3DHBA

1.4 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at the catalytic metal center
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
b'MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acyl Homoserine Lactone Hydrolase
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
total genus 81
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhbA01
2FHXB 4D02A 5LLDA 5EHTA 1SMLA 3PY5A 4UAMA 2FU6A 3AF6A 5LE1A 4UWOB 4WD6A 1HLKA 2I7VA 5ACRA 4ZEJA 3IOFA 2M5CA 4ZO3A 3BK1A 5EV8A 5FQBA 1ZNBA 2GFKA 3I15A 2YNTA 4Z7RA 2FU9A 3H3EA 2FHXA 2BFKA 2Q42A 2BIBA 4EYLA 4RAWA 4EYBA 3Q6VA 3T9MA 4F6ZA 5LCFA 2YCBA 5EVKA 2NYPA 5KIKA 2QEDA 2GFJA 1VJNA 2GCUA 2Y8AA 4AWZA 2QINA 4TZEA 2WRSA 5B3RA 2Q0JA 4LE6A 4Z6XA 2A7MA 1XTOA 3X2XA 5ACUA 3IEMA 5EH9A 1WW1A 4FSBA 1Y44A 4AX0B 5EVDA 1KO2A 5AYAA 4EYFA 1DDKA 5AHOA 4JO0A 1YCGA 4D1UA 2BTNA 3WXCA 4O98A 2BG8B 5KILA 5LS3A 3SBLA 3KL7A 5AEBA 2YNWA 1JJEA 5DPXA 5ACVA 1M2XA 1WUOA 2Q0IA 3DH8A 5HH6A 3MD7A 4RM5A 5A0TA 4TZBA 1X8GA 4Z5YA 4UA4A 3G1PA 4TYTA 2Q9UA 2FK6A 2BC2A 5A87A 2BR6A 1E5DA 2ZNBA 5HH5A 1WUPA 2OHHA 2OHJA 4NQ4A 2YNVA 5LMCA 3SW3A 3ZR9A 3IEKA 5EVBA 5FQCA 3SD9A 1L9YA 2XR1A 1XM8A 1VGNA 1WRAA 3RPCA 2YNUA 4GCWA 2H6AA 3BV6A 2AZ4A 4UWPB 3ZQ4A 4CHLA 2FM6A 4U4LA 5K0WA 4RL0A 4KEPA 4HKYA 3LVZA 1ZKPA 1JT1A 4AD9A 3IE0A 4YSLA 4Z60A 5ACXA 2NZFA 1YCHA 4P62A 4UWRB 2WYMC 4HL2A 4C1FA 3ZWFA 4EXSA 3P2UA 1BMCA 4TZ9A 5IQKA 2HB9A 5LCAA 5HIOA 3BC2A 3ADRA 2BMIA 4YSBA 3L6NA 2BFZA 3PY6A 4C1GA 4XUKA 1X8IA 3RKJA 3AF5A 2BG2A 4TZFA 5K4MA 5HH4A 2CBNA 4EXYA 4TYFA 1DD6A 5B1UA 3SFPA 1KR3A 3IDZA 4BP0A 4NQ5A 2YNVB 2XF4A 5K4KA 4J5FA 2P18A 3SRXA 4EFZA 2DKFA 2E7YA 2FU8A 5K4NA 2YZ3A 2VW8A 4EY2A 5A0VA 4AWYB 5ACSA 4H0DA 3T3OA 4ZO2A 2OHIA 5B15A 4D1VA 1JJTA 3IE2A 3IELA 2ZO4A 2WYMA 4NQ2A 2WHGA 2GKLA 4D1WA 4F6HA 1QH3A 4HL1A 4PVTA 3X2ZA 4C1EA 3KNRA 5LSCA 5AHRA 3DHAA 2AIOA 2BG7A 5FQAA 1VMEA 2QDSA 2P97A 4UWSB 5EV6A 2FU7A 4RL2A 3PG4A 4C1HA 3I11A 3IE1A 3QH8A 3X2YA 3F9OA 2ZWRA 4BZ3A 2BFZB 5HIQA 1KO3A 4C1CA 5LCHA 4RAMA 3T3NA 2P4ZA 5AXRA 4NQ6A 4FEKA 4Z67A 3VQZA 2M5DA 2Y87A 1YCFA 4ZNBA 4FR7A 3IOGA 2UYXA 2WYLA 3I0VA 3SPUA 2P1EA 4PVOA 5EWAA 4C09A 5HIPA 3FAIA 2QJSA 1P9EA 2BFLA 3ESHA 4KEQA 4B87A 