 5I71B 3ILPB 1F6AB 2EDEA 1SY6H 4ZUTB 2QPSA 5FHBH 1QSED 4HC1L 4N5EC 1D3CA 3VO0A 5AB2A 4APQD 3NRPA 3CFBB 3UMNA 3RKDC 3LXBA 4OJYA 2O61A 3ENEA 1V27A 4U0RB 3NA9H 1UYWH 1AXSA 2AV1B 4U1NB 3LN5B 4E42B 3CVIH 2BVOB 4IU3B 1JPGB 1ZHLB 4OLWH 2IGFH 3GB7A 5F1NA 3V5KA 3MROA 3CZLA 4BH8A 4JG0H 1OSZA 4J3BA 4WTQA 4XP9H 3TA4D 2NY6C 1BZ9B 5B1AB 1QRNB 1WAEA 4H8VA 5J8OA 3WDIA 4ZO6A 4AZUA 1KC5L 1CVSC 4LLDB 1IAIH 2Y6TE 2O5YH 4LSTL 4S1DC 4R0LA 1VFBB 4RZCB 5IB1A 2O6DA 4Y7MA 4AQ1B 3X12B 5B4MC 3QJHA 2YD6A 1QFUH 1T83C 1SRDA 3O6FC 4ORZC 1KPRB 5T33L 1HHHB 1M3IA 4HDIA 3GZPA 3D06A 1XGPB 3NPSB 4JHWL 5DMKB 4KV5F 3HNSH 1C5DA 5T33H 1U3HA 4O2FB 3KHOA 4CW1A 2BCKA 1TOXA 2BIHA 4H88L 3SYCA 2ZWLT 3FDWA 3ZKND 1YUHA 2FYVA 2XX1A 3WS3A 3WEOA 4Q0XL 3VFWA 1A22B 3BSGA 5IIEB 2BVTA 4JM2F 2X2IA 2X4RB 4QOKB 3JXAA 4PJHB 1KELH 5HYEA 1PF3A 4XBPA 2AQ2A 3SBRA 3LH9A 4TV3A 3P0GB 1LO3H 3I6LE 4J3OD 3PWNA 2JTYA 3GJFA 2Z31C 2HX8A 1UT1A 3MMEB 2E3VA 3KCPA 1G5GA 1IJ9A 1KXHA 2NXZC 3FUNA 4FQCH 3V6BR 4A66A 2DYPB 4OLXL 4WLCA 4G80B 5EH1A 1ZA3B 5CD3B 4QRBA 5A2KH 3MTRA 3VXNB 1F4WL 3FO2A 3GHBH 4PJ8B 1EFXD 3EOAA 4TYUA 3ZOAA 7TAAA 2XA8L 1J11A 4IKJA 3WN5C 3T04D 3RP1A 2ZOLA 3QXDA 3G5WA 4HC1A 2VJXA 2PYED 2O61B 2J1XA 3ZRCC 3N40F 1PZCA 4HJ0D 3LN5A 1NCAL 2YAOA 3GXDA 2CDGA 5EZJA 4S0TD 4J23A 3GSQB 5FO8B 4CILA 3T2PA 2YUZA 4P5KA 4ZXBD 1AQMA 5HI5D 5A6MA 5CM1A 3SDAC 2BMKB 2E74C 3CQQA 5ICUA 3QUZA 4N85A 4P2OD 2O93L 2VXQA 2DD8L 1E9OA 3DROB 1ECZA 1X44A 2OSYA 3ILQC 2X3AA 4NN7B 2GSGB 2QHRH 1OK0A 1OP5H 1HEZB 3VD1A 5LG1A 2ZSWA 5D2NE 1J8RA 3HG3A 4QD2E 2IADB 3BH9A 3SKOA 1HT6A 2YAEA 1DANU 3IB4A 3BKCH 5DR5L 1JGLH 4AL8L 1R3JA 2BVPB 1I9JH 3MLUH 5FW6A 1MVUB 4HPOL 4PLJD 1KB5L 5EG6C 1OD9A 5F0MB 2P45B 3SQOL 4AGLA 2BVOA 3ARGD 3W0WE 5JPNC 4DP8X 4XAWH 4FQ1L 3TBVA 2I60H 3BH8B 1A9VA 3RU8L 4ZX3A 3MV8A 3KDMB 4K3EH 1XSIA 1NJ9A 1ORQB 1ZLEA 5AOIA 5EU4B 2JIXB 1R3IH 1HKFA 5J7CC 1G43A 5DURD 1MJ8L 2L0DA 2ZQKA 4PJHA 1L7TH 3IDNA 4FTVE 2DKSA 5ECGA 4LCWE 5DYFA 1ZOXA 5KSAA 2YRZA 4PJGA 4JFDA 4PJFA 3BT2H 4Z7WF 5B38A 4EI5A 4JKWA 3EFDH 1V5JA 1PVHA 4PJAA 3QBTB 1B0RB 1KIRA 5CILH 3FT3B 4GEJA 4HFUL 3MRJA 4G80A 2JK5A 4BHUI 3QULB 3SZKC 5I1AA 3WIIL 2QFPA 2G3MA 2Z0BA 5I6XC 5IEKA 3EO9H 5EC2B 3RU8H 3FOMB 4J4PD 1AGFA 4MKMA 4TPRL 3CGTA 3VGGA 4WI6A 3LJ3A 1HXYA 5CIPH 1GW6A 4WNSA 3SYQA 3SDYH 1U6AL 4YSDA 4PW3A 2K6WA 1KYAA 5I1CL 1WICA 1JXJA 4L1LA 3SE3C 4MVBC 2ED9A 1VGEL 4HJTA 1HTYA 1T5WB 2QTVA 1UM6L 1LLAA 3SDCB 2ZKHL 1U93A 2B0SH 4WDIB 5HXMA 3CWGA 3UTTB 1BFSA 5K1JA 3I74A 2E7MA 1ZA3A 5CD3A 4AMKL 3LB6D 1HAUA 1HWHB 1TZGL 2VABB 4H1LG 4LKCA 1LMIA 5A16B 2FEJA 1TZIA 4PV9A 2ZOKA 2V2XB 5I0VA 1SLXA 3JT0A 4YDJA 1IBBA 3TO4D 5KVMC 