3DHBA

1.4 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at the catalytic metal center
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acyl Homoserine Lactone Hydrolase
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
total genus 81
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhbA01
4TZEA 4Z5YA 4GCWA 2Q9UA 4UBQA 1X8HA 4NQ5A 5AEBA 4RL0A 3I14A 3BK2A 5EV8A 4YSLA 4C1DA 4B87A 2BFKA 2XF4A 5A87A 5LLDA 3AJ3A 5EVDA 4FSBA 4Z7RA 2BFZB 3KL7A 1DD6A 1XM8A 3SW3A 1WUPA 2WYMA 1A7TA 1BC2A 4D1TA 4NQ4A 4YSKA 5B1UA 4KEQA 5EW0A 5ACRA 3H3EA 3AF6A 1X8IA 3PY6A 5AXOA 4LE6A 1VGNA 1ZNBA 2BMIA 3BK1A 3DHCA 5ACQA 2QEDA 4BP0A 4RBSA 1KR3A 5ACVA 2Y8BA 1JJTA 3L6NA 3P2UA 3X2XA 2GKLA 2BIBA 2A7MA 4D02A 4EXYA 3X2ZA 4V0HA 2AZ4A 2WHGA 2M5DA 2BTNA 1ZKPA 3RKKA 2OHHA 4AD9A 4EFZA 2H6AA 2FM6A 2ZO4A 2I7XA 2BG8A 4UWPB 2NZFA 1YCHA 5A5ZA 2BG2A 4FR7A 3X30A 5A0VA 4C1CA 3IE2A 2P18A 4UA4A 3KNRA 4RM5A 1VJNA 1BMCA 2BFLA 3I0VA 2DKFA 3Q6VA 5EV6A 4JO0A 4Z5ZA 5FQCA 5LCFA 5KIKA 4TZFA 5B3RA 3ADRA 4HKYA 5LMCA 2ZWRA 2NYPA 4KEPA 2CBNA 4NQ2A 2BGAA 2YNVA 2YNTA 4GYQA 4D1VA 1DXKA 1K07A 2GFKA 5FQBA 5EVKA 2ZZIA 4H0DA 3ESHA 5AXRA 4J5HA 2I7TA 4DIKA 4EYLA 4Z67A 3ZNBA 5B15A 4AX0B 5HH5A 2BR6A 4D1WA 4EYFA 4XWWA 1KO3A 4HL1A 1SMLA 4UWSB 2YNWA 5ACUA 3KNSA 5LCHA 1E5DA 4TYFA 2I7VA 3SD9A 4YSBA 3X2YA 4PVOA 3IELA 3VQZA 3JXPA 2YNUA 2FU7A 3FCZA 5HIQA 2P4ZA 2FHXB 2Q0IA 3DHBA 2WYMC 3BV6A 5HH4A 5K4KA 4C09A 4TYTA 3I11A 3I13A 5AHRA 2BFZA 3T3NA 2GCUA 2M5CA 1WW1A 1VMEA 2AIOA 5EVBA 3F9OA 1QH3A 4CHLA 4F6HA 2ZNBA 4Z60A 4FEKA 3T9MA 5AHOA 4RL2A 1M2XA 3AF5A 4UWOB 5LSCA 4NQ6A 1YCFA 1YCGA 3ZR9A 2P1EA 3ZWFA 4O98A 4UAMA 3IEKA 4ZEJA 1A8TA 5HIPA 2P97A 1MQOA 1X8GA 1JT1A 2QDTA 2DOOA 2FU9A 2BG7A 2E7YA 5K4MA 3A4YA 3WXCA 2QINA 5K0WA 2XR1A 4ZNBA 5ACPA 2GFJA 5AYAA 3BC2A 4EXSA 4J5FA 4AX1B 2R2DA 1WRAA 4Z6XA 5LE1A 5ACXA 2FU8A 4DILA 5IQKA 1BVTA 4XWTA 4P62A 3IDZA 2HB9A 2YCBA 1DDKA 3DH8A 5FQAA 4HL2A 3FAIA 3I15A 