3AJ3A 1QH5A 2ZZIA 3A4YA 2NZEA 4J5HA 3I14A 5LM6A 5A5ZA 3R2UA 1BC2A 1A8TA 3TP9A 2I7TA 4GYQA 3RKKA 3DHCA 2DOOA 1DXKA 4D1TA 1MQOA 4V0HA 3VPEA 4DIKA 5ACQA 1ZTCA 4RBSA 4UBQA 5ACTA 3ZNBA 5AXOA 5HISA 2GMNA 3X30A 4AX1B 3FCZA 2BG8A 3BK2A 5ACWA 1X8HA 1BVTA 4YSKA 3KNSA 4Z5ZA 4XWWA 4C1DA 1K07A 3S0ZA 3DHBA 1A7TA 3I13A 5EW0A 2R2DA 2BG6A 4XWTA 2I7XA 2NXAA 5ACPA 4DILA 4GYUA 2Y8BA 2YNTB 2BGAA 2QDTA 3JXPA
chains in the Genus database with same CATH superfamily
2FHXB 4D02A 5LLDA 5EHTA 1SMLA 3PY5A 4UAMA 2FU6A 3AF6A 5LE1A 4UWOB 4WD6A 1HLKA 2I7VA 5ACRA 4ZEJA 3IOFA 2M5CA 4ZO3A 3BK1A 5EV8A 5FQBA 1ZNBA 2GFKA 3I15A 2YNTA 4Z7RA 2FU9A 3H3EA 2FHXA 2BFKA 2Q42A 2BIBA 4EYLA 4RAWA 4EYBA 3Q6VA 3T9MA 4F6ZA 5LCFA 2YCBA 5EVKA 2NYPA 2CG2A 5KIKA 5AIJA 2QEDA 2GFJA 1VJNA 2GCUA 2Y8AA 4AWZA 2QINA 4TZEA 2WRSA 5B3RA 2Q0JA 4LE6A 4Z6XA 2A7MA 1XTOA 3X2XA 5ACUA 3IEMA 5EH9A 1WW1A 4FSBA 1Y44A 4AX0B 5EVDA 1KO2A 5AYAA 1DDKA 5AHOA 4EYFA 4JO0A 1YCGA 4D1UA 2BTNA 3WXCA 4O98A 2BG8B 5KILA 5LS3A 3SBLA 3KL7A 5AEBA 2YNWA 1JJEA 5DPXA 5ACVA 4AV7A 1M2XA 1WUOA 2Q0IA 3DH8A 5HH6A 2CFUA 3MD7A 4RM5A 5A0TA 4TZBA 1X8GA 4Z5YA 4UA4A 3G1PA 4TYTA 2Q9UA 2FK6A 2BC2A 5A87A 2BR6A 1E5DA 2ZNBA 5HH5A 1WUPA 2OHHA 2OHJA 4NQ4A 2YNVA 5LMCA 3SW3A 3ZR9A 3IEKA 5EVBA 5FQCA 4PDXA 3SD9A 1L9YA 2XR1A 1XM8A 1VGNA 1WRAA 3RPCA 2YNUA 4GCWA 2H6AA 3BV6A 2AZ4A 4UWPB 3ZQ4A 4CHLA 2FM6A 4U4LA 5K0WA 4RL0A 4KEPA 4HKYA 3LVZA 1ZKPA 1JT1A 4AD9A 3IE0A 4YSLA 4Z60A 5ACXA 2NZFA 1YCHA 4P62A 4UWRB 2WYMC 4HL2A 2CFZA 4C1FA 3ZWFA 4EXSA 3P2UA 1BMCA 4TZ9A 5IQKA 2HB9A 5LCAA 5HIOA 3BC2A 3ADRA 2BMIA 4YSBA 3L6NA 2BFZA 3PY6A 4C1GA 4XUKA 1X8IA 3RKJA 3AF5A 2BG2A 2YHEA 4TZFA 5K4MA 5HH4A 2CBNA 4EXYA 4TYFA 1DD6A 5B1UA 3SFPA 1KR3A 3IDZA 4BP0A 5AJLA 4NQ5A 2YNVB 2XF4A 5A23A 5K4KA 4J5FA 2P18A 3SRXA 4EFZA 2DKFA 2E7YA 2FU8A 5K4NA 2YZ3A 2VW8A 4EY2A 5A0VA 4AWYB 5ACSA 4H0DA 3T3OA 4ZO2A 2OHIA 5B15A 4D1VA 1JJTA 3IE2A 3IELA 2ZO4A 2WYMA 4NQ2A 2WHGA 2GKLA 4D1WA 4F6HA 1QH3A 4HL1A 4PVTA 3X2ZA 4C1EA 3KNRA 5LSCA 5AHRA 3DHAA 2AIOA 2BG7A 5FQAA 1VMEA 2QDSA 2P97A 4UWSB 5EV6A 2FU7A 4RL2A 4AXHA 3PG4A 4C1HA 3I11A 3IE1A 3QH8A 3X2YA 3F9OA 2ZWRA 4BZ3A 2BFZB 5HIQA 1KO3A 4C1CA 5LCHA 4RAMA 3T3NA 2P4ZA 5AXRA 4NQ6A 4FEKA 