4UQCA 3MA9H 1NL0L 2BP8A 2X89D 4PM1A 1FV1A 3VMOA 1YAZA 4NENB 1NFDE 4XGZA 4G83A 1ILSA 1CK0H 5KUMA 4Y5YB 4JRXD 2WLLB 2Z8SA 1D7DA 3S3BB 3WFHB 4WFEE 3V7AG 3FQTB 4OFIA 4P23D 4ODXA 5BZDB 4X7CC 1KLUB 2VLRB 5F7BA 3QXWA 4YFLF 3ZTNL 32C2B 3PAZA 4PTUB 1FVCA 4F3FB 1I3UA 5JYLA 1TIUA 1UJ3C 4OAWA 4NM4H 3IJEA 4U7SA 2BLFA 2OSXA 1H8OA 1KELL 3EW3B 3DV4A 1G6RL 1MJUH 2EDFA 3UO8B 4ELMB 3T4YA 4AW4A 3Q1SH 2F1AA 3DTXA 3VACA 4YX2H 2A1WH 5CEYA 3T65B 2KQMA 3QG6A 4M6OL 1GVIA 2R0WH 3LIUA 2X6CA 3D5OF 5I5IA 4ODWB 2ZNWA 1TKWB 4N0UA 5B8CA 1XF5B 3CIQA 3EKCA 5FXCH 1RFDH 1AY1L 3INUL 3L9YA 4WU5B 1KZYA 4N9GA 1BWWA 5GIRB 4PJBF 3US1A 3TV3L 7PAZA 3G6JE 3MLRH 5T3XH 4PJGB 5B38B 1BJ1J 2JMRA 3S5LG 4HXBH 1CS6A 1X5KA 4QTFA 1QVOB 5D7KD 2YPLA 4MDRA 5GHWL 1CI5A 2J2ZB 3GO1L 2E4FA 3V5HA 1XH3A 1UACH 1RZFH 2YO3A 3KPPA 3C2AL 2XBTA 4FZ8L 4L8CB 2WNKA 3O2DH 4KQ4L 3VMPA 3U4EB 4BQ6A 1YEKH 3TEZA 4IBYA 4LNRB 1OGPA 1KXQA 4OM1H 4QF1A 3IM1A 5TJWK 3S4SA 2Y2WA 1NM9A 1NMCB 5T3ZH 3RTQB 4AQEB 2FX9L 3N1PC 1A9EB 3FH8A 3BQUD 3RWDA 4E9XA 4QAWA 5IOPA 1FO0A 1J8HD 1CE1L 4J3UA 2BIMA 3UTZA 4MAZA 4JRYA 3NIFB 3Q6FB 4YFDB 2CJ3A 2R0ZH 3OKNB 5AWNH 5H37G 3GBML 5E2UH 5EORH 5BW7A 3ULVF 4NEHB 3IAGC 2GHWB 1N8ZB 5JHDA 3NCXA 1N8ZA 1ZV2A 2ZYIA 4UQ2B 1WJ3A 1TVHA 3MPCA 4OBSA 5B1CA 5HHVH 3WI9A 4XCFH 5JA8B 1U8CB 4CADB 3TA3D 2RMNA 4BSJA 3DV6B 3UTTD 2AV7A 1XZ0B 3A22A 5E8OB 3L3DB 3MZGB 4MHHG 4WGVB 1BQ5A 5DHDA 5AW9B 5IT2L 4Y2DB 4S1QL 1JWSB 2RBLA 4LPUA 4DVBA 4DVBB 1GOGA 2DTMH 2JXMB 2VDRB 2VLJB 1P4BH 2P5PA 4L0ZA 1M1SA 4DKFH 4LSUH 3GBEA 3GD1C 1I1FA 5DQJB 3HE7C 4ABWA 1I8KB 5EULV 1DCLA 2FX8L 4L3ED 3BSZL 1KIPA 1BZ7A 4XPBH 2A5UA 3HMWL 3G5ZA 3T0VA 2VDNB 4OCMC 4C83A 3ZK0A 3LV3A 2DQHL 2WKOA 4ZW7A 2BFVL 3WAKA 3NZUA 3ZN6A 4R4NC 4GI8A 5AL8A 3W82A 1EAOA 4HGWA 2KLTA 1N64H 2ZWKA 3UGEA 1JHTA 3CFJA 3L8QA 2AERT 4X7TA 4DZ8B 4ODSH 5C71A 1T4WA 2N7AA 3NCFB 4I3RL 2MFNA 2A9NH 3P73A 5F7EL 1KV3A 2QVTA 3JVFC 4M5YL 4XI5D 1S9YB 5FO7B 1UXMA 4DTGH 1CYGA 2A4ZA 4HK0A 1IGJB 1Z6JT 4YBHA 5KSUB 4NO2B 4HZLA 1BA9A 3QIBB 4U6HB 3HLKA 4CVXA 4QKXB 1PDKB 4NXSA 1UWXK 4QGTA 4UUJA 4BSVB 5SWQB 3N06B 5C0IB 3K8MA 2KDYA 4NC1C 1FNFA 4GO9A 1J88A 3M7OA 3X1EA 4UOJA 1UM4H 1A4KB 2R4RL 1M56B 2NY2D 2XBDA 2ADIA 4IMKA 4PRDB 5HDWA 3V5HB 3DKHA 3ESMA 2F7IA 2WN2A 1UQSB 1MQ8A 2FJHA 1L3NA 2K7PA 4O2CA 4W4OC 4ZXBB 4TQHA 1OAQL 4JE0A 1CXEA 4CKVX 4EEEA 3AMKA 1EEYB 4IOSA 4KTEL 4WY7L 4ZPVB 1EEYA 5DMJB 2HUEA 4KVCL 5F9OH 3E6FA 5ESVB 4E9YA 3BD5A 3A6OA 1I8AA 4AQEA 4MJIE 3DSFH 3KM1A 5CCKL 1BMWA 3VRLE 1BBDH 3MLWL 5C08B 1KN2H 3WV0A 4CN1A 1E65A 4EDXB 3O4LA 4EPSA 1IM9B 4XB3A 4M61A 5LQBH 3NACH 3O4LB 4N8VA 5EEZA 2QR0A 5J6GA 2VXQL 1CLZH 2FE0A 5ANHA 