3DHBA

1.4 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at the catalytic metal center
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
molecule keywords N-Acyl Homoserine Lactone Hydrolase
total genus 81
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhbA01
4BZ3A 1JJEA 4AX1B 2P97A 2P4ZA 5LLDA 5ACRA 2BFLA 3PY5A 3RKJA 3VQZA 5HH6A 4CHLA 1ZKPA 4YSKA 5ACSA 5A87A 2AIOA 5LMCA 3ZWFA 3T9MA 4V0HA 1A8TA 3JXPA 4UWOB 3I15A 4EXYA 2BC2A 4KEQA 5EW0A 5ACTA 4UWRB 4RBSA 2DKFA 5K4NA 5KIKA 5LSCA 4TYTA 1BC2A 4ZO3A 3G1PA 2Q0JA 3DHBA 2YNVB 5AXOA 3VPEA 2GMNA 4ZO2A 3TP9A 4UAMA 1SMLA 3SW3A 1JJTA 5FQAA 4D1TA 4EY2A 5B15A 2FHXA 5DPXA 5ACVA 2BTNA 4ZEJA 3DHAA 5A0VA 3BV6A 3IE2A 2FU7A 2BIBA 1X8HA 2XF4A 4XWTA 5K4MA 4UWPB 2E7YA 4RM5A 5EVBA 3PG4A 4HL1A 2M5CA 4YSBA 4EYFA 5EVDA 4AWZA 1MQOA 1ZNBA 3KNSA 1L9YA 4EFZA 2FU6A 2H6AA 5EV6A 2ZNBA 3IOGA 1JT1A 4RAWA 1E5DA 5LS3A 3DH8A 2OHJA 1BVTA 5LCHA 2WYMC 2AZ4A 4LE6A 5FQBA 2VW8A 3F9OA 2GCUA 1BMCA 2CBNA 2BFKA 1K07A 4WD6A 5HH5A 2YNTA 3AF6A 4GYUA 5K0WA 1WW1A 4XWWA 1KO2A 2BG6A 2Q0IA 2ZZIA 4Z5YA 3RPCA 2A7MA 5LCAA 2DOOA 3DHCA 2OHHA 2YNTB 5IQKA 3X2XA 2ZWRA 5HH4A 4F6ZA 5AHOA 4O98A 3X2ZA 3T3OA 2YZ3A 4RL0A 3X30A 4C1GA 2QDSA 3P2UA 5A0TA 2FM6A 5AXRA 2ZO4A 4C1DA 5HIQA 1WUOA 3IEKA 2YCBA 4D1UA 3ZNBA 4EXSA 2WYMA 5KILA 1WUPA 1VMEA 4DILA 2WHGA 4D1VA 4NQ5A 2FK6A 1ZTCA 4J5FA 2FU9A 2UYXA 4TZBA 3R2UA 3I14A 2NZFA 3BK2A 1X8IA 2QINA 4FEKA 1DXKA 3RKKA 1YCHA 4HL2A 2BFZB 4Z6XA 4U4LA 1YCFA 2YNVA 5ACWA 2BMIA 2WYLA 1XM8A 5K4KA 2HB9A 3AJ3A 4ZNBA 3T3NA 2NYPA 3IE1A 3L6NA 1A7TA 3ZR9A 1QH3A 4C09A 3ESHA 4Z67A 4RAMA 4HKYA 3IEMA 4TZFA 4FR7A 2BGAA 3SBLA 5EH9A 5EVKA 1HLKA 4Z5ZA 3LVZA 4PVTA 4D02A 2I7TA 4Z7RA 3I0VA 4UA4A 5A5ZA 5AYAA 4C1EA 3SPUA 3AF5A 5AHRA 1KO3A 3IE0A 3H3EA 4NQ2A 2Y87A 4D1WA 2Y8AA 4XUKA 3ADRA 4NQ4A 5EWAA 2BG8B 4UBQA 2QJSA 5LM6A 2BG2A 4GCWA 2GFKA 5HIOA 4UWSB 1KR3A 5AEBA 2YNUA 5ACPA 3BK1A 1VGNA 3I11A 4H0DA 3ZQ4A 1DD6A 2FU8A 5EHTA 4J5HA 3IDZA 2BG8A 4PVOA 3SRXA 1DDKA 2XR1A 4TYFA 4JO0A 4AD9A 4C1CA 1Y44A 5ACUA 3SFPA 2Q42A 3FAIA 5ACQA 4NQ6A 5B1UA 2Q9UA 5HIPA 4GYQA 3MD7A 4YSLA 2GKLA 4BP0A 3QH8A 4B87A 2QDTA 3Q6VA 1XTOA 2Y8BA 3PY6A 1M2XA 3IELA 2R2DA 4Z60A 2QEDA 4DIKA 4TZEA 3IOFA 2BG7A 4RL2A 2P18A 4AWYB 1WRAA 4P62A 1QH5A 2NZEA 5B3RA 3FCZA 2YNWA 4FSBA 1VJNA 3WXCA 2P1EA 2I7XA 2GFJA 5FQCA 4C1FA 4KEPA 2WRSA 4F6HA 5EV8A 1X8GA 3S0ZA 2BFZA 5LCFA 3KNRA 2I7VA 3BC2A 2OHIA 4C1HA 2FHXB 5HISA 4AX0B 1P9EA 3A4YA 3X2YA 2M5DA 1YCGA 3SD9A 5LE1A 4EYLA 3KL7A 4EYBA 2BR6A 4TZ9A 5ACXA 3I13A 2NXAA
