3DGLA

1.8 a crystal structure of a non-biological protein with bound atp in a novel bent conformation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A synthetic protein selected for ligand binding affinity mediates ATP hydrolysis.
pubmed doi rcsb
molecule keywords ATP Binding Protein-DX
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dglA00
2P05A 3LTBA 3LTDA 3DGNA 3DGMA 3LTCA 1UW1A 3DGOA 3DGLA 3LT9A 3LT8A 3LTAA 2P09A 2P0XA
chains in the Genus database with same CATH superfamily
1SJWA 3FCSB 4AEQA 1RRHA 1BSAA 1ZS7A 2AADA 1JRQA 2LQVA 3DGOA 4EYCA 2F99A 3DZLA 3FH1A 4QWTA 3IJEB 1E3VA 3UL6A 2AAEA 3H3HA 3FG1A 3DY5A 1OHSA 4HM0B 1L5GB 1EG9B 4X2HA 1B2MA 3CPOA 3WR2A 1JB4A 4LYLB 1VQN3 4N6OB 1US1A 1B20A 4G1MB 2E2VA 2SARA 5IG3A 5STDA 3E99A 1MWSA 4K90B 2XGNA 1CYVA 1VQ73 5AI1A 4HM1B 4CCVA 1DE3A 1K41A 1SARA 3X3XA 2W56B 1NB3I 3NBRA 4XBTA 5RNTA 1M904 3SOAA 1IVXA 3PXMA 2F98A 1RHLA 4HAAA 1TTOA 2GSPA 2L4VA 3NX0A 4O02B 3L0RA 3Q90A 1GD3A 3D3LA 2BHMA 2GEXA 1G96A 4HOHA 4NHFA 3FF0A 3FLJA 4BU4A 3CCR3 3RGRA 1R4CA 3ZFZA 3EBTA 4FMCA 3PYJA 2BIRA 2GBXB 2HMMB 3CXC2 2HMJB 3X42A 5EEOA 4FCMA 1GY5A 1IVWA 2C11A 1OPYA 5G2GA 3SVAA 4ZM8A 2E2UA 1RN7A 1RJOA 2Z76A 3CC73 1FW7A 3LTBA 1LOWA 1N5HA 4PEJA 1RCLA 2W03A 3ZG5A 5DREA 3DH2A 3DM8A 2YFJB 2MF7A 5IG5A 3WDGB 1KC84 3UB1A 2O3OA 3CC23 4WYKA 1ASKA 3G16A 4RNYA 1K734 1ROAA 2IUJA 4EV2A 1PU4A 2OCTA 4HM6B 3MSOA 3MHEA 4J5GA 1YI23 5HGRA 2CX1A 3KN4A 4I4KA 3B4PA 1IV7A 1W2ZA 1RGKA 3NQYA 3PCSA 1ISKA 3WOFB 3WHOA 1RGAA 3AGNA 3OWYA 1UW1A 5A0OB 1VQQA 3HOHA 1NWWA 1B2XA 2Z6BA 3D79A 3MKIA 1MWRA 3G0KA 3A5EA 3JUOA 4KVHA 2Y74A 1C54A 2YFLB 1BNSA 5BXQA 1C7HA 1MGWA 3KFQC 5D83A 1VQO3 3FGYA 1LQMB 1RGCA 3K7CA 3LT8A 2WOHA 3I563 1WMPA 2XF3A 3CCM3 3S5CA 2QA43 2RGQA 3BNDA 1K9M4 1JZOA 1HYFA 2KF4A 2ZDJA 4WYKB 2CK3H 4IT7A 1GMPA 1STDA 3DUKA 1RGFA 2CFLA 3K5TA 4RNTA 1UUVB 1OGXA 2CC3A 2YX9A 2CFWA 2RNTA 3B8LA 2FNQA 4K1UA 1BIRA 1I2EA 1RN4A 2A15A 2C4BA 3IMAB 5BVBA 1PFPA 1VQP3 5CF1A 1CH0A 3BLZA 3SYUA 4EV5A 5JPPA 5D82A 1CYUA 3GRDA 3LOYA 3V92A 5AIHA 3I553 3KIIA 3PZWA 1V57A 1RMSA 4HM7B 4N6MA 1TRQA 3WA2X 1NO3A 3G713 3A76A 1GSPA 1LOXA 2XGLA 3ROBA 3CC43 4J5KA 3CNMA 1GD4A 3MPHA 3RDEA 4LSOA 3X40A 1UCLA 2V1LA 3URPA 2CG1A 1M1K4 2I9WA 3GZXB 3K0ZA 1W7CA 3Q2PA 5G1LA 2ML6A 3D5IA 1QAKA 1JN5A 1SQWA 2RBIA 1Q7HA 3VSYA 2HMKB 3UNLA 2JQ5A 2Q07A 4HYZA 1I0VA 1GYBA 2CW9A 2BU4A 2F5WA 1W5ZA 2KF3A 1OGZA 2CKFB 4HM4B 1B2ZA 1E97A 2H0IA 1YJ93 4ORLA 4HM5B 5AYRB 5CK6A 4XDWA 3HIGA 3FZWA 5M18A 1ULIB 1Q42A 2YFIB 3WOEB 4J8TA 3T8UA 3DXOA 5M19A 1BNEA 3G4S3 1BUJA 2CIUA 3KZTA 1GOUA 3F14A 3B7CA 4N3VA 3SXXA 1AQZA 3D5GA 3DGLA 2M7OA 3HX8A 4R4KA 5LC7A 5M1AA 3HI7A 4KFFA 2FXTA 2E2TA 3EBYA 1YHQ3 5JPUA 1EUIC 1JN5B 2INXA 2OOVC 3D4AA 3V98A 2IYJA 3BIRA 1HZ1A 3QK9A 4WHAA 1GY7A 1STFI 1VQ63 4R1KA 5CLKA 2H0GA 3NUVA 5BIRA 1TIJA 4FCJA 3CCE3 1YJW3 1IQ8A 2IUKA 1R4YA 3BNEA 3LH4A 4CPKA 1BRKA 1CQSA 2W04A 4N6UA 2W6JH 2XSHB 3OX9A 4MMYB 1N8R4 2PNCA 1UDII 3F7XA 5I97A 2CWTA 4HZ9B 1GOYA 1T2IA 1M9GA 3GSPA 2Z77A 3LMLA 1IVUA 2KF5A 1Q824 2K54A 1B2SA 1D6YA 1M1XB 2XFTA 4JF8A 1O7HB 7RNTA 3VGNA 1VQM3 1IQXA 6GSPA 3LYGA 3UL5A 1RGEA 1BSDA 3MG3A 1BSCA 3F7SA 2SBLA 3QRDA 5CXOA 4ILFA 1DYUA 1OF5A 8RNTA 3ER7A 1YIT3 1BUQA 1FA3A 1A2VA 1WMOA 2WGOA 1UCJA 4L8OA 4EC6A 1ROVA 4FMBA 4NPBA 3KE7A 5IEOA 3OWSA 2O9UX 5D81A 1B21A 1LXEA 1I0XA 1I2GA 1D6ZA 3NV0A 3X3YA 1HKXA 5AIIA 1A2PA 2F4YA 1N9EA 3HK4A 1YVSA 3F40A 1MWUA 4K1VA 4KZ1A 1LRAA 2XSOB 1MGRA 1T2HA 1S5AA 2P09A 3NM7A 3DGMA 1ULJB 3LTCA 4GL6A 4L8PA 4XB5A 5FGOA 3V99A 2CG0A 3VF1A 1NB5I 3BNCA 3KCHA 1RGHA 3EF8A 3T8NA 3O8YA 1W6CA 1N8QA 1TP6A 1BNRA 4FMDA 1QVF2 1Q814 1OF5B 2MC8A 1DVCA 