3ISYA 1VAHA 3BGMB 1IKOP 4S1DD 1A3RH 1K4CB 3WO3B 3QJVB 4I7ZC 4KI5C 5I8EB 1Z9LA 3QEUB 2QGEA 3ZBMA 2GUOA 4AZ8A 2BVQA 5I1IH 3O6FD 4HG4J 4Q56A 2XQYG 4G42A 3GGWA 4BBWA 2MHAA 3GLZA 5EBLB 1KYOK 3ATBA 4WI5A 3U30C 3ZW3A 3H7BA 3LSOA 1XIWB 3QC5X 4P07A 3DIVA 2UXGA 2UZPA 4KNSA 2H6OA 4YLQT 2XTJC 5L0QB 2R4RH 1GC1L 3D9AL 1JS4A 4IRZH 3KWWA 3EUUA 12E8L 6FABH 4HXAL 5HGBA 4NJ9H 35C8L 2XRAL 3HZMB 3ILEA 1JYXA 2EO9A 4AENA 4ZG1A 3KM2A 4KKCC 4ZBJA 4CVXB 1S7VB 2B8OT 4MMZA 4Y5YC 5D8JH 1YEDB 1RZKL 4R3SB 2D3VA 2X1XR 2ARJQ 4AV0A 1N59B 3D0LA 1CMOA 3NGBB 2YFOA 1LGVA 1XF1A 5TE7H 1QR1B 5KANG 1I4FB 4MD5A 1QRND 4MD4A 1YA5A 1I7UA 1Q0EA 4K8RD 4LKXB 1R34A 2YLHA 1CGXA 1T83A 3GEWB 4IS6A 4X5XA 5JOEA 4WEEA 1JFQL 4E0RA 3CUPA 1A4AA 3QORC 2W60A 4JRFA 5F7FA 3EJQA 3NFPB 3STBA 3RWJA 4G3YH 2FZ3A 4MCYA 3FAXA 3GXNA 3QAZB 3BMWA 2Y36H 1JPTH 4PJEB 3NCWA 3DSNA 3HAEG 5HI5C 1BD2A 2WKGA 3JZYA 4NI3A 5H8DA 4JJOA 3QQXA 4IRJA 4HWBA 1ZRUA 4AGMA 1QSEB 2ZUVA 4JPKH 4WWKD 1S7RA 3G5XA 1CTOA 1VIWA 5C07A 4GUOA 3GSOA 2Y3AA 1CI3M 3BEVB 4UNUA 4X80H 3PQYD 2R59A 1AGBB 1OANA 3S37H 3FRPG 4Q89A 2QSTA 2VISB 2ZPKL 4NLAA 4ZFGH 2R51A 1S8DA 4G8GE 1FIGH 4G42B 1JZDC 1TVDA 1R5VA 1WEJH 4RZCA 1TU2A 4PRPA 3MRNB 4IDJL 3IXTA 3C5ZB 5CP7A 3UMTA 3CDYA 1WHPA 2XVLA 1AYRA 5D7JC 2GSIA 2LAAA 3O45A 3BLBA 5BRPA 2CUMA 3U30B 1T1WB 4H26B 3ZVVA 4TNWF 3KEHA 4M61B 1M6UA 5IHLB 4JGMA 3S5ZA 2DQUH 2FIKA 4FEIA 2YMXL 4OD2A 3OC8A 3MRMB 2ZUYA 4FX5A 2X0UA 3N1GC 5DSCA 1N68A 4D9QE 3FHAA 5KN5B 1OAUH 2Y7QA 4FFYL 2V9UA 2Y2YA 3CV5A 3M45A 5AVWB 5CF3A 1AD9A 1AQHA 1KBVA 3BIBX 3L5JA 1MREL 1AO7D 2XY2A 5I76A 2WZ6A 1Q9KB 2EEDA 3PWNB 4PJDF 3ZPDA 5IBTH 3O8XD 1PW3A 4Z5RB 2ESVE 1KBPA 1P84J 1E8YA 2DJUA 4R83A 4WTZA 1G84A 1LM8V 2PR4H 1TXKA 5TDPB 5H2BA 1BV8A 4QT5B 2ZKWA 3I9PA 2G5RA 1OQXA 5LBSH 3AU1B 4NQXB 4ABUA 2CIKA 1ZGLA 4ILDA 4AYSA 2DWYA 4M1DH 1DEEA 4P59H 2G5BA 3B3IB 3KPLB 2QMJA 3V0EA 1OAJA 3RWFB 1EHKB 1XAKA 5KVDL 1K4DA 3C8KA 3OX8B 3OR7B 3GS0A 1FNEA 3IVKB 4O4YL 3S36H 4YX2L 4N4YB 4RLDA 1L6XA 3MV7D 4Z7QE 1DQQB 1HDMA 1JNHB 1YG9A 3ARRA 3G6JA 3P4OA 3KPSB 4GIOA 5DZNA 5H37H 1S4IA 4XH2B 4XH2A 4ETYA 5HVFB 4U2YA 2J7LA 1E28A 5A40E 2YPLE 3J27A 1NKGA 4TQIA 3FOLA 4JCWA 3U7YH 3FOLB 4MA8L 5D96C 3T3PE 4AE1A 3D39E 1RJZA 1EO8L 1QABA 1XR8A 4XC3L 3L7FB 5DO2C 3S37X 5IB5B 3T0DA 1JGEB 1VERA 3TO2A 2G30A 4ZSOB 2F58H 4ZNEA 1MW1A 2AJUH 1QSFD 1VZHA 3BRDA 5C0FB 1BZ8A 2QFRA 2BCKB 3M8OL 4NN6C 4W6WB 3OMIB 2VDKL 2RFXA 4HWZB 2UWEF 5E6RB 1ZDSA 1SF3A 3N50A 4IGBA 1FF5A 2E9GA 4LARH 4W9EC 5EU4A 3PGDA 3UYRL 2DLIA 4TOYH 2R1YB 2QQKL 3NGBC 2VL4A 4DO4A 3BAEL 4DO6A 5F7UA 2E27L 1VFBA 2JI3A 1PJWA 5E03A 4B50A 3VI3F 1BJ1H 5K39B 5CWSB 4KDTA 5BQ7B 3VI4F 