chains in the Genus database with same CATH superfamily
4BZ3A 1JJEA 4AX1B 2P97A 2CG2A 2P4ZA 5LLDA 5ACRA 2BFLA 3PY5A 3RKJA 3VQZA 5HH6A 4CHLA 1ZKPA 4YSKA 5ACSA 5A87A 2AIOA 5LMCA 3ZWFA 3T9MA 4V0HA 1A8TA 3JXPA 4UWOB 3I15A 4EXYA 2BC2A 4KEQA 5EW0A 5ACTA 4UWRB 4RBSA 2DKFA 5K4NA 5KIKA 5LSCA 4TYTA 1BC2A 4ZO3A 3G1PA 2Q0JA 3DHBA 2YNVB 5AXOA 3VPEA 2GMNA 4ZO2A 3TP9A 4UAMA 1SMLA 3SW3A 1JJTA 5FQAA 2CFZA 4D1TA 5AIJA 4EY2A 5B15A 2FHXA 5DPXA 5ACVA 2BTNA 4ZEJA 3DHAA 5A0VA 3BV6A 3IE2A 2FU7A 2BIBA 1X8HA 2XF4A 4XWTA 5K4MA 4UWPB 2E7YA 4RM5A 5EVBA 3PG4A 4HL1A 2M5CA 4YSBA 4EYFA 5EVDA 4AWZA 1MQOA 1ZNBA 3KNSA 1L9YA 4EFZA 2FU6A 2H6AA 5EV6A 2ZNBA 3IOGA 1JT1A 4RAWA 1E5DA 5LS3A 3DH8A 2OHJA 1BVTA 5LCHA 2WYMC 2AZ4A 4LE6A 5FQBA 2VW8A 3F9OA 2GCUA 1BMCA 2CBNA 2BFKA 1K07A 4WD6A 5HH5A 2YNTA 3AF6A 4GYUA 5K0WA 1WW1A 4XWWA 1KO2A 2BG6A 2Q0IA 2ZZIA 4Z5YA 3RPCA 2A7MA 5LCAA 2DOOA 3DHCA 2OHHA 2YNTB 5IQKA 3X2XA 2ZWRA 5HH4A 4F6ZA 2CFUA 5AHOA 4O98A 3X2ZA 3T3OA 2YZ3A 4RL0A 3X30A 4C1GA 2QDSA 3P2UA 5A0TA 2FM6A 5AXRA 2ZO4A 4C1DA 5HIQA 1WUOA 3IEKA 2YCBA 4D1UA 3ZNBA 4EXSA 2WYMA 5KILA 1WUPA 1VMEA 4DILA 2WHGA 4D1VA 4NQ5A 2FK6A 4NURA 1ZTCA 4J5FA 2FU9A 2UYXA 4TZBA 4AV7A 3R2UA 3I14A 2NZFA 3BK2A 1X8IA 2QINA 4FEKA 1DXKA 3RKKA 1YCHA 4HL2A 2BFZB 4Z6XA 4AXHA 4U4LA 1YCFA 2YNVA 5ACWA 2BMIA 2WYLA 1XM8A 5K4KA 2HB9A 3AJ3A 4ZNBA 3T3NA 2NYPA 3IE1A 3L6NA 1A7TA 3ZR9A 1QH3A 4C09A 3ESHA 4Z67A 4RAMA 4HKYA 3IEMA 4TZFA 4FR7A 2BGAA 3SBLA 5EH9A 5EVKA 1HLKA 4Z5ZA 3LVZA 4PVTA 4D02A 2I7TA 4Z7RA 3I0VA 4UA4A 5A5ZA 5AYAA 4C1EA 3SPUA 3AF5A 5AHRA 1KO3A 3IE0A 3H3EA 4NQ2A 2Y87A 4D1WA 2Y8AA 4XUKA 3ADRA 4NQ4A 5EWAA 2BG8B 4UBQA 2QJSA 5LM6A 2BG2A 4GCWA 2GFKA 5HIOA 4UWSB 1KR3A 5AEBA 2YNUA 2YHEA 5ACPA 3BK1A 1VGNA 3I11A 4H0DA 3ZQ4A 1DD6A 2FU8A 5EHTA 4J5HA 3IDZA 2BG8A 4PVOA 5AJLA 3SRXA 1DDKA 2XR1A 4TYFA 4JO0A 4AD9A 4C1CA 1Y44A 5ACUA 3SFPA 2Q42A 