3IPTA 5KP1A 2XH9A 1HU9A 5AIFA 1O7MB 3WODG 3EQQB 3FG4A 1FGQA 2LYXA 3NM2A 7GSPA 3JUQA 2HOHA 1W6YA 1I70A 4BL2A 1CEWI 4LGQA 3NV0B 1Z1SA 4KFDA 2BMRB 1FUSA 3EN1B 4TX4A 5DRVA 3RGAA 2ZHXB 2IY2A 2BMQB 4X2OA 4LEHA 1IT8A 4N6LA 2OQEA 3LTAA 2KRTA 1WMNA 1O7PB 3S29A 5KP4A 4FMAA 2IMJA 4O8SA 4H3UA 3SLUA 1NU3A 1X1WA 7STDA 4CJNA 1TJDA 2ML5A 2W9QA 1DETA 3FKAA 3CNXA 1BRHA 3GZYB 4JRFA 4MEIA 1EA2A 3CME3 8CHOA 4LMIA 2GBWB 1RN1A 1UI7A 2GXFA 1FUTA 1TU5A 4U13A 1RDSA 1EKMA 1BRSA 1OCVA 3BU4A 4GB5A 5KP3A 5IW9A 3GAXA 1BNIA 1BGSA 2XR8B 4AKYA 1IT7A 4R9KA 4FCZA 1Y4KA 1E3RA 2UX0A 3LT9A 4FR9A 2OOVA 3F8HA 2BT3A 2KCDA 1SIHA 2W0QA 5ELJA 3CCS3 3N8BA 2CFKA 2D42A 3K63A 3CU3A 2XRXB 1PYLA 3STDA 1B2UA 4I5QA 1AY7A 2F56A 1DVDA 1UCIA 2GU3A 5IENA 1YGWA 2QEX3 4KT3B 3EHCA 1OH0A 3SX1A 1LOYA 3B4OA 1I3IA 2UUGC 1S723 1BAOA 3HIIA 2Z7AA 2B24B 4BTXA 1BNJA 1KWIA 3TDGA 1TFOA 4IPBA 3WA3A 1IDPA 2XFSA 3EX9A 1GMRA 1IK3A 2FGTA 5G1KA 1RRLA 2H0HA 1KQS2 1W01A 4GHOA 2CWUA 1JKGA 3LXUX 5AEUB 3MYTA 3N9HA 4RNZA 1RCKA 3EC9A 1AVLA 2WO0A 3WMDA 3FG3A 4LZIA 1AV4A 3J7Yd 2B1XB 1N5PA 1I2FA 1OACA 3S28A 1O7NB 1QAFA 2IA7A 5IEPA 1VQ83 1QMAA 2F86B 1RNBA 1DMQA 1OHOA 1FGTA 4WP5A 1IV9A 3CD63 3NBJA 5IG0A 3SOYA 1Q7Y4 9RNTA 3KSED 3AHWA 6RNTA 2CX0A 1K28A 2J8XB 2K3DA 2HMOB 1U8CB 4EW5A 1KSIA 1N9JA 1QALA 2Y73A 3EE1A 3DGYA 2QGUA 1FYSA 4HM2B 2R4IA 5CF2A 4XBYA 3M8CA 1JKGB 5LC6A 3OW22 4HKVB 1IU7A 1OUNA 1B3SA 3H51A 1IQYA 3LZAA 3MG1A 3PCRA 4KFEA 1WNHA 4MJDA 4N6V0 1T3BA 3HZPA 1GOVA 4AKZA 1SPUA 2KF6A 1AVKA 1O7WB 2UGIA 1TFKA 1VZZA 1SIIA 3CCL3 1GMQA 1BOXA 1UUWB 1W00A 1Q864 2F5MA 1VQ93 5ELUA 3ALAA 1DMNA 3JUPA 4O2HA 2K0MA 3OWUA 3AHSA 1F8NA 3CCU3 3Q3FA 1K8A4 4EXRA 1A90A 1G0TA 5GSPA 1Q40A 3NQZA 4HM3B 4OVMA 1NJI4 3MG2A 3UJMA 1BRNL 3KSPA 4Q53A 5EVHA 1J2BA 3GZRA 2BO9B 1FZUA 2GEYA 3CMA3 4XM4A 1JB2A 2HMNB 4XDVA 1YNVX 1YIJ3 3F9SA 3BB9A 1VQ53 1FUWA 4XBXA 5IF6A 1I3FA 2W2CA 4HBRA 4K61A 4O3VA 5JBSA 1UGHI 2STDA 2P0XA 2L1SA 2QIYA 4H61A 1UGIA 6STDA 3JUMA 2BMOB 1ZGXA 2BNGA 4MMZB 3RNTA 1JBTA 3G8ZA 1RLSA 3BNBA 1JBSA 4BTYA 1IVVA 1UCKA 3I0YA 3OV4A 3S27A 2CWVA 1BSEA 2WGQA 4IIAA 4BIRA 2RSXA 1LNIA 1TUHA 1U5OA 2KAAA 4N6TA 1VQ43 1JJ22 5TGNA 3Q1CA 1BU4A 3U97A 1KD14 3FF2A 5AIGA 1Q40B 1UI8A 1LNHA 4CDLA 5BU4A 3KKGA 3D9RA 1BSBA 1W2B2 1BRIA 4HVNA 3AGOA 1Q9EA 3MWZA 1G02A 1EQKA 3F8XA 4OK0A 1B27A 1BNFA 4R80A 2RFRA 1EEJA 1WTHA 1BANA 1TRPA 3DMCA 3JUNA 1JZDA 2RCDA 1BNGA 2KXGA 3PGBA 3NXJA 3EJVA 1RKYA 2W9PA 2CHCA 1D6UA 2OTJ3 1ZX2A 4NREA 2PZVA 4R9LA 4STDA 1LQGC 4RBNA 3AMOA 2P38A 1BVIA 2ZL8A 4L7KA 1AR0A 1W4NA 1A2KA 1LVNA 3PS8A 1FGOA 2CFGA 4MMXB 4OUQA 1VQL3 1JBRA 3GZBA 3U1WA 3ZG0A 1X1XA 1BRJA 1FGMA 2R41A 3EN8A 1V58A 1V74A 3K9MC 3NBBA 3T0UA 3S67A 3ECFA 4HM8B 1DMMA 1RGLA 2GU1A 4N6NB 2CH9A 1RSNA 1LOVA 1T5YA 1A67A 1NDOB 3GWRA 5EQLA 1GS3A 5AYSC 1YJN3 1MOLA 1WQLB 1IYYA 1RNTA 5IERA 1VQK3 5HOHA 3NHXA 1UUGB 3CPW2 4BL3A 1BRGA 1W6GA 2ZA4A 4HZBB 1ZO2A 2OWPA 1QVG2 2P0MA 1W02A 1MNLA 1NNVA 1MWTA 1X1UA 1RTUA 4WFOA 1I8VA 1PY3A 1YVBI 2HMLB 1QJGA 2OQEC 1JV2B 3LTDA 2C10A 2XEPA 1O7GB 3AMOB 4GSPA 4HJLB 3N54B 1JB5A 1FGRA 3EB8A 2CFDA 2JDIH 3G6E3 4DKIA 3CCJ3 2P05A 3SEDA 4J9AA 2WOFA 1YGEA 1X1YA 3FSDA 4BTWA 5AEWB 4WWUC 3OXAA 1RGGA 5IG4A 2W56A 3X41A 4RZMA 2D1WA 3CCV3 1JNQA 3DGNA 2OTL3 3X3ZA 5FW5A 1OHPA 1GY6A 3CCQ3 3JVCA 4EBGA
chains in the Genus database with same CATH topology