3ARXA 2EILB 3EBIA 5L9DL 5M94B 4N8PA 1DO5A 2OJ1A 2G2RA 4JQXA 4CW1B 4NZUL 3FCUB 3V6ZB 5T3ZD 3US9A 2K9UA 1AD0A 2QVKA 1YECH 4ODVH 2GPZA 5AW6B 2WLIA 1HXYB 5JIHA 3IGAA 4HT1H 5DD5H 2ZG2A 3IJHB 5DZVA 4FMKA 3T5WA 3GQFA 4GG8A 3QDGB 4FOMA 4LDCA 5K9QI 2EXWC 3V7MA 4CVUA 3D2TA 4PGJA 1U8KA 2NYZA 1XGZA 1MFAL 2P3YA 3PAYA 3R7RA 4CGUB 3QE5A 1SJHA 3H3BC 2YUXA 1NIAA 3IF1B 3O4OB 2DM7A 3AZUA 3LVTA 2DICA 4BZ2H 5E56A 2I26N 3IDJA 5DHYB 3D7PA 4AUJA 4OI9A 4WI2A 1XF2B 1U8IA 1DBML 4MJHA 1NCCH 1DLHA 2H0EA 1RULH 3V4VA 3V4PB 3V4VB 4JG5A 1EJFA 4OJAA 1X5AA 3BPCB 4PP2B 3WCYA 4NENA 4FQJH 4X4KA 1BOGB 1ZS8A 5EZLB 5CJOH 2X4NA 3T8XA 4XBGB 3VFNB 1IT9L 2Y2TA 2E7CA 2H2PC 3L4TA 3VTAA 5DK3A 3KJ6L 4ODHH 2DEXX 3LKRA 5TQ0L 4YC2B 4LVHC 4N0CC 2KH2B 1UEYA 3L5HA 1KLUA 1CQKA 3CSYA 4J3OF 4M4RA 1TQBC 4F8OA 4XC1H 4CUCA 4XXWC 4OQTL 3WLBA 1ACZA 4L4TA 3KBEA 1C5CL 4AK2A 5E4AA 5IBUG 4FQIH 4K71C 4HXBL 2YK1H 4TMPA 3TO2B 4NN5C 4OY9A 3RX7A 5I30L 3QIUA 1KEGL 2HMIC 3WEAA 4KMTL 5DMKA 3GK8H 1T6WA 1QKZL 1UXWA 2Y72A 4DETA 4HPYL 3BGAA 4XWGH 1EEQA 5DVOA 4QHNA 3C5XA 2VDMH 2R2BA 1FFNA 1AP2A 4YDKL 5HI4D 1FFNB 5G4NA 2JJTA 3HBGA 4X6CB 4PP1C 2CO7B 2AF2A 2N4IA 4X4ME 4L5FL 5D5MA 4J3TA 4BQ9A 3ZL2A 2PWFA 2X4UA 1A5FH 3NPZB 5AAWC 5EN2B 5DT1H 1UD2A 3KNBB 4L9LC 3GMMA 4NQDA 3P40A 3H6AA 1B88A 4LK4A 3VJ6A 2FWLB 4APXA 1EMTL 4XMUA 3LEXB 1SM3H 5J57B 4UIKH 3D08A 1G7PB 4UT9H 1B0RA 4O00A 2B7DT 2XZCH 5IB3B 2DQUL 3VXSA 3MUHL 3GXMA 4QXUL 4OJCA 2H1XA 4OW6A 2B2XH 1ZANL 5GS0C 4OFYA 3IJYA 4HULB 1NBCA 3GMOB 3OGCA 2CR6A 3H9HA 1AGFB 4RMBA 3WFDL 1T0NB 3NPSC 2HFGL 3FCBA 5C6PB 4GQPH 3LYRA 5F0LB 1V7NL 4F15C 1FO0B 2CWRA 1P4IH 5ICYB 3CLEL 3TEWA 4MGXA 1ZDQA 4GXVL 4X80L 5IKCA 5T1KB 3TNMA 2WQVA 2CSPA 1DSFH 3KGRA 5HGAB 1F41A 3ESOA 2F18A 4XP5L 1P53A 1MWOA 4WGKA 3UAJD 2W9DL 3HI1A 4HWEL 4TQ8A 2J55A 2FECL 4I77L 5DZJA 4QHUB 1XD1A 1KCVL 4LL9A 4DAGH 1MI5D 1UM6H 1AQKH 3IRZA 4WWOA 3DK2A 1YHPA 2WXHA 3I6KA 4QO1A 4R26H 4X7SH 1ZSHA 4GRLC 5EZLA 4D9LH 1HHGA 3D85A 4O9HL 1A4BA 3ZDXB 1QFWM 4G9FD 3O41B 4IKIA 4AX3A 1WGVA 5D4HA 3SPIA 5KYYA 2QKSA 5DURB 4OIFA 4G1MB 1E4WL 1AZZC 4JRLA 5DC9B 5C07E 3RA7L 3W39B 2P24B 4I9WE 3FU7B 5JNYA 4TUKH 3BJ91 3DVIA 3GSNH 1DVSA 4F9LA 4W4OA 3S3CB 3TVMB 1JK9B 1OAXH 1TTGA 3K8KA 2UUDH 4K8RH 3ME0B 1SN2A 3EIFA 4Z7VB 4RSYA 1JF1B 1SF5A 3HFML 2CHXA 4LZKA 5L8KB 2CKNA 3B7SA 2GABA 3OAUH 1NPUA 4M1DL 5C0EA 1U8HB 2HLEB 1QBAA 2CR3A 4Z7AA 3X1GA 4DT2A 4LQ1A 3NIGF 4DGIL 3AXLA 3EH5B 5CSZA 2FT8A 4DGYL 3LRSB 3VWKC 4GG6F 1EZLA 1ZA6B 2ZCKL 3VFVB 1J1OL 1BAGA 3D39D 1R1CA 5ICYA 1K8DB 2ENYA 5AYUH 4JM4L 2ZAIA 4R97C 3WY4A 2OCCB 5ID1A 1I53A 4PV1C 2XN9B 3W11D 1WV7T 3MA7A 5AG9A 1JGUL 1AHKA 1LDSA 1VFMA 2FL5A 