3FAIA 5ACQA 4NQ6A 5B1UA 2Q9UA 5HIPA 4GYQA 3MD7A 4YSLA 2GKLA 4BP0A 3QH8A 4B87A 2QDTA 3Q6VA 1XTOA 2Y8BA 5A23A 3PY6A 1M2XA 3IELA 2R2DA 4Z60A 2QEDA 4DIKA 4TZEA 3IOFA 2BG7A 4RL2A 2P18A 4AWYB 1WRAA 4P62A 1QH5A 2NZEA 5B3RA 4PDXA 3FCZA 2YNWA 4FSBA 1VJNA 3WXCA 2P1EA 2CG3A 2I7XA 2GFJA 5FQCA 4C1FA 4KEPA 2WRSA 4F6HA 5EV8A 1X8GA 3S0ZA 2BFZA 5LCFA 3KNRA 2I7VA 3BC2A 2OHIA 4C1HA 2FHXB 5HISA 4AX0B 1P9EA 3A4YA 3X2YA 2M5DA 1YCGA 3SD9A 5LE1A 4EYLA 3KL7A 4EYBA 2BR6A 4TZ9A 5ACXA 3I13A 2NXAA
chains in the Genus database with same CATH topology
4BZ3A 1JJEA 4AX1B 2P97A 2P4ZA 5LLDA 5ACRA 2BFLA 3PY5A 3RKJA 3VQZA 5HH6A 4CHLA 1ZKPA 4YSKA 5ACSA 5A87A 2AIOA 5LMCA 3ZWFA 3T9MA 4V0HA 1A8TA 3JXPA 4UWOB 3I15A 4EXYA 2BC2A 4KEQA 5EW0A 5ACTA 4UWRB 4RBSA 2DKFA 5K4NA 5KIKA 5LSCA 4TYTA 1BC2A 4ZO3A 3G1PA 2Q0JA 3DHBA 2YNVB 5AXOA 3VPEA 2GMNA 4ZO2A 3TP9A 4UAMA 1SMLA 3SW3A 1JJTA 5FQAA 4D1TA 4EY2A 5B15A 2FHXA 5DPXA 5ACVA 2BTNA 4ZEJA 3DHAA 5A0VA 3BV6A 3IE2A 2FU7A 2BIBA 1X8HA 2XF4A 4XWTA 5K4MA 4UWPB 2E7YA 4RM5A 5EVBA 3PG4A 4HL1A 2M5CA 4YSBA 4EYFA 5EVDA 4AWZA 1MQOA 1ZNBA 3KNSA 1L9YA 4EFZA 2FU6A 2H6AA 5EV6A 2ZNBA 3IOGA 1JT1A 4RAWA 1E5DA 5LS3A 3DH8A 2OHJA 1BVTA 5LCHA 2WYMC 2AZ4A 4LE6A 5FQBA 2VW8A 3F9OA 2GCUA 1BMCA 2CBNA 2BFKA 1K07A 4WD6A 5HH5A 2YNTA 3AF6A 4GYUA 5K0WA 1WW1A 4XWWA 1KO2A 2BG6A 2Q0IA 2ZZIA 4Z5YA 3RPCA 2A7MA 5LCAA 2DOOA 3DHCA 2OHHA 2YNTB 5IQKA 3X2XA 2ZWRA 5HH4A 4F6ZA 5AHOA 4O98A 3X2ZA 3T3OA 2YZ3A 4RL0A 3X30A 4C1GA 2QDSA 3P2UA 5A0TA 2FM6A 5AXRA 2ZO4A 4C1DA 5HIQA 1WUOA 3IEKA 2YCBA 4D1UA 3ZNBA 4EXSA 2WYMA 5KILA 1WUPA 1VMEA 4DILA 2WHGA 4D1VA 4NQ5A 2FK6A 1ZTCA 4J5FA 2FU9A 2UYXA 4TZBA 3R2UA 3I14A 2NZFA 3BK2A 1X8IA 2QINA 4FEKA 1DXKA 3RKKA 1YCHA 4HL2A 2BFZB 4Z6XA 4U4LA 1YCFA 2YNVA 5ACWA 2BMIA 2WYLA 1XM8A 5K4KA 2HB9A 3AJ3A 4ZNBA 3T3NA 2NYPA 3IE1A 3L6NA 1A7TA 3ZR9A 1QH3A 4C09A 3ESHA 4Z67A 4RAMA 4HKYA 3IEMA 4TZFA 4FR7A 2BGAA 3SBLA 5EH9A 5EVKA 1HLKA 4Z5ZA 3LVZA 4PVTA 4D02A 2I7TA 4Z7RA 3I0VA 4UA4A 5A5ZA 5AYAA 4C1EA 3SPUA 3AF5A 5AHRA 1KO3A 3IE0A 3H3EA 4NQ2A 2Y87A 4D1WA 2Y8AA 4XUKA 3ADRA 4NQ4A 5EWAA 2BG8B 4UBQA 2QJSA 5LM6A 2BG2A 4GCWA 2GFKA 5HIOA 4UWSB 1KR3A 5AEBA 2YNUA 5ACPA 3BK1A 1VGNA 3I11A 4H0DA 3ZQ4A 