3DGDA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3dgdA00
4L1TA 3DO4A 4PVNA 3OZLA 3I9AA 4TQPA 4Y9BA 4PMEA 3IWUA 3NEOA 4WNJA 5CLXA 5FW6A 1BZ8A 1SN5A 1BZDA 3A4EA 1THCA 3CFMA 4IKJA 1TTRA 4MRCA 1DVXA 4ACTA 2FLMA 5FO2A 1FHNA 2IGLA 3W3BA 2F7IA 4Y9EA 3NG5A 1KGJA 4DEWA 2QGCA 3IMVA 1SN2A 2H0JA 3HJ0A 4PVMA 5EN3A 5TTRA 1E4HA 1TFPA 3DJRA 5K1JA 3IMRA 4TQIA 2G9KA 4ABWA 3D7PA 4IIZA 4PWEA 4IK7A 1DVUA 5IHHA 4WO0A 3ESOA 3SSGA 2TRHA 1SOKA 4PWKA 2GABA 3Q1EA 1F41A 3NESA 4TLSA 4TQHA 4ABVA 3KGUA 1GKEA 4QRFA 4DETA 4TNEA 1TYRA 2QGBA 4IK6A 1SOQA 3CN0A 5CLZA 1TSHA 2F8IA 2H1XA 3IMTA 3IMUA 4FI7A 4ABUA 3GPSA 2B15A 3DJZA 3QVAA 3CFNA 4TL5A 1IIKA 3P3RA 4QYAA 5AKTA 4Y9FA 3A4DA 3TCTA 2PABA 5JIQA 5CLYA 4TNGA 2B9AA 4FI8A 2B16A 4HJUA 5FW8A 3CXFA 3P3SA 4D7BA 1IIIA 5AL0A 4PMFA 1X7TA 5AKSA 1ZCRA 5HJGA 4L1SA 3P3TA 4I85A 4PM1A 4ANKA 3GLZA 2QGEA 2G2NA 3U2JA 3GS7A 3CN4A 3IPBA 3A4FA 5AKVA 1DVSA 3KGSA 1ETA1 4DESA 3FC8A 3I9PA 4I89A 4HISA 1TTBA 1ICTA 2NOYA 3CFTA 3NEEA 4TKWA 5E4OA 1THAA 3ESNA 1ETB1 3TFBA 2H6UA 5A6IA 4MRBA 1U21A 3DK0A 3OZKA 5CNHA 5CR1A 4TQ8A 3BSZA 3B56A 4KY2A 2WQAA 1Z7JA 2G5UA 4MASA 1KGIA 5AL8A 5DWPA 2G3XA 2QELA 3IMSA 4AC4A 3M1OA 1IJNA 3DJTA 4N86A 4QXVA 4AC2A 2H0FA 5BOJA 4DERA 4YDMA 4HIQA 5AYTA 3BT0A 1QWHA 4PVLA 4N87A 2FBRA 2H4EA 3CN3A 2H0EA 3GRBA 2G2PA 3DJSA 3NEXA 4Y9CA 5E23A 4HJTA 1E5AA 4PWIA 1TT6A 3IPEA 2ROXA 1G1OA 1TZ8A 4ABQA 4Y9GA 1DVZA 3GRGA 4PWHA 4PWJA 5L4JA 1DVTA 2TRYA 2B77A 3D2TA 5EZPA 3ESPA 1E3FA 4IKKA 1RLBA 3CN1A 1FH2A 2G4GA 2G4EA 4TLTA 4TLUA 5L4FA 3IMWA 4IKIA 4DEUA 1SN0A 5JIMA 4TNFA 1QABA 4FI6A 1IE4A 1X7SA 1GKOA 1OO2A 1ZD6A 3CFQA 3GS4A 3KGTA 5CM1A 3DGDA 5K1NA 5L4IA 5FW7A 3DK2A 3P3UA 3FCBA 2ROYA 2GPZA 4TLKA 3GS0A 3IWVA 1DVYA 1BM7A 4TL4A 5L4MA 3CN2A 3CBRA 2QPFA 4IKLA 5CN3A 4PWFA 1BMZA 3I9IA 4N85A 1TTAA 1Y1DA 4Q14A 4WNSA 4PWGA 5E4AA 3U2IA 2B14A 4I87A 4YDNA 5JIDA 4HJSA 1TTCA 2QGDA 4TM9A 1TLMA 1DVQA 1F86A 5DEJA 2G3ZA 3DIDA 1BZEA
chains in the Genus database with same CATH superfamily
2AQNA 2NLJA 4GI9A 1U92A 5EZJA 4Q7DA 1A5FH 4M6NH 5F1OB 3FQXB 3FCGA 1HDMB 4PY7B 4QHNA 4H8QA 3TBWB 4EZKA 5C0AD 4QF1B 3QAQA 3OL2A 5IROC 2MCPH 4D94A 4M62H 4Y19D 5DVNA 5IVXB 2OFQA 3N1FC 4PVMA 3HS0C 2EINB 3ARDA 1CFVL 2A0LC 4YSRA 4PP1D 3QAZB 4KUCD 5ISZB 3QS3A 1IC5H 4ZBJA 4KX8A 5HYFA 2ITCA 1FNFA 2PMZA 3AWGA 3ARZA 4FERA 4QRQB 1E9PA 2XPGB 1EMTL 4XH2B 4JY4A 4F3FB 2ZKWA 1M2VA 3CQQA 2Q7YA 3T3ME 3QJVB 3CFCL 3JWDC 2UXVA 5DO8A 4OCLC 3FRPG 4K7PY 3ELQA 4YSQA 3Q2NA 2XQBH 4FABL 4XMPH 2J43A 4XHJC 3EOAB 4HLZH 4B9GA 4Y88A 2DAVA 2HT4D 3H9SB 3RFZA 4YBQC 5DLML 5DD6B 5ALBH 3ZE1E 4OZIB 1IQDA 5I1GL 5T3ZH 4R96B 2VDOL 3K2UH 4G6FB 3RL2B 1B2WH 1G7LB 1JWMA 1NFAA 2CUAA 4OBRA 3CDCA 2BVOB 4R84A 2UWEA 3F7YB 4J4PA 2WXHA 4LHUA 4KPHH 3PHOB 3H85A 4P2OB 1IAII 2VDNB 5E4OA 2OJEA 1H15A 4GFTB 4N9OB 5KVMC 4JB9L 4M03A 3LN4A 2L04A 3ZDZF 3RZCB 2AXJA 3CZUB 3RQ3A 5ITBL 5AYTA 4M5SA 1SJVA 4OZ4B 4GP8B 5T1LB 4PGEA 3MODL 3ECVA 4YSCA 5ICYA 4OM1L 1FL5B 3FFCD 4FCHA 4ORGA 3VMNA 5C6TL 1QHOA 5F1NB 1DO6A 4M6AA 5JO5A 5GGVL 3WL9B 2YA1A 3Q13A 1AE6H 5IVOA 2WXKA 4YSOA 4I18C 4TUKL 1NGPH 2TSBA 2GJ6D 3O3EA 2Z4QB 3G7TA 4XN4A 5FYKU 4Y4HB 3JTSB 1KCVH 1JZFA 2WOBA 1X7SA 3RVTC 1S7XA 1HEZA 4JK0D 2R59A 2COQA 4I0PB 3H55A 1JNJA 4HIJB 5DC4B 2GPZA 3PUCA 1L7TH 3LV3B 4V11A 1JS4A 1RK0B 3CTTA 4XCYA 5J1AA 1LK2B 1FA4A 1WHPA 2AXFB 4GXUM 5T33H 5TQ2H 5J13B 4MDRA 3IAQA 2V7HA 3HZYB 4KAQH 4PREB 4UT9H 3ZE0B 2A6KB 3QSKB 4EQ2A 1JRHH 3X13A 4Y4KA 1PY4A 3AC0A 3U1QA 3VX0A 4KKQA 3VG0H 4FFWD 3DRQB 3QIUC 4KQ4H 5EIQA 2DI7A 4A7UA 3OF6D 1KNOB 4HV8A 2BP5M 3H6AA 1D7BA 5DD1L 3WCYA 5A2AA 2UZIL 3D3VD 3GWJA 5D1QC 4PV8A 3U2SB 1EJOH 4WU5B 5H2BA 1MFDH 1EEQA 4OD2B 2DBLL 3QQ9C 5FM4A 5MEPA 5L8JB 1SJHA 8FABA 2WQUA 1ZT4A 2JNZA 5DMGC 3CNKA 4EIZC 5J7CC 3PHQA 2R4RH 3GSOB 5SWQB 3HRZB 4KKRA 1JZ7A 4N6QA 4HUCA 2X40A 3QZLA 1RIUL 1DBKH 4HS8H 3TBTA 2VYRE 4N2BA 1ZDQA 4L5FL 3S5YA 3HEIB 1DANU 2QKIB 3FONB 2R0WH 4NFBA 4N3TA 2F19H 3BN3B 1MXDA 3BKYH 4UOW0 4HPYL 1HAUA 2V37A 4K3EH 3BGFC 4Q6IC 1TQCB 3QIBC 3TT1H 3R06A 4FTDA 5D5ME 3K8MA 3B2PA 1OAZH 4MCNA 4DO4A 3P3TA 5EN2B 5EHFA 5EOCJ 3MJ7B 4LL9A 5EBMA 1ZT1B 3PWPE 1S7SB 3TS8A 3NA4A 1U8MB 2AEQH 4P46B 5JXAL 3K71B 3P2DA 4NWUH 3NA9L 2VDQL 4J23A 2JCCB 1BD2B 2HZHA 3NPZB 1ZMYA 2HLEB 2MHAA 1YQ2A 3G04A 4IOIB 1TQUA 2JELL 5GS0H 4PJCB 2XDHA 3RVUC 3VDBA 2R23A 4J8QA 5D7IF 1EEYA 4DERA 2I07B 2PLTA 3NIFF 4KKZA 1I3GL 4FZ8L 1O9ZA 4HIXH 2XWJB 3ZKSD 4Q4IA 5ICXB 3LIZL 1BX2A 3M86A 1E67A 3O41B 3IGKA 4P48A 5GJSH 1NC2B 4ZUUB 1X4ZA 1T80A 5ADOL 4AM0B 4P2QD 3DUSB 4M5ZL 5EOQH 2NY1C 2P8MB 1M6OA 2HH0L 3KL5A 2DD8H 2P48B 3JZ7A 2AW2A 5DJAB 5SX4H 1X5GA 4UM8B 5DRXB 2ZXDA 4PSRA 2VM4A 2YUWA 3UC2A 1TVHB 3O2WL 4AUYA 5DMYA 3SD2A 1N18A 2X1WL 3LNHA 4HJGB 4E9QA 2GG1A 1KT2B 1BJ8A 2BK8A 2FO8A 3FH5A 1EWHA 2G3MA 4X5XB 1Y1DA 1G7HB 2NUTA 4I5BB 3DYOA 5I76B 3KEDA 1UT2A 2LV4A 4LVOB 4X8JB 4PLNC 3WEMA 1XTMA 2PN5A 3CFBB 1GOHA 1I1RA 3K6FA 3GJEA 4H8HA 1G4RA 4NO5A 2VN4A 3ZHDA 1NMAH 4IGBA 3VI4E 2WZAA 5CFAA 2OXGB 5D2LF 4PG9B 4D0BA 2O5YH 3D08A 3UC0H 1MUJB 2J5WA 2X89D 