3DGDA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3dgdA00
1THAA 5EN3A 2QPFA 3IWUA 1BMZA 2G2PA 2G3ZA 5E4OA 3CFTA 4TNGA 2G4GA 5DWPA 3M1OA 2GPZA 4MRBA 5FW6A 4Y9BA 1IIKA 4ABQA 5EZPA 4N85A 3DK2A 4QXVA 4KY2A 5K1JA 4DESA 3NEOA 4IKIA 5CNHA 5JIDA 5FW8A 4PMFA 1TTBA 1X7TA 4I87A 3P3UA 4DERA 5CLXA 4ABUA 3DIDA 4N86A 5CN3A 5CLYA 1DVYA 4QRFA 2G2NA 4PWFA 4TLUA 4PVNA 3CXFA 3Q1EA 3CN3A 3BSZA 5L4IA 4TQHA 3KGSA 2H0FA 4ACTA 4HJSA 4MRCA 2G3XA 1THCA 3GLZA 1KGIA 3TCTA 1SOQA 4PVLA 5IHHA 1Z7JA 5E23A 1Y1DA 5L4JA 4TQ8A 4TL4A 2IGLA 5DEJA 3DJSA 3TFBA 3DJTA 2WQAA 1FH2A 1IE4A 4TL5A 3QVAA 3IMVA 4TLKA 4PWIA 5FW7A 4Y9CA 5CR1A 3IMSA 1TTRA 1RLBA 1DVTA 2PABA 4TQPA 4TNEA 1KGJA 5TTRA 3CN2A 1SN5A 3IWVA 1FHNA 2FBRA 3D2TA 3ESPA 4HIQA 5AYTA 5AKSA 5AL8A 1TYRA 3D7PA 4N87A 4WO0A 5L4MA 4PWGA 4HJTA 4PWEA 4IKLA 4ANKA 1DVUA 1IIIA 3IMUA 3CFMA 1E3FA 1BZDA 1E4HA 4IKKA 4Y9FA 1G1OA 1IJNA 3IMTA 4QYAA 3SSGA 3OZKA 5A6IA 1SN0A 1ETB1 1SN2A 1GKEA 2TRYA 1TT6A 3DJRA 4FI7A 4HISA 4IK7A 2B9AA 5AKTA 3W3BA 4PVMA 2QGCA 4DETA 3NEXA 4IK6A 1DVXA 1TFPA 2QGBA 1TSHA 1GKOA 3B56A 4TLSA 1F86A 1DVZA 2H4EA 2H0EA 4TKWA 1X7SA 2H6UA 3U2JA 4TLTA 3A4EA 4PWKA 5AL0A 4PMEA 3BT0A 4IKJA 2F7IA 3GRGA 1TTCA 2ROYA 3DGDA 2FLMA 4FI6A 2B77A 4YDMA 1BM7A 4WNJA 4D7BA 5CM1A 2F8IA 4PM1A 4FI8A 3A4DA 1ETA1 1ZD6A 2NOYA 3CN1A 1OO2A 1TTAA 3GPSA 3OZLA 5E4AA 3I9PA 1BZEA 4Q14A 1BZ8A 3IPBA 2B15A 1QABA 3KGTA 4WNSA 4YDNA 3P3SA 3IPEA 3CFQA 1DVSA 5CLZA 1TZ8A 3NG5A 4PWHA 3DK0A 4MASA 3U2IA 4I89A 3HJ0A 4Y9GA 1QWHA 3I9IA 4L1TA 4TNFA 5JIMA 2B16A 3NESA 1F41A 2QGEA 4TM9A 3GS7A 4PWJA 3IMRA 5HJGA 3FC8A 2QELA 3ESOA 4Y9EA 3I9AA 4L1SA 1ICTA 3P3RA 3P3TA 4TQIA 3GS0A 1E5AA 1SOKA 2QGDA 3DJZA 4AC2A 4AC4A 5FO2A 2H0JA 2ROXA 3KGUA 3NEEA 4I85A 4IIZA 2TRHA 5AKVA 3GRBA 4DEUA 5JIQA 5K1NA 5BOJA 2G5UA 3ESNA 4ABWA 3FCBA 2GABA 1ZCRA 1U21A 2G9KA 3CN0A 3DO4A 4ABVA 5L4FA 1DVQA 4HJUA 2G4EA 2B14A 1TLMA 3CFNA 3GS4A 4DEWA 3A4FA 2H1XA 3CBRA 3CN4A 3IMWA
chains in the Genus database with same CATH superfamily
25C8H 3IDIB 2PO6B 3QJTB 3RY6A 1A64A 1J86A 2NNXA 4NRYA 1TJHH 4UV7L 2CDFB 2Y2WA 3D51A 1YEJH 4MJ2A 4KKQA 2VN6A 1PD6A 5BS0A 4JMXA 3C9NA 2FIKA 4A55A 1FO0B 1PZAA 2LTQC 4LHUD 4YQXH 1MOEA 1N6QH 4PGBB 1JWSA 1RJCA 2AJSL 2DZEA 3AITA 2R69A 2FX9L 4JKPH 4XNMB 1QZ1A 4ZX5A 1I31A 2O6EA 2MCPL 4Z7AA 3TASA 3AACA 3QRLA 4OKDA 5BXFA 2Z93A 1F4XL 4KH9A 4NP9A 5JTWA 5DS1A 3LNDA 4JE0A 4JRYB 2AV1A 4NERA 1LEGA 3AW5A 2R0ZH 4YE0A 1OIOA 4HU8A 4HFWB 5I0DA 3LIZL 4K5NA 1PCSA 1FNGA 1MCJA 1BD2A 4FA7B 4GKNA 5IBLD 1RXLA 1MAML 2IV8A 1S5IL 4UV4L 4ZUWA 4IBUA 5TDNA 4B9PA 3VFVA 1T7XA 3Q2CA 2CHXA 4WV1C 1JXKA 4XBEL 3L13A 3S4SG 3FQRA 4GG6F 3BGMA 3ROLA 3DMMD 1J7VR 4FLHA 5DD3H 2FK9A 1N8OE 1UKTA 1V3MA 4NAMA 4ONHA 2VO5A 1CXFA 2ATKA 4NQXA 3QQNA 1DO6A 1SLUA 1I8KB 3KBPA 1FQ9C 1EZLA 3HG1E 4YO0A 3VM5A 2EH8H 1HL4A 4Z7OF 3L6FA 4M56A 3K4DA 4U1KA 3IFOA 4KKLC 4ZO9A 1PGRB 3PQYB 4JQXA 2GYSA 2IAMD 4NQTA 1LM8V 3ARYA 5HJDA 4MQ7A 2BH0A 1QAWA 1QVOA 2VDML 4P46D 2RQEA 2UY7B 5CS7A 3TF4A 5KW9H 2FBJH 2NY1D 3ZY7A 5JOFA 1UM4L 5C08A 3TX4A 1JGUH 3NJMA 2D2CC 2NNRA 2P7TB 1XSIA 1MVUA 4APXB 2APWA 4JHVA 2COQA 5DEGB 1OF0A 3SY0B 5F89B 3RX5A 3UJTH 2BY0A 1S7UB 2CO1A 2O6FA 2J8HA 2R0KH 1X9LA 4P2QE 1LEKB 4HKJB 4TTGA 1PFCA 4LCIL 5HTSA 1JMXA 2FYVA 3EOBA 4G3YL 4HT1L 3HFFA 3TN0D 1MW0A 1MQKL 2UZPA 1Q1JL 4Q9RH 3LNEA 2FSDA 3RL1A 2WKOA 4LESA 3GNMH 3LVEA 1NMCB 1N8ZA 1I7UA 4OUUB 1RZGB 5D1QE 4IRZH 4LOUC 25C8L 5HVHB 2XI9A 3L3KA 2P1YA 4YXKH 3KJ4C 43CAA 5F7HA 1E4KA 4PJ9D 4LEXH 4AQZA 7PAZA 3UAFA 3OQRA 4WFGD 4X6FA 5CLYA 3R06B 2X4UB 3K6SB 2P5ED 1OY3B 2XTLA 3IGFA 1QSEB 2BHYA 4LSSH 2APSA 3EG9B 4HJGA 1N6QL 3W9EB 5I0XA 2PCPA 2VDQH 1AGCB 1F58H 4JKPL 1FH5H 4PWIA 5IEHA 3HR5A 3S34H 3KS0H 4P23D 2F53E 5IR1A 1P2CA 3FB5A 1T5XA 2A9DA 3HBQA 4QEGA 2XTSA 3NCFB 2YAHA 2O1AA 4B0MB 4AYFA 5A6MA 3CJJA 4Z8FH 4KJPC 5E7FA 5J06A 1QFWM 1YYMH 1HC1A 3BH8A 2WVTA 2BFGA 2R0ZL 4FNRA 4RWYH 4BDVA 1ODAA 3QR2A 4PS7A 2WLLB 1YA5A 2IH1B 1OCZB 3DO3A 1H6FA 3N0AA 1NQBA 3B9KA 3MRNA 5HHME 4KJWC 1AD9A 4OI7A 4D9QD 5CXPA 4JFHD 3AQYA 1KN4L 3MBEB 5D5MA 1KYAA 3I84A 2X6AA 4KNUA 3O3EA 4LL9A 1BQHB 1NCCL 1EMTH 2OL3B 1OCWL 4XTRC 1UEMA 4Q9QL 3L8QA 3QNZA 1JYWA 1JV5B 4YDLC 3FZUC 4K71B 1S3KH 2VC2L 2X38A 4XO8A 2F54D 4JQIH 2EH8L 4POYA 4YE4H 3ZUCA 4WEUD 1KTJA 1CXIA 3IGUA 5DRWA 1MCIA 5ANME 1F97A 1U8NA 2X1QA 4C58B 4GI8A 4P99A 5FA3A 1CICA 1BJMA 4FD0A 2AITA 5GIRB 3EFFB 5H94B 5JXAL 5JIMA 4UDUB 5FWQA 1NC2B 1FC1A 2P8MA 5LLIC 4H8WH 3M88A 4MXVE 3FC8A 2NSQA 5HI4C 4PGEA 1E5AA 3BLPX 1QWUA 4OCWH 2FBJL 2UX7A 4E42A 3S5LA 5F3BB 2E6QA 3MREA 1I9EA 1ZGLM 2LAAA 3GZQA 3LHAA 4I18C 1X44A 4ZNCD 3QWOA 4BZ2L 1XD1A 3U6RB 1OPGL 1XCTA 3DX0A 4KK8C 4TULL 4MCMA 3TVMB 2HJFB 4ZXBD 3L9RA 4QGTA 3UJTL 3WFEL 1IT9H 1EEUA 2R0KL 1HHKA 4QHNB 3KYAA 4RX4A 2QQNL 3DECA 4I8DA 3D8MA 4X98A 3TCLA 4KTEL 5D1ZA 1FPTH 3IE4A 2XQYA 4F7MA 2X1WL 4O2CB 4KK6C 4P4KC 1RL1A 4QWWC 4ZDHB 5DJXB 4HGKC 2VLKA 4DFHA 4M7LL 1TMCB 3CXFA 4FXKB 4PJXE 1T7YA 4YHKH 5HYJA 3QIBD 3QULB 3RBSA 2VUOA 4XXDA 5AZUA 4I0PA 4NM8H 1WVZA 1WCQA 4LEXL 2W80C 5T3XH 1EJ8A 