1DD6A 2FU8A 5EHTA 4J5HA 3IDZA 2BG8A 4PVOA 3SRXA 1DDKA 2XR1A 4TYFA 4JO0A 4AD9A 4C1CA 1Y44A 5ACUA 3SFPA 2Q42A 3FAIA 5ACQA 4NQ6A 5B1UA 2Q9UA 5HIPA 4GYQA 3MD7A 4YSLA 2GKLA 4BP0A 3QH8A 4B87A 2QDTA 3Q6VA 1XTOA 2Y8BA 3PY6A 1M2XA 3IELA 2R2DA 4Z60A 2QEDA 4DIKA 4TZEA 3IOFA 2BG7A 4RL2A 2P18A 4AWYB 1WRAA 4P62A 1QH5A 2NZEA 5B3RA 3FCZA 2YNWA 4FSBA 1VJNA 3WXCA 2P1EA 2I7XA 2GFJA 5FQCA 4C1FA 4KEPA 2WRSA 4F6HA 5EV8A 1X8GA 3S0ZA 2BFZA 5LCFA 3KNRA 2I7VA 3BC2A 2OHIA 4C1HA 2FHXB 5HISA 4AX0B 1P9EA 3A4YA 3X2YA 2M5DA 1YCGA 3SD9A 5LE1A 4EYLA 3KL7A 4EYBA 2BR6A 4TZ9A 5ACXA 3I13A 2NXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BZ3 A;  1JJE A;  4AX1 B;  2P97 A;  2P4Z A;  5LLD A;  5ACR A;  2BFL A;  3PY5 A;  3RKJ A;  3VQZ A;  5HH6 A;  4CHL A;  1ZKP A;  4YSK A;  5ACS A;  5A87 A;  2AIO A;  5LMC A;  3ZWF A;  3T9M A;  4V0H A;  1A8T A;  3JXP A;  4UWO B;  3I15 A;  4EXY A;  2BC2 A;  4KEQ A;  5EW0 A;  5ACT A;  4UWR B;  4RBS A;  2DKF A;  5K4N A;  5KIK A;  5LSC A;  4TYT A;  1BC2 A;  4ZO3 A;  3G1P A;  2Q0J A;  3DHB A;  2YNV B;  5AXO A;  3VPE A;  2GMN A;  4ZO2 A;  3TP9 A;  4UAM A;  1SML A;  3SW3 A;  1JJT A;  5FQA A;  4D1T A;  4EY2 A;  5B15 A;  2FHX A;  5DPX A;  5ACV A;  2BTN A;  4ZEJ A;  3DHA A;  5A0V A;  3BV6 A;  3IE2 A;  2FU7 A;  2BIB A;  1X8H A;  2XF4 A;  4XWT A;  5K4M A;  4UWP B;  2E7Y A;  4RM5 A;  5EVB A;  3PG4 A;  4HL1 A;  2M5C A;  4YSB A;  4EYF A;  5EVD A;  4AWZ A;  1MQO A;  1ZNB A;  3KNS A;  1L9Y A;  4EFZ A;  2FU6 A;  2H6A A;  5EV6 A;  2ZNB A;  3IOG A;  1JT1 A;  4RAW A;  1E5D A;  5LS3 A;  3DH8 A;  2OHJ A;  1BVT A;  5LCH A;  2WYM C;  2AZ4 A;  4LE6 A;  5FQB A;  2VW8 A;  3F9O A;  2GCU A;  1BMC A;  2CBN A;  2BFK A;  1K07 A;  4WD6 A;  5HH5 A;  2YNT A;  3AF6 A;  4GYU A;  5K0W A;  1WW1 A;  4XWW A;  1KO2 A;  2BG6 A;  2Q0I A;  2ZZI A;  4Z5Y A;  3RPC A;  2A7M A;  5LCA A;  2DOO A;  3DHC A;  2OHH A;  2YNT B;  5IQK A;  3X2X A;  2ZWR A;  5HH4 A;  4F6Z A;  5AHO A;  4O98 A;  3X2Z A;  3T3O A;  2YZ3 A;  4RL0 A;  3X30 A;  4C1G A;  2QDS A;  3P2U A;  5A0T A;  2FM6 A;  5AXR A;  2ZO4 A;  4C1D A;  5HIQ A;  1WUO A;  3IEK A;  2YCB A;  4D1U A;  3ZNB A;  4EXS A;  2WYM A;  5KIL A;  1WUP A;  1VME A;  4DIL