4Z67A 3VQZA 2M5DA 2Y87A 1YCFA 4ZNBA 4FR7A 3IOGA 2UYXA 2WYLA 3I0VA 3SPUA 2P1EA 4PVOA 5EWAA 4C09A 5HIPA 3FAIA 2QJSA 1P9EA 2BFLA 3ESHA 4KEQA 4B87A 3AJ3A 1QH5A 2ZZIA 3A4YA 2NZEA 4J5HA 4NURA 3I14A 5LM6A 5A5ZA 3R2UA 1BC2A 1A8TA 3TP9A 2I7TA 4GYQA 3RKKA 3DHCA 2DOOA 1DXKA 4D1TA 1MQOA 4V0HA 3VPEA 4DIKA 5ACQA 1ZTCA 4RBSA 4UBQA 5ACTA 3ZNBA 2CG3A 5AXOA 5HISA 2GMNA 3X30A 4AX1B 3FCZA 2BG8A 3BK2A 5ACWA 1X8HA 1BVTA 4YSKA 3KNSA 4Z5ZA 4XWWA 4C1DA 1K07A 3S0ZA 3DHBA 1A7TA 3I13A 5EW0A 2R2DA 2BG6A 4XWTA 2I7XA 2NXAA 5ACPA 4DILA 4GYUA 2Y8BA 2YNTB 2BGAA 2QDTA 3JXPA
chains in the Genus database with same CATH topology
2FHXB 4D02A 5LLDA 5EHTA 1SMLA 3PY5A 4UAMA 2FU6A 3AF6A 5LE1A 4UWOB 4WD6A 1HLKA 2I7VA 5ACRA 4ZEJA 3IOFA 2M5CA 4ZO3A 3BK1A 5EV8A 5FQBA 1ZNBA 2GFKA 3I15A 2YNTA 4Z7RA 2FU9A 3H3EA 2FHXA 2BFKA 2Q42A 2BIBA 4EYLA 4RAWA 4EYBA 3Q6VA 3T9MA 4F6ZA 5LCFA 2YCBA 5EVKA 2NYPA 5KIKA 2QEDA 2GFJA 1VJNA 2GCUA 2Y8AA 4AWZA 2QINA 4TZEA 2WRSA 5B3RA 2Q0JA 4LE6A 4Z6XA 2A7MA 1XTOA 3X2XA 5ACUA 3IEMA 5EH9A 1WW1A 4FSBA 1Y44A 4AX0B 5EVDA 1KO2A 5AYAA 4EYFA 1DDKA 5AHOA 4JO0A 1YCGA 4D1UA 2BTNA 3WXCA 4O98A 2BG8B 5KILA 5LS3A 3SBLA 3KL7A 5AEBA 2YNWA 1JJEA 5DPXA 5ACVA 1M2XA 1WUOA 2Q0IA 3DH8A 5HH6A 3MD7A 4RM5A 5A0TA 4TZBA 1X8GA 4Z5YA 4UA4A 3G1PA 4TYTA 2Q9UA 2FK6A 2BC2A 5A87A 2BR6A 1E5DA 2ZNBA 5HH5A 1WUPA 2OHHA 2OHJA 4NQ4A 2YNVA 5LMCA 3SW3A 3ZR9A 3IEKA 5EVBA 5FQCA 3SD9A 1L9YA 2XR1A 1XM8A 1VGNA 1WRAA 3RPCA 2YNUA 4GCWA 2H6AA 3BV6A 2AZ4A 4UWPB 3ZQ4A 4CHLA 2FM6A 4U4LA 5K0WA 4RL0A 4KEPA 4HKYA 3LVZA 1ZKPA 1JT1A 4AD9A 3IE0A 4YSLA 4Z60A 5ACXA 2NZFA 1YCHA 4P62A 4UWRB 2WYMC 4HL2A 4C1FA 3ZWFA 4EXSA 3P2UA 1BMCA 4TZ9A 5IQKA 2HB9A 5LCAA 5HIOA 3BC2A 3ADRA 2BMIA 4YSBA 3L6NA 2BFZA 3PY6A 4C1GA 4XUKA 1X8IA 3RKJA 3AF5A 2BG2A 4TZFA 5K4MA 5HH4A 2CBNA 4EXYA 4TYFA 1DD6A 5B1UA 3SFPA 1KR3A 3IDZA 4BP0A 4NQ5A 2YNVB 2XF4A 5K4KA 4J5FA 2P18A 3SRXA 4EFZA 2DKFA 2E7YA 2FU8A 5K4NA 2YZ3A 2VW8A 4EY2A 5A0VA 4AWYB 5ACSA 4H0DA 3T3OA 4ZO2A 2OHIA 5B15A 4D1VA 1JJTA 3IE2A 3IELA 2ZO4A 2WYMA 4NQ2A 2WHGA 2GKLA 4D1WA 4F6HA 1QH3A 4HL1A 4PVTA 3X2ZA 4C1EA 3KNRA 5LSCA 5AHRA 3DHAA 2AIOA 2BG7A 5FQAA 1VMEA 2QDSA 2P97A 4UWSB 5EV6A 2FU7A 4RL2A 3PG4A 4C1HA 3I11A 3IE1A 3QH8A 