2IH9A 3DVIA 4JJ5B 2IALA 2YIHA 4IW4C 2EVJA 4PY7B 2PABA 3ISWA 3X3GH 3RVXC 4ZUSA 3W37A 1SHXA 3VWKC 4PFEA 4EEEA 4KWUA 5KSBE 5DD1L 3BT2H 1ETZA 1NCAH 4LSSL 3HB3C 1G9MC 3OPUA 4J8RB 1S7SA 4J3VA 2BNUB 4H13C 2Z4QA 4N2GA 4NPYA 5D9SB 5T1LA 3GTNA 5EEWA 3S34L 5D7LD 5CJ8A 3DJ9A 2IV9A 3II1A 3MLZH 5DMGD 4PRIB 2YFOA 4WO4A 3NDZE 4JFZH 4ZW5A 1U8HB 3L17A 4Z8FL 1D5MA 1BFVH 4UNTA 4AUYA 2VQUA 3BN9D 1FBIL 4WW2A 5DEFA 2VKXA 1UOKA 2EIZA 4G43B 2OAAA 4YEEA 4BCZA 2X0UA 5MEQA 4M8UA 3S35H 4WRLA 3W0WA 1N5YH 2HXAA 5C7XH 3KL5A 4TSBH 1SUHA 1T1WA 2YMOA 1E2VA 1P1ZB 4IRZA 4M48H 4JFED 4AUUA 3CH8A 3WHXA 2FTAA 4LHUB 2HA1A 2DTSA 4JM2D 4AGQA 1LHZA 2JKSA 4JFDD 2MMXA 5AALA 2AABL 1I8IB 3GJEA 3HJ0A 1GY1A 3PXJA 1WG3A 5SV3A 4NUPA 3V0WH 4DKTA 1FC2D 3CLFH 4JM4H 5A43C 5JW5A 3IDUA 3H3KA 4H44C 4MMZC 4YE4L 3QZBA 4OQTA 1T2XA 2R4SH 4XP6L 4LQFH 4HJ0C 4WWPA 5FYJU 2QSCL 1WEJH 3PU7A 1RIHH 4ZW3A 2Q76B 3TT1L 3U4KA 1RUAH 3QZWB 4N8CL 1AOHA 2P5PA 3FCTB 3PY9A 3BISA 4I1NB 5C92A 3TF7C 4WEEA 3CG8A 1UJTA 1QEXA 3PHAA 4GJTB 4A7QA 4YNYB 3HG4A 3WG7B 5GZOA 3IDMB 1TTGA 1FL3A 1KNOA 3SBQA 4OCWL 1MVFA 1NGQH 1V05A 4UQ9A 3GXUB 4UB0H 4IMKC 1P5UC 1FVDB 1AO7E 1OTSC 2BP8B 1IC5H 1O5DT 2O5NA 2YN5A 4BSWA 3DMMB 1PF3A 3THML 1NDMB 2YSSA 4ORGA 3GMNA 1JNLL 3GLAA 1E8WA 2WXLA 2PETA 4OFDA 3FUEA 3DETD 5DQJB 2EH7H 3NCCB 2X7LA 5FGCB 2HFGH 4QGYA 4U2ZA 2YWYA 1F4WH 4KFZC 2VL5B 4OGAD 5CCKH 4JQIA 2IAMB 2VXQL 1FPTL 2H0FA 4M7KL 1WT5C 3GLZA 3QG7H 4U1SA 2JQMA 1Z9OA 2FEDC 3NFPB 4W4NA 3GGWB 4P46B 5GGRA 4AIOA 5HSFA 4O4YL 3CFBA 4MDJA 15C8L 2XG4A 4JFYB 1BQKA 3JZYA 4LLMA 4KUCF 2NY1B 4N90E 4MAZA 3FQUA 2VDLB 4KTGA 4NRZA 2VDKL 3OJDB 1PLAA 5B7MA 3ARFD 5EULV 5T3XL 4PRDB 4AM0A 3T0EA 2ICCA 2ZJSH 4F1SA 3Q8BA 4MX7B 1U93B 2WTRB 4Z7VA 4W9HC 1BHGA 4NQQA 4E9XA 1Q38A 4ISVA 4LXFA 3HTLX 2BSTB 3CC1A 5I15H 3BQUD 1B2YA 3UBXA 1A6VL 3LH2L 4NDMA 3ZJAA 4KX9A 2OXGB 5CEYB 1DANT 3A67L 5G4MA 1HS6A 1TO4A 3WEAA 3PGCB 5K33A 4F15C 3RJQB 3AMLA 1D7DA 3I85A 4QRQB 3ZR6A 2EC8A 5F96L 1JDAA 4JFZL 3TNNA 3MFGB 4GKSA 3T65B 1MCFA 1HWGB 2DM2A 3APCA 2F58H 4MB5A 1QW8A 2V5SA 2I69A 3LD8C 3WSQH 1I8MB 3VTMA 3F8UB 2R2BA 4LPCA 2B15A 3TOPA 2GSGB 2PXYC 3MN8A 2X2UA 4PJ9B 1BEXA 3S35L 3STBA 1VADA 2PW1A 3DV4B 4JRXA 2H32B 5C7XL 1NKOA 4M48L 1T1YA 5DCCA 2P5EB 4LCCB 1ZE3H 4GQQA 4FG4A 3RBGA 1JV2A 5H37G 1CLVA 1IAMA 1S7VB 3R8BB 3BUPA 5FYKD 3TBVA 3C5SB 1HILB 2J8UB 5I76A 4KO5A 3KYNB 5EIIG 3QUYA 1HH6A 1CVRA 3TIEB 1CDIA 4JM4L 4FQIH 3FN0L 3P3YA 4GUPA 1D9KA 4QRPE 1GMEA 5DZPA 4I77H 3MRDB 2R4SL 4JL2A 4LQFL 4YHMH 4ZMOA 4XNBA 1CL7H 3HPLA 5E00A 7TAAA 1WEJL 2J1KA 3Q9PA 4LCWE 3ULAB 5EIQA 3MJ7A 2Z91B 3OHMB 4PGJA 4LSVL 4MNQD 2HUHA 3EYVA 3QQ4A 2UWEF 2PPDA 1S9VA 4PLKD 5IJKC 1QFUL 4M7ZB 3SYPA 1JWUB 3AC0A 4OZHE 4NO2A 5EZOH 5JIKA 3RFZA 2PTUA 3VGGA 3LKSA 5EPMB 1JGVH 4EN3A 5C0EA 3T2LA 3GLDA 5JIDA 5KBDA 4X8JA 4UB0L 3V2AR 4DKEL 2GI0A 2OJZH 1JTOA 1T83C 3ZYZA 3H9SA 3CPLB 5FO7B 4PJ5D 1RU9H 1V7ML 4Y16D 3ZU8A 5ICZB 3VGHA 3V4VL 3LKOB 4R84A 4RISL 3MLSH 3GIVA 2YPKA 1BBDL 3TCTA 4XPHL 5IFJA 4WLCA 2BIIA 4O2EB 4X9GA 2L7UA 4LKXA 5INCA 4FP8H 2XA8H 5JPMC 1MVYA 4XGZA 3CU1A 3QEHB 4FJ6A 3REWA 1A21A 3UAEA 1UB5A 5E94B 3RJOA 2X4RB 1IGYA 4ZUVA 2Y24A 4LDOB 4XT1C 3WS6A 4XCEA 3FTGB 5FCUH 5GRJL 2OZ4A 3G9VA 3SEPA 3POHA 3HC3L 3B56A 1O6VA 3BKYH 3IJYB 3JV4B 4EVNB 3O9WA 5BZZA 3C08L 3QRBA 1A4AA 2J5LC 5ICYB 2BRRH 2F5BL 4ZXBB 2L7JA 5KOVC 4B3VA 4HS6B 1BFOA 2FLRT 1E42A 4PV9A 3QWRA 5I15L 2CR3A 1TZIA 4NZUH 4PCTA 1RV6X 1TQBC 3LRLA 2J4WL 1T0NB 1PAMA 4JZOA 5TK4A 1BQUA 2R15A 2XN9D 2B5IB 5KJ7E 1BZQK 1NC4A 3FU9A 5D7JA 2VZ3A 1MCEA 5DTFA 1O7DE 4HP5A 4PS4H 2CO7B 4XNUL 3Q9QA 4M7LT 4N2OA 4QIRA 4WK4B 2WQWA 1I7TA 1YAIA 5I73B 5B38B 2F58L 4KKAD 3ARPA 2DEYX 1GZPB 4NQVA 1L9NA 1Z0MA 3MA9H 5EO1A 4JY6A 3MCKB 1COBA 5INDB 1DJSA 3MCYA 2H26B 3KCPA 5HD8D 4YX2H 4AC2A 3KJ6H 5IW3A 2YGPA 1HSAB 2EACA 5B38G 4GKZA 4J3OF 3GMPB 2E9JA 5DUPL 1E9QA 4Z95H 5CEZD 5EU3B 3U25A 1O6SA 3HOGA 5IESL 3ORJA 1AD0A 1Y07A 2B59A 1PZ2A 3B43A 1ZLDA 5LJYH 5D7LB 1RJYA 2ITFA 2QPFA 4FQIL 1OP3H 4DUWA 1NL0H 2J1ZA 1ZA3A 3EH5B 2WAHA 2Z92B 3V7AG 3ZE1E 2BHZA 3RY4A 4OJDH 5CEXA 1CD1A 3UZEC 1TVHA 5IMKB 4CMHB 5CSZB 2D0GA 1TTBA 4MHHI 2ZCHH 5E1AB 3FW6A 2BW4A 3B1TA 2COVD 2ZTBA 1FZJB 3OPZL 3QXWA 1S7QA 3NTCL 3DGCR 1OXYA 1Q9LB 5EZOL 5HHVH 4JFEB 4NQCD 1X5XA 1JGVL 1FFPB 5KUMA 1JGDB 4MRCA 2R8SL 1XR9B 1F8TL 5I1IH 2DM7A 4JM2B 3MLYH 2GJZA 1FA4A 3D69B 4JFDB 2WQAA 4X7TB 2VRQA 3ZDXB 1RU9L 1VACA 2XDHA 4OB5H 2YD7A 3ECBA 3UO1L 3FK3A 1JNHA 4MA1B 3B2UC 1R3KA 2G5BA 4ZFOL 3OKLB 1E5CA 3WFCL 2JJVA 2NYYC 1QFWH 4YZFE 5F9AC 4X8XA 4PJCF 3OKMB 1G1OA 3E2HB 4FP8L 2XA8L 4S10A 2E7CA 5EH1A 2G75A 3P9LA 3HG1A 3GBMH 4IK6A 3Q8FA 1MFNA 3UX9B 4Z7UE 2H3NB 4YXHH 3F5WA 3QUKB 2BP0B 4NOBA 4KKCC 3VRJA 2ADIA 5FCUL 5AL0A 3T1FA 3NIDB 4MYPA 3KPMA 3OB8A 2VQ1A 3SBWA 5BVPH 3BKYL 3IKKA 4N8VB 3CAFA 1FZKA 3DDGA 3KPNB 4L9LA 4XHQA 1YYLH 2ZXBA 2CM6A 5DRNA 3EJYD 4FAAB 4UOW0 1UG9A 1JPSH 2MNWA 1U8KA 4EJ1C 2MKWA 2KDYA 2XOTA 4NZUL 5F0JB 2CPCA 3FB8A 2O61A 3US9A 1NCGA 5J8OA 5I6KA 4N8VG 3QCUH 2Q7YB 5CSBA 5E6IA 3T6WA 4ZI8A 3G04A 2NZIA 3Q0HA 