3TP9A 1WUOA 4RAWA 3G1PA 2NXAA 2YZ3A 2OHIA 4ZO3A 3R2UA 2BG6A 1HLKA 2Y8AA 4C1EA 1ZTCA 2VW8A 3MD7A 2Q42A 3IEMA 2BG8B 2UYXA 3T3OA 3SRXA 3SPUA 3QH8A 2FU6A 1Y44A 2BC2A 1JJEA 3VPEA 2Q0JA 4XUKA 5HIOA 2WRSA 3LVZA 4TZBA 4RAMA 2QJSA 4PVTA 5HH6A 3IE0A 2WYLA 3DHAA 4D1UA 4AWYB 5ACSA 3SBLA 2NZEA 5EWAA 5LM6A 3IOGA 5KILA 5A0TA 1XTOA 2FK6A 5LCAA 5ACWA 4ZO2A 4C1FA 3IOFA 2YNVB 5DPXA 5LS3A 2YNTB 3PG4A 1P9EA 4UWRB 5EHTA 5EH9A 5HISA 1QH5A 1L9YA 3S0ZA 5ACTA 2FHXA 2QDSA 4EY2A 4BZ3A 4WD6A 1KO2A 5K4NA 3ZQ4A 4AWZA 4GYUA 4TZ9A 3RKJA 4F6ZA 4U4LA 4C1HA 4C1GA 2OHJA 2Y87A 3PY5A 3SFPA 4EYBA 2GMNA 3RPCA 3IE1A
chains in the Genus database with same CATH superfamily
4TZEA 5A23A 4Z5YA 4GCWA 2Q9UA 4UBQA 2YHEA 1X8HA 4NQ5A 5AEBA 4RL0A 3I14A 3BK2A 5EV8A 4YSLA 4C1DA 4B87A 2BFKA 2XF4A 5A87A 5LLDA 5AIJA 4PDXA 3AJ3A 5EVDA 5AJLA 4FSBA 4Z7RA 2BFZB 3KL7A 1DD6A 1XM8A 3SW3A 1WUPA 2WYMA 1A7TA 1BC2A 4D1TA 4NQ4A 2CFUA 4YSKA 5B1UA 4KEQA 5EW0A 5ACRA 3H3EA 3AF6A 1X8IA 3PY6A 5AXOA 4LE6A 1VGNA 1ZNBA 2BMIA 3BK1A 3DHCA 5ACQA 2QEDA 4BP0A 4RBSA 1KR3A 5ACVA 2Y8BA 1JJTA 3L6NA 3P2UA 3X2XA 2GKLA 2BIBA 2A7MA 4D02A 4EXYA 3X2ZA 4V0HA 2AZ4A 2WHGA 2M5DA 2BTNA 1ZKPA 4AXHA 3RKKA 2OHHA 4AD9A 4EFZA 2H6AA 2FM6A 2ZO4A 2I7XA 2BG8A 4UWPB 2NZFA 1YCHA 5A5ZA 2BG2A 4FR7A 3X30A 2CG2A 5A0VA 4C1CA 3IE2A 2P18A 4UA4A 3KNRA 4RM5A 1VJNA 1BMCA 2BFLA 3I0VA 2DKFA 3Q6VA 5EV6A 4JO0A 4Z5ZA 5FQCA 5LCFA 5KIKA 4TZFA 5B3RA 3ADRA 4HKYA 5LMCA 2ZWRA 2NYPA 4KEPA 2CBNA 4NQ2A 2BGAA 2YNVA 2YNTA 4GYQA 4D1VA 1DXKA 1K07A 2GFKA 5FQBA 2CFZA 5EVKA 2ZZIA 4H0DA 3ESHA 5AXRA 4J5HA 2I7TA 4DIKA 4EYLA 4Z67A 3ZNBA 5B15A 4AX0B 5HH5A 2BR6A 4D1WA 4EYFA 4XWWA 1KO3A 4HL1A 1SMLA 4UWSB 2YNWA 5ACUA 3KNSA 5LCHA 1E5DA 4TYFA 2I7VA 3SD9A 4YSBA 3X2YA 4PVOA 3IELA 3VQZA 3JXPA 2YNUA 2FU7A 3FCZA 5HIQA 2P4ZA 2FHXB 2Q0IA 3DHBA 2WYMC 3BV6A 5HH4A 5K4KA 4C09A 4TYTA 3I11A 3I13A 5AHRA 2BFZA 3T3NA 2GCUA 2M5CA 1WW1A 1VMEA 2AIOA 5EVBA 3F9OA 1QH3A 4CHLA 4F6HA 