1SJWA 3FCSB 4AEQA 1RRHA 2LQVA 3DGOA 4EYCA 1JRQA 2F99A 3DZLA 3FH1A 4QWTA 3IJEB 1E3VA 3UL6A 3H3HA 3FG1A 3DY5A 1OHSA 4HM0B 1L5GB 1EG9B 4X2HA 1VQN3 3CPOA 1JB4A 4N6OB 1US1A 4G1MB 2E2VA 5IG3A 5STDA 3E99A 4K90B 2XGNA 1CYVA 1VQ73 5AI1A 4HM1B 4CCVA 1K41A 3X3XA 2W56B 1NB3I 3NBRA 4XBTA 1M904 3SOAA 1IVXA 3PXMA 2F98A 2L4VA 3NX0A 4O02B 3L0RA 3Q90A 1GD3A 3D3LA 2BHMA 2GEXA 1G96A 4NHFA 3FF0A 3FLJA 3CCR3 3RGRA 1R4CA 3EBTA 4FMCA 3PYJA 2HMMB 2GBXB 3CXC2 2HMJB 3X42A 5EEOA 4FCMA 1GY5A 1IVWA 2C11A 1OPYA 5G2GA 3SVAA 4ZM8A 2E2UA 1RN7A 1RJOA 2Z76A 3CC73 3LTBA 4PEJA 1N5HA 2W03A 5DREA 3DM8A 5IG5A 2YFJB 2MF7A 3WDGB 1KC84 3UB1A 2O3OA 3CC23 4WYKA 1ASKA 3G16A 4RNYA 1K734 1ROAA 2IUJA 4EV2A 1PU4A 2OCTA 4HM6B 3MSOA 3MHEA 1YI23 5HGRA 3KN4A 4I4KA 3B4PA 1IV7A 1W2ZA 3NQYA 3PCSA 1ISKA 3WOFB 3OWYA 1UW1A 5A0OB 1NWWA 2Z6BA 3MKIA 3G0KA 3JUOA 4KVHA 2Y74A 2YFLB 5BXQA 1C7HA 3KFQC 5D83A 1VQO3 3FGYA 3K7CA 3LT8A 3I563 3CCM3 2WOHA 1WMPA 2XF3A 3S5CA 2QA43 2RGQA 3BNDA 1K9M4 2ZDJA 4WYKB 2CK3H 4IT7A 1STDA 3DUKA 2CFLA 3K5TA 1UUVB 1OGXA 2CC3A 2YX9A 2CFWA 3B8LA 2FNQA 4K1UA 2A15A 3IMAB 5BVBA 1VQP3 1PFPA 5CF1A 3BLZA 4EV5A 5JPPA 5D82A 1CYUA 3GRDA 3LOYA 3V92A 5AIHA 3I553 3KIIA 3PZWA 4HM7B 4N6MA 3WA2X 1NO3A 3G713 3A76A 1LOXA 2XGLA 3ROBA 3CC43 3CNMA 1GD4A 3MPHA 3RDEA 4LSOA 3X40A 2V1LA 1M1K4 2CG1A 2I9WA 3GZXB 3K0ZA 1W7CA 3Q2PA 2ML6A 1QAKA 1JN5A 1SQWA 3VSYA 2HMKB 3UNLA 2JQ5A 2Q07A 4HYZA 1GYBA 2CW9A 1W5ZA 4HM4B 1OGZA 2CKFB 1E97A 1YJ93 4ORLA 4HM5B 5AYRB 5CK6A 4XDWA 3HIGA 3FZWA 1ULIB 1Q42A 2YFIB 3WOEB 4J8TA 3T8UA 3DXOA 3G4S3 2CIUA 3KZTA 3F14A 3B7CA 4N3VA 3SXXA 3DGLA 2M7OA 3HX8A 4R4KA 5LC7A 3HI7A 4KFFA 2FXTA 2E2TA 3EBYA 1YHQ3 5JPUA 2INXA 1JN5B 2OOVC 3V98A 4WHAA 3QK9A 1GY7A 1STFI 1VQ63 4R1KA 5CLKA 3NUVA 1TIJA 4FCJA 3CCE3 1YJW3 1IQ8A 2IUKA 3BNEA 3LH4A 1CQSA 2W04A 4N6UA 2W6JH 2XSHB 3OX9A 4MMYB 1N8R4 2PNCA 3F7XA 5I97A 2CWTA 4HZ9B 1M9GA 3LMLA 2Z77A 1IVUA 1Q824 2K54A 1M1XB 1D6YA 2XFTA 4JF8A 1O7HB 3VGNA 1VQM3 1IQXA 3LYGA 3UL5A 3MG3A 3F7SA 2SBLA 3QRDA 5CXOA 1DYUA 1OF5A 1BUQA 3ER7A 1YIT3 1FA3A 1A2VA 1WMOA 2WGOA 4L8OA 4EC6A 1ROVA 4FMBA 5IEOA 3KE7A 3OWSA 2O9UX 5D81A 1LXEA 1D6ZA 3NV0A 3X3YA 1HKXA 5AIIA 1N9EA 3HK4A 3F40A 4K1VA 4KZ1A 2XSOB 1S5AA 2P09A 3NM7A 3DGMA 1ULJB 3LTCA 4GL6A 4L8PA 4XB5A 5FGOA 3V99A 2CG0A 3VF1A 1NB5I 3BNCA 3EF8A 3T8NA 3O8YA 1W6CA 1N8QA 1TP6A 4FMDA 1QVF2 1Q814 1OF5B 2MC8A 1DVCA 3IPTA 5KP1A 2XH9A 1HU9A 5AIFA 1O7MB 3WODG 3EQQB 3FG4A 1FGQA 2LYXA 3NM2A 3JUQA 1W6YA 1CEWI 4LGQA 3NV0B 1Z1SA 4KFDA 2BMRB 3EN1B 4TX4A 5DRVA 3RGAA 4X2OA 2BMQB 4LEHA 1IT8A 4N6LA 2OQEA 3LTAA 2KRTA 1WMNA 1O7PB 3S29A 5KP4A 4FMAA 2IMJA 4O8SA 4H3UA 3SLUA 1NU3A 7STDA 2ML5A 2W9QA 3GZYB 3FKAA 3CNXA 4JRFA 4MEIA 1EA2A 3CME3 8CHOA 4LMIA 2GBWB 1UI7A 2GXFA 1TU5A 4U13A 1EKMA 1OCVA 4GB5A 5KP3A 5IW9A 3GAXA 4AKYA 2XR8B 1IT7A 4R9KA 4FCZA 1Y4KA 1E3RA 2UX0A 3LT9A 4FR9A 2OOVA 3F8HA 2BT3A 2KCDA 1SIHA 2W0QA 5ELJA 3CCS3 3N8BA 2CFKA 2D42A 3K63A 3CU3A 2XRXB 3STDA 1DVDA 2QEX3 2GU3A 5IENA 3EHCA 1OH0A 3SX1A 3B4OA 1S723 3HIIA 2Z7AA 2B24B 4BTXA 1KWIA 3TDGA 1TFOA 4IPBA 3WA3A 1IDPA 2XFSA 3EX9A 1IK3A 2FGTA 1RRLA 1KQS2 1W01A 2CWUA 1JKGA 3LXUX 5AEUB 3MYTA 3N9HA 4RNZA 3EC9A 1AVLA 2WO0A 3WMDA 3FG3A 4LZIA 1AV4A 3J7Yd 2B1XB 1N5PA 1OACA 3S28A 1O7NB 1QAFA 2IA7A 5IEPA 1VQ83 1QMAA 2F86B 1DMQA 1OHOA 1FGTA 4WP5A 1IV9A 3CD63 3NBJA 5IG0A 3SOYA 1Q7Y4 3KSED 1K28A 2HMOB 1U8CB 1KSIA 1N9JA 1QALA 2Y73A 3EE1A 2QGUA 4HM2B 2R4IA 5CF2A 4XBYA 3M8CA 1JKGB 5LC6A 3OW22 4HKVB 1IU7A 1OUNA 3H51A 1IQYA 3LZAA 3MG1A 3PCRA 4KFEA 1WNHA 4MJDA 4N6V0 3HZPA 4AKZA 1SPUA 1AVKA 1O7WB 1TFKA 1VZZA 1SIIA 3CCL3 1UUWB 1W00A 1Q864 1VQ93 5ELUA 3ALAA 1DMNA 3JUPA 4O2HA 2K0MA 3OWUA 1F8NA 3CCU3 1K8A4 4EXRA 1A90A 1Q40A 3NQZA 4HM3B 4OVMA 1NJI4 3MG2A 3UJMA 3KSPA 4Q53A 5EVHA 1J2BA 3GZRA 2BO9B 2GEYA 3CMA3 4XM4A 1JB2A 2HMNB 4XDVA 1YIJ3 1VQ53 3F9SA 3BB9A 1FUWA 4XBXA 5IF6A 2W2CA 4HBRA 4K61A 4O3VA 5JBSA 2STDA 2P0XA 2QIYA 4H61A 6STDA 3JUMA 2BMOB 4MMZB 2BNGA 3G8ZA 3BNBA 4BTYA 1IVVA 