3X2YA 3F9OA 2ZWRA 4BZ3A 2BFZB 5HIQA 1KO3A 4C1CA 5LCHA 4RAMA 3T3NA 2P4ZA 5AXRA 4NQ6A 4FEKA 4Z67A 3VQZA 2M5DA 2Y87A 1YCFA 4ZNBA 4FR7A 3IOGA 2UYXA 2WYLA 3I0VA 3SPUA 2P1EA 4PVOA 5EWAA 4C09A 5HIPA 3FAIA 2QJSA 1P9EA 2BFLA 3ESHA 4KEQA 4B87A 3AJ3A 1QH5A 2ZZIA 3A4YA 2NZEA 4J5HA 3I14A 5LM6A 5A5ZA 3R2UA 1BC2A 1A8TA 3TP9A 2I7TA 4GYQA 3RKKA 3DHCA 2DOOA 1DXKA 4D1TA 1MQOA 4V0HA 3VPEA 4DIKA 5ACQA 1ZTCA 4RBSA 4UBQA 5ACTA 3ZNBA 5AXOA 5HISA 2GMNA 3X30A 4AX1B 3FCZA 2BG8A 3BK2A 5ACWA 1X8HA 1BVTA 4YSKA 3KNSA 4Z5ZA 4XWWA 4C1DA 1K07A 3S0ZA 3DHBA 1A7TA 3I13A 5EW0A 2R2DA 2BG6A 4XWTA 2I7XA 2NXAA 5ACPA 4DILA 4GYUA 2Y8BA 2YNTB 2BGAA 2QDTA 3JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHX B;  4D02 A;  5LLD A;  5EHT A;  1SML A;  3PY5 A;  4UAM A;  2FU6 A;  3AF6 A;  5LE1 A;  4UWO B;  4WD6 A;  1HLK A;  2I7V A;  5ACR A;  4ZEJ A;  3IOF A;  2M5C A;  4ZO3 A;  3BK1 A;  5EV8 A;  5FQB A;  1ZNB A;  2GFK A;  3I15 A;  2YNT A;  4Z7R A;  2FU9 A;  3H3E A;  2FHX A;  2BFK A;  2Q42 A;  2BIB A;  4EYL A;  4RAW A;  4EYB A;  3Q6V A;  3T9M A;  4F6Z A;  5LCF A;  2YCB A;  5EVK A;  2NYP A;  5KIK A;  2QED A;  2GFJ A;  1VJN A;  2GCU A;  2Y8A A;  4AWZ A;  2QIN A;  4TZE A;  2WRS A;  5B3R A;  2Q0J A;  4LE6 A;  4Z6X A;  2A7M A;  1XTO A;  3X2X A;  5ACU A;  3IEM A;  5EH9 A;  1WW1 A;  4FSB A;  1Y44 A;  4AX0 B;  5EVD A;  1KO2 A;  5AYA A;  4EYF A;  1DDK A;  5AHO A;  4JO0 A;  1YCG A;  4D1U A;  2BTN A;  3WXC A;  4O98 A;  2BG8 B;  5KIL A;  5LS3 A;  3SBL A;  3KL7 A;  5AEB A;  2YNW A;  1JJE A;  5DPX A;  5ACV A;  1M2X A;  1WUO A;  2Q0I A;  3DH8 A;  5HH6 A;  3MD7 A;  4RM5 A;  5A0T A;  4TZB A;  1X8G A;  4Z5Y A;  4UA4 A;  3G1P A;  4TYT A;  2Q9U A;  2FK6 A;  2BC2 A;  5A87 A;  2BR6 A;  1E5D A;  2ZNB A;  5HH5 A;  1WUP A;  2OHH A;  2OHJ A;  4NQ4 A;  2YNV A;  5LMC A;  3SW3 A;  3ZR9 A;  3IEK A;  5EVB A;  5FQC A;  3SD9 A;  1L9Y A;  2XR1 A;  1XM8 A;  1VGN A;  1WRA A;  3RPC A;  2YNU A;  4GCW A;  2H6A A;  3BV6 A;  2AZ4 A;  4UWP B;  3ZQ4 A;  4CHL A;  2FM6 A;  4U4L A;  5K0W A;  4RL0 A;  4KEP A;  4HKY A;  3LVZ A;  1ZKP A;  1JT1 A;  4AD9 A;  3IE0 A;  4YSL A;  4Z60 A;  5ACX A;  2NZF A;  1YCH A;  4P62 A;  4UWR B;  2WYM C;  4HL2 A;  4C1F A;  3ZWF A;  