2ZNBA 4Z60A 4FEKA 3T9MA 5AHOA 4RL2A 1M2XA 3AF5A 4UWOB 5LSCA 4NQ6A 1YCFA 1YCGA 3ZR9A 2P1EA 3ZWFA 4O98A 4UAMA 3IEKA 4ZEJA 1A8TA 2CG3A 5HIPA 2P97A 1MQOA 1X8GA 1JT1A 2QDTA 2DOOA 2FU9A 2BG7A 2E7YA 5K4MA 3A4YA 3WXCA 2QINA 5K0WA 2XR1A 4ZNBA 5ACPA 2GFJA 5AYAA 3BC2A 4EXSA 4J5FA 4AX1B 2R2DA 1WRAA 4Z6XA 5LE1A 5ACXA 2FU8A 4DILA 5IQKA 1BVTA 4XWTA 4P62A 3IDZA 2HB9A 2YCBA 1DDKA 3DH8A 5FQAA 4HL2A 3FAIA 3I15A 3TP9A 1WUOA 4RAWA 3G1PA 2NXAA 2YZ3A 2OHIA 4ZO3A 3R2UA 2BG6A 1HLKA 2Y8AA 4C1EA 1ZTCA 2VW8A 3MD7A 2Q42A 3IEMA 2BG8B 2UYXA 3T3OA 3SRXA 3SPUA 3QH8A 2FU6A 1Y44A 2BC2A 1JJEA 3VPEA 2Q0JA 4XUKA 5HIOA 2WRSA 3LVZA 4TZBA 4RAMA 2QJSA 4PVTA 5HH6A 3IE0A 2WYLA 3DHAA 4D1UA 4AWYB 5ACSA 4NURA 3SBLA 2NZEA 5EWAA 5LM6A 3IOGA 5KILA 5A0TA 1XTOA 2FK6A 5LCAA 5ACWA 4ZO2A 4C1FA 3IOFA 2YNVB 5DPXA 5LS3A 2YNTB 3PG4A 1P9EA 4UWRB 5EHTA 5EH9A 5HISA 1QH5A 1L9YA 3S0ZA 5ACTA 2FHXA 2QDSA 4EY2A 4BZ3A 4WD6A 1KO2A 5K4NA 3ZQ4A 4AWZA 4GYUA 4TZ9A 3RKJA 4F6ZA 4AV7A 4U4LA 4C1HA 4C1GA 2OHJA 2Y87A 3PY5A 3SFPA 4EYBA 2GMNA 3RPCA 3IE1A
chains in the Genus database with same CATH topology
4TZEA 4Z5YA 4GCWA 2Q9UA 4UBQA 1X8HA 4NQ5A 5AEBA 4RL0A 3I14A 3BK2A 5EV8A 4YSLA 4C1DA 4B87A 2BFKA 2XF4A 5A87A 5LLDA 3AJ3A 5EVDA 4FSBA 4Z7RA 2BFZB 3KL7A 1DD6A 1XM8A 3SW3A 1WUPA 2WYMA 1A7TA 1BC2A 4D1TA 4NQ4A 4YSKA 5B1UA 4KEQA 5EW0A 5ACRA 3H3EA 3AF6A 1X8IA 3PY6A 5AXOA 4LE6A 1VGNA 1ZNBA 2BMIA 3BK1A 3DHCA 5ACQA 2QEDA 4BP0A 4RBSA 1KR3A 5ACVA 2Y8BA 1JJTA 3L6NA 3P2UA 3X2XA 2GKLA 2BIBA 2A7MA 4D02A 4EXYA 3X2ZA 4V0HA 2AZ4A 2WHGA 2M5DA 2BTNA 1ZKPA 3RKKA 2OHHA 4AD9A 4EFZA 2H6AA 2FM6A 2ZO4A 2I7XA 2BG8A 4UWPB 2NZFA 1YCHA 5A5ZA 2BG2A 4FR7A 3X30A 5A0VA 4C1CA 3IE2A 2P18A 4UA4A 3KNRA 4RM5A 1VJNA 1BMCA 2BFLA 3I0VA 2DKFA 3Q6VA 5EV6A 4JO0A 4Z5ZA 5FQCA 5LCFA 5KIKA 4TZFA 5B3RA 3ADRA 4HKYA 5LMCA 2ZWRA 2NYPA 4KEPA 2CBNA 4NQ2A 2BGAA 2YNVA 2YNTA 4GYQA 4D1VA 1DXKA 1K07A 2GFKA 5FQBA 5EVKA 2ZZIA 4H0DA 3ESHA 5AXRA 4J5HA 2I7TA 4DIKA 