3UABA 4MNGA 1NGZB 1CBJA 4P2AA 5AW4B 5C3IA 3G6DH 5E94B 32C2A 2F53E 4KRPD 5BMFH 4JGMA 5FYJD 3WYRA 5FKAA 3SKJL 3VYOA 2GSGB 3BN9D 3HHSB 1DQJB 4ZD3H 2B08A 4W9DC 4IBYA 2BOCB 3SDAC 5I0YA 2UZPA 3VFWB 3ZE2F 4F9PA 5AG8A 3BIBX 4A6YA 4KI5E 1E5BA 5C8JA 4G72B 2D2CC 1SOQA 3SGEI 4Y2OA 1ADWA 3TV3L 1X4XA 4ZMOA 5DDHA 3K5SA 2DL2A 5HXMA 1TMCB 5TF1L 4OCRH 3WHE0 2Y7QB 2Q5BA 4WJG3 3OVUB 4Y9FA 1MCBA 1BOGA 5IFJB 1NCGA 4LLAA 1WWAX 3KLKA 5EULV 3THML 3HNTH 3TO4D 2F08A 2VDPL 1GXEA 3LKNB 4PJBF 4D9RE 1U8IB 4W4OC 4ZUWA 2F74B 1QSFB 3IDGA 4NRYA 2MSPA 5GS2D 1SF3A 2DYRB 2VW7A 2V9QA 5KWYC 2I7SA 2JB6B 1CL7I 1CN4A 1KCSH 4LT7A 1JWUB 4C4KT 4NQCA 2M8XA 3CVHA 3MCLL 4G9FA 4F5CA 1MVUA 2X53A 3OR6A 3LSOB 3HBQA 5DWPA 2ZYIA 4XBGB 2SODB 3VXNB 3IGUA 5BRPA 5B39A 4PJXF 3BT0A 1L7IH 1N64H 4PJEE 4JO3L 1YEIH 4ONGL 3RFRA 2XXGA 1A6ZB 2DQIH 4XGZB 5I71B 3DHJA 2GTZB 2PW2A 4WO4A 2EDYA 1D5ZA 2Y7SA 4W9IC 4UIKL 4AEFA 7FABH 5ID0A 4LBEB 3ML9A 4KRNA 3X14A 1ZA6B 3QUYD 5GRUL 3WHXA 1PQZB 1RKRA 2GAZB 1U3HC 4F7KA 3EYOA 5I5JA 3SN6N 3D4YA 1AXSA 3BEWB 4DVRL 1JPEA 3MGTB 4OLVL 3DPDA 4G3YL 5IJDC 1CE1L 1WD8A 3KWTA 3AT8A 3GKWL 1LP9E 4YVNA 3L16A 1YNTF 1MF2H 4H8PA 3VQMA 1UOVA 5D71H 4P46C 4JQXC 2HG5A 4AI7A 3OAYK 3N85H 2OMZA 4XI5C 4D7PA 3AABA 2FNBA 1CE6B 1JGIA 4LPXA 4HBCL 5CO1A 1LO5A 1J0KA 5B22A 4BV1A 2XA8H 1CFTB 2CJUH 2P24B 3RKPA 2BS9A 1PPIA 3FT4B 4XWOD 1CFQB 4FQQA 3S8FB 4UDTA 4FQXA 2R8SL 3AU0A 4PJ9D 2FZ3B 2MNUA 4M9PA 5M94B 2HFFA 3OAZK 4Y9EA 5J57B 4JRYA 1RZJL 3CQFA 3QWOB 4UAOB 3AREA 4XMUA 4MDIA 1QRND 1HI6A 1JMZA 2R15A 3NK3A 5FYKH 1XSKA 2QVIA 3T2OA 1U93B 2FO1A 4OGYL 1NDMA 5B1KA 5IESL 1N5YH 3QJFB 3DRTA 4FF9A 3NESA 5E8OB 5JYMA 2O93L 2LGNA 3SKOA 4D0CA 3NCCB 4DETA 2QV4A 2WNWA 4KH2A 1FVCA 3V9FA 1GGBL 4LOVA 2D3LA 3T0AA 1MHCA 5EC1B 5FM5O 3BI9X 4Q97A 1G7PA 5LGHH 4BZ2H 3T3MF 5E7BA 4CU7A 1FE8L 5KVFL 2W0FA 3KXFE 1R17A 4L1HA 4LVOC 5F0PB 4PLJD 4DTGL 3NAAH 2B0SL 3FSOA 3VFRA 2G5BA 2KKQA 3KEHA 4H7VA 5DXWA 1BQKA 3SDYL 2Q8BH 1G7MA 3CFEA 3HAEG 4KK5C 4JR9H 2H32B 4RH4A 3CN4A 2J4WH 2OCCB 4KVNH 1UB6B 3ZE1F 4F33B 3MNWB 3EOBA 4Y5XA 2IVFC 5LN4A 1KBPA 1ID2A 1T1XB 4C83A 5BRZA 4BUHA 4KZCA 4I3RL 6FABL 4KV5F 2X88A 2YAFA 4P4KB 3TFBA 3WE1A 1PS3A 2XTJC 3EO0A 4LSUL 1J87A 2BWQA 1QSEB 3UTZA 2MKWA 1J0HA 3C6LD 1IAIH 4KKBC 4HS3A 4ZAKD 4XNUH 3ATAA 4ZUTA 3V0HA 1VACA 4FG0A 3ROOB 5DUML 3COOA 4NC1E 3ML8A 3V0AC 3GIZH 2WBJA 2OBGA 4M43H 3VXRE 3FHAA 4GAJH 4UZSA 3VSQA 1JXDA 3II2A 3RTQA 1QWNA 5A2JH 3VFUB 1NAMA 2PR9A 3AADB 5CSBA 2J6EA 4B53A 3AXHA 1MQ8A 1E4WL 1ERNA 1S7RA 2YBRA 3HUJA 3MYZA 4AYSA 1TLKA 1WZMA 1MJ8H 4LDOB 4X6BA 5DJYB 2VR4A 5JDSA 3NN8B 1LE9A 4WV1C 2H3KA 1MDAA 1NL0H 4MWFB 4NQVB 2WBKA 4XTRC 5FB8A 2OXHA 4GUPA 1AQ8A 4C8XA 2Q0ZX 2EEFA 3B6SA 5AYQA 1A6UL 3HPJB 2OTUA 1KCUL 2AQRA 4YO0B 2OJZL 3VRIB 1JE6A 2J21A 3AVEA 3QDGE 1P6WA 4MJ6A 4Z7OB 5D70L 1KV7A 4HWZA 5G4OA 1GR7A 3C5ZC 3CSFA 2CKBL 1RZQA 3HIZA 3HVNA 4NZ8A 1EHLH 2FIKB 4YZWA 2A99A 1T6WA 4IEFA 4XPGH 3MAWA 4FL4C 1GVIA 1QEXA 2DYPA 2VMCA 5EBLB 1KGUA 5K1JA 4C4UA 1XL4A 3EJQA 1IQWL 2X9XA 2WNXA 5CD3B 1R3HB 4TUOA 5EZIL 4ZFGH 3HE6D 3MRDA 4P2CG 4H5SB 2Q86A 1U2YA 5C0AB 3BP6A 5FXCH 3QNFA 5EU3B 5ID1A 4ZG1A 3CG8A 4G6AD 3AU1A 5E8EB 4APQD 2P5PA 3KPNA 3X1NA 1GKEA 4BZ1L 5CJOL 1T66D 2C7UB 1A6AB 2X4OB 3BZEB 3QXAA 3KLQA 3RYMA 4DP4X 1RURH 2HN7B 1JCKA 3U0PA 1CQYA 4P5KB 5DQJA 3MRGB 1YN7B 1YEDB 2OL3H 4ONFL 5B7FA 3CFNA 3UFIA 4P3CL 4F8PA 4TVPE 3BEVA 5FHAL 4Q9QL 1BVLA 1CS6A 1TF4A 5HPMA 3LZRA 3P1VA 4GKSA 1JNHA 3H3KA 5IW3A 1JYVA 1J11A 1T2QH 3UYOD 4KQ0A 4KRMB 1X5HA 2X3CA 5D5MF 3VXQA 1TPXB 1NUNB 1FG2B 4J1UA 4GRWE 5D93B 4XNXL 3KH4A 4JKPH 4RGOL 4KNTA 5CUSH 1MPAH 3EHBC 2XXFA 1J88A 5IQ7H 3MCG1 2A4ZA 1KJ3L 3UPCA 3QXVA 1FZMA 1JWSB 2E6QA 4ODBD 2XWXA 1J9TA 2IAMA 3QCTL 2NXYD 4BDVB 4EQ3A 1PKQA 3WXVL 1IBYA 5IB4B 1I7TA 3MRHB 1EAOA 5HGAA 4GQPH 1KLGB 1L5GA 1E5AA 3LNDA 1CD0A 4AZUA 2H3XC 2L7UA 4H88L 1M7DB 4CMHC 3VA2C 4MS8D 5C0JA 4UT6L 1TJGL 4I4WA 4RFNC 1JGUL 2P45B 4XVJH 4BSVA 4ZUVB 3WN5B 4NEHB 5CBAB 1YECH 1PLBA 2E7CA 1RD6A 1JJUA 1EV2E 3RP1A 1CJYA 1T5WB 1MVFA 2W88A 5CMAA 3ZQ9A 3T6WA 1D5IH 3T6XA 2YXMA 1NJ9B 3KLHD 1PZCA 4PEEA 3DX6B 4U1NA 2Z93B 2GJ6B 1OB1B 2Y1VA 3PQYE 4U0RB 5E8PB 4D8PA 2BH0A 2X87A 4HJSA 4D8OA 1SJXA 2FATL 4JO1H 5EOCL 4N0UB 4LCCA 3K72B 3NRFA 5IMMA 1U58A 3HI6L 1CLZL 3RL1A 5IBUB 4OFQA 2YWYA 2V33A 1Z3GL 3KE0A 1HHHB 3NFSH 1E90A 3WHE1 3W39B 5JHDB 3VI4F 4DQOH 1KB9K 2YA0A 1EO5A 4ABWA 2AZUA 5BZDA 3NGBB 3S3CB 2BNUA 4X6CA 3GINA 5EU7E 3VXME 3OKNB 4NNXB 4HHAB 3STLB 3DVGB 3DYMA 1AGCB 1KFAL 3T0EA 1RZ8A 4KTYA 2XZZA 2J8HA 3D3VB 3U82B 3WENA 4NHCH 4YFLF 3T6QC 2B1AL 2X4TB 3BWZA 3AWEA 3LKPA 4G8AC 4KI5F 3P3RA 3D34A 3DOHA 3SGEH 1GSKA 4KTGA 5DT1L 3TJHC 4OH2A 4QNPE 3C09B 3BQUC 3VD7A 2NSMA 5I82A 4JM4L 1T2JA 3U30B 5I1GH 5IMLA 3JYBA 1XGRA 4UMSA 1O75A 4FQLH 3LOWA 5DS8A 4DESA 3BHBB 3EH4B 4J12A 4RGMB 3HAEH 4PBWD 5FK9A 4N2AA 4NJAL 4JVPA 1AHWC 4TNWF 1NICA 3ISRA 4L3EA 2VSKB 3FSWA 4NN6C 4ZQKB 4OTXL 1CL7H 2NCMA 3M7OA 3PREA 2NY6D 4PD4J 1K72A 2H45A 4LGPB 2XN9E 2V4LA 3TONA 1N4XL 1FJ1B 1F1DA 3D4ZA 1KBGH 1NTDA 5HGBB 3C5JA 3MODH 