3I0YA 3OV4A 3S27A 2CWVA 2WGQA 4IIAA 2RSXA 1TUHA 1U5OA 4N6TA 1VQ43 1JJ22 5TGNA 3Q1CA 3U97A 1KD14 3FF2A 5AIGA 1Q40B 1UI8A 1LNHA 4CDLA 3KKGA 3D9RA 1W2B2 4HVNA 3MWZA 1EQKA 3F8XA 4OK0A 4R80A 2RFRA 1WTHA 3JUNA 3DMCA 2RCDA 2KXGA 3PGBA 3NXJA 3EJVA 1RKYA 2W9PA 2CHCA 1D6UA 2OTJ3 1ZX2A 4NREA 2PZVA 4R9LA 4STDA 4RBNA 3AMOA 2P38A 2ZL8A 4L7KA 1AR0A 1W4NA 1A2KA 1LVNA 3PS8A 1FGOA 2CFGA 4MMXB 4OUQA 1VQL3 3GZBA 3U1WA 1FGMA 3K9MC 3EN8A 3T0UA 1V74A 3NBBA 3S67A 3ECFA 4HM8B 1DMMA 4N6NB 2GU1A 2CH9A 1T5YA 1A67A 1NDOB 3GWRA 5EQLA 1GS3A 5AYSC 1YJN3 1MOLA 1WQLB 5IERA 1VQK3 3CPW2 3NHXA 1W6GA 4HZBB 1ZO2A 2OWPA 1QVG2 2P0MA 1W02A 1MNLA 4WFOA 2HMLB 1YVBI 2OQEC 1QJGA 1JV2B 3LTDA 2C10A 2XEPA 1O7GB 3AMOB 4HJLB 3N54B 1JB5A 1FGRA 3EB8A 2CFDA 2JDIH 3G6E3 3CCJ3 2P05A 3SEDA 4J9AA 2WOFA 1YGEA 3FSDA 4BTWA 5AEWB 4WWUC 3OXAA 5IG4A 2W56A 3X41A 4RZMA 2D1WA 3CCV3 1JNQA 3DGNA 2OTL3 3X3ZA 5FW5A 1OHPA 1GY6A 3CCQ3 3JVCA 4EBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  3LTB A;  3LTD A;  3DGN A;  3DGM A;  3LTC A;  1UW1 A;  3DGO A;  3DGL A;  3LT9 A;  3LT8 A;  3LTA A;  2P09 A;  2P0X A; 
#chains in the Genus database with same CATH topology
 1SJW A;  3FCS B;  4AEQ A;  1RRH A;  1BSA A;  1ZS7 A;  2AAD A;  1JRQ A;  2LQV A;  3DGO A;  4EYC A;  2F99 A;  3DZL A;  3FH1 A;  4QWT A;  3IJE B;  1E3V A;  3UL6 A;  2AAE A;  3H3H A;  3FG1 A;  3DY5 A;  1OHS A;  4HM0 B;  1L5G B;  1EG9 B;  4X2H A;  1B2M A;  3CPO A;  3WR2 A;  1JB4 A;  4LYL B;  1VQN 3;  4N6O B;  1US1 A;  1B20 A;  4G1M B;  2E2V A;  2SAR A;  5IG3 A;  5STD A;  3E99 A;  1MWS A;  4K90 B;  2XGN A;  1CYV A;  1VQ7 3;  5AI1 A;  4HM1 B;  4CCV A;  1DE3 A;  1K41 A;  1SAR A;  3X3X A;  2W56 B;  1NB3 I;  3NBR A;  4XBT A;  5RNT A;  1M90 4;  3SOA A;  1IVX A;  3PXM A;  2F98 A;  1RHL A;  4HAA A;  1TTO A;  2GSP A;  2L4V A;  3NX0 A;  4O02 B;  3L0R A;  3Q90 A;  1GD3 A;  3D3L A;  2BHM A;  2GEX A;  1G96 A;  4HOH A;  4NHF A;  3FF0 A;  3FLJ A;  4BU4 A;  3CCR 3;  3RGR A;  1R4C A;  3ZFZ A;  3EBT A;  4FMC A;  3PYJ A;  2BIR A;  2GBX B;  2HMM B;  3CXC 2;  2HMJ B;  3X42 A;  5EEO A;  4FCM A;  1GY5 A;  1IVW A;  2C11 A;  1OPY A;  5G2G A;  3SVA A;  4ZM8 A;  2E2U A;  1RN7 A;  1RJO A;  2Z76 A;  3CC7 3;  1FW7 A;  3LTB A;  1LOW A;  1N5H A;  4PEJ A;  1RCL A;  2W03 A;  3ZG5 A;  5DRE A;  3DH2 A;  3DM8 A;  2YFJ B;  2MF7 A;  5IG5 A;  3WDG B;  1KC8 4;  3UB1 A;  2O3O A;  3CC2 3;  4WYK A;  1ASK A;  3G16 A;  4RNY A;  1K73 4;  1ROA A;  2IUJ A;  4EV2 A;  1PU4 A;  2OCT A;  4HM6 B;  3MSO A;  3MHE A;  4J5G A;  1YI2 3;  5HGR A;  2CX1 A;  3KN4 A;  4I4K A;  3B4P A;  1IV7 A;  1W2Z A;  1RGK A;  3NQY A;  3PCS A;  1ISK A;  3WOF B;  3WHO A;  1RGA A;  3AGN A;  3OWY A;  1UW1 A;  5A0O B;  1VQQ A;  3HOH A;  1NWW A;  1B2X A;  2Z6B A;  3D79 A;  3MKI A;  1MWR A;  3G0K A;  3A5E A;  3JUO A;  4KVH A;  2Y74 A;  1C54 A;  2YFL B;  1BNS A;  5BXQ A;  1C7H A;  1MGW A;  3KFQ C;  5D83 A;  1VQO 3;  3FGY A;  1LQM B;  1RGC A;  3K7C A;  3LT8 A;  2WOH A;  3I56 3;  1WMP A;  2XF3 A;  3CCM 3;  3S5C A;  2QA4 3;  2RGQ A;  3BND A;  1K9M 4;  1JZO A;  1HYF A;  2KF4 A;  2ZDJ A;  4WYK B;  2CK3 H;  4IT7 A;  1GMP A;  1STD A;  3DUK A;  1RGF A;  2CFL A;  3K5T A;  4RNT A;  1UUV B;  1OGX A;  2CC3 A;  2YX9 A;  2CFW A;  2RNT A;  3B8L A;  2FNQ A;  4K1U A;  1BIR A;  1I2E A;  1RN4 A;  2A15 A;  2C4B A;  3IMA B;  5BVB A;  1PFP A;  1VQP 3;  5CF1 A;  1CH0 A;  3BLZ A;  3SYU A;  4EV5 A;  5JPP A;  5D82 A;  1CYU A;  3GRD A;  3LOY A;  3V92 A;  5AIH A;  3I55 3;  3KII A;  3PZW A;  1V57 A;  1RMS A;  4HM7 B;  4N6M A;  1TRQ A;  3WA2 X;  1NO3 A;  3G71 3;  3A76 A;  1GSP A;  1LOX A;  2XGL A;  3ROB A;  3CC4 3;  4J5K A;  