4EYLA 4Z67A 3ZNBA 5B15A 4AX0B 5HH5A 2BR6A 4D1WA 4EYFA 4XWWA 1KO3A 4HL1A 1SMLA 4UWSB 2YNWA 5ACUA 3KNSA 5LCHA 1E5DA 4TYFA 2I7VA 3SD9A 4YSBA 3X2YA 4PVOA 3IELA 3VQZA 3JXPA 2YNUA 2FU7A 3FCZA 5HIQA 2P4ZA 2FHXB 2Q0IA 3DHBA 2WYMC 3BV6A 5HH4A 5K4KA 4C09A 4TYTA 3I11A 3I13A 5AHRA 2BFZA 3T3NA 2GCUA 2M5CA 1WW1A 1VMEA 2AIOA 5EVBA 3F9OA 1QH3A 4CHLA 4F6HA 2ZNBA 4Z60A 4FEKA 3T9MA 5AHOA 4RL2A 1M2XA 3AF5A 4UWOB 5LSCA 4NQ6A 1YCFA 1YCGA 3ZR9A 2P1EA 3ZWFA 4O98A 4UAMA 3IEKA 4ZEJA 1A8TA 5HIPA 2P97A 1MQOA 1X8GA 1JT1A 2QDTA 2DOOA 2FU9A 2BG7A 2E7YA 5K4MA 3A4YA 3WXCA 2QINA 5K0WA 2XR1A 4ZNBA 5ACPA 2GFJA 5AYAA 3BC2A 4EXSA 4J5FA 4AX1B 2R2DA 1WRAA 4Z6XA 5LE1A 5ACXA 2FU8A 4DILA 5IQKA 1BVTA 4XWTA 4P62A 3IDZA 2HB9A 2YCBA 1DDKA 3DH8A 5FQAA 4HL2A 3FAIA 3I15A 3TP9A 1WUOA 4RAWA 3G1PA 2NXAA 2YZ3A 2OHIA 4ZO3A 3R2UA 2BG6A 1HLKA 2Y8AA 4C1EA 1ZTCA 2VW8A 3MD7A 2Q42A 3IEMA 2BG8B 2UYXA 3T3OA 3SRXA 3SPUA 3QH8A 2FU6A 1Y44A 2BC2A 1JJEA 3VPEA 2Q0JA 4XUKA 5HIOA 2WRSA 3LVZA 4TZBA 4RAMA 2QJSA 4PVTA 5HH6A 3IE0A 2WYLA 3DHAA 4D1UA 4AWYB 5ACSA 3SBLA 2NZEA 5EWAA 5LM6A 3IOGA 5KILA 5A0TA 1XTOA 2FK6A 5LCAA 5ACWA 4ZO2A 4C1FA 3IOFA 2YNVB 5DPXA 5LS3A 2YNTB 3PG4A 1P9EA 4UWRB 5EHTA 5EH9A 5HISA 1QH5A 1L9YA 3S0ZA 5ACTA 2FHXA 2QDSA 4EY2A 4BZ3A 4WD6A 1KO2A 5K4NA 3ZQ4A 4AWZA 4GYUA 4TZ9A 3RKJA 4F6ZA 4U4LA 4C1HA 4C1GA 2OHJA 2Y87A 3PY5A 3SFPA 4EYBA 2GMNA 3RPCA 3IE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZE A;  4Z5Y A;  4GCW A;  2Q9U A;  4UBQ A;  1X8H A;  4NQ5 A;  5AEB A;  4RL0 A;  3I14 A;  3BK2 A;  5EV8 A;  4YSL A;  4C1D A;  4B87 A;  2BFK A;  2XF4 A;  5A87 A;  5LLD A;  3AJ3 A;  5EVD A;  4FSB A;  4Z7R A;  2BFZ B;  3KL7 A;  1DD6 A;  1XM8 A;  3SW3 A;  1WUP A;  2WYM A;  1A7T A;  1BC2 A;  4D1T A;  4NQ4 A;  4YSK A;  5B1U A;  4KEQ A;  5EW0 A;  5ACR A;  3H3E A;  3AF6 A;  1X8I A;  3PY6 A;  5AXO A;  4LE6 A;  1VGN A;  1ZNB A;  2BMI A;  3BK1 A;  3DHC A;  5ACQ A;  2QED A;  4BP0 A;  4RBS A;  