1I1FB 4AMWA 2H0PA 4BELD 2AK4D 4PP1C 2VB5A 3LKOA 3UYRL 1O7DC 2PXYA 3HFML 3WD5L 3PDGA 1KYFA 3N91A 4FNLL 5GGVH 1OCRB 4PJEF 3RB5A 2V9TA 4FNPA 4E2OA 2OX5A 3QYCA 4K2UH 3VFOA 2XX1A 8CGTA 3QJUB 2IH3A 4XOBA 3H6JA 4WSGA 4UNVA 4PP2A 1QLRA 3BQVA 4OF5A 4W93A 2A73B 1KLFA 3HMXL 1OGSA 1CBVH 5J6HB 4G43B 1OTTD 1ZVYA 1BSIA 3IXAB 3BAEH 1BEXA 1YYCA 4HG4J 1LP9F 1QLEB 2OSYA 5IK3B 2XUWA 3VH8G 1N0LB 3HS8A 2W9LA 4MGXA 3IFLH 5JIDA 2E75C 3JV4A 1R3IH 3TNNB 1XL6A 2C4FU 4JFTA 1C5CL 4OIBA 1K8IA 3TEZA 5CP7B 1WITA 4X8XA 1UJ3C 4P2RB 1W72H 3HZMA 4GSUA 5EZOL 1PG7L 4XP5L 3VFSA 4MB3A 2PCYA 3PRZA 1UYWH 1E4KA 1V3KA 2V7NB 5K39B 5C0IA 3GSVB 2DQUL 5DRWB 4YPJA 2QGCA 4UQAA 5HJ3A 4DGWC 3I75A 2OS7A 3AXLA 4EDXB 1V7NH 4NNYA 3RWFA 3RBGA 3P54A 5D7SL 2CO1A 3FRPA 4PWKA 2DQTL 5I23A 3UADA 3I6GA 2CGYA 5KUKA 3PNRB 1YPZA 2IDSA 4KRPB 3MRFA 2A4CA 4N8UA 5DJCA 1JPFB 2DF3A 1T22A 3LKRA 4L5FH 1AYRA 4GG6A 4NQEE 3WO4C 2BP8B 1A0QH 4NSKB 4U0RC 1UXMA 4OJAA 2BHFA 1CD9B 5EBWB 1KLUA 1KV3A 1D5XB 2F1AA 3D18A 3H7BA 2LTQC 2P5WA 1RUKH 5JLZB 4RFEB 2EABA 3MRCA 4M8VA 1CGTA 1T1YB 2PW1A 3MLRL 3HE7B 1B90A 5G4MA 5JIPA 2FL5A 1T89A 1BPLB 1KPRA 3ECQA 4U49A 2Z31A 3M8OL 4Z7UB 1BLNB 3TO4B 4KTDL 2JTDA 3NA9H 3WY3A 1XEUA 3X1GA 3FCTA 1BQSA 1S9YB 4FZEH 4FFWC 4NXSA 1G84A 2JELH 1J1OH 1D6EB 5IW1A 4RFOL 1T1WA 1D7FA 1OQOA 3LEXA 2FEEL 2MMXA 4HH8A 3T2LA 4MFHA 4FZ8H 2Z35A 4MMXB 3O3UN 3OPZL 4MXWL 2J56A 3CAFA 1I82A 2BVPB 4P2YA 5DEZA 1KUMA 3Q2WA 2BPBA 2DIBA 1C5DA 3CK0H 3BIKB 3ABZA 4AKOA 2WWKT 3PWLA 3ZDYE 2OW7A 3U30C 4MXQC 1SUHA 5CN2A 3BH9B 3N2JA 1M9WA 4C56A 4JDVB 2X4PB 3L17A 2OMVA 4QTHA 1BAFL 4HU8A 3WIHL 1XCXA 4A1RA 1F42A 2CCWA 3NCFB 2EIMB 3NJHA 1Q72H 4Q58C 5I1HL 3W11C 1SUJA 4X4KA 2GCYA 1CDCA 5IHZA 1E6OL 4FRWA 5KVEE 3C12A 3H8NA 3QDJE 4DKEH 3DIFB 3GO1L 3L9RA 4Z8FH 4PRHA 3SPHA 1M3JA 1HQRB 2QDWA 2D7TH 4PTUB 4R5XA 2GI7A 1U0QA 4F8OA 4QUOA 1DL7L 3EJZC 3QE5A 4HUUA 3QRBA 3SKJH 3EH1A 4YDVA 3NSCA 4OGXL 3VO0A 1P6FA 3VFMA 2VWEC 4LIQH 3UGEA 3WTSA 4NPYB 4HVBA 2WXPA 5K33A 5T3XL 5FWQA 1QRNB 5IQMA 1DLHB 5CCKL 1GW0A 3GPSA 4BFEA 1VFBB 1PVHA 2Y6TE 4F91B 4DO6A 3HG1A 1XGTB 1A6TB 5CSZB 4Q0XL 1DQML 2YZ8A 1UUSA 1ZCRA 3LZOA 4HXBL 1QTYT 1W16A 1GRWA 5HYQA 1X6LA 2X3AA 1ZHBA 1YN6B 1XEDA 2BSTA 4UM9D 3OGCB 1B88A 2CLVA 2JVUA 1CI3M 2W9DL 3OZ9H 3PWPD 3W38A 3UO8B 4GRWF 4GY4A 1WA2X 4N25A 1SHXA 2RB8A 5L9DH 1KB5B 3NJXA 2XYBA 2F7OA 2VJXA 3N0AA 3FT3A 4XRCB 2PCPA 3KWWB 4M61A 3V5KB 3D2UB 4MNQE 1UD4A 5TF0A 3MRJB 4MD4A 3KS0J 3DX8B 4KRPC 3PJSA 4NO2A 3UPAA 3NBNA 4LLMB 4ONGH 4A7QA 3ZDZB 1IL1B 4ABQA 3BN9C 4EDWH 1I53A 5F9AC 1BJ1H 3C6LB 4BSWA 1MCKA 3F12B 4U6HA 4ZAKB 1TJIL 5HHXH 5CN1A 5BRQA 1HSAB 3E3QE 5DK3A 4PIRF 3NFPA 2FSEB 3GS4A 1OKEA 4N90D 4L8SA 3DGDA 1CE1H 3CHSA 2ADIA 3D39E 2BVEA 4KNQA 1FFRA 2KHAA 4QRUA 3C8DA 5DJ8A 3TO4C 4IKLA 4CGUB 2Q6WA 1AJ7H 5E5MA 5JPMA 4IIQA 2HRLA 4RAVB 5B7MA 4QTIH 1Z1WA 3PAYA 3NABL 4QY8B 4WW1B 43CAA 2UY6A 5J11B 2ZXBA 1A9VA 1UT1A 2ORBH 1P4IH 1BZ9A 1UFUA 5BZXA 4KKAC 1BZ8A 2O26U 3TZVA 3P9MB 1TTUA 4XZUB 2QMKA 1A7NL 3SDDD 3ZYOA 2E27L 2Z4TA 3QC5X 3P4MB 5KVDL 4EI0A 3ZYIA 1CXFA 5KAQF 1F4YL 1RZJH 2EDMA 5EU4B 5FO7B 4WFHE 3LPPA 2F53D 3PGDB 4RDQF 1ZEAH 5IHHA 3ROLA 2XETA 2FE0A 2A7BA 4RNRA 4TSAH 4K8RH 2K4AA 1ODAA 1E9QB 1N12A 2XACC 3S97C 4B6ZA 1I7ZA 1FIGH 1LO4L 3MR9A 4KY1H 4UV7L 4IK6A 3P2TA 1WFIA 3QUYC 4KI5D 4WHTB 5C08A 3ECUA 1C7SA 5GZND 4HKZA 4F57L 2UZXA 5FYLE 1FE8H 2WMPB 2MQ0A 4APQB 3KYMB 5D8JH 4I88A 1A6VL 4Y5VB 4K5NA 4ZS7H 1N2RB 4O2CB 2P80A 1SQ2N 2X6CA 4QNPF 3SKMB 1EXUA 2JKLA 1WFOA 2YGNA 1WS7A 5E8DH 1YDPB 2RMNA 2X2UA 1RSYA 3ULUL 4AH2A 4J8RB 3DMMA 3LH2H 4JJOA 4X6FB 2ZX9A 1PBYA 4ENEC 5C92A 4RSYA 1UKSA 4G7VL 2EDHA 4HKBA 4LSDA 4P5TD 1DBJL 1Y0LB 4IMKA 5CFHA 1L9SA 3DJTA 2GHWB 4PJ9C 4E9TA 5I17A 1QNZH 2VQ1B 2ZX5A 2XRAL 1IGYA 4ZMWA 1IILE 1QWHA 4GB9A 3G5XA 5JUEL 1H8NA 4X9GA 3QUZD 2ICWB 4N2CA 2AMGA 2EXWD 5I9QC 4UINL 5D7IB 1HQ4B 4RAHA 3PGFL 5IWLA 4AVIA 1JPGA 1LL1A 1VLXA 2ZWZA 3ETBF 3NIFB 4HA1A 3TN0C 1OAXL 1DZ0A 2KPWA 1ED3B 1FC2D 5F7MC 4DP0X 1HKFA 1VCAA 5GZOD 4AENA 3ILDA 4JLRA 4ATTA 3D85D 4K7PX 5IV2B 1RHHA 1F2XK 1NC4A 4E9LA 3APNA 3CSYB 4H20L 1ZLSH 3BXNB 3LCYA 4AJVA 1J10A 3E1F1 2YA2A 1OE2A 3ULVH 2VLKB 2FX9H 2HCZX 4PLJC 4G8FA 1KCUH 2VQUA 3LH8A 3IDNA 2HVJB 1S7WB 4BFOA 1YNLH 3DX9B 1DJSA 4ZDHB 5HHVL 2HRPH 4HK0A 1OTUD 1ZV9A 1BQHB 4NERA 2CKBH 1LO3H 1MIMH 1ACCA 2B1HL 2IANA 2EEBA 4WCYL 4YHMH 2RA1A 3BYYA 5BNXD 4PY8J 2OAAA 3MACH 1OP5K 3LZLA 4MNHB 4ZXBC 1DQTA 2OK0H 1BOYA 5K9KB 1IQWH 5D2LB 1ULVA 1SHMA 2VIRB 4L3CA 5TE4L 4AEHH 2BNQE 5F7EH 2J8OA 4KKPA 2H8PA 2CPUA 5IEKB 2PKDA 3A6BL 3VM5A 3SY6A 2Z3FA 3SPCA 3T8VA 5CJOH 1OF0A 4C47A 1OP3H 1NGYB 1Q8MA 2CPCA 1XT5A 3MRIA 3VJ6B 2NPLX 1JFQH 4QRTA 2H1XA 3VFTA 3WMSA 3B2UC 4PTTA 4PYHA 4LARL 4DAGL 3CDZA 4TNWK 3RX7A 1TJXA 2CIIB 3HAEA 4MMZC 3PV7A 5L2JB 2EZ0D 1P9MC 1DSFH 3KXFD 3D4CA 2F6AA 5DR5L 5E2TL 1I85A 1DUZA 1J9RA 5IB3B 3WMPA 4BGLA 4G8GE 1UH4A 5H8DA 5BW7C 4RGOH 4PJBB 4AYFB 4PRDB 4HPOH 3ARRA 5JPNB 5J4MA 4NM8H 3SCMA 2IWEA 2P7TA 2F7PA 3HNSH 4L05A 4AC2A 3D33A 1SBBA 1W8NA 1K2DB 5ERWA 3FRUB 3KLLA 5HGDA 5SWZE 