3CNM A;  1GD4 A;  3MPH A;  3RDE A;  4LSO A;  3X40 A;  1UCL A;  2V1L A;  3URP A;  2CG1 A;  1M1K 4;  2I9W A;  3GZX B;  3K0Z A;  1W7C A;  3Q2P A;  5G1L A;  2ML6 A;  3D5I A;  1QAK A;  1JN5 A;  1SQW A;  2RBI A;  1Q7H A;  3VSY A;  2HMK B;  3UNL A;  2JQ5 A;  2Q07 A;  4HYZ A;  1I0V A;  1GYB A;  2CW9 A;  2BU4 A;  2F5W A;  1W5Z A;  2KF3 A;  1OGZ A;  2CKF B;  4HM4 B;  1B2Z A;  1E97 A;  2H0I A;  1YJ9 3;  4ORL A;  4HM5 B;  5AYR B;  5CK6 A;  4XDW A;  3HIG A;  3FZW A;  5M18 A;  1ULI B;  1Q42 A;  2YFI B;  3WOE B;  4J8T A;  3T8U A;  3DXO A;  5M19 A;  1BNE A;  3G4S 3;  1BUJ A;  2CIU A;  3KZT A;  1GOU A;  3F14 A;  3B7C A;  4N3V A;  3SXX A;  1AQZ A;  3D5G A;  3DGL A;  2M7O A;  3HX8 A;  4R4K A;  5LC7 A;  5M1A A;  3HI7 A;  4KFF A;  2FXT A;  2E2T A;  3EBY A;  1YHQ 3;  5JPU A;  1EUI C;  1JN5 B;  2INX A;  2OOV C;  3D4A A;  3V98 A;  2IYJ A;  3BIR A;  1HZ1 A;  3QK9 A;  4WHA A;  1GY7 A;  1STF I;  1VQ6 3;  4R1K A;  5CLK A;  2H0G A;  3NUV A;  5BIR A;  1TIJ A;  4FCJ A;  3CCE 3;  1YJW 3;  1IQ8 A;  2IUK A;  1R4Y A;  3BNE A;  3LH4 A;  4CPK A;  1BRK A;  1CQS A;  2W04 A;  4N6U A;  2W6J H;  2XSH B;  3OX9 A;  4MMY B;  1N8R 4;  2PNC A;  1UDI I;  3F7X A;  5I97 A;  2CWT A;  4HZ9 B;  1GOY A;  1T2I A;  1M9G A;  3GSP A;  2Z77 A;  3LML A;  1IVU A;  2KF5 A;  1Q82 4;  2K54 A;  1B2S A;  1D6Y A;  1M1X B;  2XFT A;  4JF8 A;  1O7H B;  7RNT A;  3VGN A;  1VQM 3;  1IQX A;  6GSP A;  3LYG A;  3UL5 A;  1RGE A;  1BSD A;  3MG3 A;  1BSC A;  3F7S A;  2SBL A;  3QRD A;  5CXO A;  4ILF A;  1DYU A;  1OF5 A;  8RNT A;  3ER7 A;  1YIT 3;  1BUQ A;  1FA3 A;  1A2V A;  1WMO A;  2WGO A;  1UCJ A;  4L8O A;  4EC6 A;  1ROV A;  4FMB A;  4NPB A;  3KE7 A;  5IEO A;  3OWS A;  2O9U X;  5D81 A;  1B21 A;  1LXE A;  1I0X A;  1I2G A;  1D6Z A;  3NV0 A;  3X3Y A;  1HKX A;  5AII A;  1A2P A;  2F4Y A;  1N9E A;  3HK4 A;  1YVS A;  3F40 A;  1MWU A;  4K1V A;  4KZ1 A;  1LRA A;  2XSO B;  1MGR A;  1T2H A;  1S5A A;  2P09 A;  3NM7 A;  3DGM A;  1ULJ B;  3LTC A;  4GL6 A;  4L8P A;  4XB5 A;  5FGO A;  3V99 A;  2CG0 A;  3VF1 A;  1NB5 I;  3BNC A;  3KCH A;  1RGH A;  3EF8 A;  3T8N A;  3O8Y A;  1W6C A;  1N8Q A;  1TP6 A;  1BNR A;  4FMD A;  1QVF 2;  1Q81 4;  1OF5 B;  2MC8 A;  1DVC A;  3IPT A;  5KP1 A;  2XH9 A;  1HU9 A;  5AIF A;  1O7M B;  3WOD G;  3EQQ B;  3FG4 A;  1FGQ A;  2LYX A;  3NM2 A;  7GSP A;  3JUQ A;  2HOH A;  1W6Y A;  1I70 A;  4BL2 A;  1CEW I;  4LGQ A;  3NV0 B;  1Z1S A;  4KFD A;  2BMR B;  1FUS A;  3EN1 B;  4TX4 A;  5DRV A;  3RGA A;  2ZHX B;  2IY2 A;  2BMQ B;  4X2O A;  4LEH A;  1IT8 A;  4N6L A;  2OQE A;  3LTA A;  2KRT A;  1WMN A;  1O7P B;  3S29 A;  5KP4 A;  4FMA A;  2IMJ A;  4O8S A;  4H3U A;  3SLU A;  1NU3 A;  1X1W A;  7STD A;  4CJN A;  1TJD A;  2ML5 A;  2W9Q A;  1DET A;  3FKA A;  3CNX A;  1BRH A;  3GZY B;  4JRF A;  4MEI A;  1EA2 A;  3CME 3;  8CHO A;  4LMI A;  2GBW B;  1RN1 A;  1UI7 A;  2GXF A;  1FUT A;  1TU5 A;  4U13 A;  1RDS A;  1EKM A;  1BRS A;  1OCV A;  3BU4 A;  4GB5 A;  5KP3 A;  5IW9 A;  3GAX A;  1BNI A;  1BGS A;  2XR8 B;  4AKY A;  1IT7 A;  4R9K A;  4FCZ A;  1Y4K A;  1E3R A;  2UX0 A;  3LT9 A;  4FR9 A;  2OOV A;  3F8H A;  2BT3 A;  2KCD A;  1SIH A;  2W0Q A;  5ELJ A;  3CCS 3;  3N8B A;  2CFK A;  2D42 A;  3K63 A;  3CU3 A;  2XRX B;  1PYL A;  3STD A;  1B2U A;  4I5Q A;  1AY7 A;  2F56 A;  1DVD A;  1UCI A;  2GU3 A;  5IEN A;  1YGW A;  2QEX 3;  4KT3 B;  3EHC A;  1OH0 A;  3SX1 A;  1LOY A;  3B4O A;  1I3I A;  2UUG C;  1S72 3;  1BAO A;  3HII A;  2Z7A A;  2B24 B;  4BTX A;  1BNJ A;  1KWI A;  3TDG A;  1TFO A;  4IPB A;  3WA3 A;  1IDP A;  2XFS A;  3EX9 A;  1GMR A;  1IK3 A;  2FGT A;  5G1K A;  1RRL A;  2H0H A;  1KQS 2;  1W01 