A;  2WHG A;  4D1V A;  4NQ5 A;  2FK6 A;  1ZTC A;  4J5F A;  2FU9 A;  2UYX A;  4TZB A;  3R2U A;  3I14 A;  2NZF A;  3BK2 A;  1X8I A;  2QIN A;  4FEK A;  1DXK A;  3RKK A;  1YCH A;  4HL2 A;  2BFZ B;  4Z6X A;  4U4L A;  1YCF A;  2YNV A;  5ACW A;  2BMI A;  2WYL A;  1XM8 A;  5K4K A;  2HB9 A;  3AJ3 A;  4ZNB A;  3T3N A;  2NYP A;  3IE1 A;  3L6N A;  1A7T A;  3ZR9 A;  1QH3 A;  4C09 A;  3ESH A;  4Z67 A;  4RAM A;  4HKY A;  3IEM A;  4TZF A;  4FR7 A;  2BGA A;  3SBL A;  5EH9 A;  5EVK A;  1HLK A;  4Z5Z A;  3LVZ A;  4PVT A;  4D02 A;  2I7T A;  4Z7R A;  3I0V A;  4UA4 A;  5A5Z A;  5AYA A;  4C1E A;  3SPU A;  3AF5 A;  5AHR A;  1KO3 A;  3IE0 A;  3H3E A;  4NQ2 A;  2Y87 A;  4D1W A;  2Y8A A;  4XUK A;  3ADR A;  4NQ4 A;  5EWA A;  2BG8 B;  4UBQ A;  2QJS A;  5LM6 A;  2BG2 A;  4GCW A;  2GFK A;  5HIO A;  4UWS B;  1KR3 A;  5AEB A;  2YNU A;  5ACP A;  3BK1 A;  1VGN A;  3I11 A;  4H0D A;  3ZQ4 A;  1DD6 A;  2FU8 A;  5EHT A;  4J5H A;  3IDZ A;  2BG8 A;  4PVO A;  3SRX A;  1DDK A;  2XR1 A;  4TYF A;  4JO0 A;  4AD9 A;  4C1C A;  1Y44 A;  5ACU A;  3SFP A;  2Q42 A;  3FAI A;  5ACQ A;  4NQ6 A;  5B1U A;  2Q9U A;  5HIP A;  4GYQ A;  3MD7 A;  4YSL A;  2GKL A;  4BP0 A;  3QH8 A;  4B87 A;  2QDT A;  3Q6V A;  1XTO A;  2Y8B A;  3PY6 A;  1M2X A;  3IEL A;  2R2D A;  4Z60 A;  2QED A;  4DIK A;  4TZE A;  3IOF A;  2BG7 A;  4RL2 A;  2P18 A;  4AWY B;  1WRA A;  4P62 A;  1QH5 A;  2NZE A;  5B3R A;  3FCZ A;  2YNW A;  4FSB A;  1VJN A;  3WXC A;  2P1E A;  2I7X A;  2GFJ A;  5FQC A;  4C1F A;  4KEP A;  2WRS A;  4F6H A;  5EV8 A;  1X8G A;  3S0Z A;  2BFZ A;  5LCF A;  3KNR A;  2I7V A;  3BC2 A;  2OHI A;  4C1H A;  2FHX B;  5HIS A;  4AX0 B;  1P9E A;  3A4Y A;  3X2Y A;  2M5D A;  1YCG A;  3SD9 A;  5LE1 A;  4EYL A;  3KL7 A;  4EYB A;  2BR6 A;  4TZ9 A;  5ACX A;  3I13 A;  2NXA A; 
#chains in the Genus database with same CATH topology
 4BZ3 A;  1JJE A;  4AX1 B;  2P97 A;  2CG2 A;  2P4Z A;  5LLD A;  5ACR A;  2BFL A;  3PY5 A;  3RKJ A;  3VQZ A;  5HH6 A;  4CHL A;  1ZKP A;  4YSK A;  5ACS A;  5A87 A;  2AIO A;  5LMC A;  3ZWF A;  3T9M A;  4V0H A;  1A8T A;  3JXP A;  4UWO B;  3I15 A;  4EXY A;  2BC2 A;  4KEQ A;  5EW0 A;  5ACT A;  4UWR B;  4RBS A;  2DKF A;  5K4N