5GGQL 4N8VG 1KJVA 2GK2A 3MOQA 1TT6A 1U8HB 5JA9A 4AVJA 5BVJA 1DVZA 3FO9B 3PUUA 2AXGA 3FUIA 4H88H 4N28A 2NQ3A 3HE6C 4FXTA 5EZPA 4LLUA 4PJXB 3VXRD 3O45B 2XA3A 3NOIA 4UT6H 4ES8A 3BPLB 4HCRH 4G6AC 4KOCA 2VMEA 4HC1L 4AGOA 3VD9A 4NP9A 1WLHA 1U9KA 2BDNH 2WXJA 3MC0A 5IQ9A 1AXTH 1W72A 1R5VB 2UX6A 2J8UE 4ONOA 4NP4H 5EUKB 3ZDYF 4CL7A 1ZLUH 1JI1A 2Y7OA 1WC7B 1XF2B 2EVJA 1CICD 3VXUA 5CCJA 4JL1A 4OM0H 2KLSA 3QDGD 4QRRA 1AANA 5KSAB 2NW3A 3GYRA 2WO2B 1W91A 4ERSH 1F1AA 4N9GA 3WNOA 1P5VB 4YH6A 5HI3C 3ZT6A 2AKRA 4MS6A 3E38A 5C0ND 2OPCA 3VXTA 4X4YB 3IPFA 1FFPA 3WY1A 3V5HA 1URIA 4NQUA 3JWDH 2NXYC 1H9DA 1A66A 4AIZA 3TWCH 4CDHA 1TZAA 3OKDA 4X5WB 5FUZL 4Z95L 5KTEL 1KYDA 4HMEA 4YNYA 1BECA 4M1GL 4QO1B 4X0KA 5IMOB 2GSIB 1DYZA 1CLOL 1FYTD 1I3UA 4QKXB 4EI5A 1U2HA 1U95A 4ELKB 1PX4A 3QXUA 4MS8C 1R34A 1CI5A 4QDGA 2PPDA 3C60D 3GTTA 3HC3H 3IMTA 4RISH 3SYCA 5E00B 2HFEB 1UD6A 2B16A 3TVMD 2HT2D 4TVPD 1YEHH 2GFBA 1S5HA 4KRLB 3KLHC 5EPMB 4JM4H 1QKZH 3T3MB 4FX5A 2XWTB 4UNTA 2W07B 1E6JL 1MCHA 4MCYB 4PJ7E 4PV1C 4W6YB 1XBRA 2XKNB 3H56A 3VFGL 5BV7B 4AGNA 1I9IH 5J12B 1P4BH 3KPSE 3OZKA 3HFFA 1TITA 1CVRA 4R90L 1AQKH 3SJVA 3U7YH 5HVHC 3ZE1B 4XAWL 4FGMA 4K7FB 2GBAA 5E2VH 1FAIH 3GXFA 1DQDL 1UZ8A 2QVKA 3O6ML 4M7KL 2GKIA 4N6RA 1N4XH 3MBWA 4FHJA 5T5FL 3RILA 4Y5YA 4PYGA 4IRSA 3EGDB 2G2PA 2N1KA 1FZJA 2GBTA 5GGSY 1TKWA 1RZ7L 2NXZD 4WEMB 3ARBB 1DVTA 2ENYA 1Y18A 3U9UB 4L8BA 3MOBH 1BEYH 2CE6A 1CGSL 3NZ8B 4N2HA 1JNNL 1E8YA 1M3IA 3RY6A 4P5RA 3SPGA 1AGDB 5HHNB 3DUUA 1J7VR 4BH8A 2CLZB 4P3DB 1JL8A 1QTPA 1D5MA 5GRZA 3FCSB 3P0YL 2JI1A 3SDCD 4E9YA 3KPRE 3MFFA 1USQA 3QZMA 4YVUA 1QFWL 3CVIL 2Y07H 3HBZA 2FR4A 5C7XL 3BMVA 5F9JA 1NOFA 5LVEA 3PQYD 1ZSDA 4QOKE 3WDJA 2YAEA 4DCQB 1C5CH 2HX7A 2Y36L 3IJ9A 1M1XB 3QB7C 4OZFB 1NPUA 2WTPA 1BZDA 1A4AA 3MUGA 1NBCA 4YBLB 4AT6B 4G8IA 5D96C 1K6QH 5DJDB 2W94A 2YD8A 4OZGB 4XP5H 5DZNA 1KBVA 2AQQA 1MHEA 2K6ZA 1JPSH 1J48A 2DM3A 1TFPA 5LQBL 2NY6C 2D7OA 1KB9J 5CU5A 3UPRB 1ML0A 1IKFH 5E6ID 3O3BB 3ESOA 1TR7A 1CLYL 2Y6SD 3S6CA 1SY6H 2WNKA 5D7SH 3H2WA 3VXMD 3VGAB 3V10A 1WFUA 4JHZA 3EUDA 4GRLB 2TAAA 5AAMC 1RUAH 4MAYA 2BZ7A 5ICZA 1IGJA 4M7JL 2NW2B 2D31B 2VR3A 1KXVC 3FQ2A 4FMFA 2ICWJ 1F00I 2P42B 2WQSA 3FU9A 1MRFL 5JIIA 1AQHA 1HILA 4O02B 4OLZL 1JK9B 4JM2B 4ANKA 1P84K 3FAWA 1Y6KR 1F3DJ 3EGSB 3EH5B 3FQWB 1MG2C 2VZTA 3LHAA 4PR5B 5C0DA 1FN4B 3MJ8A 1XVSA 1ZIAA 3NACH 3KLAB 5EA0H 2L7JA 5BQ7B 5I0WA 4FNTA 2C26A 4IMLB 1JHKL 3CLEL 4K3DH 3M8OH 3ZKND 4PJ8D 4LAQL 4HUXA 4IOFC 4KTDH 1ZVHA 4K3JL 5DHMC 3JTBA 1KIUB 1IGFL 5D5MB 1XB6A 2EE2A 2XG5B 1GTFA 4NIKB 2ILLA 3K8KA 2JJWA 4X98B 3FO2B 3VWKD 1TEGA 2ALAA 2F5BL 1KC5H 1E2WA 4FDWA 4AEEA 1C8QA 1OGAE 3KDMA 4JFYB 3L7FA 3V4PH 2QBWA 2X12A 2XN9D 5F44A 5E2UL 4EUPB 2WIIB 1QR1A 4B9PA 4KHTH 1A9EA 3SE8L 2B8OT 1IJ9A 2KQMA 5I8KH 4X7EC 2N0KA 3GBML 3X11A 3CXDH 5AEAA 3QCUH 4RMVA 4P57A 4TNVK 2WLMA 4XWGH 2XN1A 4JS7A 2X9YA 5FAAA 1LNUB 2XPYA 3OC8A 3PP3H 5B38G 5D6CA 3AW5A 4R83A 4WGKA 3EJYD 3HB3D 1CK0L 4L0PB 1IAOB 3HZVB 3FUEA 3F05A 1O5PA 2FQGA 4ZX4A 1SYVB 4EI6B 2BP0B 2BY3A 4AM0Q 2FBJH 5AAPA 5I6OA 4LLYB 3VH8A 2GT9A 4PUBL 3BC9A 3L4YA 3MRQB 4JE4B 4NENB 4R4FL 4JGUA 4RBPH 3MVSA 1J8HE 5GSRB 2YLHA 3FFDA 5HHPB 4Z7VA 2C3GA 1J05A 1NLBH 2O5XH 3LYRA 4XNZB 3DHMA 3PWVA 5I24A 1RJYA 1TENA 4IW4C 4CC4C 3GFUA 1CFSB 2XI9A 4GS7B 1DVXA 1FNSH 1FAKT 2IPKB 1S9WB 1WBYB 3G6AA 1HWHB 2HYMA 3BGMB 5K9JL 2C9VA 3T0DA 2F8XC 1WA1X 4NZUH 5MERB 2Y1YA 3EO1A 4XO5A 2VUYA 3O2VH 3D52A 2NY4D 1GAFL 4MD0A 3VI4B 5KYXA 3HR5B 1AZBA 4YHOH 2O61B 1QHPA 3LH9A 1H8OA 3GJFH 2AQ3A 3LVTA 3QQNA 2CDEA 3MX0B 4G7YH 5K9OA 2AI0L 4U6VL 1JN6A 3S88H 3WGUB 2F53B 3LB6C 5CCKH 1SXSA 3PIQB 1PNDA 3GSRA 2CUIA 4OGZA 4MBRA 1AS8A 4NBXB 4NQED 1A2YA 3ETSA 4Q0XH 3QRLA 5DC9B 2H6PA 4HXBH 2VL5B 3S5ZA 3SB3A 4DNLA 1OLZA 2VUKA 1SDDB 2UWEE 1EBAA 4JQVC 2AJUH 3PABA 4WWKD 1Y07A 4I89A 2NX5D 3UEZA 4FQIH 5HYJA 3R18A 3JV6A 4JFSA 2FRGP 2DWEA 5FYJL 3F5WB 5IB2A 3X12A 1LO0H 1AYOA 1W8OA 2WN3A 4FN0A 4OCSL 4OF3A 1V27A 2YMOA 3N9GL 4PS4L 3QYMA 4M7ZB 1TQSA 1R3JB 2FBRA 4Z3IA 3AS3A 3NQKA 5B4MC 4J6RH 5E23A 2XKUA 5DD5H 4HUVA 1QWUA 3E80A 3Q2LA 5EO9B 1G0YR 4YHNA 1PKOA 2IDQA 3I84A 4GBXA 3EF4A 3T1FB 3GQFA 3HC4L 1DN0A 2B77A 3FB5B 1Z9MA 3ESPA 4WFFE 4GW1B 1KENL 1BM3H 4ZTPH 4K71B 2Y7LA 4ZX5A 2VXQH 5BXFB 3US1A 4P99A 2YC1A 1QBLH 3QUZB 4XP4L 4PJEB 4KGJA 2E74C 4ISVB 1ITCA 4F7TA 2K3TA 4O51B 1HEJC 4AUUA 4XPHH 5EU6B 4ZPVB 2CKBA 1DVFD 3HLKA 4P49A 5KJ4A 3S3SA 3MA7A 4L18A 4GT7A 3QULB 5AUMA 4MSWA 3IBOA 3MUHL 3D85B 5L2KA 1MFCL 1YG9A 2C8NA 2J8UF 1VZIA 2W65B 2Z7ZA 2R2HB 3GSXA 3KNBB 4HH9B 2I5YH 2FIRT 2C9RA 2P5EB 4OLXL 4Y0GA 1I9RH 3U36A 1BXVA 1LP9B 1WGVA 2DQEL 1H3PL 2D3JA 4WUUE 2Y5QA 3QDJD 1RZPA 2A9NL 3AUVA 1K5NB 3FQUB 2IG2H 5FCUH 3ZDXE 4N0CD 5KVDH 5EOTA 4LCWA 2FEDD 1N59A 4UANA 1JD7A 5I74B 3UZVB 4AG4L 1YEWA 1XR8B 3TYGL 4RA0C 4TOYL 4XXCA 4ZOEA 3ESUF 1YEFH 3IRPX 5TE7L 4L37A 2CRYA 2YOAA 2VLRE 3AXIA 4F7MA 3A67L 4JCMA 3VYPA 1B2YA 5C0RL 1J5IA 1MFNA 1AO7B 1LO4H 3EAKA 3QRFM 3AGVA 7PAZA 1JZ8A 4HLEA 4JKWA 4WTZA 5TH2A 4U7MA 4LOUC 4WNQA 3TA3D 2EH8L 4F57H 