A;  4GHO A;  2CWU A;  1JKG A;  3LXU X;  5AEU B;  3MYT A;  3N9H A;  4RNZ A;  1RCK A;  3EC9 A;  1AVL A;  2WO0 A;  3WMD A;  3FG3 A;  4LZI A;  1AV4 A;  3J7Y d;  2B1X B;  1N5P A;  1I2F A;  1OAC A;  3S28 A;  1O7N B;  1QAF A;  2IA7 A;  5IEP A;  1VQ8 3;  1QMA A;  2F86 B;  1RNB A;  1DMQ A;  1OHO A;  1FGT A;  4WP5 A;  1IV9 A;  3CD6 3;  3NBJ A;  5IG0 A;  3SOY A;  1Q7Y 4;  9RNT A;  3KSE D;  3AHW A;  6RNT A;  2CX0 A;  1K28 A;  2J8X B;  2K3D A;  2HMO B;  1U8C B;  4EW5 A;  1KSI A;  1N9J A;  1QAL A;  2Y73 A;  3EE1 A;  3DGY A;  2QGU A;  1FYS A;  4HM2 B;  2R4I A;  5CF2 A;  4XBY A;  3M8C A;  1JKG B;  5LC6 A;  3OW2 2;  4HKV B;  1IU7 A;  1OUN A;  1B3S A;  3H51 A;  1IQY A;  3LZA A;  3MG1 A;  3PCR A;  4KFE A;  1WNH A;  4MJD A;  4N6V 0;  1T3B A;  3HZP A;  1GOV A;  4AKZ A;  1SPU A;  2KF6 A;  1AVK A;  1O7W B;  2UGI A;  1TFK A;  1VZZ A;  1SII A;  3CCL 3;  1GMQ A;  1BOX A;  1UUW B;  1W00 A;  1Q86 4;  2F5M A;  1VQ9 3;  5ELU A;  3ALA A;  1DMN A;  3JUP A;  4O2H A;  2K0M A;  3OWU A;  3AHS A;  1F8N A;  3CCU 3;  3Q3F A;  1K8A 4;  4EXR A;  1A90 A;  1G0T A;  5GSP A;  1Q40 A;  3NQZ A;  4HM3 B;  4OVM A;  1NJI 4;  3MG2 A;  3UJM A;  1BRN L;  3KSP A;  4Q53 A;  5EVH A;  1J2B A;  3GZR A;  2BO9 B;  1FZU A;  2GEY A;  3CMA 3;  4XM4 A;  1JB2 A;  2HMN B;  4XDV A;  1YNV X;  1YIJ 3;  3F9S A;  3BB9 A;  1VQ5 3;  1FUW A;  4XBX A;  5IF6 A;  1I3F A;  2W2C A;  4HBR A;  4K61 A;  4O3V A;  5JBS A;  1UGH I;  2STD A;  2P0X A;  2L1S A;  2QIY A;  4H61 A;  1UGI A;  6STD A;  3JUM A;  2BMO B;  1ZGX A;  2BNG A;  4MMZ B;  3RNT A;  1JBT A;  3G8Z A;  1RLS A;  3BNB A;  1JBS A;  4BTY A;  1IVV A;  1UCK A;  3I0Y A;  3OV4 A;  3S27 A;  2CWV A;  1BSE A;  2WGQ A;  4IIA A;  4BIR A;  2RSX A;  1LNI A;  1TUH A;  1U5O A;  2KAA A;  4N6T A;  1VQ4 3;  1JJ2 2;  5TGN A;  3Q1C A;  1BU4 A;  3U97 A;  1KD1 4;  3FF2 A;  5AIG A;  1Q40 B;  1UI8 A;  1LNH A;  4CDL A;  5BU4 A;  3KKG A;  3D9R A;  1BSB A;  1W2B 2;  1BRI A;  4HVN A;  3AGO A;  1Q9E A;  3MWZ A;  1G02 A;  1EQK A;  3F8X A;  4OK0 A;  1B27 A;  1BNF A;  4R80 A;  2RFR A;  1EEJ A;  1WTH A;  1BAN A;  1TRP A;  3DMC A;  3JUN A;  1JZD A;  2RCD A;  1BNG A;  2KXG A;  3PGB A;  3NXJ A;  3EJV A;  1RKY A;  2W9P A;  2CHC A;  1D6U A;  2OTJ 3;  1ZX2 A;  4NRE A;  2PZV A;  4R9L A;  4STD A;  1LQG C;  4RBN A;  3AMO A;  2P38 A;  1BVI A;  2ZL8 A;  4L7K A;  1AR0 A;  1W4N A;  1A2K A;  1LVN A;  3PS8 A;  1FGO A;  2CFG A;  4MMX B;  4OUQ A;  1VQL 3;  1JBR A;  3GZB A;  3U1W A;  3ZG0 A;  1X1X A;  1BRJ A;  1FGM A;  2R41 A;  3EN8 A;  1V58 A;  1V74 A;  3K9M C;  3NBB A;  3T0U A;  3S67 A;  3ECF A;  4HM8 B;  1DMM A;  1RGL A;  2GU1 A;  4N6N B;  2CH9 A;  1RSN A;  1LOV A;  1T5Y A;  1A67 A;  1NDO B;  3GWR A;  5EQL A;  1GS3 A;  5AYS C;  1YJN 3;  1MOL A;  1WQL B;  1IYY A;  1RNT A;  5IER A;  1VQK 3;  5HOH A;  3NHX A;  1UUG B;  3CPW 2;  4BL3 A;  1BRG A;  1W6G A;  2ZA4 A;  4HZB B;  1ZO2 A;  2OWP A;  1QVG 2;  2P0M A;  1W02 A;  1MNL A;  1NNV A;  1MWT A;  1X1U A;  1RTU A;  4WFO A;  1I8V A;  1PY3 A;  1YVB I;  2HML B;  1QJG A;  2OQE C;  1JV2 B;  3LTD A;  2C10 A;  2XEP A;  1O7G B;  3AMO B;  4GSP A;  4HJL B;  3N54 B;  1JB5 A;  1FGR A;  3EB8 A;  2CFD A;  2JDI H;  3G6E 3;  4DKI A;  3CCJ 3;  2P05 A;  3SED A;  4J9A A;  2WOF A;  1YGE A;  1X1Y A;  3FSD A;  4BTW A;  5AEW B;  4WWU C;  3OXA A;  1RGG A;  5IG4 A;  2W56 A;  3X41 A;  4RZM A;  2D1W A;  3CCV 3;  1JNQ A;  3DGN A;  2OTL 3;  3X3Z A;  5FW5 A;  1OHP A;  1GY6 A;  3CCQ 3;  3JVC A;  4EBG A; 
#chains in the Genus database with same CATH homology