A;  5KIK A;  5LSC A;  4TYT A;  1BC2 A;  4ZO3 A;  3G1P A;  2Q0J A;  3DHB A;  2YNV B;  5AXO A;  3VPE A;  2GMN A;  4ZO2 A;  3TP9 A;  4UAM A;  1SML A;  3SW3 A;  1JJT A;  5FQA A;  2CFZ A;  4D1T A;  5AIJ A;  4EY2 A;  5B15 A;  2FHX A;  5DPX A;  5ACV A;  2BTN A;  4ZEJ A;  3DHA A;  5A0V A;  3BV6 A;  3IE2 A;  2FU7 A;  2BIB A;  1X8H A;  2XF4 A;  4XWT A;  5K4M A;  4UWP B;  2E7Y A;  4RM5 A;  5EVB A;  3PG4 A;  4HL1 A;  2M5C A;  4YSB A;  4EYF A;  5EVD A;  4AWZ A;  1MQO A;  1ZNB A;  3KNS A;  1L9Y A;  4EFZ A;  2FU6 A;  2H6A A;  5EV6 A;  2ZNB A;  3IOG A;  1JT1 A;  4RAW A;  1E5D A;  5LS3 A;  3DH8 A;  2OHJ A;  1BVT A;  5LCH A;  2WYM C;  2AZ4 A;  4LE6 A;  5FQB A;  2VW8 A;  3F9O A;  2GCU A;  1BMC A;  2CBN A;  2BFK A;  1K07 A;  4WD6 A;  5HH5 A;  2YNT A;  3AF6 A;  4GYU A;  5K0W A;  1WW1 A;  4XWW A;  1KO2 A;  2BG6 A;  2Q0I A;  2ZZI A;  4Z5Y A;  3RPC A;  2A7M A;  5LCA A;  2DOO A;  3DHC A;  2OHH A;  2YNT B;  5IQK A;  3X2X A;  2ZWR A;  5HH4 A;  4F6Z A;  2CFU A;  5AHO A;  4O98 A;  3X2Z A;  3T3O A;  2YZ3 A;  4RL0 A;  3X30 A;  4C1G A;  2QDS A;  3P2U A;  5A0T A;  2FM6 A;  5AXR A;  2ZO4 A;  4C1D A;  5HIQ A;  1WUO A;  3IEK A;  2YCB A;  4D1U A;  3ZNB A;  4EXS A;  2WYM A;  5KIL A;  1WUP A;  1VME A;  4DIL A;  2WHG A;  4D1V A;  4NQ5 A;  2FK6 A;  4NUR A;  1ZTC A;  4J5F A;  2FU9 A;  2UYX A;  4TZB A;  4AV7 A;  3R2U A;  3I14 A;  2NZF A;  3BK2 A;  1X8I A;  2QIN A;  4FEK A;  1DXK A;  3RKK A;  1YCH A;  4HL2 A;  2BFZ B;  4Z6X A;  4AXH A;  4U4L A;  1YCF A;  2YNV A;  5ACW A;  2BMI A;  2WYL A;  1XM8 A;  5K4K A;  2HB9 A;  3AJ3 A;  4ZNB A;  3T3N A;  2NYP A;  3IE1 A;  3L6N A;  1A7T A;  3ZR9 A;  1QH3 A;  4C09 A;  3ESH A;  4Z67 A;  4RAM A;  4HKY A;  3IEM A;  4TZF A;  4FR7 A;  2BGA A;  3SBL A;  5EH9 A;  5EVK A;  1HLK A;  4Z5Z A;  3LVZ A;  4PVT A;  4D02 A;  2I7T A;  4Z7R A;  3I0V A;  4UA4 A;  5A5Z A;  5AYA A;  4C1E A;  3SPU A;  3AF5 A;  5AHR A;  1KO3 A;  3IE0 A;  3H3E A;  4NQ2 A;  2Y87 A;  4D1W A;  2Y8A A;  4XUK A;  3ADR A;  4NQ4 A;  5EWA A;  2BG8 B;  4UBQ A;  2QJS A;  5LM6 A;  2BG2 A;  4GCW A;  2GFK A;  5HIO A;  4UWS B;  1KR3 A;  5AEB A;  2YNU A;  2YHE A;  5ACP A;  3BK1 A;  1VGN A;  3I11 A;  4H0D A;  3ZQ4 