1J9SA 2VR8A 2JTYA 1DP0A 3KBEA 4N1CA 3VVWA 3MGOB 4JKMA 4ELMA 1L9QA 3HS9A 2X2YA 1DQVA 5C07A 3CH1A 3GMMA 4FXKC 2FX7L 3IDXL 3VFNB 2FO4B 3DVFA 1BYOA 5HD8D 2KT6A 2FECI 2VW4A 3IKKA 2BSEA 1DBMH 1EGJL 4F9LA 4L1LA 2JV6A 3VM7A 4ZX3A 4PJ7F 5AVRB 2QQLL 3DK0A 3KXFB 1PYWA 1NCBH 4HD9A 1XIWA 4PW3A 5G55A 5I1CL 1YJDC 1XD1A 1DBJH 4QXVA 3GSQA 4Z5RB 3SDDC 5BOJA 4UT6A 4XXDB 3QA3A 4HCRA 5EIIG 3FYEB 4XPBL 4OI9A 4PVLA 2XRAH 1BVKB 3CSPA 3KPOA 5TE6H 4MNQD 4BH7A 4GP4B 1EFXA 2GJPA 4MAUL 2K78A 2MFNA 3BDYL 4WWID 1JGDB 5E8NA 3ZHLA 3PGFH 4YQXH 5FLVA 5I0XA 3VMOA 1OAXH 4QPEA 1QZNA 3UIYA 1UHVA 1A7RL 4ETQA 3VD5A 5IJCC 3EYQD 3IF1A 5IROA 1KB5L 3BZFB 5SWSB 5SV4A 1T2XA 1E2VA 1N0XH 3HS0A 2ZKHL 5GZNC 3Q8CA 1E9OA 3O8XD 2NUPB 2OI9B 4H20H 4CJ0A 3D39D 5F93C 3KPQB 1BQLH 1GIGH 2E46A 2F54A 2H26A 3VXRB 4ADIA 5DK2B 3WXWH 3O6FD 2R9HD 1ORQB 1BF5A 4GAGL 1BWMA 3K4ZA 5DLLA 3W9EB 3RJQB 3BW9A 1KJ2B 4KUZL 4LVNB 4DUXA 2I24N 4PVNA 1IAKA 4KJYA 3GI8H 4UIMA 4HW6A 4U6XA 3VCLB 3HR6A 3PWJB 2LR4A 3PCYA 2VLJA 4XT1C 2VZOA 1YEEH 2IOMA 1XGPA 3U9PL 4MNGE 5IQLA 4L4VB 5AD0A 2B1HH 1R24A 1CICB 2I9LB 1AQDA 4JN2A 4GQ9H 2CHXA 4P5TC 3QDGB 1U8NA 5IZ7A 4GP5B 3VFPB 1KTDB 3FU7B 3DI2B 3P0VL 2CO7A 1NGQL 2Q9OA 4WFHD 1G43A 2WWMC 2CM6A 2Z0UA 5IMKB 1DDTA 2XXMB 1MFUA 5GS1B 3A6BH 4HZAA 2GJZA 2GC4C 4E5XB 2WZPD 1U33A 1JZ4A 5IW6A 4FQHA 3VYNA 3ZL4L 5H94A 1KELL 1VA9A 3O9WD 1VCBC 4HLJA 4LQFL 2MQGA 3CFUA 3QXTA 4E9WA 4X7TA 1B6UA 1ZTMA 2BHZA 3PJLA 3P3SA 5FYLD 4Y4FC 3BRFA 5FDWB 3DLQR 2BVTA 4G1MA 4A2MA 1QX1A 5IT2H 3L95B 2OMWB 4KNUA 1KBKA 4I85A 5DR5H 2XWDA 1NCDH 2AZAA 4ZI8A 1IC4L 3F01A 1YQVH 2X4NA 3C60B 3UZEC 4I18A 3ARGD 5I66B 5KSVB 3ASNB 3PDOB 4KH9A 3ABKB 3D0VB 4HZLA 4MA7L 4NQCE 2MOVA 3TVMB 3CFKA 4G9FE 4FYTA 2YK1L 1KTJA 2AJVL 3APFA 3BWSA 1T20A 4JPVL 4OD3L 1T7WA 3OGOE 3O0LA 3EYVA 1NPJA 3HZKA 5TGBB 1SLUA 2K8QA 2Z9TA 4GXVL 4JO5A 4GRWB 2HVKB 2WXGA 3BO8B 1OCWL 4R6UA 3WKQA 5I8EA 3DXAA 3V6ZA 4LB8A 3BSZH 5ESVB 1QVOB 1DN2A 5I6PA 1E3FA 3QIUA 4NS0A 1WBXB 1OARL 1U8OB 4JEGB 1FSKC 1T4KA 1BAGA 3VI3A 2FT7A 3IVKB 3AFLA 1L9NA 1BREA 2ZCHH 3NJKA 1NSNH 3ZYZA 4OR1A 4RIRA 5F6IC 5FF6B 5D1QA 1T1ZA 3PNWA 2NXZB 4KVPA 2A6IB 3SDXB 3U0TB 2GHZA 1RFDH 3L3JA 1KGYE 2LLNA 3MUY1 1FPTL 2YO3A 2WKOA 3GHEL 3U9WA 2EZ0C 1TTAA 2ZF9A 2C4XA 1MRDL 1N3NB 2R29L 4JDEB 5C0GA 1E4XL 1DUYA 5DUPH 3IGLA 1QUNA 2WB7A 2WKLA 4GMTL 5HSFA 3T04D 5I1JH 3SDCB 4QXTB 4KDTC 2VT0A 1KIQA 4YK4B 4AQAA 3TASA 3BP5B 1JPTH 3IJYA 4LHJB 1OSYA 1IEAB 1X5YA 2NY3D 1SY6A 4JRYE 3FTGB 3QIBA 4TUUA 2ZOOA 3PQYB 3S36L 1SN2A 5K1VA 2YPVH 5E5LA 3SQBB 1IVTA 4GI8A 2N56A 2NY5L 1XCWA 1P1ZB 2IDCA 4CSPA 5KTEH 2QQNH 4M1GH 5J1SC 3WEXA 4B9YA 2ADGA 1F56A 3D0LB 4FOMA 4BFIA 2CDGB 1PDKB 1RU9H 5FGCE 2V3DA 2BNQD 4JQIL 4PRPB 3KM1A 1XGUB 3OXSB 4EN3A 4AV4A 2EXTA 1JMXA 5B1CA 3RWHA 2Z8VC 4QYOB 2OR9L 1AHMA 3TO2B 4POYA 1P69B 4QI3A 4HULB 1E3ZA 3T2NL 4F8TA 4YDIL 3VSTA 3D25B 1LK3H 4DVBB 3VXMB 1BIIA 4D9QE 4DF9A 4FNUA 5AKSA 1IZJA 3KPLA 2AV7A 4P23D 4BINA 1PTZA 1J8SA 1F58L 1BF2A 4XCEB 1CU4L 3UTQA 2Y22A 1E6JH 2X6BA 4JREC 2EE9A 5AVWB 5GRXG 1DJWA 2Z91B 4WI3A 3V4PA 1HYRC 4G8GD 5CKAA 4NB7A 4UQ9A 4FQCH 4FEIA 3K80A 2UWEF 2QSTA 4S2SB 1DSYA 1YC7A 3V4VH 1PF3A 1J1PL 2VITB 2EYSB 1S7UB 5IB5B 4N8VA 3TLRA 3EFDL 5F89B 5DA0B 5DK0B 4X5LA 1LEIA 1PIGA 2WM0A 4M7KH 3RJOA 5C0NC 5E9DA 4AL8C 5DHVB 3MRMB 2IXQA 2KLRA 3J2PA 4HJ0D 4POUB 5C09A 4AEIH 1I4FA 4OUUA 2UZYA 2LE9A 5SWZD 3QJOA 3STZB 3QO1B 1F8TH 1G5GA 4U1KB 2BWIA 1JZ5A 3ZO9A 2BXYA 1RZ7H 2VMDA 3P11L 4YHZH 3RIAF 1AP2A 1AZNA 1JZEA 4JAMA 4J6IA 2GK0A 3HUJE 3DGGA 3NSFA 4LRNH 5L4FA 2ZKMX 3S0PA 2OMTB 2COVD 2XN9B 3OG6B 1S8DA 5ANMA 1HJBC 2B2XH 3L3GA 5E5RB 5K1NA 3B9KD 4JFFA 3WL9A 1CFMA 1XSIA 4JFVA 3KYNB 1BIHA 2X7LB 1VGEL 2YKKA 2VDRB 3LNEA 2WZ6A 3OXRB 4HWEH 1T0MB 3GS0A 5ETUB 2VDMB 2ATPA 3ES6B 2QJDA 3HW7A 2VC2H 5BS0E 5KG9B 4U1IA 4PWFA 2VKWA 4OV5A 2DWDB 3SDAA 2KLTA 1F86A 3DVNB 1HZKA 3QXDA 4HQQL 1GGIL 3QH3B 6CGTA 3L2LA 3N1PC 3ATBA 2P47B 4W9EC 2F1EA 4OQTL 2XXCB 5IBTL 1K4CA 1IX2A 4JFOA 4ETYA 3UGXA 3C5SA 4DEWA 3BKCL 2APFA 1RZGA 3GJFA 1A02N 4W4OA 3VB9A 5BOPA 2Y5TB 1WWWX 2ZWKA 3ZDXF 3POCA 3NZSA 4YDKL 4LKCA 2ADJA 4UDUA 4ZRGA 3DETD 5ELIA 4JFPB 2AJSL 1VAHA 4TQHA 1NBYA 3D69A 3GZPA 5IM7A 4LSRL 1T0NB 4ZFZA 3ORJA 1JK8B 5IG7B 2XSKA 1HEHC 1XCQA 1MVYA 4XN2A 5HVGB 2IGFH 1XF5B 2YARA 4K5LA 4M56A 4YN3A 5JQHC 1ZANL 2NRDA 1XH1A 3DSNB 4PJ5B 4MLSA 2WUBH 4WKZA 3TA4D 4K23H 4PMFA 3UG4A 3RKDC 2HPOA 4YAQB 2YAQA 4MD5B 3NIGE 4YHIB 2YR3A 1KJMA 1GYCA 4G42A 2X6UA 4AGLA 1EDQA 3LIUA 5DS1A 2BS71 3RGVC 1MWAB 3MV9A 3QJRB 5I73B 5DGRA 1U3HA 2V5YA 4NO3A 3GXMA 4NQEB 1J8RA 1JERA 1DJHA 2WLKA 3ZL2A 1NGXA 1KULA 4AE1A 4LAQH 1W9XA 4W6XB 2NDGA 4LU5H 4Z7AA 1L9OA 4FJYA 5FPIA 1IGFH 4KTEL 1KIRA 1UVQB 1PKQE 2CBPA 3KPSD 2P43B 3VGEA 1AGBB 1JZHA 1S6NA 1U8MA 3LS5L 1ZRUA 3MLYL 2LQRA 4JQXA 1DTUA 2ZJSH 1G6RH 1YAIA 3CPUA 4M00A 4HWNA 1MNUL 2UYLA 2B7DT 2VXQA 3GRBA 5A7EA 1TQBB 1Z6JT 1Q0XL 3QNZB 3QUMB 4PJGB 5IVXE 4Z76B 4RAUA 4OFYA 5KYYB 4XC1H 3A6OA 3KD4A 5TDNA 2YGQA 3JV0A 3SE8H 1FGNL 3N44F 1FV1B 3MYJB 5E6IC 5ESAA 1JGLL 5BV7L 2Y6SC 1KPUB 2FT8A 