1KR3 A;  5ACV A;  2Y8B A;  1JJT A;  3L6N A;  3P2U A;  3X2X A;  2GKL A;  2BIB A;  2A7M A;  4D02 A;  4EXY A;  3X2Z A;  4V0H A;  2AZ4 A;  2WHG A;  2M5D A;  2BTN A;  1ZKP A;  3RKK A;  2OHH A;  4AD9 A;  4EFZ A;  2H6A A;  2FM6 A;  2ZO4 A;  2I7X A;  2BG8 A;  4UWP B;  2NZF A;  1YCH A;  5A5Z A;  2BG2 A;  4FR7 A;  3X30 A;  5A0V A;  4C1C A;  3IE2 A;  2P18 A;  4UA4 A;  3KNR A;  4RM5 A;  1VJN A;  1BMC A;  2BFL A;  3I0V A;  2DKF A;  3Q6V A;  5EV6 A;  4JO0 A;  4Z5Z A;  5FQC A;  5LCF A;  5KIK A;  4TZF A;  5B3R A;  3ADR A;  4HKY A;  5LMC A;  2ZWR A;  2NYP A;  4KEP A;  2CBN A;  4NQ2 A;  2BGA A;  2YNV A;  2YNT A;  4GYQ A;  4D1V A;  1DXK A;  1K07 A;  2GFK A;  5FQB A;  5EVK A;  2ZZI A;  4H0D A;  3ESH A;  5AXR A;  4J5H A;  2I7T A;  4DIK A;  4EYL A;  4Z67 A;  3ZNB A;  5B15 A;  4AX0 B;  5HH5 A;  2BR6 A;  4D1W A;  4EYF A;  4XWW A;  1KO3 A;  4HL1 A;  1SML A;  4UWS B;  2YNW A;  5ACU A;  3KNS A;  5LCH A;  1E5D A;  4TYF A;  2I7V A;  3SD9 A;  4YSB A;  3X2Y A;  4PVO A;  3IEL A;  3VQZ A;  3JXP A;  2YNU A;  2FU7 A;  3FCZ A;  5HIQ A;  2P4Z A;  2FHX B;  2Q0I A;  3DHB A;  2WYM C;  3BV6 A;  5HH4 A;  5K4K A;  4C09 A;  4TYT A;  3I11 A;  3I13 A;  5AHR A;  2BFZ A;  3T3N A;  2GCU A;  2M5C A;  1WW1 A;  1VME A;  2AIO A;  5EVB A;  3F9O A;  1QH3 A;  4CHL A;  4F6H A;  2ZNB A;  4Z60 A;  4FEK A;  3T9M A;  5AHO A;  4RL2 A;  1M2X A;  3AF5 A;  4UWO B;  5LSC A;  4NQ6 A;  1YCF A;  1YCG A;  3ZR9 A;  2P1E A;  3ZWF A;  4O98 A;  4UAM A;  3IEK A;  4ZEJ A;  1A8T A;  5HIP A;  2P97 A;  1MQO A;  1X8G A;  1JT1 A;  2QDT A;  2DOO A;  2FU9 A;  2BG7 A;  2E7Y A;  5K4M A;  3A4Y A;  3WXC A;  2QIN A;  5K0W A;  2XR1 A;  4ZNB A;  5ACP A;  2GFJ A;  5AYA A;  3BC2 A;  4EXS A;  4J5F A;  4AX1 B;  2R2D A;  1WRA A;  4Z6X A;  5LE1 A;  5ACX A;  2FU8 A;  4DIL A;  5IQK A;  1BVT A;  4XWT A;  4P62 A;  3IDZ A;  2HB9 A;  2YCB A;  1DDK A;  3DH8 A;  5FQA A;  4HL2 A;  3FAI A;  3I15 A;  3TP9 A;  1WUO A;  