4EXS A;  3P2U A;  1BMC A;  4TZ9 A;  5IQK A;  2HB9 A;  5LCA A;  5HIO A;  3BC2 A;  3ADR A;  2BMI A;  4YSB A;  3L6N A;  2BFZ A;  3PY6 A;  4C1G A;  4XUK A;  1X8I A;  3RKJ A;  3AF5 A;  2BG2 A;  4TZF A;  5K4M A;  5HH4 A;  2CBN A;  4EXY A;  4TYF A;  1DD6 A;  5B1U A;  3SFP A;  1KR3 A;  3IDZ A;  4BP0 A;  4NQ5 A;  2YNV B;  2XF4 A;  5K4K A;  4J5F A;  2P18 A;  3SRX A;  4EFZ A;  2DKF A;  2E7Y A;  2FU8 A;  5K4N A;  2YZ3 A;  2VW8 A;  4EY2 A;  5A0V A;  4AWY B;  5ACS A;  4H0D A;  3T3O A;  4ZO2 A;  2OHI A;  5B15 A;  4D1V A;  1JJT A;  3IE2 A;  3IEL A;  2ZO4 A;  2WYM A;  4NQ2 A;  2WHG A;  2GKL A;  4D1W A;  4F6H A;  1QH3 A;  4HL1 A;  4PVT A;  3X2Z A;  4C1E A;  3KNR A;  5LSC A;  5AHR A;  3DHA A;  2AIO A;  2BG7 A;  5FQA A;  1VME A;  2QDS A;  2P97 A;  4UWS B;  5EV6 A;  2FU7 A;  4RL2 A;  3PG4 A;  4C1H A;  3I11 A;  3IE1 A;  3QH8 A;  3X2Y A;  3F9O A;  2ZWR A;  4BZ3 A;  2BFZ B;  5HIQ A;  1KO3 A;  4C1C A;  5LCH A;  4RAM A;  3T3N A;  2P4Z A;  5AXR A;  4NQ6 A;  4FEK A;  4Z67 A;  3VQZ A;  2M5D A;  2Y87 A;  1YCF A;  4ZNB A;  4FR7 A;  3IOG A;  2UYX A;  2WYL A;  3I0V A;  3SPU A;  2P1E A;  4PVO A;  5EWA A;  4C09 A;  5HIP A;  3FAI A;  2QJS A;  1P9E A;  2BFL A;  3ESH A;  4KEQ A;  4B87 A;  3AJ3 A;  1QH5 A;  2ZZI A;  3A4Y A;  2NZE A;  4J5H A;  3I14 A;  5LM6 A;  5A5Z A;  3R2U A;  1BC2 A;  1A8T A;  3TP9 A;  2I7T A;  4GYQ A;  3RKK A;  3DHC A;  2DOO A;  1DXK A;  4D1T A;  1MQO A;  4V0H A;  3VPE A;  4DIK A;  5ACQ A;  1ZTC A;  4RBS A;  4UBQ A;  5ACT A;  3ZNB A;  5AXO A;  5HIS A;  2GMN A;  3X30 A;  4AX1 B;  3FCZ A;  2BG8 A;  3BK2 A;  5ACW A;  1X8H A;  1BVT A;  4YSK A;  3KNS A;  4Z5Z A;  4XWW A;  4C1D A;  1K07 A;  3S0Z A;  3DHB A;  1A7T A;  3I13 A;  5EW0 A;  2R2D A;  2BG6 A;  4XWT A;  2I7X A;  2NXA A;  5ACP A;  4DIL A;  4GYU A;  2Y8B A;  2YNT B;  2BGA A;  2QDT A;  3JXP A; 
#chains in the Genus database with same CATH topology