4I5BB 2IH3B 5C0FB 1OAUL 4XCNA 3FFOA 2IBZY 1XMWA 3A3YB 4P2QA 4QXWA 3EYOA 2PYED 1DBKH 2DTMH 4NN5C 4U3SA 3DSNB 5FLUA 5I8KL 2PW2B 4Z76B 3WIIH 4EDXB 2FYYB 2WQRA 4KTDH 2NY2D 3NJKA 3GSWA 2P44B 3MA9L 3ARFB 2A74C 1UXMA 1WZ1L 3MRCA 2JTYA 4FKHA 4YX2L 4NZTL 1O0VA 5D1QA 5AENA 3CHSA 2EXTA 3D2UA 3SPCA 1BBJA 3A0OA 1B0GB 5E9DB 3MRKB 3KLSA 5I19L 3OGCB 4Z95L 3FL7A 3GJFK 2DWEB 3KW7A 3GSXA 4LCUB 3RVWD 4QXVA 3TT3L 4YGAB 4A6YL 1XXDC 4DPRA 4IGBD 3MRHB 4U3CA 3HC2A 1BLNA 1M6OA 4NLAA 3KAAA 4FKEA 1VB9A 5D8JH 2WXQA 3QYCA 2Y7OA 4N86A 2UXTA 4G70B 5F7BA 4X0NA 2BO0A 3QIWB 1OAJA 2FL5B 4JUSA 2HLAB 3BZEA 3D4ZA 2W60A 3I50L 2F53A 5ETUB 3DX3A 3SJVB 1ORSA 1MRCH 4F8TA 4O58H 3V6FA 3RP1A 3H8NA 2OULB 4AXWB 5HHVL 3N85L 4UINL 5I1IL 3MLYL 5EA0H 1V3KA 4PIRF 2WUCL 5KTEL 3D05A 4L8CB 1ZXQA 3F84A 3FCSB 3LEXB 1DBBH 4LARH 1KTBA 3EJZD 3ARBC 1TJGH 4L3ED 3AQZA 3S0PA 4NGHL 3KLHD 2EYSB 4JRYE 1CFVH 2YQ3A 5KANG 5BV7B 2Y5TB 5IKCB 3RLSA 4MNGB 1UURA 1HI6B 1P4UA 5T1JA 3GBML 3OZ9H 4FXLA 2VLLB 1UZGA 4XWGL 3FUJA 5DFAA 1UOVA 4YXHL 5AVTB 3P4NA 1A8JH 4XB3A 4OLWH 4OF5A 4V11A 5ANMA 3F6JA 1TUPA 1PNCA 1QBML 5KG9B 2CGZA 3I6GA 4N2BA 5GGTH 1LK2A 3QQXA 2YXWA 4RGNE 3GUTB 1RLWA 1HE7A 3E6FA 2WM0A 2XVGA 3U0TB 3FQYA 1CF8H 5F88A 4NI6A 3MV8B 4MASA 2FNWA 3DX7A 4PJ5B 4Q6KA 4BELD 4U6YA 2HRPH 3CPUA 1MIMH 3HE7D 2XNAB 3ATBA 3O8XD 3QDHA 5KYYA 1UD5A 1Z9LA 3BPOB 3BZ4B 4P06A 5D7KE 1JPSL 1NBVL 1A4CA 2APXA 3HAEA 2AP2A 3QQ3A 4N6QA 1WA0X 3MNZA 1UFUA 3TYGL 4F7PB 2LQRA 1F4YL 5B8CB 1CGSH 4P48A 1MUJB 2DMHA 4G6KL 4UAHA 1M4KA 4HWEH 4XCFH 4FKKA 3H9HB 4XBPA 2Y23A 2Z0BA 4FQHA 5DS8A 4YVNA 3JTSB 4PJIF 1UD4A 3CVBA 3VFTB 1SXSA 4PLOB 4A68A 5CHNA 2WYHA 5E8NA 5L4FA 1AQDB 4GG8A 3RGVD 2DTML 2DMCA 2YC1A 3KPRE 2P80A 3RILA 4AT6B 4LLVA 4NQSB 1BFTA 2WGXA 4E9WA 4BFIB 1IEAA 3C60A 3ZKSD 4U6XA 4DT2A 4KTDL 4U0RC 1RUQH 3NDYE 2G0KA 4G1MA 1RK1A 1KDJA 4U1HB 3FT1A 4HUWB 1KGWA 1L9PA 4WY7H 3RWFA 5BMFL 5AB0A 1ZT7B 3LX9A 1WPCA 2A4EA 1QBBA 2E9WA 4MMYA 4UZSA 1BF2A 3AT8A 3HCVB 4KQ4L 3M17B 4JFXB 3KWVA 3U4BL 2IBBA 4CMMA 4QUOA 1XTLA 2XN9B 2E7DA 3WTYA 2LW3A 3D50A 3GTTA 4OD3L 5KSBA 1NDGA 2MKLC 1W80A 4RBPH 3KPSD 4ZMYA 4HCIA 1MFUA 3VAEA 1UM5H 2K6YA 2NY0C 4I9WD 5DK0B 1Z5LB 5CWSA 1D5ZA 1ZHKB 4Q0XL 4HIHB 3SGDI 1CBJA 3V5KB 3QC6X 3US0A 1YN6A 2JB5H 5G4NA 4R90H 4LDCA 2DV6A 3NPSC 5EMYA 3QAZB 4HISA 1TT6A 4NQDD 5KS9E 2VXTH 3ARXA 1QW9A 3DSFH 4D8OA 3N91A 2A9BA 3REVA 5EA0L 4DPAX 1A1NA 1QX1A 3FFCD 4JL1A 4K8RH 4M61B 4BWUA 1PNDA 1TJGL 1CGVA 4ECNA 2WGNB 1NMBH 3MRFA 2K78A 1M71B 1KGUA 1W0VA 2AKRA 2ICES 3BIKA 2BVUA 4WNJA 5GSRB 1T66C 4AEHH 4KZ0A 3B2MA 4QRRD 1E2ZA 4U1LB 2VRKA 3RWHA 4APQB 5I18L 1F42A 2CR0A 2RR3A 3OZ9L 3ZYJA 2OPCA 2WLIA 3GBDA 3PE9A 1IGCL 3IEAA 3P77B 3PUCA 4I1RA 4WU5B 4G6FB 4XNYH 5AVWB 2OLDA 4TVPE 1C16A 4F7TA 2XXMB 2RMNA 5SX4I 2WB7A 3T0XA 4YSRA 4NQCB 4OV6F 1JHTB 3BCDA 5GGTL 1T2JA 5EUOF 2BVPB 2VR7A 4H26A 3OTTA 1BEYH 4CVXA 4M8QA 4Y1AE 3Q2VA 5DHYB 4YHPB 12E8H 2EINB 2F1AA 1E4WH 3AY2A 1MHHB 2HRPL 3BZFB 1LE5B 2C5DC 3ESMA 2K4WA 3DYPA 5I5JA 3L7EA 2V9RA 3L2LA 4XZ4A 2WWMD 1T20B 1AO7A 5LCVA 5TK2A 3WIAA 1RPKA 2R39A 3VXSD 5C9JA 3IU4H 1BZ7B 2BCKB 1HNYA 3G5ZB 4NC2B 4O51A 4UTAH 1NLDH 3RWCA 3IGAA 3B5HA 1W0WA 4UBDC 1H5BA 3BVNB 1FORL 3NFNB 4JHUA 2RIKA 4ORZC 4HKBA 4FERA 4A7UA 5IF0B 2KKQA 1RUQL 3JWDH 1ZLEA 2FJSA 2NY4D 3MJ8B 4JHWL 3RNKB 3W39B 2D31B 1QSVA 2YZ1A 3ERXA 3V4UL 1KPRA 1JNJA 5BO1H 1AXSA 3O41A 4YXLL 4PJBE 4WY7L 2E76C 1UT1A 5IHZB 1NPNA 2H9GB 1L3NA 3OKDB 1D3CA 4GQRA 2PYFA 1BQRA 3D0LA 3PCYA 3SPVA 5SWZD 4TNEA 3UTQB 3BDYL 3KVPA 2OA9A 2GBAA 3IM1A 4WO0A 2XHNA 1KIUB 1YG9A 3GXMA 3J8F7 4BUHA 3C5ZA 2PYEB 3IF1B 1GGBH 3DGGA 2DJSA 4BFEA 4P2OD 3U30C 2QGCA 3X3FH 2D4FA 4X6EA 4TUJB 1EXGA 2NY2B 5TGBB 2DLHA 1MCKA 3X1BA 3QJXA 2UZXB 5BZXA 4RGOL 1C5BL 1BXAA 3CHXA 2VXTL 2X6BA 3RIKA 3DSFL 2ORBL 2JKJA 1ZLUH 3SHSA 5K39B 3DOIA 3TYFB 1U2HA 2R2HB 5CGMA 2ZNWA 4XWOD 3ZT7A 3WJJA 4PRIE 1CD0A 5E2TH 1WBZA 1TJIH 2JELH 4QY8B 3ZR5A 2UZIH 1G6RB 2UY6A 3L5XH 4YDNA 5EOTA 1IC7H 43C9A 1JHKH 1TPXC 2A73A 4QTHA 4LL4A 4NRXA 5IV2A 5ERWB 3MJGX 2Z31A 3ZQWA 4NUJB 3WY4A 2EE2A 4JQXC 5JDJA 5JHAA 4UQ3B 1QI4A 2O93L 2A9CA 1OSPL 4ZUTA 1E4XI 1DQVA 1SEBA 1NWPA 4HV8B 4QRPA 2P45B 3MRIB 5J1AB 3RUGE 4LCWA 2DI7A 2Q3XA 3QEGH 4FJYA 5FO2A 3AMKA 4AEFA 4C83A 3WEMA 4GIOA 4NNPH 4CADA 3PWPD 4B95C 5F7AA 4AM0Q 3Q05A 1IAIM 4OZHA 3HZYA 4A38A 1XF2B 2Q0ZX 1FYTD 3DHUA 2WWKT 1BFSA 4L3EB 3KPTA 32C2B 2GW5A 2FO8A 2KDGA 3VMOA 4N85A 4KI5C 4WW1B 2IGTA 5DRZA 1R6VA 4GT7A 2X3CA 2ZZUT 1UM6L 2XX0A 4G42A 3HI5L 4B41A 4YDLB 1OM3H 2E5EA 5IQMA 4ELDA 3FO1B 2H3KA 3N43B 5LNEA 1BQ5A 4RH4A 4YDIL 3PGDB 4HLZG 3TZVA 4ANVA 2X2IA 1E4KC 1C5DA 4J4PD 4QI3A 3JWDL 4FQCH 2F8XC 4XXWA 4Z78A 4I7ZC 1EGJH 1J05B 3O8XB 2OMTB 4HUKB 2W9EH 4X7EC 1ANUA 3TV8A 5ACZA 5C2BH 2CHWA 2ODHA 3W82A 2KZWA 5EOCJ 4PHZA 2IWEA 3JV0A 3B6SB 5L2KD 3VRIB 4EUPA 4KJQC 5F3FA 5KBKA 2YBRA 3OZKA 2AQ3A 3BP4B 4J8QA 4JO3H 4MA3A 1HXYB 3QORA 1T2QL 2VXSH 2WINA 4PJGF 3ROOB 4FQ1H 1QSFA 4YBQC 1JZ7A 4UT7L 3GSNB 3RGVB 3B7UX 2NY7H 3GDCA 3VI4B 3QJZA 4PBDA 2FHBA 2Y1VA 1KENH 4MBOA 4LPUA 3X3FL 5FCSH 