3AAZB 2OR9H 3MFFA 2Y6SD 4WO4A 5HGHA 4JRYD 3WIHL 3TL5A 4FLHA 2XPYA 3LD8B 1S7QA 1Z3RA 5LHDA 1H6UA 3T2NH 1IC5L 2XN0A 4E41D 1XL4A 3SKMA 3CVHB 2K7QA 1LO0H 4QAMB 4EKJA 3ZYOA 2P49B 5DJ6B 3GBDA 4AQ8C 4PLKD 4TUJB 4GMTH 3QQ3B 2R1WA 3PWUB 1WPCA 1QNIA 2BOCA 2YSSB 4DPAX 5I1HL 2VQTA 4X6CE 3FRUA 1A6WL 2NNAB 1PD0A 2WLLA 1SMAA 3SGDI 2X1OA 4X98B 3FQRA 3FUDA 5LXGH 2O5XL 3SOBL 5LGKA 4KJPD 1IE4A 1GYAA 1BZ7B 2L4OA 3HZVA 5GRUH 3SD5A 3V6FA 1Q0XL 2B20A 6PAZA 1INQA 3QSKB 1Q1JH 1X3DA 3QUMH 4A63A 3GKWL 1PCSA 1UENA 2YRLA 4U3XA 5D7IA 2HWZL 4WGWB 1XIWA 4FXGC 3MLSH 3QO0A 4K7FB 1QLRA 4NSKB 2GI0A 4S0SD 5H35A 5F0JB 3QUXD 5JHBA 5F88B 4DP6X 4ZNEE 5L88H 3QJFA 3CJJA 4M6AA 1IEBB 4AM0A 1FVDA 2BO0A 1A6TB 2W88A 3Q1EA 4NYLA 5LGHH 4G3YL 5KG9B 5I75B 1O75A 2VJ0A 1QYGL 2EXYD 3FXIC 4NKDA 5T5FL 1OGTA 4YDMA 1EUUA 4LEOB 2A6KA 1NCUA 4OR1A 5IGXH 3I3EA 3FQ1A 5E8PB 2OBGA 4BV1A 3O3BB 1JK9A 4OLUH 5E4EC 5EU6B 1VADA 1OKEA 2EO1A 4DGWC 4LSUL 3RTQC 4YHKH 1Y18A 2VN6A 2H2SC 4X8JB 1KBBA 2VLRE 1LYQA 1MG2C 4R6UA 3GLDA 3CZKA 1PEWA 5EO9A 3ZTJH 3EFFA 5IMLB 5E99L 4ONHA 1JCKA 1XGQA 4ONHB 3VI4A 5IY5B 1M2OA 4K3GA 4H7VA 2P46B 4Z8FH 3KAAA 4Y5VC 4X5WB 4ANXA 2AK1L 3OSVA 1IGCH 5GGSA 3OKDA 2L3BA 4FG4A 3IDGA 3BWUF 2KC0A 2EDBA 3GMPB 5EPMB 1PZBA 4L2YA 1A7PL 3VM5A 1SFDA 4AM0Q 5CMAB 4CVZA 4ZNCD 4LASL 4TSCH 3F3HA 4JL2A 3INOA 1CDJA 1E4WH 3GTNA 2X4TB 2AXJA 2HLAA 2VR3A 3REVB 4OZGF 5L8LB 1H9DA 3QCVL 4Y88A 2FWOA 1N0LB 4HK3N 4LCWA 3Q8CA 1MRDL 4OBRA 3KZ8A 1HEHC 4PJGE 1F3JA 3GFUA 2NY6D 1AZBA 2V2WA 1QNZH 3MLYH 4AG4L 1CFTA 5GRYA 3KPRD 4OGAD 3KPTA 4PJAE 3QORB 1P9MC 4Y1TA 1E6OL 2AV7B 4UU9A 3MCYA 3ZUNC 2A6JA 2PTUA 2WXKA 5IP4A 1TLKA 5LVEA 4D8PB 4ZMLA 2LQRA 3M17B 5CCKH 4IMLA 1HJCA 2ZF8A 3BCFA 3EJUA 5EBWB 2ZUQC 2Y1YA 4GI6A 3MNDA 4P5MA 3H42H 4OVVA 3M6DA 2XZQH 3ZRSA 1UOKA 1M4KA 1CDBA 1KJVB 2A4CA 4X0KA 5ACMA 1JF6A 4Z3EA 3OWRA 5E5UB 2DLHA 1GHFH 2VLLB 2JKIS 3L9RB 4L4TE 4QHLA 5BCAA 2O6FA 3TBYA 1TCMA 4M7JL 5CLWA 4RRPG 3VXOB 3WO4B 3OMAB 5A43C 1Z9PA 1BAFH 2IAND 2QPFA 1A8ZA 2AKRB 1T4KA 2P8LA 3RUGF 4KU1A 4P04A 4BK5C 1B6DA 2O5ZL 1QI5A 1AZVA 1C5BL 2TRHA 4MMYB 3NSCA 3TBTB 1ULVA 1HZLA 1CCZA 3C8DA 4N1HB 4NZJA 4XOAA 3DX2A 2OQJA 4W9DC 5D5ME 1ZWIB 3MRPA 4N2MA 4WK4B 1OF2A 4HEPG 1UC6A 4ZUUA 1RUQL 1BVLA 1K5NA 1VEMA 5I24A 2YWZA 3ISRA 5GXBB 4CMMB 4E2OA 3BN9D 3BSZH 2C5DC 5HY9B 4LLDA 1R3HA 1GZQB 1N12A 3QUMB 5D4QA 3SHSA 3TEYA 4Y2LA 3UAJA 1LE9B 1SHMA 2EVFA 1CDHA 3MRNA 1P5UB 3CDZB 5A3IC 1S9XB 1HXKA 2OMVB 2MTPA 5ESQA 1IFHL 2DIAA 2CGRH 3RAJL 2WQRA 2XIIA 4X8XA 3CFNA 5E6IB 4P5SA 1PLCA 4WENB 5J1AB 3G5XB 2WVUA 3V4UH 2X4TA 4FJYA 3IMWA 5IJKA 4UQEA 4LXFA 4XO4A 3IJ7A 2OMXA 2Y0SA 3QZNA 3B4NA 4X6CF 2OCFD 