4RAW A;  3G1P A;  2NXA A;  2YZ3 A;  2OHI A;  4ZO3 A;  3R2U A;  2BG6 A;  1HLK A;  2Y8A A;  4C1E A;  1ZTC A;  2VW8 A;  3MD7 A;  2Q42 A;  3IEM A;  2BG8 B;  2UYX A;  3T3O A;  3SRX A;  3SPU A;  3QH8 A;  2FU6 A;  1Y44 A;  2BC2 A;  1JJE A;  3VPE A;  2Q0J A;  4XUK A;  5HIO A;  2WRS A;  3LVZ A;  4TZB A;  4RAM A;  2QJS A;  4PVT A;  5HH6 A;  3IE0 A;  2WYL A;  3DHA A;  4D1U A;  4AWY B;  5ACS A;  3SBL A;  2NZE A;  5EWA A;  5LM6 A;  3IOG A;  5KIL A;  5A0T A;  1XTO A;  2FK6 A;  5LCA A;  5ACW A;  4ZO2 A;  4C1F A;  3IOF A;  2YNV B;  5DPX A;  5LS3 A;  2YNT B;  3PG4 A;  1P9E A;  4UWR B;  5EHT A;  5EH9 A;  5HIS A;  1QH5 A;  1L9Y A;  3S0Z A;  5ACT A;  2FHX A;  2QDS A;  4EY2 A;  4BZ3 A;  4WD6 A;  1KO2 A;  5K4N A;  3ZQ4 A;  4AWZ A;  4GYU A;  4TZ9 A;  3RKJ A;  4F6Z A;  4U4L A;  4C1H A;  4C1G A;  2OHJ A;  2Y87 A;  3PY5 A;  3SFP A;  4EYB A;  2GMN A;  3RPC A;  3IE1 A; 
#chains in the Genus database with same CATH topology
 4TZE A;  5A23 A;  4Z5Y A;  4GCW A;  2Q9U A;  4UBQ A;  2YHE A;  1X8H A;  4NQ5 A;  5AEB A;  4RL0 A;  3I14 A;  3BK2 A;  5EV8 A;  4YSL A;  4C1D A;  4B87 A;  2BFK A;  2XF4 A;  5A87 A;  5LLD A;  5AIJ A;  4PDX A;  3AJ3 A;  5EVD A;  5AJL A;  4FSB A;  4Z7R A;  2BFZ B;  3KL7 A;  1DD6 A;  1XM8 A;  3SW3 A;  1WUP A;  2WYM A;  1A7T A;  1BC2 A;  4D1T A;  4NQ4 A;  2CFU A;  4YSK A;  5B1U A;  4KEQ A;  5EW0 A;  5ACR A;  3H3E A;  3AF6 A;  1X8I A;  3PY6 A;  5AXO A;  4LE6 A;  1VGN A;  1ZNB A;  2BMI A;  3BK1 A;  3DHC A;  5ACQ A;  2QED A;  4BP0 A;  4RBS A;  1KR3 A;  5ACV A;  2Y8B A;  1JJT A;  3L6N A;  3P2U A;  3X2X A;  2GKL A;  2BIB A;  2A7M A;  4D02 A;  4EXY A;  3X2Z A;  4V0H A;  2AZ4 A;  2WHG A;  2M5D A;  2BTN A;  1ZKP A;  4AXH A;  3RKK A;  2OHH A;  4AD9 A;  4EFZ A;  2H6A A;  2FM6 A;  2ZO4 A;  2I7X A;  2BG8 A;  4UWP B;  2NZF A;  1YCH A;  5A5Z A;  2BG2 A;  4FR7 A;  3X30 A;  2CG2 A;  5A0V A;  4C1C A;  3IE2 A;  2P18 A;  4UA4 A;  3KNR A;  4RM5 A;  1VJN