3N5AA 4UTAA 2A1WH 3UL4A 5I8OL 3BRFA 1PG7X 1UWEH 3MNWA 3K0YA 4O5LL 5CJBA 5LGKA 3B9KC 1MH5A 4P5TA 1YEWA 4AMWA 3B7SA 4AENA 3SCMA 3QDAA 2WLHA 1J0ZA 5F9WC 1JI2A 4IOFD 4QTFA 3C6LA 1CDYA 4JJOA 3NRQA 5F21B 4DKFH 1SYVB 4WHTB 3KW8A 1Q94B 1TJIL 3QH3A 2UZIL 5FHBL 2I07A 1CYXA 3GMMA 3KPSB 1DQMH 1IC7L 4PJ7F 4HUNB 4JANB 3VA6A 3WN6A 3QYMA 3N6YA 4Q58C 5JXEA 5CZXC 5I1HL 3HB3B 4G80B 4WFGE 1CICC 1G9NL 1JRHH 3EDFA 4PI0A 1MHPH 1A3RL 2CHNA 3Q6FB 4JFFB 3W57A 2P5EE 3QK0A 3WN5A 4UUJA 5C0CD 4Y4KA 1DVQA 3O0RL 4GAFB 4HJUA 5LUMA 3K2UH 1FIGH 3H9YA 5DFVD 1SNRA 3MRQA 2BSCA 3QEGL 4NQDB 5D1XD 2A83A 3FCUB 3TV3L 1C08B 1E5UI 3IN2A 3QSKB 3RWJB 5EC1A 1KJ2B 1DFXA 3D08A 4WI9A 2YK1H 3A47A 5E1GA 4ZW8A 3PL6A 4W70A 4J3OD 4HUUA 3EIFA 4RA3A 1NIDA 2WOYA 3BUBA 3BPLC 4OU3A 5F9DC 4YSTA 4MZIA 1W6WA 4OJAA 1SDYA 1I4FB 5E51A 1FUNA 1TNMA 3IXAB 4K5MA 3G6DH 4ALAH 1NCBH 3HIZA 3PRZA 1Z6JT 1DN0A 4FFZH 1CPUA 2PLTA 4QRRB 4PRBA 4ZYKB 3CMGA 1SDAB 2ZUUA 4D9QE 2W91A 3PIQB 4JFHE 4U1NB 1VCBC 2DLEA 4B53A 5F9OH 3MOAH 1K8IB 4PUBH 2XG5B 1NUFA 2NYZA 4RLDA 4E41D 2OFQA 4ODXA 1UA7A 4LF3A 1FV1A 4XC1H 2FX8L 4WWKA 2EP6A 3T4AB 4Z7UA 5ABZA 4I0PC 4EF3A 3M45A 5F1OB 3ZQXA 4FQCL 1M7UA 2F54E 2X4SA 4ZX3A 1EGJL 3DHMA 1YMMD 1FAIL 3BAYA 3M7FB 2Q87A 4AZ8B 2NXZC 4S0HA 2QGBA 1RY7B 5M95B 4GXVH 4DK3A 4ADJA 3QJOA 2YGOA 3K72A 4P4RA 1T0OA 4MMXB 1U3HD 4K0OA 2FRGP 2LVCA 3DX6B 3MACL 4W9LC 1I1YA 1WO2A 4P5KB 2YPLD 4M4RB 1XGQA 2DM3A 3T77A 4MJ6A 2ZCZA 4TTDD 3CSYA 4AIZB 3QZLA 2X6VA 4WO4C 3GZKA 1PFOA 1QR4A 3RRQA 2Q2LA 3S96B 4B9FA 4DCQA 2AEQL 1AHMA 2LR4A 4P3DA 2YPVA 5KJ4A 4WW2C 1K5WA 3QZMA 1RULL 5F7FA 3SYCA 2A1WL 1YNTB 1T21A 4YSDA 4WU7B 4Z0XB 4EMZA 4XPGH 2NY4B 5IMMA 4JG5A 4PJ8D 1QA9A 4XI5D 5FYJL 5D7HA 2OR8A 5D6DA 3TTYA 1MG3C 3KPPB 1AKJB 4KNTA 1INEL 1NAKL 4KJYB 3CFEB 2WSPA 4H40A 1A7PH 4XPAH 3ULUD 4G7QB 3JWNE 4QXUL 3KR3L 5AKVA 4H7VA 2J1YA 2OMYB 1O7SA 5IVXF 1J1PH 2G5UA 4LZKA 2DQIH 2MSPA 2CA4A 3H4HA 1DQML 3HMXH 4WFFD 5HDBE 2CZNA 2V9TA 5ITBH 3FOMA 4PI2A 3Q6GH 5DYOB 1W16A 1NGYA 4IDLA 1ZK5A 3NRFA 3IVKB 1EZUA 1IFRA 3ECWA 5E4OA 4AGPA 2VJXA 2XJKA 4GBXD 1LDSA 2MCG1 1Q0EA 4K7PY 3P4MA 1G4RA 4J27A 4LVEA 4LVHB 3IDIA 4XHJD 1N59B 1JK8B 1G7JA 4DAGH 4ADGA 5IWLA 3S37H 1FIGL 3SBPA 2PO6A 1PVHA 4TVPH 4F15B 5GZOC 4GRWB 3UZQB 4F8PA 1YZZA 2CDFA 3I6KB 1S9YB 3LQZB 4L1LA 4JPSA 3DO7A 3Q13A 5C71A 5D7LE 3GSQA 1SJVA 3NCWA 1FO0A 3I9GH 1FG2A 2YK1L 5EU5A 5FFGA 3B5TA 4FHKA 3DLQR 3DWTA 2FUQA 2ZOKB 3ETTA 4J12A 2V5RA 1DE4B 1JIBA 3ZUNC 3VFWB 2QEJA 4F20A 2BVOB 1DTUA 2HCZX 8PAZA 3F7RA 4QDGA 3MDJA 1XBRA 3G6DL 1EFXB 1B3IA 4ALAL 5AAPA 3WS3B 4MJID 4EXPX 2ICWB 2N0KA 5FYLD 4L0YA 3QNXB 4LAJH 1Z1WA 2AJYH 4RESB 4JRYA 1MJ7H 4L4TB 1VESA 1CLYL 2IPKA 3AXLA 2FWOB 4HFWA 2JJUA 5F9OL 1SMOA 2WLMA 5I2IB 3CDFA 4FNPA 4GINA 1SY6A 2VDPL 1ZT4B 4DIXA 4WUKH 1NCWL 4D3CH 5GGSY 1QLEH 4JFDE 5ITFB 3ZDXE 4XC1L 3BAEL 2ID5A 4H8WC 2NTFA 5DJZB 4BFRA 2DQGH 3TL5A 3DYMA 4TKWA 1PZ3A 4A67A 1EJ6A 2DQMA 3T0EC 1FYTB 2K3HA 3BWUC 3JT2A 5IMLA 4BFJA 3X11B 2F6AA 4NN6B 3MROB 4MDIB 4GXVL 1CB4A 1OZUA 4HEPG 1OHQA 2RTTA 4GW1B 4OZFG 4GXFA 3KG5A 4AJYV 3FUNA 3EDJA 1VENA 2F8VA 2VKWA 2MH4A 3B9EA 4XP4H 4NX0A 5FKAB 2ZCKH 5AUMB 2J1WA 4JAMB 3PQYA 3NIDE 3FH8A 4FFZA 2PCFB 2DQEH 3ILEA 3CGTA 1HVXA 3GXPA 5AW2B 3JV5A 4IRJD 2YAQA 4M6NH 3AQDA 4M62H 3AXIA 1EDYA 4JCLA 3IJHA 3LNIA 4Y9EA 3ZTJH 1KTDB 3WFDH 3KPRA 2X42A 1SOKA 3D39E 3QIUD 3R18A 2WLYA 4U1MA 4APXA 4KZDH 4NJ9H 5DSCB 4OQ1A 1WTLA 2HX9A 3IDYB 3OAZH 5ADOL 4N5UA 2E9BA 5L2KB 4WI5A 1S7UA 4R4BB 5IW1A 4BH8B 4M93B 1LEKA 4HKJA 4B97A 4YIQB 4K23L 3QUYC 1BMZA 5L88H 5SWQB 4LKCB 2WB1A 2EQDA 1GA2A 2WXMA 1D9KC 2C34A 4Z0BH 1WDAA 1U8PB 4G8AC 1E7VA 3QR0A 2AXGA 4U1GC 2HTKD 4BKLB 3NZUA 1IV8A 4OUUA 1IGIH 1RZGA 2CUMA 3GHPA 4I88A 4G5ZH 4ZD3H 4W68A 3LOWA 2Z7YA 1AIFB 1A4JB 4PS8A 1QFHA 4EN2A 1RQ5A 3OKEB 4TVPL 2WLJA 3RFZC 4EN3C 4C8XA 3R06A 5IMOA 1T1XA 2X4UA 2ZYIA 3K6SA 5GRWA 4PJFB 4W6XB 1UA3A 2EIKB 5MEPB 4FABH 3I9GL 3QVAA 1RPQA 4PJHB 4HS3B 2H7WA 3EG9A 1FCGA 4HZLB 5CZRA 3WYRA 2QDVA 3LMJH 4UT6L 2EEDA 5CZVH 1AGCA 3L1FA 4NZFA 1DZBA 5JYLA 3VFUB 3BD4A 1KB3A 5C0IA 1BQLH 4DGIH 3O3DB 2NYKA 2XX1A 2DBJA 2G9HB 4FCHA 3G08B 3UAJD 3HMXA 3BUIA 3MVSA 3WIFB 1MJ7L 2HT3C 2QQQA 5C0CB 2EVHA 1MXDA 2HX8A 1VFBB 1MF2L 1ROCA 2W9DL 1CGTA 2WLLA 2IH1A 5FFOA 3U2JA 3WS6C 3ZX1A 3ATFA 3JSSA 5FYKE 1ASPA 4D3CL 1QLEL 2DLGA 2XZAH 5D1XB 3D18B 5T1DH 3EADA 1CE1L 1V7NL 2FT6A 3O2DH 4PD4J 4DQAA 1FFRA 3L3OB 1BQHA 3O9WC 4G9DB 5I75B 2Z9TA 2DBLH 4X9BA 3NCJL 4FL4B 2PMZA 3BP7B 1EZSA 3WTVA 1I3GH 3QDMD 5ACLA 5JA9A 5EEXA 2CCVA 4QTIH 4Y1AA 4V1DD 3UIYA 1VSCA 5D2LF 3F58H 4MNQE 3FTWA 1NGPL 2UZYB 1CXHA 1TDQA 3U1PA 3NFSH 4XP4L 1OW0A 1WWWX 4JLRA 5B3JF 4X5PA 1CDBA 2ZCKL 5D7JC 4L1BA 5GIRA 5H94A 4WVRA 4Q6IB 3SN6N 1N0LB 1DJGA 4NUGH 1X7QB 3OF6D 1M7IB 3DX2A 4X2UA 5IB4A 5K1NA 2UVFA 1VRSA 4AV4A 4PJ5E 4LFHD 1MRDH 4M62L 1IAIH 5I1DA 4OVVA 3H55A 5F3BA 3VRLF 4UT9H 1G5AA 3L3HB 1A7OL 4R0LB 3WFDL 5MI0C 2CGRL 3K1KC 1YMMB 4KZDL 4EIUA 1X5GA 2GJPA 4H1LB 5E7BA 4UOW1 2HJFA 1HKLH 4TPRH 4GUOA 4R7NB 3JZ7A 4RETB 4G7VH 1IU1A 4QHNA 1PX8A 5KSAC 4ZX4A 