3OAWA 3U7AA 4YGVA 3VFPA 5I1CH 4OZGB 2HMID 1TU2B 2BC4A 3C5JA 2EXSA 4WK0B 5AAMC 5M7QA 4KO5A 1WUNT 3BWAB 1JUFA 4M3HA 5DMIH 2JKNA 1IIIA 2YD0A 3NZHL 2PO6D 5JHLH 4M8QB 1NMAL 3D25A 1SXAA 3IU4L 5E6ZA 2PCPA 3KR3H 5DFVD 1C12B 2DI7A 3QFJB 4HEMA 4I0PC 4O2FA 2AXFA 4GRLB 3T4AC 1RP9A 1QZ1A 4Z7WE 5K9JL 4JO2H 3IGLA 2PCXA 2QKIC 2XZZA 2WBJC 3U1QA 4JMXA 1LD9A 3FUFA 3JWOC 4JPIA 3BT2L 4NPYB 1U58B 1ETZB 4NBZB 1RUPH 2X7LB 4JFFA 3FTZA 2MNWA 4JRYE 4G43B 4EIBA 4YMPA 2ZX5A 3LDBB 4K23L 5IVOA 5K9OB 4HSCX 1RU9H 4P2RD 3MCKA 1DDTA 1AMYA 1F0LA 4ZMPA 5B39G 3EOBB 2Q8AH 3PHSA 4IK6A 4J8RA 4OKVA 4XBEL 4XMPH 1TFPA 4G70B 2Q7NA 1G87A 2AKRA 4LKCB 1JHLH 4RFEA 2OXHB 2HRPH 2ID5A 2NY4C 3HMXL 2V2XA 2YJLA 4KQ0A 4FI6A 2OK0H 1IBDA 1FDLH 3BKCL 4JBSA 4WK2B 5DR5H 4AL8H 5L0QC 1ZKAA 4HWEH 3UPRB 2JJTC 1MFDH 1DQVA 3L81A 3W5NA 1GTFA 2HVJB 3KL3A 2PW2A 4FFZL 4GBXB 4ZDHB 1IARB 5FA4A 4F8LA 1HKLH 5GZNC 3NCMA 4M8UA 4PRHA 3Q8EA 4R9HA 4KVNL 1E28B 5GRUL 4YXKL 4HJSA 2V5TA 4HJGB 2BOBA 5CEXB 2Y23A 5JIDA 2GT9A 4J3XA 2X70B 2AANA 3F05A 3BQUB 3BZFA 1PTZA 1YMME 3DVNB 1C5CH 1UZ8B 4PBVC 4RMVA 4Z7VE 4V11A 4ZSOA 4XE5B 1YNTB 4UTBA 3S96B 2Q76A 5DUBA 3TJEL 3JVGA 1OTUD 1UH3A 2VAAA 1X5FA 2HRGA 3LN9A 3D50A 2YD4A 3GBNH 1XTLA 3I6GB 4NRYA 3MV8B 1MCDA 1R0AL 2P8MB 4X6CA 4DH2A 1RK7A 4R5XA 3PNWB 1CT8B 3IDIA 1XF3B 4PS7A 5IUCA 3MUZ1 3MBXL 2BVYA 5GGUA 1OP5K 4CMHB 2HVKB 3S3SA 2WXPA 3MJGX 1JL8A 1EJOL 2R29A 2YGQA 4H2AA 4EXKA 1B6UA 2LU7A 4X6FB 4MB4A 3HC3L 1YUKB 3BFOA 2DF3A 4GSRA 1QEWA 4W9LC 2CKBA 2ZCZA 3PU7A 2CKBB 2IOOA 3GJEB 3IDJB 4POZD 1MWAB 3C5ZC 3QG7L 2PXYB 2VDRL 9CGTA 1HWGB 4MNGA 2VUOA 4M1GL 2O26U 2VDPL 2Q5BA 3QC6X 1U8JA 3CXHK 1QFUL 3K0WA 4F7CB 4K15A 3MRKA 3O4LE 2I07A 1TJIH 3GWJA 1N0XL 4KTDH 1JK8B 4YXHL 3RKDD 2PW2B 4TVPL 1IEAA 3ULUH 1E4XH 3QQ4A 3OKOB 5JIKA 4LFHG 3S98A 3CFCH 1U8NB 3SCMA 3HHRB 1E90A 3PF2A 2HJKA 3FQ4A 3RNKB 5HJ3A 4I2XE 4DWHA 4URKA 2VLRA 3KLSA 4TLUA 4RFEB 4XN9A 2R0KL 4HIXL 4N3TA 4AMXA 1XR8B 1NFIB 2V5SA 2HSIA 1WBXA 5BNXD 2A6DB 1GY1A 4XNMB 2GTQA 4M02A 4NRXA 3WTXA 2W07B 1DL7H 3VXMB 2R4SH 4R7VA 3DV4B 1INDH 3J8F7 2W38A 3W5MA 4G8FB 2GBUA 2YBRB 1AGDB 4TULH 3T77B 2J4WL 1X9UA 1A25A 2D0GA 1ADQA 2R0LH 3HC0B 5LCVA 1GGBH 1TR7A 2X0WA 2YGNA 2XLLA 4MLSA 4WW2B 2F2HA 1JXFA 1MCJA 2DS4A 3JV6B 3SYAA 2IH1B 1FNHA 2NR6A 1T7ZA 4OJFH 1XCQA 3GUFA 3MUJA 4GRMB 4LQFL 1VF5C 4Y4KA 5EF0A 4EI5B 5JORA 4JFDB 4PJFB 4A6YH 3BP6A 2Q3AA 4FXTA 2IG2L 2WD0A 2VT0A 4KGJA 4WEBH 5ERWA 5FWRA 4PY7A 5F7KC 3QNFA 5BVPL 3BI9X 4PWEA 3LAFA 2Q8BL 5GGTH 3ES6B 4JY6B 2EXYC 4AQ8A 3BXNA 2OMYA 4AQOA 5TDOB 3PWVA 3RBSA 5C2BL 1S5HB 4FNTA 5IEKB 2ILLA 4UM9D 5EC2A 1TF4A 1U6AH 5HJDA 4X7EC 3T3MF 5DD1L 3VVVA 4JUSA 1LNUA 