A;  1DD6 A;  2FU8 A;  5EHT A;  4J5H A;  3IDZ A;  2BG8 A;  4PVO A;  5AJL A;  3SRX A;  1DDK A;  2XR1 A;  4TYF A;  4JO0 A;  4AD9 A;  4C1C A;  1Y44 A;  5ACU A;  3SFP A;  2Q42 A;  3FAI A;  5ACQ A;  4NQ6 A;  5B1U A;  2Q9U A;  5HIP A;  4GYQ A;  3MD7 A;  4YSL A;  2GKL A;  4BP0 A;  3QH8 A;  4B87 A;  2QDT A;  3Q6V A;  1XTO A;  2Y8B A;  5A23 A;  3PY6 A;  1M2X A;  3IEL A;  2R2D A;  4Z60 A;  2QED A;  4DIK A;  4TZE A;  3IOF A;  2BG7 A;  4RL2 A;  2P18 A;  4AWY B;  1WRA A;  4P62 A;  1QH5 A;  2NZE A;  5B3R A;  4PDX A;  3FCZ A;  2YNW A;  4FSB A;  1VJN A;  3WXC A;  2P1E A;  2CG3 A;  2I7X A;  2GFJ A;  5FQC A;  4C1F A;  4KEP A;  2WRS A;  4F6H A;  5EV8 A;  1X8G A;  3S0Z A;  2BFZ A;  5LCF A;  3KNR A;  2I7V A;  3BC2 A;  2OHI A;  4C1H A;  2FHX B;  5HIS A;  4AX0 B;  1P9E A;  3A4Y A;  3X2Y A;  2M5D A;  1YCG A;  3SD9 A;  5LE1 A;  4EYL A;  3KL7 A;  4EYB A;  2BR6 A;  4TZ9 A;  5ACX A;  3I13 A;  2NXA A; 
#chains in the Genus database with same CATH homology
 4BZ3 A;  1JJE A;  4AX1 B;  2P97 A;  2P4Z A;  5LLD A;  5ACR A;  2BFL A;  3PY5 A;  3RKJ A;  3VQZ A;  5HH6 A;  4CHL A;  1ZKP A;  4YSK A;  5ACS A;  5A87 A;  2AIO A;  5LMC A;  3ZWF A;  3T9M A;  4V0H A;  1A8T A;  3JXP A;  4UWO B;  3I15 A;  4EXY A;  2BC2 A;  4KEQ A;  5EW0 A;  5ACT A;  4UWR B;  4RBS A;  2DKF A;  5K4N A;  5KIK A;  5LSC A;  4TYT A;  1BC2 A;  4ZO3 A;  3G1P A;  2Q0J A;  3DHB A;  2YNV B;  5AXO A;  3VPE A;  2GMN A;  4ZO2 A;  3TP9 A;  4UAM A;  1SML A;  3SW3 A;  1JJT A;  5FQA A;  4D1T A;  4EY2 A;  5B15 A;  2FHX A;  5DPX A;  5ACV A;  2BTN A;  4ZEJ A;  3DHA A;  5A0V A;  3BV6 A;  3IE2 A;  2FU7 A;  2BIB A;  1X8H A;  2XF4 A;  4XWT A;  5K4M A;  4UWP B;  2E7Y A;  4RM5 A;  5EVB A;  3PG4 A;  4HL1 A;  2M5C A;  4YSB A;  4EYF A;  5EVD A;  4AWZ A;  1MQO A;  1ZNB A;  3KNS A;  1L9Y A;  4EFZ A;  2FU6 A;  2H6A A;  5EV6 A;  2ZNB A;  3IOG A;  1JT1 A;  4RAW A;  1E5D A;  5LS3 A;  3DH8 A;  2OHJ A;  1BVT A;  5LCH A;  2WYM C;  2AZ4 A;  4LE6 A;  5FQB A;  2VW8 A;  3F9O A;  2GCU A;  1BMC A;  2CBN A;  2BFK A;  1K07 A;  4WD6 A;  5HH5 A;  2YNT A;  3AF6 A;  4GYU A;  5K0W A;  1WW1 A;  4XWW A;  1KO2 A;  2BG6 A;  2Q0I A;  2ZZI A;  4Z5Y A;  3RPC A;  2A7M A;  5LCA