4Y2OB 1KWGA 1YEFL 1ZOXA 2EXWC 4ZTEA 1GOHA 2YPLB 4PJBA 5HGGS 1KPVA 5K9JL 4NHCL 3L3GB 4H1LG 4OF6A 4HOZA 4HPHA 2VDRH 5JHMA 4O2CA 3HG0A 1LO5B 1Y0LB 2E75C 2GITB 5C0ND 3FONB 2FQEA 1IGIL 3C09C 2EEAA 1LLAA 4TOYH 1EUTA 1B3JA 3OAUL 4PJ8B 2FDBP 4JGMA 3ULVC 1DEEB 4KK5C 5AW9B 2IJ0C 5MERA 5D4QA 1RJLB 4JJ5A 2FEJA 4GW5A 3WKYA 4NN5B 2BWQA 4PY7A 5CBEB 3LPFA 2XN9E 4KC3B 2SODB 3VU1A 4XAKD 4PBVC 2NY5H 4F7CA 2EO1A 1A25A 2WQ8A 4L29B 1GKEA 1QEWA 3SODB 3VD5A 1ZE3C 4J8RA 4ZFGH 3K4ZA 1SJMA 1QRND 2BNUA 2YEZB 3VX1A 5B39A 2V8MA 3O45B 2RALA 3UTSD 3CZNA 5IUSA 1OGTB 3D09A 3KS0J 3STLB 2LU5A 2YRBA 3VD0A 4Y8AA 4JKWA 3A21A 1BQLL 4UNUA 4TLTA 4GKOA 3A4EA 3VGAC 4PRIA 4DGIL 5AW4B 3IK2A 3DUUB 4HPOH 4WTZG 1OTUD 1U8HA 3LKNA 1E28B 1RK0B 2IADB 4GBXB 4TQEH 3HS0B 5CGYC 2EE0A 3VQ2C 1HSBB 4Q89A 2LV4A 1ZY9A 5DJ0B 3CVIH 1P5VB 2JIXD 1B4JH 4FQJH 4PW3A 2RBLA 3ISRA 5GRXG 1AZUA 5D7IF 5CEZE 2XZAL 1HAWA 1P1ZA 3GDBA 3O3AB 3SBWC 3ILDA 3O2DL 5EEUA 2DOCA 4AK1A 2W0PA 3V5HB 2QQKH 3EO9H 3RUGA 4LHUA 3APNA 2CMRH 2JB6A 4F7EB 4QLWA 5LVEA 4ZMQA 2EDLA 3NIFF 4OJYA 1I3GL 4FTVD 1SXCA 1I8IA 4IIQB 5IP4A 2A0LD 3OV6A 4QTIL 1MQ8A 1ICTA 3F58L 1BAFL 2ITDB 1DR9A 3PP3H 4HFUL 2CHZA 3V0HA 3NFSL 4I0CC 2WNKA 4A63A 5E6IC 5LXGH 1AZZC 5FV1L 5BUAA 2MNUA 2Q76A 1OAKH 3KDMB 3ZHFA 2VDNL 3QZWA 2FR4B 2VQTA 2IPUK 3FCTA 5AYTA 4UM8B 5B4MD 5SX4H 2K6ZA 1WBXB 1BXUA 1E9OB 2NW2B 3E8UH 4K9JA 4JFQA 1BVKB 2IVFC 2DRUA 3IDMA 5MEND 3MRJB 2HJLB 4MRBA 5FW6A 1N7ML 1CR9H 2A9MH 1CO1A 1PD0A 1DSYA 1M1SA 3DMMA 3GSVB 5FS5A 3GYRA 3I3BA 5D1QC 2J44A 3TO4D 5C6TL 5I0VA 2O5XH 4PEEA 1HKLL 4TPRL 3NABL 4R2GB 5DJ2B 4H88L 4WEMB 5A2CA 2PCYA 1AS7A 1TLKA 4OR1A 4V2CB 1KYFA 2K8MA 5DQJA 1YY9C 2D3JA 3P2DA 2FQGA 3AM8A 1JZ2A 4WI3A 3JWNH 4NO5A 4R7VA 1UYWL 4MFHA 2VL5A 1YUKB 1KIPA 3BHBB 3CVHB 4OW6A 3MNMA 2IAMA 1QUNB 2HVJB 2KZKA 1DVTA 2NY3C 3OR7B 2NXYD 3NFPA 4Z7NF 4IRJB 3GGWA 4P46A 2A6DB 4B9KC 4CA4A 3DRQB 2PCXA 5HDOA 3TBBA 3V0EA 2EYTB 4JFYA 1WGVA 2G30A 2ZUTA 1W2KT 4OGZA 1HIML 1BZDA 3W9DB 4JKMA 3RVTC 3QIUB 3VXRD 5AKTA 3OJDA 4G7RB 2Q6WB 3IJSA 2GB2A 4PRDA 2RJMA 3V0AC 2LHAA 3IB4A 3T6XA 4Z7OE 3A6CL 4MX7A 4UT9A 1U93A 1YDPB 2WTRA 4AVJA 4K7FA 1X7SA 2D8KA 5FDYA 4HEME 1WICA 2BSTA 3S88H 2PYEE 4XH2A 3QFJD 4TVSa 2VLJB 1HE8A 2OXGA 5CEYA 3TN0A 1PTZA 1MI5D 2AJUH 3ZMEA 3PGCA 2ZPKL 4PJDF 1KCRL 4QRQA 1K72A 1I1RA 4Y19B 5BQDA 4ZMAT 2QADC 3HG3A 5AW7B 1M53A 2FO1A 1KYOK 4TQEL 3T65A 4PY8I 1IGMH 4J1UB 2A77L 3VFSB 2ZKYA 5JO5B 1CU4L 1WAAF 5I1KL 1I8MA 5AW1B 3EJJX 3ZE2F 3H54A 1TVDA 2G2RB 4PJ9A 1SEQH 1WIUA 1YJDH 3LEYH 4L23A 1IM9B 5DHEA 4H25B 4D2NA 4N0CD 3ZMRA 1JZIA 3PPEA 2P5EA 2ZOLB 3I75B 1F3RB 4LCCA 1NCTA 4FDWA 2QQKL 2CMRL 1S7VA 2WSKA 4X6DB 3GRBA 1SXZA 4X6CF 4LGPB 1HILA 3VQMA 5L9DL 5IROD 1A7NH 4QRAA 3TIEA 4JZJB 1PDKB 4DN4H 3LQAC 3MRDA 3AROA 4TNVF 3WMSA 4MJ5B 4ANUA 1ZAGA 3UPAA 5LXGL 3F65A 3EJUA 4L48A 1J9QA 5JZ7D 3DPDA 2Z91A 4TNWF 3P0VH 2XKNA 4NBYB 5EDSA 1RK7A 3FRPB 1JWUA 1QI5A 4MAUH 5IUCA 3C60C 2AGJL 1YCSA 5EPMA 3ZHDA 1DVYA 1NBYA 3FQTB 4MKTA 2XXCB 4KHTL 1CR9L 3ARWA 3M7OA 4ZS6D 2EKSA 2CM5A 5IHUH 3MJ9A 4JMNA 2ATPB 3QDMB 3CPLA 5FO7A 1MEXL 5ICZA 2Y1AA 4HLJA 5DEJA 3SDAD 1OB0A 2R29A 3GXIA 1IE4A 4LQ1A 4GRMB 4N2HA 4V1DB 3ULVL 2F54A 1CG9A 3N2JA 1BF8A 1GC1C 5TE7L 4JPKH 4DP2X 1WWAX 3C5XA 3NPZB 4XNDA 1HDMA 1OPOA 4GLRH 1BVLB 2A3TA 4Y2NA 4QHLB 1GPOL 4P2CG 3GXFA 4FFYL 4UQBA 2CRYA 3QEHA 3NZHH 2KS0A 5J4MA 1RI8A 1HQ4B 1UACH 3T8XB 5CJQH 4WFHD 4C56D 4OCRL 1PYWA 3OXRA 1QHOA 4ZTPL 5K5YA 3FTGA 4A7TA 1ZS2A 2X6MA 5I1JL 2GSIB 4I48A 1T7VA 3CC5B 4KK9D 3RE0A 2XV6B 4JREB 4EVNA 3JV4A 1V8HA 1TOXA 2IG2H 3QI9D 5ICYA 1OGAD 3CFKB 4ZXBA 5I1EL 2DYSB 3G6AA 2OYPA 4HS6A 1ZS8B 3RAJL 1WFIA 5BZDB 4W6YB 4WENB 4H0IA 1D5BB 2BNQD 2X40A 1T0NA 3VI4E 3KWUA 4NRYB 1JPTH 2GJRA 5E5UB 3NIGB 1HZHH 5BS0B 1DJWA 3C9NB 5E0QA 4CSPA 5BCAA 4PTTA 4XE0A 4ZMVA 2AZAA 1JWSB 5C1MB 5B22A 1DL7L 1IGML 3BPCB 3LHPL 5C0AB 2E4TA 3QIBA 2EIDA 2YMXL 3OG6B 1WRFA 1ZLVH 1AHKA 1XF4A 2LOEA 1GZPA 3DOSB 3CZLA 3MCKA 5INDA 3WEXA 2Z93B 2H26A 4MS8C 1H3PH 4AGNA 4RMWA 1HSAA 1X5IA 4HQQH 4K9EL 3U30B 5I66B 3KPSE 1NEZB 3GMPA 3OL2A 4TSCH 1FNGB 2QFRA 3WNNA 4OLVL 1C12A 1PY9A 1GGCL 1QRNB 2RA1A 4V2BA 4I9WE 5D7LA 1A7NL 4TNVK 5F1IA 1NLBL 4OF3A 1AHWB 1RVFL 1N68A 2ZKHL 2Z92A 4N9GB 5EF0A 1NIAA 4KKLD 4TNWK 3B3IB 4Y4HD 1S78D 3ROLB 2YA1A 3NK3A 4PBWD 4QHKJ 5IMKA 5CIPB 1AE6H 1E4XL 1Q9KA 4NQDE 1BIHA 4NQXB 2CLVB 1R3JA 3WJLC 4LLUB 2VIRB 3U46A 4BQ6A 4YO0B 1FZJA 4R8WH 1H5BC 5HGAB 1QFOA 3RA7L 3V79C 2OMVA 4PR5A 3TJEL 2JCCF 3JYCA 1Q9LA 3FFCE 4JFEA 4U1KB 1K3ZA 5E24E 3L3JB 3NSXA 1KLFA 3OMNB 1KJVA 5GS3A 3DARA 1NGWB 4JM2A 4N24A 4LCYB 3VNYA 5IHUL 4PYHA 4QKXB 1EHNA 2FBRA 1MHCA 3D69A 3MRGB 3HZVA 4JFDA 5HPOA 3DIVA 1B0IA 4PWGA 2I25N 2ZUQB 3K74B 3MOBH 4QRRE 1MCNA 3IU3B 2N59A 2VXUH 1YECL 3LS4H 4JPKL 3OKLA 4FI7A 4N1EA 4WSJA 1CTMA 1YEKH 2HSIA 1MVUB 3OKMA 4KH2A 1LK3L 1MCOH 4HHAB 4AG4H 1FN4B 1J5OH 3U6XA 4A7SA 2CNYA 4TRPH 3C5ZC 1V3LA 4BZ1H 2BP0A 4KI1A 6PAZA 1GRWA 2EILB 3UYRH 4LOUD 2MCAA 3EOBB 3QS3A 3OAYK 2ED6A 1BZEA 3NQIA 2IG2L 1GHFL 2V37A 3KPNA 1BVNT 3TO4B 5HHXH 5I30L 2VE6B 