3BYTA 2G3NA 3I9GL 5EU7C 5KN5B 1C1EH 5F3BB 1Q0YH 1FFQA 1BVOA 1BBJA 5EO0B 2WINB 4G82A 3OHMB 1RJZB 3DWTA 5HHOB 1K8DB 2JKJA 4MDJB 1B4JH 4PJDA 5KBKA 4AQ1B 1KXTA 1M05B 3OKKA 3TEUA 3FUFA 1CCZA 1AMXA 3GSWB 4PS3A 3ZMRA 2FJGB 2RCSL 4FQPA 3SE6A 1WIPA 2X38A 3KPRD 4R4FH 4DGIL 4JNXA 3TIEA 2FJFA 5CGYD 4UV4L 5DMKB 4QHLB 4OZIE 1VPOH 4BA8A 3CMOH 4LPCA 4RZKA 1M7UA 1O7VA 3A22A 2WTRB 2BMKA 4Z18A 5J06A 2D2OA 3EIFA 1HL4A 1DCEA 3IU3B 4A67A 3ZKNC 3QI9B 1M42A 1MI5B 4HF5L 1AR1D 2VERN 2X9ZA 4PJ8C 1AY1L 4JO2L 2O1AA 4H13C 1RVFH 4N2OA 2FUQA 3P69A 5CHNA 4FHKA 4H40A 3M6DA 4UTBH 3VWKC 4NRZB 3B9AA 1X3DA 4X6CE 2HT3C 1WO2A 3UAEA 2ZUWA 4XVTL 1RZKC 5C0FA 4J3OH 5AZUA 3FQRB 5T1KA 4P9HC 2GABA 3REWB 4X2UA 2F7QA 4N2IA 1JXFA 1J5DA 4LNRA 5FGSA 3CLWA 3GMPB 1SYSA 3NCBB 1ID5I 3PG2A 3IDMA 5I0DA 1BG1A 5JA8B 3J7HA 2DKMA 3RTLA 3EJYC 5D1XC 3HB3C 5C0CB 5DO2C 4J5VA 5IEHB 4ODXB 3ZOAA 1RZFL 3FB6A 5CLYA 3ILPA 5HYSB 4LSVL 4RLDA 4NM4H 4KZDH 5KBNC 1R3LB 3WLBA 1ETZB 4FP8L 4J3WA 1P84J 2YQ3A 1R1CA 4MVBC 4NUJA 4QWWC 3T4AB 4H8WC 1ORSA 4WJ5A 4FTVB 1PZAA 2R0ZH 1A4BA 3FB8A 4JZJB 4FQ2H 1R75A 4WV1A 5KSUA 3QJHB 2WQAA 4JZNB 4WI7A 5EBGA 1I1AB 1PSKH 3QQDA 5FO8A 4PJFA 3IXTA 4KFMA 1MFBL 5DZOA 3OWEA 2HKAA 1I8IA 4NKMB 2Q10A 4PS4H 3BVUA 3BCFA 1A9BA 3N5AA 1I9EA 2DQGH 2R0LH 3MUZ1 1OGAD 2VJ8A 4NQQA 3J27A 5B38A 4O2EB 1BMWA 3B2MA 4AJWA 1MEXH 3NZUA 2VRAA 3C5ZA 3D2TA 4HBQA 4YE4L 2IPTL 4LVHB 4OJYA 2NY4C 2E8ZA 2WLLA 5E4IA 1U8QA 2M1KA 4X7SH 2QFPA 1SEBA 5CF3A 2W59A 4P04A 2CCVA 2ZAHA 1FNGA 4XAKE 1ZAGA 5L6YL 1PCSA 2YAOA 4GMSL 4D0DA 4M5YH 1PU0A 3NCXA 4LP8A 4QT5B 1XV8A 1FO0H 3T65A 2QDVA 1JF6A 2JXMA 1MH5A 4QEGA 5CWSA 3T71A 2R51A 1J8HD 1MFCH 3ISYA 4LASL 3V0VB 4NKIL 1UKTA 4DP5X 4X5PA 1TZHA 5I1DB 1MHPH 4F7EA 4Y9BA 1H5BC 3SOBH 5EEVA 1G9NL 2BRRL 3O8XB 4JY5L 4ONHA 4WWKC 2PTTB 3D39B 5I5IA 1NKGA 1HOCB 3QUKA 4GSQA 4DP6X 3OKEA 4RMWA 1JZ3A 2J1KA 1NFKA 3O6FB 3WTVA 1EUTA 2AVFA 3PHSA 4WQOA 5A16B 2JCCE 3WJMB 4QHKI 4GINA 2EVHA 5IOPB 4KK9D 5FC9A 4AX3A 1JI2A 2ZUQB 1URLA 5LCVH 2WWOA 3BWAA 1WWCA 4WW2C 4OI8A 3SOTA 1DJYA 3T8MA 1YPZE 4KMLB 5DSCA 5FOJA 5C9JA 2W81C 1JOIA 4AQ1C 1EEZA 2O6PA 4GG6E 4NT6A 2DQCH 1SNRA 3FNKA 3FH8A 3D9AH 3UXFA 3U7WL 4QRPB 4XP9H 2IMNA 2EH8H 3V6OC 3OKMA 2VDKB 3MTRA 2EEDA 2P5WE 3DROA 3JTTB 2DKSA 2JKXA 3ZZSA 5C6WH 1F45A 4FQ1H 3Q48A 1XGQA 3HKZA 2FX7H 4YSSA 1DVFC 4WEBL 3O9WB 4X6EA 1WK0A 4KJQD 2V2XB 5SV3A 2HJFA 1XDTT 1XMEB 4LHUD 3OAUH 1YEGL 4ZS6C 5D1ZB 5F7HA 5BZWA 3BSZA 2AXWA 3IKCA 4JFHE 1TEFA 2RFXA 3KPTA 4NQXA 4FNSA 4N86A 5I1CH 4ZTEA 3ARGB 3WTWA 3ERXA 4BZYA 4OJFH 1NMBH 1FCCA 3LQAC 4N0CC 2YD4A 3TBSB 5KW9H 1LVEA 1J5HA 2FEDC 4NPJA 5GGTL 4XCNA 5F96L 1G0DA 2XWBB 3MMEB 2DQHH 5CU9A 2DM4A 1MDTA 4UQ2B 4EVNA 1DE4A 2CUHA 2ZG3A 3CN1A 5JHMA 4RMTA 3B5TA 3CXHK 3MBXH 2KL6A 5C97A 4WFFD 1E5UI 1A3LH 4HDIA 2QFRA 4DP7X 4C56E 4OFDA 3HUJF 3C2AL 2WXOA 1UXSB 1V3MA 3TA3C 1M2OA 3O6KL 4XMKH 5T1DH 4RCAA 4KROB 4X42A 5LLIC 2Z7WA 1P4LA 3NIDB 4U1SA 4JZJC 4YDNA 4GAGH 1H6EA 5F88A 1QSFE 1RMFL 3QFJA 2YPVA 5HD8C 4JFUA 4Y4KD 4LKXB 3ZTNL 4Q56A 4ODTH 4PRHE 4G59C 4XNQA 3HLAA 1XO8A 4WI9A 3LD8C 1TZIB 2FJSA 4KDWA 5KYUB 1Q38A 1VFAB 4PG2C 4U0QB 3GIVB 3KPMB 4WUUD 1FFNB 1B0GA 2VDKH 3VU2A 2F5AH 3GK8H 1FLRH 3S5LG 1NDGA 3V9CA 3CQPA 3BQUA 4GG8A 5CILL 5IIEA 4P9MH 2QEJA 1T7XA 3V6BR 1N8ZB 1URZA 5KSBA 2C3WA 3P0VH 4R7DA 3TCLB 4MA8H 1S5IH 1R6VA 2ZOKA 4U1HA 1SOKA 4UU9A 2NY3B 1CFNA 1KWGA 4CADB 5TDOB 3UBXB 2FQFA 1KTLB 1GHFH 1AHWA 2YSSB 2Z92B 2Y5EA 2YRPA 3NFNA 4YDJB 2VLRD 3ULAB 1LD9A 3LDBB 2B3IA 2KZ1B 1JF1A 3NMEA 4IRZH 4N3UA 4ABUA 4G71B 3GSNH 3HG1E 3WFHB 3EYQC 1AKJD 1HJCA 4XOEA 3WKMH 4NO0B 4Y19A 1NCAH 5ALCH 3V4VA 3QS2A 1MW0A 1XF3A 4JRFA 4ZW5A 5DJ6A 3VXPA 5JOFB 2GITB 2NTFB 3DV6A 3SO5A 2R9HC 4YL4A 3WE6B 1CYWA 1C12A 3NIGF 1UD3A 2AGJL 3RIAK 4BKSC 3UYPA 5JW5B 1HHIA 1TTBA 2SEBB 4MA7H 2CRZA 3DTUB 1XBDA 3B1TA 2HLFD 4N24A 3F7LA 4BFGA 5EIIA 3KW7A 4I1RA 1LEKB 2AJVH 2BIHA 2FWOA 5D9SB 4JPVH 1B0RA 3LZPA 3EJUA 4NOFA 4JDZA 3P4OB 4O4YL 2UUDK 4Q9CA 4NCDA 4G8GB 3ZTCC 2CO6A 3BWUC 4QRSB 1GC1L 3AMLA 1S2EA 5E7FA 1F0LA 2EDOA 2AV1A 2C34A 4HEMA 1Q1JH 2VO5A 1UJ3A 3GSUA 4C54A 2JKSA 5IVXF 3U6XA 5CEYA 1WG3A 1B9ZA 1AFVL 3F84A 4YXHH 5CZVL 2G9HB 2WQ8A 4FNRA 2EVGA 5SWZB 4WWOA 5JQ6L 5FW7A 1IGTB 1NBQA 5LGJA 2JKRM 4DOHB 2BJML 3CZFA 2FQEA 1G7QA 4JFDA 4YWGH 4BE6A 3FMGL 3WMQA 2X42A 2Y23A 3FQNB 3FFCA 1ND0B 3ESMA 5T5NF 4ZO9A 1XCTA 1LO2H 5I30H 3MCKA 1MRDH 2HB0A 4DKFL 3VE0A 3RA7H 5HGHB 3B9KB 2D8KA 2F2HA 1QHQA 5I19H 4M9OA 4IS6A 3NEOA 4OZIF 3CFMA 5IGXH 5DTFB 2XV3A 4BA0A 3K0YA 2V5SA 3BVWA 1CF1A 3IRZA 1WT5C 1FDLH 4EBQL 4PJHA 3S36H 1QSEE 1H8SA 2VRQA 3SO3B 2LHAA 2XVGA 4EOWL 1Y7VA 1ZWIA 3H42L 1JF5A 4WO0A 3TFKC 3MLXL 2CAKA 4F2EA 3Q1EA 4X6CF 1ZHKA 5B8CC 2AERT 1YYLH 3PAVA 2BSBA 1U41A 3T6ZA 2E56A 1QI4A 1WAAE 3JSSA 5C08E 1UB5B 4NKOB 5AW2B 3ARPA 3B83A 2OR9H 3ME0B 3TPKA 3QP3A 3UZQB 1J12A 3PAZA 3C8KA 4UILL 5GGRA 1JGEA 4Z78B 4R0LB 4L8CB 2EADA 4OJDH 2YD5A 4MJ5B 3WIFB 1ZJAA 3N1GC 5LBGA 3QHFL 4FC3E 1FNEB 2OP4H 1Q9OA 1F90H 5I8CB 2DWYA 4AL8L 1KB3A 5JNYB 1G6RA 3RPIB 3GMLB 4U1MB 2NOYA 2DLHA 2JK5A 