A;  1BMC A;  2BFL A;  3I0V A;  2DKF A;  3Q6V A;  5EV6 A;  4JO0 A;  4Z5Z A;  5FQC A;  5LCF A;  5KIK A;  4TZF A;  5B3R A;  3ADR A;  4HKY A;  5LMC A;  2ZWR A;  2NYP A;  4KEP A;  2CBN A;  4NQ2 A;  2BGA A;  2YNV A;  2YNT A;  4GYQ A;  4D1V A;  1DXK A;  1K07 A;  2GFK A;  5FQB A;  2CFZ A;  5EVK A;  2ZZI A;  4H0D A;  3ESH A;  5AXR A;  4J5H A;  2I7T A;  4DIK A;  4EYL A;  4Z67 A;  3ZNB A;  5B15 A;  4AX0 B;  5HH5 A;  2BR6 A;  4D1W A;  4EYF A;  4XWW A;  1KO3 A;  4HL1 A;  1SML A;  4UWS B;  2YNW A;  5ACU A;  3KNS A;  5LCH A;  1E5D A;  4TYF A;  2I7V A;  3SD9 A;  4YSB A;  3X2Y A;  4PVO A;  3IEL A;  3VQZ A;  3JXP A;  2YNU A;  2FU7 A;  3FCZ A;  5HIQ A;  2P4Z A;  2FHX B;  2Q0I A;  3DHB A;  2WYM C;  3BV6 A;  5HH4 A;  5K4K A;  4C09 A;  4TYT A;  3I11 A;  3I13 A;  5AHR A;  2BFZ A;  3T3N A;  2GCU A;  2M5C A;  1WW1 A;  1VME A;  2AIO A;  5EVB A;  3F9O A;  1QH3 A;  4CHL A;  4F6H A;  2ZNB A;  4Z60 A;  4FEK A;  3T9M A;  5AHO A;  4RL2 A;  1M2X A;  3AF5 A;  4UWO B;  5LSC A;  4NQ6 A;  1YCF A;  1YCG A;  3ZR9 A;  2P1E A;  3ZWF A;  4O98 A;  4UAM A;  3IEK A;  4ZEJ A;  1A8T A;  2CG3 A;  5HIP A;  2P97 A;  1MQO A;  1X8G A;  1JT1 A;  2QDT A;  2DOO A;  2FU9 A;  2BG7 A;  2E7Y A;  5K4M A;  3A4Y A;  3WXC A;  2QIN A;  5K0W A;  2XR1 A;  4ZNB A;  5ACP A;  2GFJ A;  5AYA A;  3BC2 A;  4EXS A;  4J5F A;  4AX1 B;  2R2D A;  1WRA A;  4Z6X A;  5LE1 A;  5ACX A;  2FU8 A;  4DIL A;  5IQK A;  1BVT A;  4XWT A;  4P62 A;  3IDZ A;  2HB9 A;  2YCB A;  1DDK A;  3DH8 A;  5FQA A;  4HL2 A;  3FAI A;  3I15 A;  3TP9 A;  1WUO A;  4RAW A;  3G1P A;  2NXA A;  2YZ3 A;  2OHI A;  4ZO3 A;  3R2U A;  2BG6 A;  1HLK A;  2Y8A A;  4C1E A;  1ZTC A;  2VW8 A;  3MD7 A;  2Q42 A;  3IEM A;  2BG8 B;  2UYX A;  3T3O A;  3SRX A;  3SPU A;  3QH8 A;  2FU6 A;  1Y44 A;  2BC2 A;  1JJE A;  3VPE A;  2Q0J A;  4XUK A;  5HIO A;  2WRS A;  3LVZ A;  4TZB A;  4RAM A;  2QJS A;  4PVT A;  5HH6 A;  3IE0 A;  2WYL A;  3DHA A;  4D1U A;  