3VXSE 2XKSA 5HI3D 1R3IH 1N8ZB 1UJ3B 1TZ8A 3HI6H 1I7UB 1M56B 3FTVA 5D6CB 4WTQA 1MFEL 3QS2A 3LAFA 4RSYA 3WJJC 2ITEA 3CZKA 4KROC 2VDMB 43CAB 1SPDA 4MSWA 3LN9A 2CNZA 4L1DA 1RZKH 4OKVA 4X6FB 3N1MC 1JPTL 4FGMA 1HHHB 2AQRA 2GEEA 3R19A 4UM9D 4LEBA 4B96A 4DQOL 4R9HA 3BXNB 5C0FA 1N10A 5I6XC 3HKZA 2NXYB 3BVDB 3DRTB 1U3JA 1MLCA 2Z31C 5T3XD 1TTFA 4RCAA 3DSNA 4YHLH 3FTYA 2PCPB 1KBWA 1DQKA 1TCRA 4ZOCA 2F7OA 2PW2A 4Z76A 3K5SA 2IBGA 4LB8A 4KJWD 2FYYA 4PB0L 2XBZA 2GUOB 3FB5B 5F6HJ 3ARFA 5F6IC 2GCYB 5D93C 4AZUA 1AJ7H 4OIIH 1BOYA 2HFFB 5J0BA 5JA8B 4NOFA 4WFED 3SYAA 5SWZE 3O3BA 1NOAA 1H3PL 2DICA 5BZWB 5D96B 5GZND 4HQQL 2NPLX 3ILQC 4NEHB 5E9DA 2J71A 4TSCL 3MRKA 3ZOAA 3BQUA 3OGCA 3HLAB 1R3HB 3ALPA 2DWEA 4HOMA 3MCG1 4HF5H 3MRNB 3QFJB 4N2CA 2LLGA 1UH4A 3LB6D 4PWFA 1MLBA 1MI5B 1MZYA 3U36B 2VW6A 3LXUX 1ND0B 5ANHA 4K8RC 1UZ6E 1A4BA 3O3EB 4NKDB 4KO6A 5F9WB 2G3XA 2EDRA 2VLMD 4GP8B 5EIVA 4DUVA 1NFDB 2FL5A 2BS8A 4BFFA 3QNZB 3GRWA 1AE6L 1XGPB 1BV8A 1T7ZA 2AXWA 2X87A 5ETUA 4TQPA 1CXLA 2IAND 2O5ZH 1KGJA 3G6JF 3LIUA 2WOBA 1PLCA 4RMQA 3SQOH 5EG6C 2UYLB 4P57A 3HMWL 4JHAL 3TZVC 2YHGA 2VERN 5E2UH 3E7JA 1U8NB 3SE9H 5KYNA 1JF6A 3U0WH 1SN2A 4XXWC 3VXMD 3FSZA 3PAYA 1XGUB 2OTWA 2AAVA 2P8MB 5DHVH 3LEXA 1S46A 2D7PA 2J72A 1OSYA 2ZUWA 3CSFA 4PGEB 3OWEA 5JHLH 3ZTDC 3EH1A 4X7CC 4K3DH 3S5LB 3ML9A 5IKCA 3S2AA 5CP3A 2WJ7A 4LOFA 3HUJB 4MNGA 3QORC 4FNLL 3TIDB 1W0YT 4ZZFA 1HI6A 1J5OL 2Y36H 3LZFH 2X4NB 1D7CA 1KF9B 1J88A 2C1PB 4MNQA 4TRPL 1BG1A 2VLLA 5LB1A 3GXTA 4Q7DA 3PWPE 4NP4H 5J13C 4FNSA 1HHKB 3IPBA 5HGBB 1FJ1B 4BZ1L 4AITA 3UYRL 3S5LG 2P8PB 1FYTE 1O7DC 3P11H 4A7VA 3ZSSA 5KG9A 4X98B 2VC2B 4KUZH 4JNXA 1KV7A 1RMFL 3HS8A 4FN0A 4HK3N 3GUTA 2EXYC 4UNIA 3ENEA 1IE5A 1MIEH 5D1ZB 4P5TC 2EICA 4F7MB 2E74C 5HHXL 5A6LA 4M6OH 4PJ5A 5E08L 4Y16A 3SCMC 3VWKD 5JLZA 2VLKB 4F8QA 2XNAA 3SDAB 3C6LC 3Q7JA 3IPFA 4WUUD 4F7PA 2OV0A 3VW3H 1M2OA 3UP1A 2MQGA 1MUJA 5EDXA 3WTWA 1A66A 1RZKL 2XQYG 3H9HA 2VQ4A 1J9RA 4ABVA 4OT1L 4WHDA 5DMYA 3WTXA 5TFSL 1EV2E 3ZDZF 5AOLA 3JTSA 1KB5H 4ZUSB 4NFBA 3B9VA 3DHPA 4OFIA 4C56B 4YC2B 1AQDA 4PV1C 5I1GH 1SXAA 2WP3T 4AT6A 5EBLB 4NQSA 2ADJA 4K7PL 3CVDA 3TWCH 4HBCL 4NN7C 2Z4QB 4Y4FC 2CD0A 4BFIA 4YHOL 1WE5A 3WN5C 4RGMC 3IFPB 4Y4KC 3RX7A 3ZL4H 3PDOB 5L0QB 5T3ZD 3TTSA 3QXAB 4ELMF 2CHDA 1I9JH 5D55A 5L2KE 4DP8X 3QI9B 4U1HA 4TUKL 1OGAB 2AQQA 3SQBB 1D5MB 4HUWA 3OSKA 1RIVL 3TPUA 2E8YA 3LZOA 4XP9H 4FA8A 1ZT7A 2EIZB 3PL6C 1N4XL 2ZCLH 3MLTB 3TFKD 5AVXB 3MAWA 3M17A 1DHKA 5IB3B 1NGZB 5DURD 4ZS7H 2XN9A 1I1AD 2UVEA 3N04A 4WWNA 2ISDA 1TNNA 2ED8A 2CJTA 4KRPC 4X6BB 4XN5A 2YLKA 3I6LD 1DYZA 1TITA 1NIFA 1Z5LA 1MWAL 3F7PC 2ZT9C 1ZHKA 4F58H 4HIHA 3ZPDA 2YOCA 4OFPA 2XY1A 4PJFE 3CMOL 3VACA 5JW5B 5IG7B 2VDQB 3QHZH 4PJHE 3MSPA 4JDVB 2FO4A 4AEEA 2HVKB 4WWKC 2FCBA 4MLIA 2DDQH 5E2UL 4B9IA 4PS3A 5GS0L 1IB5A 3MR9A 4HWBH 1E27B 3HRPA 3DGDA 5HHNB 1B2WH 4M61A 4Y8DC 4JDTL 5A2KH 1KNOB 2VT0A 4PAZA 4TV3A 2QT6A 5C0CE 3N41F 4XCYB 4BSWB 1KLGB 4Y4HB 4ETQA 3PFQA 2X70A 1AYRA 1OARH 2IDQA 4CVZB 4IHBA 4U1LA 2YSSB 5F3HB 5D1XE 2ZWNA 3U7AA 7FABL 1OGPA 4NP4L 3P77A 4WU5A 1FNFA 2C9AA 3LSOA 1EEYA 2WQXA 2YEQA 4S2SB 5C86A 4HW6A 2X7LB 4NQCA 4G8FB 4K73A 4R26L 2AJXL 2W95A 2BVPA 3L2NA 2XPZA 2NCEA 4LNRB 2V3EA 3RPIB 3PV6B 5DHYA 5T5NF 4YHPA 1EJOH 1NKGA 4QXGH 1U6AL 2XWXA 1MHHA 5D6DC 1LE5A 5EF2A 1CZ8L 3SOBH 2XG4B 1T20A 1PW3A 4U7SA 3VW3L 4BA8A 1TQCC 3PWVA 4NRZB 5JHLA 4N2NA 4E41E 1BZ7A 1XX9C 3GSNH 4OI8A 1MCWM 3RYMA 4KFMA 2AJZB 3ASOB 1KB5L 4HKZB 2GG1A 4Z7VB 2DIAA 4ISVB 2GTQA 4MXWH 3GXDA 5I1GL 1EUUA 4XO9A 2BY1A 4UANA 3FFDB 1A0QH 5CCGE 1JN6A 3BVNA 1YMME 1CI3M 3NFNA 4KKZA 5AKRA 2Q9OA 2O6CA 3NYKA 5IF0A 5IWLC 1X5MA 3ZL4L 2AQTA 4YAQB 4S1DC 4JVPA 2PO6C 4TVUA 1U8JA 2YD5A 3L2MA 4RMBA 4Y5XA 3RNKA 4LPYA 2NX5D 3W39A 5EO0B 3IMVA 3RVUC 4GKSB 3UBXG 2YPLE 4XP9L 4LP5A 4W81A 2R2BB 1WD8A 2H9GA 5IHZA 1MCHA 3OKDA 2ATAA 2Y9RT 5IW6B 3MXVH 1GCFA 1LILA 1VADB 1NH6A 2BOBB 1IL1A 4PWEA 4R97B 3UTQA 5C97A 4ZS7L 1JZ5A 1JZ6A 1WFMA 4UM9B 3FAXA 1P4BL 4KI5F 4HEMA 4Y88A 1KIUA 2F61A 1CFSB 3H0TB 3P1VA 4XPTH 2PYEA 4F57H 3IF1A 4GMTL 1ZXKA 3TBVB 4HWNA 2AFNA 4L8DB 4X9FA 5L8JB 2ETWA 4OCSH 5I76B 5BUPA 2H6PA 3TA3D 4YDJB 4ZSOB 1S5HB 1WZKA 5IQ9A 2DI8A 1OT4A 5TGBA 3QHZL 2UZXA 4CJ1A 3ULUE 1DQQB 4KVNH 4QRTB 4ZUUB 3J07A 1G7LB 1QZNA 5DJYA 3I3EA 2L0DA 4HWBL 5K39A 5ES4B 4EOWH 1INQA 4A66A 3MRPB 4M1CD 2R2HA 1JP5A 1A22B 1L5GA 4EPSA 3A6BL 3EYFA 4YSSA 1OCOB 1U58A 4P5RA 5TDPB 3RWIB 3H7BB 4BCYA 3IDGA 4QY8A 5EB9A 3ETSA 4NYLB 1G6RA 3RFZB 1D6VH 4KU1A 3LKSB 4EN3B 1ZT1A 1J1OL 1TYJA 1EO8H 4QRUB 4UTBH 1KY7A 5EBWB 4XRCB 4PV8A 3MBXH 5ERWA 3SE8L 4NUJA 2H1PH 2J88H 4UQ3A 2IANB 2X89D 4CU8A 4HV8A 1T6VN 2YPKB 3MRIA 3U7WH 1EVUA 2ZUVA 3B8SA 5L6YH 4O02H 3OJMB 4LKXB 5C0BD 3V95A 3CDZB 3H9ZA 4ZQKB 5AYUH 1MCLA 2R83A 3RNQB 9CGTA 2XVLA 3S9DB 3REWB 5D5MF 1A6TB 1KTLB 1IKNA 1EJOL 4HWUA 4RFOL 4HMEA 4MJIE 5FYLE 5KAQG 5GS1B 4L3EA 4DESA 1WD9A 1YEIH 5GQBA 4KDVA 3TEUA 3O9WB 2VDOL 4WW1A 4JCWA 1DSFH 2CXKA 3OWRA 4LLYB 1I8LA 4P5SA 2V2WA 1WS8A 4RIRB 1KT2A 1J8RA 4XPBH 4XBMA 4X5XA 4G9FD 4PV9B 