3SE8H 3UDWA 5DJ2A 3D52A 1TO4A 2CM5A 5F3FA 3THML 2IPKB 2Z4QB 5FW7A 1DVQA 4PSPA 3B9AA 5C0CD 1T5WA 2ZCLL 2Q0ZX 5C0BA 3DRQB 3M8OH 3PJLA 1SEBA 1H5BB 4FQXB 3P3UA 4HJ0C 4I1RA 3S36X 4BCZA 2H0JA 2FBOJ 3PS6A 5JOFB 4L2LA 2CPCA 2XWZA 1UQSA 3NJHA 4FXGA 2OL3L 2LFGA 1OP4A 3MFFB 1RJLB 2CK0L 1MF2H 2CBMA 2XA3A 3PWPE 5AVQB 5MEPB 3ZO9A 1R75A 2IO5A 4BFOA 2FEEL 3BO8A 4N6RA 3NSYA 2EDRA 1NSNH 4N6RB 1O9VA 1U4FA 2X41A 5KVDH 2VM4A 4L8BB 4NJAL 3ZZQA 5HVHB 3ILQD 1EO8H 3U2JA 1X9QA 2F54E 4O58L 1BVZA 3AREA 1GAFH 4IW4C 4LSVH 4U31A 3F62A 5B7EA 1NEUA 4UYQA 3RBGA 4G6AD 4ORGA 5FB8B 2WCSA 3OKOA 3QQDA 2VN5A 4OF6A 2D31A 5D4JA 2QJDA 2NY7H 1I82A 1RAMA 4ALAL 4GAJH 1QSEE 3TBWA 3U6XS 2HJKB 2K4WA 4ES8A 3D85D 4X4ZA 4BK4A 1KTLB 2ZP8A 2IALB 3VQ1C 4E41E 2BRRL 4HKBB 1TQSA 4WKXA 2UZXA 1BDYA 2ZX8A 1O7DC 2FAUA 1ZPLA 4A2FA 4PCKA 3WIAA 1M3JA 1JZ8A 2PNDA 3TT1L 2IFFL 2OI9B 3HE6C 5F88A 2V17H 2BSRB 3VRJA 2AEIT 5IHWA 3QJFB 3HPJA 1IILE 2NW2B 4IJTA 5E6UB 1RPUA 2ZT9C 2JSFA 3WNJA 4Y9GA 3BPNC 2Z31B 4M62H 2ENSA 3CDGB 1TENA 2GJ6D 3WNKA 4JB9H 4A2DA 1RULL 5T1DL 3F84A 1NCDH 2PWEA 2V4LA 4HC1H 4KTYA 1TKWA 4N0UB 3KXFB 5B8CB 1KSRA 3ZX1A 2UWEB 4GBXC 1OAUL 1FZMB 5I73B 3TWCL 3T0EA 3IDYC 4J4PC 2LAGB 4PJ7E 4KKCD 3VYNA 1OT4A 2H9GB 4ZOEA 1CL7H 4M43L 2NDGA 3EJPA 5D1QA 5E8EB 4WI7A 1CR9L 5IUSA 5EF2A 1AS7A 4LKXA 3CLFH 4L0PB 5JOFA 1S7SB 4IS6B 5BPPA 2K6YA 5C0GB 1E7VA 2C3VA 3D39A 5KVEE 1XSOA 1WTGT 4UAHA 2HT3D 1JYWA 3DUSB 1IM3B 5GSVB 2WW8A 1CGVA 2GC4C 2NSMA 1MFDL 1LEKB 4NWUL 1LNUB 1EZVX 4S2SA 1FSKC 1A9EA 1HFUA 2WLHA 1N64L 4A7TA 3WG7B 3HMXA 3VXPA 1AI1H 2C9VA 2MTAA 3WHXB 3HEIB 4G6KL 3RG1C 4ACPA 2JQZA 5AVSB 1KYFA 2XT1B 4HHGA 5FM4A 3HNSL 3M1OA 4CDGC 4WWNA 3ORJA 4YHIA 3MCLL 5AD0B 4ZFFA 3HN3A 1JVLA 4PSRA 3CBRA 3F7QA 3EBHA 4N8CH 1O6TA 2B1HL 4PRAB 2IV8A 2M8XA 2BW5A 4GB9A 1EIBA 3FN0H 1BCIA 4NNPL 2DOCA 4ZPVA 5D6DA 2LV4A 2HH0H 2ZAHA 1YY8B 3T1WA 2GK0B 3ROOB 2XG4A 2XKNB 5JZ7D 5JO5A 3EYSH 4OSUH 1T3FA 1J0IA 1FNLA 1MCEA 4G59C 3HC4H 4N68A 4S1SH 4C8XA 4S0HA 2GCYA 1BAFL 1NAMH 4A38A 4LEXL 3HG5A 3KW8A 1CL7L 4DK6A 3PP3K 2HG0A 5AG8A 4NERA 1DUZB 2XXGA 4QTHB 2O6CA 5IROC 4TTDD 4W6XB 1TZ8A 4XMVA 3N44B 2BSTB 3ESVF 1PZSA 3V6OC 3N41B 1HN1A 5CIPA 3OPZH 4JFEE 4MYWB 4RZKA 3NESA 4NQUA 2XYCA 3BUBA 3N3EA 5E6SB 1XGRB 1JVKA 5JDJA 3K5SA 2WO3B 2FJSA 2GB2A 4JN1L 2FT6A 3CCHB 3AACA 1JN6B 1QFWH 4PJIE 3G3LA 3MOAL 2CUIA 5DHEA 3P73B 5DJYB 1IAOB 4HLZH 1U36A 3FRPA 4Z7QF 5EO9B 3U9UB 5C92A 3ZE1E 1ZT1A 1MUJA 3WGUB 5BS0D 2NXYD 2DJSA 1E4XI 3ARGA 4KQ3L 3VGAB 1KDJA 4Z76A 5BS0B 1BQSA 3B9KA 4Y9CA 1CTMA 4ZT1A 1UA6L 3CDFA 4HIHB 5SWQA 2GTWB 4BSVA 5GGSB 4NO5B 4UF7C 3BKML 1AIFA 3OKEB 2WAHA 3CHXA 1TJMA 5AW4B 1P2CA 1A7NH 