 2FHX B;  4D02 A;  5LLD A;  5EHT A;  1SML A;  3PY5 A;  4UAM A;  2FU6 A;  3AF6 A;  5LE1 A;  4UWO B;  4WD6 A;  1HLK A;  2I7V A;  5ACR A;  4ZEJ A;  3IOF A;  2M5C A;  4ZO3 A;  3BK1 A;  5EV8 A;  5FQB A;  1ZNB A;  2GFK A;  3I15 A;  2YNT A;  4Z7R A;  2FU9 A;  3H3E A;  2FHX A;  2BFK A;  2Q42 A;  2BIB A;  4EYL A;  4RAW A;  4EYB A;  3Q6V A;  3T9M A;  4F6Z A;  5LCF A;  2YCB A;  5EVK A;  2NYP A;  2CG2 A;  5KIK A;  5AIJ A;  2QED A;  2GFJ A;  1VJN A;  2GCU A;  2Y8A A;  4AWZ A;  2QIN A;  4TZE A;  2WRS A;  5B3R A;  2Q0J A;  4LE6 A;  4Z6X A;  2A7M A;  1XTO A;  3X2X A;  5ACU A;  3IEM A;  5EH9 A;  1WW1 A;  4FSB A;  1Y44 A;  4AX0 B;  5EVD A;  1KO2 A;  5AYA A;  1DDK A;  5AHO A;  4EYF A;  4JO0 A;  1YCG A;  4D1U A;  2BTN A;  3WXC A;  4O98 A;  2BG8 B;  5KIL A;  5LS3 A;  3SBL A;  3KL7 A;  5AEB A;  2YNW A;  1JJE A;  5DPX A;  5ACV A;  4AV7 A;  1M2X A;  1WUO A;  2Q0I A;  3DH8 A;  5HH6 A;  2CFU A;  3MD7 A;  4RM5 A;  5A0T A;  4TZB A;  1X8G A;  4Z5Y A;  4UA4 A;  3G1P A;  4TYT A;  2Q9U A;  2FK6 A;  2BC2 A;  5A87 A;  2BR6 A;  1E5D A;  2ZNB A;  5HH5 A;  1WUP A;  2OHH A;  2OHJ A;  4NQ4 A;  2YNV A;  5LMC A;  3SW3 A;  3ZR9 A;  3IEK A;  5EVB A;  5FQC A;  4PDX A;  3SD9 A;  1L9Y A;  2XR1 A;  1XM8 A;  1VGN A;  1WRA A;  3RPC A;  2YNU A;  4GCW A;  2H6A A;  3BV6 A;  2AZ4 A;  4UWP B;  3ZQ4 A;  4CHL A;  2FM6 A;  4U4L A;  5K0W A;  4RL0 A;  4KEP A;  4HKY A;  3LVZ A;  1ZKP A;  1JT1 A;  4AD9 A;  3IE0 A;  4YSL A;  4Z60 A;  5ACX A;  2NZF A;  1YCH A;  4P62 A;  4UWR B;  2WYM C;  4HL2 A;  2CFZ A;  4C1F A;  3ZWF A;  4EXS A;  3P2U A;  1BMC A;  4TZ9 A;  5IQK A;  2HB9 A;  5LCA A;  5HIO A;  3BC2 A;  3ADR A;  2BMI A;  4YSB A;  3L6N A;  2BFZ A;  3PY6 A;  4C1G A;  4XUK A;  1X8I A;  3RKJ A;  3AF5 A;  2BG2 A;  2YHE A;  4TZF A;  5K4M A;  5HH4 A;  2CBN A;  4EXY A;  4TYF A;  1DD6 A;  5B1U A;  3SFP A;  1KR3 A;  3IDZ A;  4BP0 A;  5AJL A;  4NQ5 A;  2YNV B;  2XF4 A;  5A23 A;  5K4K A;  4J5F A;  2P18 A;  3SRX A;  4EFZ A;  2DKF A;  2E7Y A;  2FU8 A;  5K4N A;  2YZ3 A;  2VW8 A;  4EY2 A;  5A0V A;  4AWY B;  5ACS A;  4H0D A;  3T3O A;  4ZO2 A;  2OHI A;  5B15 A;  4D1V A;  1JJT A;  3IE2 A;  3IEL A;  2ZO4 A;  2WYM A;  4NQ2 A;  2WHG A;  2GKL A;  4D1W A;  4F6H A;  1QH3 A;  4HL1 A;  4PVT A;  3X2Z A;  4C1E A;  3KNR A;  5LSC A;  5AHR A;  3DHA A;  2AIO A;  2BG7 A;  5FQA A;  1VME A;  2QDS A;  2P97 A;  4UWS B;  5EV6 A;  2FU7 A;  4RL2 A;  4AXH A;  3PG4 A;  4C1H A;  3I11 A;  3IE1 A;  3QH8 A;  3X2Y A;  3F9O A;  2ZWR A;  4BZ3 A;  2BFZ B;  