 1SJW A;  3FCS B;  4AEQ A;  1RRH A;  2LQV A;  3DGO A;  4EYC A;  1JRQ A;  2F99 A;  3DZL A;  3FH1 A;  4QWT A;  3IJE B;  1E3V A;  3UL6 A;  3H3H A;  3FG1 A;  3DY5 A;  1OHS A;  4HM0 B;  1L5G B;  1EG9 B;  4X2H A;  1VQN 3;  3CPO A;  1JB4 A;  4N6O B;  1US1 A;  4G1M B;  2E2V A;  5IG3 A;  5STD A;  3E99 A;  4K90 B;  2XGN A;  1CYV A;  1VQ7 3;  5AI1 A;  4HM1 B;  4CCV A;  1K41 A;  3X3X A;  2W56 B;  1NB3 I;  3NBR A;  4XBT A;  1M90 4;  3SOA A;  1IVX A;  3PXM A;  2F98 A;  2L4V A;  3NX0 A;  4O02 B;  3L0R A;  3Q90 A;  1GD3 A;  3D3L A;  2BHM A;  2GEX A;  1G96 A;  4NHF A;  3FF0 A;  3FLJ A;  3CCR 3;  3RGR A;  1R4C A;  3EBT A;  4FMC A;  3PYJ A;  2HMM B;  2GBX B;  3CXC 2;  2HMJ B;  3X42 A;  5EEO A;  4FCM A;  1GY5 A;  1IVW A;  2C11 A;  1OPY A;  5G2G A;  3SVA A;  4ZM8 A;  2E2U A;  1RN7 A;  1RJO A;  2Z76 A;  3CC7 3;  3LTB A;  4PEJ A;  1N5H A;  2W03 A;  5DRE A;  3DM8 A;  5IG5 A;  2YFJ B;  2MF7 A;  3WDG B;  1KC8 4;  3UB1 A;  2O3O A;  3CC2 3;  4WYK A;  1ASK A;  3G16 A;  4RNY A;  1K73 4;  1ROA A;  2IUJ A;  4EV2 A;  1PU4 A;  2OCT A;  4HM6 B;  3MSO A;  3MHE A;  1YI2 3;  5HGR A;  3KN4 A;  4I4K A;  3B4P A;  1IV7 A;  1W2Z A;  3NQY A;  3PCS A;  1ISK A;  3WOF B;  3OWY A;  1UW1 A;  5A0O B;  1NWW A;  2Z6B A;  3MKI A;  3G0K A;  3JUO A;  4KVH A;  2Y74 A;  2YFL B;  5BXQ A;  1C7H A;  3KFQ C;  5D83 A;  1VQO 3;  3FGY A;  3K7C A;  3LT8 A;  3I56 3;  3CCM 3;  2WOH A;  1WMP A;  2XF3 A;  3S5C A;  2QA4 3;  2RGQ A;  3BND A;  1K9M 4;  2ZDJ A;  4WYK B;  2CK3 H;  4IT7 A;  1STD A;  3DUK A;  2CFL A;  3K5T A;  1UUV B;  1OGX A;  2CC3 A;  2YX9 A;  2CFW A;  3B8L A;  2FNQ A;  4K1U A;  2A15 A;  3IMA B;  5BVB A;  1VQP 3;  1PFP A;  5CF1 A;  3BLZ A;  4EV5 A;  5JPP A;  5D82 A;  1CYU A;  3GRD A;  3LOY A;  3V92 A;  5AIH A;  3I55 3;  3KII A;  3PZW A;  4HM7 B;  4N6M A;  3WA2 X;  1NO3 A;  3G71 3;  3A76 A;  1LOX A;  2XGL A;  3ROB A;  3CC4 3;  3CNM A;  1GD4 A;  3MPH A;  3RDE A;  4LSO A;  3X40 A;  2V1L A;  1M1K 4;  2CG1 A;  2I9W A;  3GZX B;  3K0Z A;  1W7C A;  3Q2P A;  2ML6 A;  1QAK A;  1JN5 A;  1SQW A;  3VSY A;  2HMK B;  3UNL A;  2JQ5 A;  2Q07 A;  4HYZ A;  1GYB A;  2CW9 A;  1W5Z A;  4HM4 B;  1OGZ A;  2CKF B;  1E97 A;  1YJ9 3;  4ORL A;  4HM5 B;  5AYR B;  5CK6 A;  4XDW A;  3HIG A;  3FZW A;  1ULI B;  1Q42 A;  2YFI B;  3WOE B;  4J8T A;  3T8U A;  3DXO A;  3G4S 3;  2CIU A;  3KZT A;  3F14 A;  3B7C A;  4N3V A;  3SXX A;  3DGL A;  2M7O A;  3HX8 A;  4R4K A;  5LC7 A;  3HI7 A;  4KFF A;  2FXT A;  2E2T A;  3EBY A;  1YHQ 3;  5JPU A;  2INX A;  1JN5 B;  2OOV C;  3V98 A;  4WHA A;  3QK9 A;  1GY7 A;  1STF I;  1VQ6 3;  4R1K A;  5CLK A;  3NUV A;  1TIJ A;  4FCJ A;  3CCE 3;  1YJW 3;  1IQ8 A;  2IUK A;  3BNE A;  3LH4 A;  1CQS A;  2W04 A;  4N6U A;  2W6J H;  2XSH B;  3OX9 A;  4MMY B;  1N8R 4;  2PNC A;  3F7X A;  5I97 A;  2CWT A;  4HZ9 B;  1M9G A;  3LML A;  2Z77 A;  1IVU A;  1Q82 4;  2K54 A;  1M1X B;  1D6Y A;  2XFT A;  4JF8 A;  1O7H B;  3VGN A;  1VQM 3;  1IQX A;  3LYG A;  3UL5 A;  3MG3 A;  3F7S A;  2SBL A;  3QRD A;  5CXO A;  1DYU A;  1OF5 A;  1BUQ A;  3ER7 A;  1YIT 3;  1FA3 A;  1A2V A;  1WMO A;  2WGO A;  4L8O A;  4EC6 A;  1ROV A;  4FMB A;  5IEO A;  3KE7 A;  3OWS A;  2O9U X;  5D81 A;  1LXE A;  1D6Z A;  3NV0 A;  3X3Y A;  1HKX A;  5AII A;  1N9E A;  3HK4 A;  3F40 A;  4K1V A;  4KZ1 A;  2XSO B;  1S5A A;  2P09 A;  3NM7 A;  3DGM A;  1ULJ B;  3LTC A;  4GL6 A;  4L8P A;  4XB5 A;  5FGO A;  3V99 A;  2CG0 A;  3VF1 A;  1NB5 I;  3BNC A;  3EF8 A;  3T8N A;  3O8Y A;  1W6C A;  1N8Q A;  1TP6 A;  4FMD A;  1QVF 2;  1Q81 4;  1OF5 B;  2MC8 A;  1DVC A;  3IPT A;  5KP1 A;  2XH9 A;  1HU9 A;  5AIF A;  1O7M B;  3WOD G;  3EQQ B;  3FG4 A;  1FGQ A;  2LYX A;  3NM2 A;  3JUQ A;  1W6Y A;  1CEW I;  4LGQ A;  3NV0 B;  1Z1S A;  4KFD A;  2BMR B;  