4PQXA 3BT2L 5JDJA 4NQCD 5F0JB 3KHQA 3P9LA 4G9FD 4H0HB 1KF9B 3ZPDA 4HIIB 1MKFA 1XZ0B 5FA3B 1ODUA 1MCPH 3NZHL 4HCFA 4ZUSA 4PJ7B 2EC9U 1F2QA 1UZ6E 2C1OA 4CKVX 3FO1A 1RCYA 2EEAA 2YEZB 1TUPA 3EBGA 4C4BA 1U8LA 1S9XA 3FAXA 3TTSA 4C55A 2X1PA 4FFYH 5L4JA 4WO4D 4GXFA 3L3OC 3ARYA 4X83A 2EDDA 2TRYA 3ALXA 4OCYH 5DEGB 2AJXL 1QUPA 4L3FA 1FORH 1T0OA 4UWQB 2DJ4A 4TVPL 1U8KB 4AYDC 5LBSH 1IT9L 3BVVA 2MRYA 5LKNA 3UJJL 4YXKL 1ZA3A 1CG9B 1OF2B 4L9LB 2JJTC 4AK2A 2DQDL 4ANXA 4PFEA 1BBDL 4N8CH 3UBFA 2ICES 3NT0A 4TRPL 5FKPB 1A3ZA 5AVTB 2YEVB 3CSGA 5HVWA 3HN5A 1VZGA 3KJ4C 4A7SA 4LBAA 4AGQA 3KBHE 3LTVA 3QIWD 1OL0A 4I87A 3S34H 4P23C 2VQ4A 4RWYH 4EIBA 4OF7A 5KS9A 2HFGH 2X2JA 1P5UB 1CFBA 2XNAA 3KWUA 4MQTB 5HTSA 2GEQA 1WTLA 3EYFA 4P2QA 4Z1PA 3ZZQA 1FC1A 1BZ7A 1I9JH 1ZVNA 2IANE 5AYUH 5H37G 3HN8A 3KPRB 4FQXD 4LLQA 4NDMB 1MELA 1OSZA 1RK1B 5I1IL 2WXIA 3IN2A 4A04A 4JRYD 3BLPX 4QHUA 3ARED 4QOKB 1BZQK 2P49B 3MKGA 2JCCF 4YR6B 3GMOB 3OJDA 1ZOXA 1IM3A 3IS0X 4QXUL 3TEXA 4HJ0C 5DQDL 3DVIA 3MRRA 1NM4A 1OT4A 4CMMB 2FYYB 3EDFA 5I6LA 3S96A 1KEMH 2N3JA 1IGCL 2X4SB 4LSRH 4XX1E 3QR2A 3LRKA 3EH3B 1OM9A 3KR3L 3PV6A 3V4LA 3BH8B 1YPZF 2A74B 3DJZA 3HI1A 4F7CB 2XV2A 1HH6A 3JUZA 5E2WH 5CLTA 4GG6F 3V9EA 3OB8A 3F7VB 5ADPL 5JORB 4NC2B 2BCKB 2ZP9A 4MJIA 1TXKA 4R2GD 1QOKA 3Q1SL 1WCBA 1UA6H 4D9QD 1IGML 4PM1A 2ZUYA 4DW2L 3WNKA 1JHTA 3D05A 2DQJH 3K6SA 3CZEA 1MFEL 2UY7A 3PWNA 4YLQT 3SO3C 3ALPA 3WFDL 3V8OA 1IFRA 1SXAA 2YGOA 4HGKC 3F8UB 3L7EB 4WWPA 4MASA 4MCZA 3HA0A 2VSCA 3Q6FA 4KTEH 5BOZG 1MJ7L 5CJXC 4PJIA 1WE5A 3DX4A 4OY9A 1DFBH 3UAJD 5I18L 1CC3A 5I1LB 2DQFA 1IVLA 1D9KC 1L9MA 1PFOA 1UA3A 3FO0H 1R47A 5FCSH 4PCKA 4J3TA 1Z5YD 4APXA 3RWCA 3H9HB 1D6VL 1ACXA 3IDYC 3QWQB 4ADGA 4K94C 2GI0A 3NCEB 4BWUA 3KCPA 1J5CA 1IKOP 1X7QB 3DETC 1JGLH 2EUZA 3RTQD 4XN1A 1FO0A 3S37H 3I9GH 1GPOL 4K9EC 3T09A 3LQZB 4PIBA 4N1EA 1NCWL 4Y2DC 3LMJH 4DEPB 4H4NA 3S4SG 1RI8A 2XG4A 4WJKB 2CALA 6PCYA 4ZMYA 4KJPD 3WNPA 3L1EA 4OD1L 4Y8AA 3OG4B 2TSAA 3VXUE 3T8XB 5J1TC 5BS0D 4K55A 2Y4SA 1OAUH 1IARB 3LN5B 3RNKA 3D07A 1HVXA 1FH5H 1MZYA 3QUYA 4PJAA 5B1BB 5LCVA 4H2CA 3X3GL 3UEQA 1TJHL 1KN2L 3GRWL 3O4LB 4HS6B 2G75B 4LEOA 2WVTA 5FHBL 4BGDA 3DOSB 4HF5H 1ZHLB 4GLRI 3W3BA 4IDJL 3QRGH 4G6MH 5DJ2B 3UTOA 3QG6B 2DYPD 2VDRL 3UJIL 1U8JB 2QQKL 3HJ0A 2VDML 5DYFA 2WCPA 4D9LL 1JDAA 2NLJB 1U92B 1GZHC 4QD2E 2IQ9L 5EZJB 2PUQT 2R1YA 1VFUA 3QORA 2FBOJ 4L4JA 5JXED 3OD3A 4QHNB 3KYOA 4L9LC 2CGRH 2X3BA 1BQUA 2P4AB 4MQSB 1A14L 2A1WH 1OP9A 2EEXA 5AVQB 3CN0A 5KANG 5CLZA 5GRVK 3ARDB 1WUNT 3B9EA 2MOQA 4Z3JA 4PJ9A 2A9ML 3IT8D 4LGRB 4X9BA 3EYSH 4URKA 2ITCB 3A4DA 4XCFH 3BJ91 2ZX7A 2X1QA 1E9PB 3TNMA 4JY4B 4UB0L 3DBSA 1GOFA 1M2VB 3ZZ1A 2Q7YB 2V6HA 4L1SA 1ZLVK 3BUTA 1UWGH 2HKHH 4X8CA 2Y7NA 3RUGA 1VFBA 2EYTB 4E36A 2WVUA 4FP8H 4I1NB 5GGUA 3TN0A 2E7HA 2R4SL 5CGYC 2DM2A 3VXSA 3RDTD 1F6AA 4GRMB 4O9HL 1MFAL 3RFZB 3SJVE 4OLWH 1NGWA 1LWHA 3ULSA 1IQDB 2VQTA 2NNCA 5ESQA 5JOPE 4P2RE 5IR1A 2IAMD 1JWMB 2EO9A 1AR1C 1MIEL 4TV3A 1MFBH 3FSVA 4B7IA 4N4YB 2CMRL 2DPKA 2JKWA 2UWEB 3MDJA 3HRPA 4LHUB 3V0FA 2M26A 3L5XL 1AMYA 4BWTA 1A1NA 2OJEB 5KYWA 1H15B 3CGTA 1LEGA 1O6SB 3LN4B 5F6HI 3MXWH 5AOMA 4MJ2A 1OWWA 4CSTA 4ORZC 1BG9A 1VENA 4GSDL 4YHYB 5I1AA 4YJZL 1BP3B 2F68X 2D7QA 4OLUL 4PGEB 1X9LA 2QHRL 1C16A 1SN0A 5HDOA 5J3HC 1K3IA 5ICYB 2JF1A 4MHHG 4ORGB 4QLWA 4X5QA 4ZXBA 2P8PA 5JO5B 5EEWA 3KZ8A 1XXDC 1GGTA 1PMYA 1CZ8H 3AGWA 1XF1A 1DEDA 3FOMA 3QUML 3O3EB 5BZZA 2DTSA 4Q2ZA 3VTAA 1ES0A 2I26N 3F6JA 1NCCL 2CA4A 1S7XB 1HEZB 4PRIA 3EDEA 1BZEA 2FHCA 4TQPA 4A68A 4PGCA 1HNYA 3OX8A 2MKLC 2CNZA 4XCYB 5J1AB 5DD3L 4LIQE 4MMZA 5IVZA 3L1OL 2V7HB 4N0FA 4P2OD 5H37H 1JNLL 1R46A 3X13B 4Y4KB 1VERA 2GJRA 4IRZA 1W6LA 2D0FA 3OMNB 2HP4A 1L6PA 3GSNA 3JZYA 4FXGC 4N5ED 4CSSA 5BW7A 3S37X 2AAAA 4BUGA 5E08H 5T1LD 2ZCLH 4HV8B 3KW8A 5L8KB 2R1XA 1R5WA 3ZDXB 2H3NA 1NANI 5I5MA 4PV8B 4QLRA 1T7ZA 4EZJA 5H2BB 4LE8A 3MA9L 4W9CC 1S7QB 3EJJX 4X5RA 5MEPB 4AQ8C 4ANUA 3WFBL 1SJHB 8FABB 1ZT4B 3MLUL 2ZIDA 3PHQB 3L4UA 3VD4A 4R26H 1UH2A 4I0PD 2V9UA 5GS0D 1VB9A 3U46A 5KVEL 3TBTB 3GHBL 3HE6A 1YJDH 4WFGE 5DJXA 4JZOA 4Z7NF 1AHKA 3K6IA 3OTTA 2ERJB 2IPUG 3C5XA 3CX5K 1FRGH 1FL6A 3S35H 4HISA 2O6DA 3R06B 4KC3B 1U21A 2E7BA 1CR9L 1RSFA 1GZPA 3D06A 2Q8AL 1X9RA 5B1AB 3N40P 2B59A 4HOXA 7CGTA 5EBMB 3VXOA 2OTPA 1VGKA 2ZOTA 3OKLA 3MLTA 5GGTH 1SLVA 2Z8WC 2WGNB 4KK9C 4KK6C 3CZNA 4S1QH 3KVPA 2MHAB 2OZ4H 3G04B 2PXYD 2GIMA 3TH3T 1XF4A 2R23B 1VJSA 4HZ1A 1EEYB 2J1XA 3T0WA 3D5OF 3CC5A 5EO1A 3U6RA 2WWKO 3HG3A 1QABA 3CD4A 2Z7YA 1OY3B 3N44B 1B4LA 3TURA 1G94A 1BX2B 3I02A 4EXPX 2VISA 4DN4L 4XAKD 3K1KC 5ILTL 2ID5A 1P53A 1Z9NA 3VWJC 5JW3L 1C08A 3PWUB 4Z7VE 3ZW3A 3I9IA 1M6OB 1ECYA 2DLFL 1AIZA 2QR0A 1UEYA 3CFDA 3BXNA 3OHXC 2K7PA 3EGXA 1N5AA 2V0AA 3QDAA 4KJQC 5C2BH 5L88H 3ZTNH 1SN5A 1F11A 1JUFA 4I3SL 1F13A 4V2CB 2IDFA 1NA8A 3W81A 4BQ6A 2XJLA 3INOA 5MI0B 2K6WA 3UGUA 2NUTB 2CK2A 2UVFA 4GAYA 4FFTA 1MFMA 5F0MB 3CHPA 5CILH 5K93A 1GYWA 3NCMA 5E1AA 2J72A 2HFTA 2XQYG 3GJEB 3QQXA 4JFQA 4NO5B 2WYHA 4W68A 4IGBB 1S78D 1WICA 5K5YA 2JKNA 