5HIQ A;  1KO3 A;  4C1C A;  5LCH A;  4RAM A;  3T3N A;  2P4Z A;  5AXR A;  4NQ6 A;  4FEK A;  4Z67 A;  3VQZ A;  2M5D A;  2Y87 A;  1YCF A;  4ZNB A;  4FR7 A;  3IOG A;  2UYX A;  2WYL A;  3I0V A;  3SPU A;  2P1E A;  4PVO A;  5EWA A;  4C09 A;  5HIP A;  3FAI A;  2QJS A;  1P9E A;  2BFL A;  3ESH A;  4KEQ A;  4B87 A;  3AJ3 A;  1QH5 A;  2ZZI A;  3A4Y A;  2NZE A;  4J5H A;  4NUR A;  3I14 A;  5LM6 A;  5A5Z A;  3R2U A;  1BC2 A;  1A8T A;  3TP9 A;  2I7T A;  4GYQ A;  3RKK A;  3DHC A;  2DOO A;  1DXK A;  4D1T A;  1MQO A;  4V0H A;  3VPE A;  4DIK A;  5ACQ A;  1ZTC A;  4RBS A;  4UBQ A;  5ACT A;  3ZNB A;  2CG3 A;  5AXO A;  5HIS A;  2GMN A;  3X30 A;  4AX1 B;  3FCZ A;  2BG8 A;  3BK2 A;  5ACW A;  1X8H A;  1BVT A;  4YSK A;  3KNS A;  4Z5Z A;  4XWW A;  4C1D A;  1K07 A;  3S0Z A;  3DHB A;  1A7T A;  3I13 A;  5EW0 A;  2R2D A;  2BG6 A;  4XWT A;  2I7X A;  2NXA A;  5ACP A;  4DIL A;  4GYU A;  2Y8B A;  2YNT B;  2BGA A;  2QDT A;  3JXP A; 
#chains in the Genus database with same CATH homology
 2FHX B;  4D02 A;  5LLD A;  5EHT A;  1SML A;  3PY5 A;  4UAM A;  2FU6 A;  3AF6 A;  5LE1 A;  4UWO B;  4WD6 A;  1HLK A;  2I7V A;  5ACR A;  4ZEJ A;  3IOF A;  2M5C A;  4ZO3 A;  3BK1 A;  5EV8 A;  5FQB A;  1ZNB A;  2GFK A;  3I15 A;  2YNT A;  4Z7R A;  2FU9 A;  3H3E A;  2FHX A;  2BFK A;  2Q42 A;  2BIB A;  4EYL A;  4RAW A;  4EYB A;  3Q6V A;  3T9M A;  4F6Z A;  5LCF A;  2YCB A;  5EVK A;  2NYP A;  5KIK A;  2QED A;  2GFJ A;  1VJN A;  2GCU A;  2Y8A A;  4AWZ A;  2QIN A;  4TZE A;  2WRS A;  5B3R A;  2Q0J A;  4LE6 A;  4Z6X A;  2A7M A;  1XTO A;  3X2X A;  5ACU A;  3IEM A;  5EH9 A;  1WW1 A;  4FSB A;  1Y44 A;  4AX0 B;  5EVD A;  1KO2 A;  5AYA A;  4EYF A;  1DDK A;  5AHO A;  4JO0 A;  1YCG A;  4D1U A;  2BTN A;  3WXC A;  4O98 A;  2BG8 B;  5KIL A;  5LS3 A;  3SBL A;  3KL7 A;  5AEB A;  2YNW A;  1JJE A;  5DPX A;  5ACV A;  1M2X A;  1WUO A;  2Q0I A;  3DH8 A;  5HH6 A;  3MD7 A;  4RM5 A;  5A0T A;  4TZB A;  1X8G A;  4Z5Y A;  4UA4 A;  3G1P A;  4TYT A;  2Q9U A;  2FK6 A;  2BC2 A;  5A87 A;  2BR6 A;  1E5D A;  2ZNB A;  5HH5 A;  1WUP A;  2OHH A;  2OHJ A;  4NQ4 A;  2YNV A;  5LMC A;  3SW3 A;  3ZR9 A;  3IEK A;  5EVB A;  5FQC A;  3SD9 A;  1L9Y A;  2XR1 A;  1XM8 A;  