1JSYA 5DVOA 1JHLH 1NMCC 1TZIB 2CO3A 1VKXA 4XOBA 1D6EB 3FMGL 1H3XA 2BINA 4ODVH 5HVHC 2F15A 1NC4B 2BFVH 4K5PA 3UPCA 2VN5A 3D2TA 5DT1L 1P53A 4YK4B 3PWUB 4HJTA 1QLRB 1J05A 3O8XA 2OMTA 3HE7A 5E99L 1I7TB 3LEVL 1HOCA 3WDJA 3KL0A 3VD7A 3B6SA 4PGDA 2C4XA 3VRIA 4PP2A 2CO6A 3TBWA 5DK2A 2VZUA 4KRNA 4NQVB 3D3VD 1A9BB 1YEGL 1GTNA 2IEPA 3BP4A 4KKNA 1HXYA 3KCPB 2H2SC 4YFDB 3HZMB 2FT7A 3CD4A 3ROOA 2F7PA 2R27A 2QVTA 5FEBA 4GKZB 4F57L 2FWUA 4NHUA 3GSNA 1FGVH 2CJUL 3DROA 2V7NA 4NWUL 3RGVA 4HG4J 3VI4A 5C7ZA 4YJZL 4R4NC 1PJWA 3FO2A 1AD0B 2WUBH 3VMNA 2GVYA 1KUMA 2WNWA 3DHJA 1ZA3B 4FQLH 1MREH 5ELIA 5CEXB 3SOTA 2BC4A 2F19L 3MBEC 1TVHB 3TXAA 3MODH 3AG1B 3T3MF 3C09B 2P24A 1F6AB 2B4CC 1SYVA 4WHTA 1XZWA 5HHPB 3IMRA 5JW3H 5DRXB 1Q94A 3NAAH 4EZJA 4GT0A 4ZX6A 1DCEA 1I1AB 2BIPA 5LKNA 4OGXL 3QQDA 1D6VL 3IRZA 3PP4L 3KPSA 1TTUA 3BAWA 3NZ8A 1EEQA 4UTBL 2GJZB 1OW0C 3BO8A 1MFBL 1DQLL 1FRGH 4G80A 2H1PL 1VACB 3GS4A 2B2XH 5K9KB 2WXNA 4PH8A 2WXJA 2WO2B 1U2YA 3SY6A 3ECBB 2YWZA 3Q6FA 3BZ5A 1G4MA 3HZKB 4WW2F 3U7WL 3ZW3A 5I0YA 2OTUA 5DZAA 5FK9A 2CKBH 4MCYB 3V6BR 1KB9J 3E38A 2I5YH 1DLHB 4X6DE 4BBWA 1IMHC 1VGEL 4JB9H 4NQDA 2YZ8A 4O02L 1TETH 4MQXC 1Q9WB 4BE6A 1KGYE 3BVUA 3RWJA 5DUMH 2JNZA 1SLWA 1KJ2A 1A4KA 2F68X 3PHQA 1EAQA 4PJEB 1W72H 3F5WB 4K3HA 3ZT5A 5IEKA 3NJGA 3WY3A 2K9FB 3F7QA 3KGSA 4NENB 1KFGA 1TZAA 3KPMB 1I4FA 3IXAA 2VQ1B 5L4JA 2OMXB 2Y6SC 4K94C 4LOEA 3L9EA 2XV2A 4QRRA 2V9UA 4FXGB 4L9LB 1F90H 5B7EA 2GBUA 2VW4A 1XV8A 2FZ3B 2ZWYA 3PIQA 4U1NA 2J73A 2Y3AA 4XPBL 1HX0A 2ENYA 4RMVA 2BNRD 2XFGB 4JFWA 1U91B 3VGFA 4B27A 4WKZA 3VDCA 1K8IA 2L3BA 3EYSH 4L2YA 3RZCD 4X4XA 1P69B 4FXKC 4A2EA 1D7BA 1WJ3A 3QDME 2YEVB 4ODVL 1QG3A 2BSSA 3CU7A 1HNFA 1N26A 3HNSL 3T4AA 1MJJB 3G04B 4A1RA 4V1DE 2HP4A 4XCNB 4LBEB 2WY3B 1PZBA 4FNUA 2H0EA 2B3IA 3ARDB 4PD4K 1A3ZA 1JWMB 4AZ8A 3F7KA 1L9RA 3SQRA 4AVKA 5AVVB 1UKSA 2W8CA 1KYDA 1YNLH 1A6PA 4CC4A 4CGTA 3V7AE 2CUAA 4MMXA 2V9QA 3VXSA 5JIIA 1ES0B 1NA8A 1M05B 4K3EL 1WAEA 4DP4X 2XQYK 3NOIA 5D1QB 2X2YA 5GJTL 4RQQA 4JKKA 4AIZA 6CGTA 2R23A 1EAPB 4Q52A 4U1IB 1OL0A 3T5WA 3JVGA 3PNWB 3PJNA 3VWJD 3N44B 1AS6A 2KH2B 2F2HA 4WU7A 4Z0XA 4W1TA 4FQLL 4IBLT 3F05A 2XRAL 3H85A 2NY3B 4GSUA 5GRUH 3FXIC 3BWUF 2XWJB 3KPPA 5GJSH 1AKJA 4YLQT 4KJYA 2CQVA 3CFEA 2W38A 1XH2A 2XWDA 4Z3HA 3BQVA 3H2QA 2GABA 1JYVA 1X5JA 3S37X 1A2YB 2PWGA 3V6FB 3ARVA 4MZ2A 2LLLA 2OMYA 1AP2A 4JG1L 3I9PA 1Z9PA 3OLDA 3AWFA 4OCXH 3OMZA 4ES8A 5LBGA 1T4KB 1E50A 2AI0H 4L2LA 2W92A 3IVKA 4P2OA 3OVUB 4GMSL 3UDWA 5KVFL 1H15A 3H7LA 1GGTA 2ZSWB 1JNNL 3FYIB 5FHAL 1H6TA 2VN7A 1N59A 1JK8A 2C9XA 4XAKE 1AC6A 1PD1A 1CYGA 2QSTA 3MRBA 4JB9L 4J3OH 2ED7A 5FX3A 1QRNE 2R2EB 3I6KA 1S9YA 1VZIA 3LQZA 1LO4H 5DUML 3UTSE 4JO1L 3RIAF 3DMMC 3DTXB 4NFDA 1U8OA 5E1HB 3GJFH 4LNVA 1W72L 2ZOKA 4OZGB 3P4NB 5ANMB 3K4AA 4Y9CA 5ICXA 3V9CA 3MUGB 3VFWA 3CN2A 5AZEH 3I6GB 2BVOA 1LK2B 3G5YB 3L3IA 1GYCA 1UWGL 2YJLA 5E6ZA 3AM8C 3WS3A 5TF1L 3IJEB 4N3UA 1CD9B 3UZVA 1UT2A 2BDNL 4U6YB 3QNXA 2IAMC 1SN0A 3B5GA 1NM9A 4H8UA 1DJZA 2JI2A 2X1PA 2MEJB 1XB6A 5I2IA 4YHYB 4JPQA 1Z3GH 4P46C 4PREB 4Z7QF 1L7IH 4FTVE 5ITFA 2NY1C 2EABA 4KPHL 1KFAH 3PWPA 2CKBA 2IDFA 3O0LA 4LMQI 1C7TA 1SHSA 2GTWB 4YDMA 4YSCA 3GIZL 2RD0A 1GVIA 1FYTA 4FLQA 3HAEG 3P4LA 4XN8A 3X11A 3MROA 4MDIA 1IEAB 2WXRA 4FG0A 2KHAA 4GW1A 4N26A 4NJAH 5KAQF 1AZCA 2YFNA 3ZIYA 4G1MB 5CKAA 2V4LA 4CKQA 2OL3L 3TN0C 4PJXB 5FKAA 3CQPA 5DGRA 4K2UH 1EIBA 5AUMA 4HK0B 4JAMA 5MENE 1P7QD 1UOWA 4G9FB 1B0RB 5ESVB 4PWJA 3GMQB 5GISL 1HEZB 2PPEA 2OZNA 4PN6A 2ADFL 3K71B 4AGOA 4S1QH 4PGCB 4CMMB 2RCSH 3VXUD 4F37F 1NUNB 1IBZA 2ZX5A 5KSBB 4PJ9C 3OKNA 1ZANL 4JS7A 1C9SA 3MMEB 3F00A 3ULUH 5DSCA 3ZT6A 1S3RA 2PPCA 2BLFA 4L4VD 4LCCC 1ITBB 2M1KA 5IFAH 2VL4A 3NJJA 5GJSL 4NXKA 2JKTM 3HR6A 5L2KA 1XO8A 2DKUA 2XU9A 5AW0B 4R4BA 3T04D 3D3VB 3SDDD 2O5YH 1S2EA 4YIQA 5FGRA 3V0IA 1ZGLB 2NY5C 5ALCH 5SWQA 4LKCA 2Z1KA 5BOZG 4G59C 1T89C 1U8PA 5AWNL 1I85A 3DIDA 1JXDA 4DK5A 2BZDA 3KWXA 3VXRE 3NACL 1C8PA 4AK2A 5IZ7A 2PR4H 4BKLA 3ARED 5I5IA 2YBGA 3S97C 4FS0A 3FH7A 2ZX8A 4NSKA 3X1GA 4E9SA 1J9CT 2FATH 1DQDL 3BE1L 4M3HA 2AAAA 2AKRB 4M7ZC 3OKEA 3RIAK 4M9PA 4U4IA 4I3RH 4AW7A 1JGEA 3RWHB 3QFJE 4RAVA 4G11A 1LO4L 4PJFA 4WCYL 2QPSA 5DZLA 3K0WA 1UENA 1F56A 1G1KA 1MI5E 3MXWL 5MEPA 4PJHA 2ZAHA 4HS3A 4KAQH 2X1OA 1PCXA 1C16B 4QYAA 3CQQA 3IGLA 1J1XH 5FYLH 1NFDE 4WI8A 5EU7E 3W3BA 4AW4A 4P3CL 3CIAA 3MBWB 4R7LA 3VFUA 2CKNA 1KJ3H 4JG0L 2N01B 3NCXA 4H26B 3KGRA 4TLSA 4CVXB 4M8QB 2A9AA 5CD5D 3O3DA 5K59E 1OB1B 1T5KA 2ALAA 3TU6A 4JEGB 2LLNA 2AQ1A 3G08A 4RZKA 1IFGA 5CMAA 1URIA 4NM4H 4PCKA 3WMQA 4D9RD 5GS2H 4OJFH 3W5NA 3KD4A 3L7EB 3WIFA 3ABGA 5C0CA 5E4IA 1SFHA 1AO7B 1DDHA 1F2XK 3ABMB 1HK6A 2WLKA 2NZ9C 1VFBA 2NNAB 3OXSB 4F91B 5JHDD 1ADQL 4BFBD 1M1XA 1MJUL 3EKCA 4XMUA 4P5MB 5D1XA 5C9JB 3D18A 3FQ1A 4AQ1B 3ULVF 2OCJA 2P52A 3L3OA 1WA1X 5H37H 4BK5A 4G9DA 3N50A 5TE6H 4DW2L 1N6UA 4BIKA 3WIHH 1MHEB 3BIAX 4ZXBC 3BP7A 4YHZH 4ZMWA 4G1EA 3RWDA 1UGKA 4HKBB 1BGXH 3CVHH 3HE6D 4GIPD 2IH8A 4YOKA 4D0DB 2HRHA 2OP4L 4LU5L 2UZYA 2GFBB 4P9MH 2B5IC 4G6AD 