A;  2DOO A;  3DHC A;  2OHH A;  2YNT B;  5IQK A;  3X2X A;  2ZWR A;  5HH4 A;  4F6Z A;  5AHO A;  4O98 A;  3X2Z A;  3T3O A;  2YZ3 A;  4RL0 A;  3X30 A;  4C1G A;  2QDS A;  3P2U A;  5A0T A;  2FM6 A;  5AXR A;  2ZO4 A;  4C1D A;  5HIQ A;  1WUO A;  3IEK A;  2YCB A;  4D1U A;  3ZNB A;  4EXS A;  2WYM A;  5KIL A;  1WUP A;  1VME A;  4DIL A;  2WHG A;  4D1V A;  4NQ5 A;  2FK6 A;  1ZTC A;  4J5F A;  2FU9 A;  2UYX A;  4TZB A;  3R2U A;  3I14 A;  2NZF A;  3BK2 A;  1X8I A;  2QIN A;  4FEK A;  1DXK A;  3RKK A;  1YCH A;  4HL2 A;  2BFZ B;  4Z6X A;  4U4L A;  1YCF A;  2YNV A;  5ACW A;  2BMI A;  2WYL A;  1XM8 A;  5K4K A;  2HB9 A;  3AJ3 A;  4ZNB A;  3T3N A;  2NYP A;  3IE1 A;  3L6N A;  1A7T A;  3ZR9 A;  1QH3 A;  4C09 A;  3ESH A;  4Z67 A;  4RAM A;  4HKY A;  3IEM A;  4TZF A;  4FR7 A;  2BGA A;  3SBL A;  5EH9 A;  5EVK A;  1HLK A;  4Z5Z A;  3LVZ A;  4PVT A;  4D02 A;  2I7T A;  4Z7R A;  3I0V A;  4UA4 A;  5A5Z A;  5AYA A;  4C1E A;  3SPU A;  3AF5 A;  5AHR A;  1KO3 A;  3IE0 A;  3H3E A;  4NQ2 A;  2Y87 A;  4D1W A;  2Y8A A;  4XUK A;  3ADR A;  4NQ4 A;  5EWA A;  2BG8 B;  4UBQ A;  2QJS A;  5LM6 A;  2BG2 A;  4GCW A;  2GFK A;  5HIO A;  4UWS B;  1KR3 A;  5AEB A;  2YNU A;  5ACP A;  3BK1 A;  1VGN A;  3I11 A;  4H0D A;  3ZQ4 A;  1DD6 A;  2FU8 A;  5EHT A;  4J5H A;  3IDZ A;  2BG8 A;  4PVO A;  3SRX A;  1DDK A;  2XR1 A;  4TYF A;  4JO0 A;  4AD9 A;  4C1C A;  1Y44 A;  5ACU A;  3SFP A;  2Q42 A;  3FAI A;  5ACQ A;  4NQ6 A;  5B1U A;  2Q9U A;  5HIP A;  4GYQ A;  3MD7 A;  4YSL A;  2GKL A;  4BP0 A;  3QH8 A;  4B87 A;  2QDT A;  3Q6V A;  1XTO A;  2Y8B A;  3PY6 A;  1M2X A;  3IEL A;  2R2D A;  4Z60 A;  2QED A;  4DIK A;  4TZE A;  3IOF A;  2BG7 A;  4RL2 A;  2P18 A;  4AWY B;  1WRA A;  4P62 A;  1QH5 A;  2NZE A;  5B3R A;  3FCZ A;  2YNW A;  4FSB A;  1VJN A;  3WXC A;  2P1E A;  2I7X A;  2GFJ A;  5FQC A;  4C1F A;  4KEP A;  2WRS A;  4F6H A;  5EV8 A;  1X8G A;  3S0Z A;  2BFZ A;  5LCF A;  3KNR A;  2I7V A;  3BC2 A;  2OHI A;  4C1H A;  2FHX B;  5HIS A;  4AX0 B;  1P9E A;  3A4Y A;  3X2Y A;  2M5D A;  1YCG A;  3SD9 A;  5LE1 A;  4EYL A;  3KL7 A;  4EYB A;  2BR6 A;  4TZ9 A;  5ACX A;  3I13 A;  2NXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...