1VGN A;  1WRA A;  3RPC A;  2YNU A;  4GCW A;  2H6A A;  3BV6 A;  2AZ4 A;  4UWP B;  3ZQ4 A;  4CHL A;  2FM6 A;  4U4L A;  5K0W A;  4RL0 A;  4KEP A;  4HKY A;  3LVZ A;  1ZKP A;  1JT1 A;  4AD9 A;  3IE0 A;  4YSL A;  4Z60 A;  5ACX A;  2NZF A;  1YCH A;  4P62 A;  4UWR B;  2WYM C;  4HL2 A;  4C1F A;  3ZWF A;  4EXS A;  3P2U A;  1BMC A;  4TZ9 A;  5IQK A;  2HB9 A;  5LCA A;  5HIO A;  3BC2 A;  3ADR A;  2BMI A;  4YSB A;  3L6N A;  2BFZ A;  3PY6 A;  4C1G A;  4XUK A;  1X8I A;  3RKJ A;  3AF5 A;  2BG2 A;  4TZF A;  5K4M A;  5HH4 A;  2CBN A;  4EXY A;  4TYF A;  1DD6 A;  5B1U A;  3SFP A;  1KR3 A;  3IDZ A;  4BP0 A;  4NQ5 A;  2YNV B;  2XF4 A;  5K4K A;  4J5F A;  2P18 A;  3SRX A;  4EFZ A;  2DKF A;  2E7Y A;  2FU8 A;  5K4N A;  2YZ3 A;  2VW8 A;  4EY2 A;  5A0V A;  4AWY B;  5ACS A;  4H0D A;  3T3O A;  4ZO2 A;  2OHI A;  5B15 A;  4D1V A;  1JJT A;  3IE2 A;  3IEL A;  2ZO4 A;  2WYM A;  4NQ2 A;  2WHG A;  2GKL A;  4D1W A;  4F6H A;  1QH3 A;  4HL1 A;  4PVT A;  3X2Z A;  4C1E A;  3KNR A;  5LSC A;  5AHR A;  3DHA A;  2AIO A;  2BG7 A;  5FQA A;  1VME A;  2QDS A;  2P97 A;  4UWS B;  5EV6 A;  2FU7 A;  4RL2 A;  3PG4 A;  4C1H A;  3I11 A;  3IE1 A;  3QH8 A;  3X2Y A;  3F9O A;  2ZWR A;  4BZ3 A;  2BFZ B;  5HIQ A;  1KO3 A;  4C1C A;  5LCH A;  4RAM A;  3T3N A;  2P4Z A;  5AXR A;  4NQ6 A;  4FEK A;  4Z67 A;  3VQZ A;  2M5D A;  2Y87 A;  1YCF A;  4ZNB A;  4FR7 A;  3IOG A;  2UYX A;  2WYL A;  3I0V A;  3SPU A;  2P1E A;  4PVO A;  5EWA A;  4C09 A;  5HIP A;  3FAI A;  2QJS A;  1P9E A;  2BFL A;  3ESH A;  4KEQ A;  4B87 A;  3AJ3 A;  1QH5 A;  2ZZI A;  3A4Y A;  2NZE A;  4J5H A;  3I14 A;  5LM6 A;  5A5Z A;  3R2U A;  1BC2 A;  1A8T A;  3TP9 A;  2I7T A;  4GYQ A;  3RKK A;  3DHC A;  2DOO A;  1DXK A;  4D1T A;  1MQO A;  4V0H A;  3VPE A;  4DIK A;  5ACQ A;  1ZTC A;  4RBS A;  4UBQ A;  5ACT A;  3ZNB A;  5AXO A;  5HIS A;  2GMN A;  3X30 A;  4AX1 B;  3FCZ A;  2BG8 A;  3BK2 A;  5ACW A;  1X8H A;  1BVT A;  4YSK A;  3KNS A;  4Z5Z A;  4XWW A;  4C1D A;  1K07 A;  3S0Z A;  3DHB A;  1A7T A;  3I13 A;  5EW0 A;  2R2D A;  2BG6 A;  4XWT A;  2I7X A;  2NXA A;  5ACP A;  4DIL A;  4GYU A;  2Y8B A;  2YNT B;  2BGA A;  2QDT A;  3JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...