3EN1 B;  4TX4 A;  5DRV A;  3RGA A;  4X2O A;  2BMQ B;  4LEH A;  1IT8 A;  4N6L A;  2OQE A;  3LTA A;  2KRT A;  1WMN A;  1O7P B;  3S29 A;  5KP4 A;  4FMA A;  2IMJ A;  4O8S A;  4H3U A;  3SLU A;  1NU3 A;  7STD A;  2ML5 A;  2W9Q A;  3GZY B;  3FKA A;  3CNX A;  4JRF A;  4MEI A;  1EA2 A;  3CME 3;  8CHO A;  4LMI A;  2GBW B;  1UI7 A;  2GXF A;  1TU5 A;  4U13 A;  1EKM A;  1OCV A;  4GB5 A;  5KP3 A;  5IW9 A;  3GAX A;  4AKY A;  2XR8 B;  1IT7 A;  4R9K A;  4FCZ A;  1Y4K A;  1E3R A;  2UX0 A;  3LT9 A;  4FR9 A;  2OOV A;  3F8H A;  2BT3 A;  2KCD A;  1SIH A;  2W0Q A;  5ELJ A;  3CCS 3;  3N8B A;  2CFK A;  2D42 A;  3K63 A;  3CU3 A;  2XRX B;  3STD A;  1DVD A;  2QEX 3;  2GU3 A;  5IEN A;  3EHC A;  1OH0 A;  3SX1 A;  3B4O A;  1S72 3;  3HII A;  2Z7A A;  2B24 B;  4BTX A;  1KWI A;  3TDG A;  1TFO A;  4IPB A;  3WA3 A;  1IDP A;  2XFS A;  3EX9 A;  1IK3 A;  2FGT A;  1RRL A;  1KQS 2;  1W01 A;  2CWU A;  1JKG A;  3LXU X;  5AEU B;  3MYT A;  3N9H A;  4RNZ A;  3EC9 A;  1AVL A;  2WO0 A;  3WMD A;  3FG3 A;  4LZI A;  1AV4 A;  3J7Y d;  2B1X B;  1N5P A;  1OAC A;  3S28 A;  1O7N B;  1QAF A;  2IA7 A;  5IEP A;  1VQ8 3;  1QMA A;  2F86 B;  1DMQ A;  1OHO A;  1FGT A;  4WP5 A;  1IV9 A;  3CD6 3;  3NBJ A;  5IG0 A;  3SOY A;  1Q7Y 4;  3KSE D;  1K28 A;  2HMO B;  1U8C B;  1KSI A;  1N9J A;  1QAL A;  2Y73 A;  3EE1 A;  2QGU A;  4HM2 B;  2R4I A;  5CF2 A;  4XBY A;  3M8C A;  1JKG B;  5LC6 A;  3OW2 2;  4HKV B;  1IU7 A;  1OUN A;  3H51 A;  1IQY A;  3LZA A;  3MG1 A;  3PCR A;  4KFE A;  1WNH A;  4MJD A;  4N6V 0;  3HZP A;  4AKZ A;  1SPU A;  1AVK A;  1O7W B;  1TFK A;  1VZZ A;  1SII A;  3CCL 3;  1UUW B;  1W00 A;  1Q86 4;  1VQ9 3;  5ELU A;  3ALA A;  1DMN A;  3JUP A;  4O2H A;  2K0M A;  3OWU A;  1F8N A;  3CCU 3;  1K8A 4;  4EXR A;  1A90 A;  1Q40 A;  3NQZ A;  4HM3 B;  4OVM A;  1NJI 4;  3MG2 A;  3UJM A;  3KSP A;  4Q53 A;  5EVH A;  1J2B A;  3GZR A;  2BO9 B;  2GEY A;  3CMA 3;  4XM4 A;  1JB2 A;  2HMN B;  4XDV A;  1YIJ 3;  1VQ5 3;  3F9S A;  3BB9 A;  1FUW A;  4XBX A;  5IF6 A;  2W2C A;  4HBR A;  4K61 A;  4O3V A;  5JBS A;  2STD A;  2P0X A;  2QIY A;  4H61 A;  6STD A;  3JUM A;  2BMO B;  4MMZ B;  2BNG A;  3G8Z A;  3BNB A;  4BTY A;  1IVV A;  3I0Y A;  3OV4 A;  3S27 A;  2CWV A;  2WGQ A;  4IIA A;  2RSX A;  1TUH A;  1U5O A;  4N6T A;  1VQ4 3;  1JJ2 2;  5TGN A;  3Q1C A;  3U97 A;  1KD1 4;  3FF2 A;  5AIG A;  1Q40 B;  1UI8 A;  1LNH A;  4CDL A;  3KKG A;  3D9R A;  1W2B 2;  4HVN A;  3MWZ A;  1EQK A;  3F8X A;  4OK0 A;  4R80 A;  2RFR A;  1WTH A;  3JUN A;  3DMC A;  2RCD A;  2KXG A;  3PGB A;  3NXJ A;  3EJV A;  1RKY A;  2W9P A;  2CHC A;  1D6U A;  2OTJ 3;  1ZX2 A;  4NRE A;  2PZV A;  4R9L A;  4STD A;  4RBN A;  3AMO A;  2P38 A;  2ZL8 A;  4L7K A;  1AR0 A;  1W4N A;  1A2K A;  1LVN A;  3PS8 A;  1FGO A;  2CFG A;  4MMX B;  4OUQ A;  1VQL 3;  3GZB A;  3U1W A;  1FGM A;  3K9M C;  3EN8 A;  3T0U A;  1V74 A;  3NBB A;  3S67 A;  3ECF A;  4HM8 B;  1DMM A;  4N6N B;  2GU1 A;  2CH9 A;  1T5Y A;  1A67 A;  1NDO B;  3GWR A;  5EQL A;  1GS3 A;  5AYS C;  1YJN 3;  1MOL A;  1WQL B;  5IER A;  1VQK 3;  3CPW 2;  3NHX A;  1W6G A;  4HZB B;  1ZO2 A;  2OWP A;  1QVG 2;  2P0M A;  1W02 A;  1MNL A;  4WFO A;  2HML B;  1YVB I;  2OQE C;  1QJG A;  1JV2 B;  3LTD A;  2C10 A;  2XEP A;  1O7G B;  3AMO B;  4HJL B;  3N54 B;  1JB5 A;  1FGR A;  3EB8 A;  2CFD A;  2JDI H;  3G6E 3;  3CCJ 3;  2P05 A;  3SED A;  4J9A A;  2WOF A;  1YGE A;  3FSD A;  4BTW A;  5AEW B;  4WWU C;  3OXA A;  5IG4 A;  2W56 A;  3X41 A;  4RZM A;  2D1W A;  3CCV 3;  1JNQ A;  3DGN A;  2OTL 3;  3X3Z A;  5FW5 A;  1OHP A;  1GY6 A;  3CCQ 3;  3JVC A;  4EBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...