4K2UL 4I9XA 2QQLH 1TYEB 1F5WA 3JWNC 4IOIB 4Q6IA 3RU8L 1WV7T 3BP6B 3FT9A 4OF7A 1N0LA 1CYWA 4F37K 3RZCB 5I73C 1X7QA 1M7IA 2XVKA 2JCCB 2HRLA 3QDGD 1ECYA 4O00A 4FXTA 2RCSL 2FUTA 2Y25A 4X8GA 3SD5A 1DFBL 2K70A 3L3HA 1RHHA 1EHLH 3OSVA 4Y2LA 1YMMA 2KBGA 2YD3A 3BKMH 3NCYS 4CUCA 5AOIA 2FJFB 4IDJH 2NNCA 4WEBL 2DYRB 5FKPB 4R7NA 3ARUA 2IPTH 3GTVA 4NKOB 1U3HA 2O5YL 3II2A 1G5GA 1N5AB 4KRLB 5MEOA 1U8CB 4WFHE 4C56E 2XV3A 3WD5L 2YPLA 4Y2DD 3D87B 5DMGC 3H2PA 1MW1A 5DU7A 1ZTMA 1EXUA 3L3GA 3QCVH 2ZIDA 3DJSA 5GGUB 3PDDA 1LO5A 4PJAF 5FYJD 3BN9C 4CMHC 1M9WA 3VWJB 1OGAE 1SJXA 1M7XA 3ZHLA 3BPNB 2FATL 5HYQB 4W9DC 1HOEA 3K2MC 5EOTB 5HJBA 5KYUA 3V5DA 5J7CC 5I6XB 4PJ8A 1E9PB 3T3PF 4HUXB 1DEEA 4QTHB 2A73B 2OSXA 4NRXB 5IV2B 1RJLA 2BNQE 2Z31B 3UG5A 4LASH 1QUPA 3FQ4A 4UQAA 2ZX7A 1YJDC 4TYUA 3NEXA 4JM2C 2HPOA 4M5TA 4QRPB 4R7DA 4EKXA 3CE1A 3HC0B 1G0YR 2K9UA 1LDPH 3PYCA 3QHFL 2YEZA 2VDLL 5FO9B 1OGTA 2BZ7A 4MA1C 1MDTA 4X80L 3STLA 1OSEA 2BX5A 3GRGA 5D70H 3S36L 4KI5D 5DUBB 2AHIA 3L4UA 1NCDH 2J7LA 2AJVH 1GS7A 5K9QG 3A4DA 3E2HC 3HZYB 3SKJL 2DKSA 2WWKO 2KERA 2YQBA 1OO2A 1ID5I 1E28A 1XMEB 2M2DA 2IADA 4GBXA 4OJFL 3F3HA 3HS0A 2XWBB 1KCVL 4M43H 1HSBA 4NB7A 5DJ0A 2ILLA 1P5VA 1LWRA 1PZ5B 1GYUA 4ONFL 5EORL 3GK8H 3G5XB 5ALBL 2AK4D 2QGEA 5ECJE 4HIEB 4G42B 3V5HA 1ZGLP 2K7QA 4F7EA 5TE6L 3O6FD 1H3TA 4MCZB 2DF3A 1R4XA 3FQNB 3WLBB 4YHZL 4HPYL 3QBTB 4IIQA 4R6UA 3UJIH 3UPRA 3DETC 2XIBA 3JWOL 5GSVB 3QCTL 3TZVB 2ITDA 1I3VA 3MLRL 4KMLB 3U1QA 4MJIA 5DHDA 3O4LD 1AS8A 4OGAC 1RZJC 3K91A 4E5XB 3UOAB 3RGBA 4I1PA 3KDMA 4ICXA 2FR4A 2FHFA 1ODUA 4FG2A 2YBRB 3DX9B 1WBXA 1E9OA 2MRYA 3HHRB 2IO5A 2CJSA 2Y3NA 3VSVA 1GR7A 2DQCL 2DQUH 2HJLA 3MRJA 4ELKB 2ICWI 2Q8BL 1X4ZA 1MFMA 3ARFC 4RAUB 1N3NA 3UC0H 4C4BA 3FT3B 2G2NA 3GSVA 2N7SA 4EUPG 2HPTA 3HNTL 5LGHH 4GFXA 3IJ9A 3AY4C 4U7MA 3QC5X 2MJWA 4IU3B 5I1LA 5D71H 5DJ2A 5CBEA 3WIHA 5ESAB 5IB2B 3JTTA 1WS7A 1M3IA 2O6DA 3TPKA 3T2QA 4BQCA 4G7YH 4XMXA 5BQ7B 3C75A 3RGHA 3ZZ1A 3BHBA 4AENB 3CVHA 3HG2A 1P7QB 2YUWA 2B1AL 2X9YA 2VW7A 1QUNA 3QCVL 1RIUH 3ZZQA 4XE5B 5HXMA 2W07B 3OR6B 2HVJA 2BJMH 2BP3A 3C6LB 3OR7A 4MQSB 3GPEA 3QIWC 4Y89A 4B9CA 5GGQH 4IRJA 1NJ9B 3MJWA 5LWYH 2J6WA 1G1CA 2DMGA 1TSRA 1IBBA 3T2PA 4NKQB 2I07B 5C3TA 5KVDH 3HHMA 1PX4A 4PVBA 1ERNA 4L0PB 5A2LH 5L8KB 1ZMYA 3QIUA 3L1EA 3NCEB 4OFKA 1CK0H 3FCGA 1IC1A 4L4VB 5DJ8B 1GIGL 3VG9B 2Y2YA 2GIXA 3AG3B 1YDPA 2MHAB 4HAGA 4MB1A 5CKGA 5D7SH 5GRYA 3P9WB 3RIFK 3MZTA 3WN5B 4UUJB 1M57B 2APTA 3VI3B 5D4JA 3WE6B 3ZE1B 4F7KA 1MY7A 2LU3A 3PJSA 4MGXA 5I23A 5T3XE 1G9EA 3MRQB 5E4AA 2VH5L 4FZ8L 1IC4H 4FMVA 4UV7H 5I74B 5BV7C 3WNJA 2V7HB 1NCDL 2LGNA 5E56A 4ZSOE 4CSZA 1D5IH 1IJ9A 2XQBH 1WFOA 2PP9A 3Q43A 4WHYH 4Z5RB 1ZHBB 4J1UA 4AL8H 2FX9H 3VFSA 1AR1D 1S9KC 3P02A 4BSVA 1NGXA 4F24A 2G2RA 4UF7C 1A47A 1LO2H 1FL5B 2MCPH 2YKKA 4KRPB 4MWFB 4X7FC 5HJ3A 4JFVA 1F4XH 1LO0H 1E6JL 5EBMB 1NTDA 1WHPA 2ZOLA 3I75A 3VFMB 2YD8A 5DZVA 3LIZH 1SRDA 4X6DA 4LSUH 2DQDH 2VLME 3BPOC 4OGYL 3UJIL 1MAMH 4LF3B 1S5IH 1FV1B 1G9HA 2J6EL 2J3SA 4JZJA 4Z7UB 1PDKA 3NBNA 1BXXA 2IANE 3CHQA 1MRFH 2GPZA 2Y7MA 1JTTA 3QPXL 4U31A 5B8CC 1JK9A 2X4SB 1AXIB 1R9FA 4MJ5A 4X5QA 4KGJA 3UAJA 5LQBH 3T09A 4GNKB 4X42A 4A7GF 3F12B 3UCRA 5JHDB 3K72B 4XODA 4P4RB 3VXME 5I6NA 1FNHA 1AYOA 3FRPA 1A6AA 1VPOH 3W0WD 3RKPA 2DQUL 3GBLA 3O6KL 3FQTA 1INDL 3NCMA 3UC0L 1OWWA 4XB8A 2DYPD 3QNFA 5I5MA 3AUWB 1HT6A 3QR1A 3ZTCC 1U0QA 2ATPA 2VZSA 3QDMA 4LPXA 5LGHL 2Y0SA 1YEHL 4V1DA 4GRMA 5D71L 4BFGA 2AEWA 4YSQA 3HE6B 3HNVL 3TESA 3IT8D 5AB2A 3SO3B 2ZF9A 5KBMA 3AG2B 5IMMB 3L5HA 3RVVD 1QA9B 1MCQA 4QHLA 2BJML 2ZOOA 1KBKA 2CDEB 2W0FB 1G6VK 2XACC 5GGQL 2HFTA 3QDGB 4KKAC 5E8EA 1E8YA 2JKRM 3MFFB 4HT1H 5KVDL 3TJHD 3CC5A 4G6JL 4IOSA 4WUUE 1E7UA 5CN1A 3EBIA 1MQKH 1CBVL 5HD8C 1Q1JH 6PCYA 3QAZC 2WIMA 3UO8B 4UDTB 4XZUA 5ENWB 3CFKA 4P9HL 3SDCD 2WO4A 2YD2A 4YR6B 4ILDA 5B3JE 5D7SL 4Z3GA 4M7JL 4MA7L 1ZS8A 4RSVA 3TO2B 5BZDA 1G7JB 3UERA 5AG9A 1DUZA 1D5BA 5C3IA 4PQXA 5DWUL 1IC4L 5HHQB 4Y2DB 3JUYA 1MSPA 1GH7A 2HH0H 1CIUA 1F41A 2VABB 3DO7B 1QBLH 3KLLA 4KKBD 3GSQB 2P8LB 4QNPE 1XAUA 5EU5B 1FG2B 2MOVA 5T3ZE 4TQIA 3VRLE 1ASOA 1D5IL 2XN2A 3MU3A 4PW4A 4U3XA 4APQC 3HN3A 4QJ5B 5BNXD 2XQBL 1AC0A 3BPCA 4PRAA 5E95B 5C0AA 4AL8L 5A2BA 3BD3A 3DOSA 4NKIH 5KVEL 1LO2L 1HHJB 1ZTXL 1LO0L 4IEFB 2G3ZA 3H6AA 2YXMA 5J9PA 5I66A 2DQJH 2IPKB 3AXLB 1NEZA 3N40F 1FZOA 2H2PD 5EO9B 4LSUL 1FNAA 1QRNA 2DQDL 3I6LE 4PMFA 1TENA 3BAKA 3UTSA 4CDHA 3D34A 1KN4H 3FUMA 1CD8A 1HZLA 1AHWA 2NTFB 2JVUA 2YAMA 3SKNB 2JKLA 1MRFL 5J6HB 2E7LA 1NCCH 1OTTD 4N9GA 1IVTA 3SYQA 5DQDH 3B3IA 4W9KC 1OCWH 5LQBL 4Q9QH 5IMLB 5CIPA 4RGNB 1T04B 1YUHB 4RFNB 2CLVA 3E3QE 3BKJL 2VC2H 4LLUA 2VIRA 5E0FA 4MTMA 4X83A 5KEZA 5HGAA 4KXDA 4AJ0A 1FGNL 1SN5A 1VPOL 2DB8A 3IWVA 3MV9D 2NT0A 4PJEE 4RDQF 2AK4B 1LGVA 3KPLB 3CFIC 4NAJA 5DZJA 5L4MA 3L3JA 4POUB 1NGWA 5JXAH 4HDIB 4LCYA 3O6FB 4OAWB 4Y5XC 4DP5X 3MRGA 1ET8A 4FTVA 1OAZH 3EJYC 3FSVA 1HXMB 4OZHF 4ZQTA 3IU3A 4AOFA 1KULA 3LIZA 4JO5A 2HMID 3IJHB 2H4EA 2OMWA 3QUYD 1EA9C 3O4LB 2DQFA 3KPRB 4FZEL 1ZHNA 4U1MB 4BZ2H