1MI5B 1EZVY 1PSKL 1JZHA 2UXTA 3FUEA 3Q0HA 4JM2B 4NHCL 1FFOB 1HNYA 2DJ4A 2M2DA 3VH8B 3UROR 3VXTA 3ARPA 5KSAD 5C07B 4JFDD 5F9JA 5C0GA 4DGVH 5DA4A 3MRBA 1LEIA 2Y5QA 1JNLH 4XVTH 1OOAA 4HOXA 3SBWA 2X4SA 3PQYB 1K72A 4JZOB 1EA9C 1A02N 1RY7B 4U1SA 2CK0H 4I0PA 4XN2A 1IZJA 2BFVH 3BP4A 3ZYIA 1ZTXL 3Q3GA 1U8PB 5J6HA 2DQGL 3MGTA 5JTWA 2CDFB 2YGOA 2EYSB 2WBJA 1IAKA 1MHPH 2WQXA 1J1OH 2R1WB 3QRGH 2VZ3A 4ADGA 1I8MB 5HYQB 2A7BA 2W81C 1PPIA 5D6CA 3ATAA 5IV2A 3LQAH 5DS1A 2NNAA 1UFUA 3ZE2F 2B5IB 3N0AA 4ZFOA 3GPSA 3OMZA 3PLYA 1VKXB 1TYEB 1N0LA 1J0ZA 2Z1PA 1D6EB 3HNTL 5IT2H 3Q8FA 1AHWB 2OXGB 5F9WC 3FBQA 3L3HB 1ZLWK 3CXDH 4F8TA 3ZDYF 1OP9A 1XGYH 5LNGA 1A6AA 5MERA 2ROXA 2XN9E 1SJXA 4BCYA 1RLWA 4UTAL 3O0RL 4HWBL 2BPBA 1KY7A 1BQKA 1F58H 1EO5A 2VR5A 3TWCH 5EC1A 4HX1B 3CPLB 3GC3A 4ESKA 2VIRA 1MPAL 3M17A 2VR4A 3GMNB 4FABL 3DO3A 2J56A 1MEXL 1MCRA 2AQRA 3K80A 3L17A 5AENA 4DVRL 5FYKD 1NLBH 4JMNA 3IFOA 4ZFOL 4K94C 2VC2B 5GZNA 1DQIA 2G5BB 5DJ8A 5B22A 1U58A 5F1OB 4OKDA 3UTSA 5IQOA 4YSTA 3FN3A 3WAJA 4Z8FL 1MI5A 2UWEE 3BZEB 3MKGA 1PY0A 3FZUC 3RHWK 4EQ3A 1U8KB 5H4ZA 3F64A 3QRGL 3OSKA 4FQHA 2WKOF 2YMOA 3WN5A 4ZMAT 3P11L 4Y1AB 4JM2C 5ITFA 2J25A 2MNJB 1HK6A 3FN0L 1Z5YD 3A67L 4X8GA 5D2LE 4XN4A 4NCDA 4ZZFA 3K6IA 4U2ZA 5E0FA 1EGJA 4HAGA 2XACC 4PGCA 3SZ6A 1XGTA 4ZJ9A 4FLOA 2DM3A 2R2CA 2TSBA 2IWFA 4ELME 5BXFB 2XXMB 3NP4A 2QHLA 4DEPB 1E4XL 2JIXD 1KBGL 1UGNA 4KTGA 5INDA 4KK6C 4X6DF 3DLQR 1JPGA 5T5NG 4OZIB 2WN3A 4K2UL 4Z7IA 1DQDL 2KKQA 2J43A 4S10A 1HH9B 1JZ6A 2BZ7A 3QUZB 4I5BA 3RX8A 5I6NA 4HALA 1E5YA 4UILH 1FYTA 5ESAB 4KUCF 4R8WL 4PR5B 4OZGA 3OAYK 3C5ZA 5KS9E 3SQOH 1FFQA 1Q0XH 2YXWA 3TIEB 5CP7B 4UT9L 3HG4A 2FX7H 2FBJH 4WCYH 3OB8A 4YO0A 3ZE2E 2NLJB 2AJXH 4L1BA 2VDOL 4DEUA 1A4JA 3N43F 3UTQB 2WO2B 4C54A 4NDMB 5I0ZA 4WNQB 4DK5A 1JDAA 1T6BX 2JCCB 3MOQA 2W94A 1OV8A 5IJDC 2GJ6A 3TJHD 4F5CA 1RJYA 3HC2A 4NZDA 1MIEH 3QNYB 4KI5F 1C1EL 3TBSB 1TEFA 4H5SB 3TBSA 1UWYA 3B34A 3HZYA 3OVUB 4E41A 4XBPB 1I9RH 3NK3A 2AK4D 4QHLB 3BZ5A 4L9DA 5J89A 1ZT7A 3GSVA 3PGCA 3KLDA 3SJVD 4AIZA 5HD8C 3FFDA 5EUKB 4PJBA 5KYUB 2YUWA 1G6RH 3RFZC 4EKXA 5DRZA 5TF0A 5G2NA 2AW2A 4N2AA 4Z7VF 2VSDA 5DUPH 4PS8A 3TP4A 3VSQA 1KCVH 4B53A 5IHUH 5F7HA 4KVNH 4YXKH 1J9TA 1X5GA 4TLTA 3UC2A 3MRKB 4YLCA 3AB0B 1XMEB 1EWHA 4DGIH 2PYEA 1K6QL 4HLZG 5LAXB 2CHWA 4ODSL 2XXFA 3MV7B 4FERA 3B37A 4LSSH 4Q6YA 1DBBL 5CGTA 5D7HA 5DT1L 5KW9H 5D1ZA 3KPOA 3LCYA 2E7BA 1UA3A 1IBGL 1RPKA 4EVNB 3MRCB 2NX5A 5ABDE 1BQHB 2X4OA 1BZ9A 2DLEA 1KXVA 3T8MA 2UXVA 3P9WB 4PD4J 1HC1A 4XZUA 2B39A 4P05A 1FE8H 4RBPK 3WKML 1HYSD 2HT4D 2XICA 4XPGL 1KEGH 2ZKYA 3ZLQC 3TZVC 4AT6B 1HHHA 2YAMA 4HDIB 5I71C 4G82A 4BIN