4D0BB 4AYGA 4HK3N 1EPFA 4MLIA 4Z77A 4DN3H 2VW6A 2IADA 4N26A 3GBEA 4MNGB 4D2NA 4Y1SA 1PG7W 32C2B 5LNEA 3MBEC 5AZEH 1WZ1H 5KVGE 3IB4A 3QXWA 4KXCA 4U7KA 4WKXA 2FHBA 5FKAB 3Q5TA 3QVAA 2D03L 2APVA 2V5MA 2VLLA 3PYCA 5JHBA 3T5WA 5FFOA 4ZW7A 3BAWA 4RMQA 3N1QC 4XO4A 4M6OH 1X7TA 1BMGA 4A6YB 2VXVL 1MHHA 1GW6A 2P5WD 4G70B 5C8JB 3MV7A 3QPQD 1EAPA 35C8H 4UQ3A 2L8AA 2QGEA 3WNIA 5DDHB 3UO1L 1NCUA 1G87A 2OYPA 4IOSA 4OKVA 3T77A 2B5IC 5E99H 1BOGB 1EX0A 1UQSA 2Z31D 3WDHA 4OIFA 4TKWA 4HX1A 3BUPA 4XPTH 3U0WH 4X4XA 1BWWA 2R69L 1J9QA 4FFYA 4AV0A 4ZUWB 4NRYB 3IDGB 4P3WA 4F80A 2F9BT 2BZCA 3QC6X 2H1LM 4JFHD 2WB1A 3VD0A 3ARFC 2IOIA 3CFJA 5LBSA 3M88A 2XBZA 4UUJA 1A3RH 4Y9CA 1WISA 2Q3AA 2H7WA 4AJYV 4NQCB 1QBML 5GHWL 1AAJA 3CVHB 3ATFA 4HT1L 4G9FB 1N10A 1QMUA 2GC7C 1MVUB 3OR6B 3ULVE 1BPVA 5ENWA 1WIOA 2V2WA 3IETA 2DH3A 2GBUA 5EC2A 3V0GA 3T3PE 5FYLL 2ENJA 5B39B 4TSCH 3CXHJ 1R5IA 3ZLQC 5DVLA 3JWNC 4B27A 3I85A 1C9SA 2K70A 1P7HL 1XB3A 3QDMA 4BFRA 1JVLA 1AZVA 2L7QA 1J0YA 2PW2B 2YD0A 4WO4B 1D5ZB 4XPFH 4C56D 3ULUD 2ERJC 4YHPA 3X14B 2VH5L 3WHXB 3FMGH 1OSPH 2ED7A 5L2KE 2CD0A 2PCFA 3EYOB 3PDDA 4NWTL 1AXSB 5D2NC 3S35X 1FFOA 2W60A 2AK4A 3TV8A 4V1DA 1TVBA 5TPWH 4HMDA 1E65A 5DRNA 2E86A 3K3QA 4WNJA 1QSFD 2MWCA 3WKNA 5B3SB 2ZP0T 3S5LA 2HG5B 1ZLWH 4PRHD 3ZGHA 2DRUA 1KXVA 1YNTA 1MCQA 4XC3L 4LCWE 2OMZB 2HLFC 5DU7A 3UCQA 4LLVA 3AM8C 3T1WA 4CVXA 4S0SD 5I1KL 2QADD 1LO5B 1PAZA 4GLRH 4PB0L 2XZQL 5I1EH 5TFSH 1P5VA 5IBLD 5FO9A 2CHWA 2ODHA 2OMUA 4FQQB 4JO4L 4UDTB 1PLGL 1NLDH 3GLAA 3LXAA 3FL7A 3MLXH 4FQXB 5AZ2H 2IDUA 2ZONA 4XNYL 2HFFB 2VN3A 4JRYB 4GO6B 2XC8A 3AREB 4M93C 4MDIB 2F8IA 1HI6B 4J27A 3FT1A 4ELME 1NDMB 1WJ3A 3HG1D 4W9FC 2NZIA 3DRTB 3KYKL 5GGVY 2B4CL 2VXUH 5A7BA 5IQOA 2AQ1A 2Z7UA 4FNQA 3SKOB 3UOAB 4D0CB 1CXIA 1ZPLA 1UTDA 4ZO7A 5FGCB 1FVCB 1JCVA 2OMXA 3FB7A 4BWWA 3QHFH 1MHCB 1BJMA 2VLKE 1G7PB 2KDGA 4IDLA 4ODHL 3SYPA 2QSVA 4XOAA 2W0FB 4XVSL 5I0ZA 1GSMA 4JY6A 2ZX8A 4MB1A 3TBYA 4R2GB 2LU7A 3BT2H 1GTNA 3VFRB 1IE5A 1UWXH 2G5BB 2E59A 3C9NA 4KHXH 1G7MB 3CFEB 4HIPA 1MJUH 5E6UB 5IHWA 3GM8A 3EOBB 2XWCA 4Y5XB 5EORL 1NBZA 3IGAA 1XMWA 2CNYA 3BAXA 4C83B 3QNXA 5BRZB 1ET8A 4FA8A 4ZNEE 1SXNA 3BPCA 5LXGL 5LAXB 3OV6A 5FM8A 1W80A 5FIEA 3EO0B 3R7QA 3UTZB 3WSQL 4CC4A 1V7ML 4QHMA 1L3NA 1ZV2A 3MJ9H 1RUMH 4HS3B 1E5CA 4F15C 4ZUTB 1SFHA 2JB5H 3E6FA 3MCYA 1VACB 4KKLD 4MZRA 1BGXL 2DQDH 2IFGA 3WDIA 2WBJB 1MCOL 3UJTL 1BBDH 5DMIL 3CLFL 4TL4A 2J57A 3RTQB 1PJWA 1NAMB 4YPGA 4PLKD 1EANA 5A2FA 1S7RB 2YBRB 4NN5B 1CDJA 1XXFC 3HUJB 4YHKH 5IJBC 3LXCA 2EKSA 1X9UA 1FL3A 5JDSB 2VZ1A 1LE9B 2X4UA 1TMQA 4FFZH 2JIXA 3ZTDC 4PMEA 2VLJE 3BPNC 3Q6GL 5CLWA 2XZCL 3TZVD 2QZ5A 3O0RL 5FB8B 2OXHB 4GUPB 1C5BH 3U4BH 5MP6H 5L0QB 4AY0A 3B6SB 3RY5A 1IEBA 4P8QA 1UCBH 3RRQA 2OTUB 5A6MA 5J89A 2P26A 4XCCH 3VDAA 3Q7JA 3RU8H 2HKFH 3K1DA 4MJ6B 5LHDA 2HWZH 1MZZA 4HWZB 5C9KA 3QG7L 1UASA 1JXKA 4JQVA 1QSED 3L1GA 1AH1A 2F7RA 4BFNA 1GMIA 2YGVA 2DI9A 2QVFB 5D7KE 4IEFB 1UACL 3FU0A 2DYPB 2VOTA 4WO4C 1SEQH 1VEOA 1KWKA 1AI1H 4G6JH 2QPUA 4PHZA 1SLXA 3EG9A 4GO8A 5C08D 4TUOB 3IU4L 5HDQH 2IJ0C 3MRDB 2WVVA 1NANH 4XXWC 2Q86B 5AKRA 3BP6B 5ID1B 2J1YA 3LRSA 3SE9H 3AU1B 3KPNB 1BVNP 1FWXA 2VZUA 3QXAB 4FFVD 3VQLA 2J73A 4AE0A 2WO3B 1T83A 1KXQA 2H1PL 3KL0A 1NKOA 1JXGA 5DQJB 2FGWL 3U0PB 4QJ4B 3VG9C 2W80C 5E5UB 5KZCD 2CBTA 3QIWC 4RGNC 2F8OA 3BEVB 1BVLB 3NEEA 5GISH 3QHZH 2F18A 5HPMB 4GKSB 4Q9BA 3I74A 1JNHB 4AGMA 4NZRL 3DMMD 1TNMA 1EJ6A 5DI8A 4ANVA 4N2FA 4XP1L 4ZOCA 4KVCH 1QTSA 3T0XA 4FQXC 4J3BA 2YD3A 4J1UB 3VXQB 4GKZA 5FOBA 1XB8A 2BY1A 3DXAE 2GQHA 2ZUUA 5AFAA 1U36A 2CK0L 1FBIL 1FZMB 5D7JC 1D6VH 1RIHL 5AB0A 3CWGA 4JPKH 2IAMB 2YS4A 3K91A 4ZPTA 4B5EA 3VMPA 1J5OH 1W0VA 4UM9A 1UD5A 5G5DA 4EAEA 3B5HA 3P4NA 1AIFA 3VI3E 1PKQB 4H1LG 3LHPH 2Q2LA 3PWPA 1I7TB 3VQ2C 4F7PA 5AALA 3FT0A 5DYOA 4LEXL 4FQJL 2XQ0A 3CFQA 1NC4D 1NCWH 1QR4A 1L5GB 5B3NA 3N55A 3AG2B 1FI8C 5F7DA 5C0JB 1O7SA 1YO4A 4I4WB 4BSVB 5CN3A 4OD1H 1D7CA 1DQLL 5IHUH 2YD9A 5KOMC 4JGNA 1NEUA 12E8L 5F9OL 2ENPA 4HOWA 1G9ML 1AQMA 3IDJA 5H37A 4Z7VF 4IKNA 3L5WA 5CMAB 2Y2TA 3A4EA 3BUYA 3PP4L 1BFTA 1RZKH 3X3GH 4KZEL 1TJHH 4U1NB 1OM3H 4MBOA 1EZVX 4P9HH 2Y1ZA 4IBWA 2IAND 4D8PB 2HRHA 5KJRL 2YXWA 1AD0A 2QQKH 4NKQB 3GBNH 4FXKA 4D9LH 4LSTH 3UAJC 4LCCB 1JGVH 4KXAA 4TSBH 4JFEA 4AMKL 1U58B 5IMMB 2PYEA 5J0BA 4KV5E 3RL1B 3ZT7A 5E4EC 3N06B 4S11A 4YHLL 3MLZH 1HXMA 4EO5A 4TF4A 25C8L 1BFVH 2AJZA 4RQQA 5INCA 1RUPH 3ZMEA 1DJXA 4NUQA 1BVZA 4LEBA 4OFKA 3H7LA 3QPXH 2D3VA 5BZDB 3SDDA 2BNUB 4X6CB 1QNIA 4CU6A 4F2MA 4TPRL 1YY8A 5BVPL 3WTXA 1K4DA 4H8WH 4HJUA 3T0EB 1CURA 2DTMH 1RZ8B 3NPSC 5IFHL 2ATKA 4EXKA 4Z0BL 2XZAL 4KJPC 2ED8A 1BDYA 2ZCKL 2AP2A 2GBVA 2J5LB 4ZFOA 4DKAA 3LKPB 1MRCH 1TZGL 5C3TA 2N1TE 2WSPA 3NDYE 1OAQL 5GGTA 3T2PA 3LKSA 3GHPA 1KACB 1OE3A 2OZ4A 4P59H 2XBTA 3GI9L 1UM5L 5IMLB 1XGRB 3BSHA 2ZPKH 4OLYH 5E9DE 3GDBA 4OZGE 1CLVA 1MIEH 4B0MM 5C09E 5DS8B 3MV8A 1JIBA 2CMRH 3B7TA 1HSBA 4F2FA 3A6CH 2YMXH 5FK9B 2L0DA 1JYWA 2NSQA 1IKNC 1TZ8A 1JDDA 3VGDA 4HMCA 3BPOC 1UEMA 4L3EB 4B0MB 5CGMA 5JHDD 5IQNA 5JXEC