4AWY B;  5ACS A;  4NUR A;  3SBL A;  2NZE A;  5EWA A;  5LM6 A;  3IOG A;  5KIL A;  5A0T A;  1XTO A;  2FK6 A;  5LCA A;  5ACW A;  4ZO2 A;  4C1F A;  3IOF A;  2YNV B;  5DPX A;  5LS3 A;  2YNT B;  3PG4 A;  1P9E A;  4UWR B;  5EHT A;  5EH9 A;  5HIS A;  1QH5 A;  1L9Y A;  3S0Z A;  5ACT A;  2FHX A;  2QDS A;  4EY2 A;  4BZ3 A;  4WD6 A;  1KO2 A;  5K4N A;  3ZQ4 A;  4AWZ A;  4GYU A;  4TZ9 A;  3RKJ A;  4F6Z A;  4AV7 A;  4U4L A;  4C1H A;  4C1G A;  2OHJ A;  2Y87 A;  3PY5 A;  3SFP A;  4EYB A;  2GMN A;  3RPC A;  3IE1 A; 
#chains in the Genus database with same CATH homology
 4TZE A;  4Z5Y A;  4GCW A;  2Q9U A;  4UBQ A;  1X8H A;  4NQ5 A;  5AEB A;  4RL0 A;  3I14 A;  3BK2 A;  5EV8 A;  4YSL A;  4C1D A;  4B87 A;  2BFK A;  2XF4 A;  5A87 A;  5LLD A;  3AJ3 A;  5EVD A;  4FSB A;  4Z7R A;  2BFZ B;  3KL7 A;  1DD6 A;  1XM8 A;  3SW3 A;  1WUP A;  2WYM A;  1A7T A;  1BC2 A;  4D1T A;  4NQ4 A;  4YSK A;  5B1U A;  4KEQ A;  5EW0 A;  5ACR A;  3H3E A;  3AF6 A;  1X8I A;  3PY6 A;  5AXO A;  4LE6 A;  1VGN A;  1ZNB A;  2BMI A;  3BK1 A;  3DHC A;  5ACQ A;  2QED A;  4BP0 A;  4RBS A;  1KR3 A;  5ACV A;  2Y8B A;  1JJT A;  3L6N A;  3P2U A;  3X2X A;  2GKL A;  2BIB A;  2A7M A;  4D02 A;  4EXY A;  3X2Z A;  4V0H A;  2AZ4 A;  2WHG A;  2M5D A;  2BTN A;  1ZKP A;  3RKK A;  2OHH A;  4AD9 A;  4EFZ A;  2H6A A;  2FM6 A;  2ZO4 A;  2I7X A;  2BG8 A;  4UWP B;  2NZF A;  1YCH A;  5A5Z A;  2BG2 A;  4FR7 A;  3X30 A;  5A0V A;  4C1C A;  3IE2 A;  2P18 A;  4UA4 A;  3KNR A;  4RM5 A;  1VJN A;  1BMC A;  2BFL A;  3I0V A;  2DKF A;  3Q6V A;  5EV6 A;  4JO0 A;  4Z5Z A;  5FQC A;  5LCF A;  5KIK A;  4TZF A;  5B3R A;  3ADR A;  4HKY A;  5LMC A;  2ZWR A;  2NYP A;  4KEP A;  2CBN A;  4NQ2 A;  2BGA A;  2YNV A;  2YNT A;  4GYQ A;  4D1V A;  1DXK A;  1K07 A;  2GFK A;  5FQB A;  5EVK A;  2ZZI A;  4H0D A;  3ESH A;  5AXR A;  4J5H A;  2I7T A;  4DIK A;  4EYL A;  4Z67 A;  3ZNB A;  5B15 A;  4AX0 B;  5HH5 A;  2BR6 A;  4D1W A;  4EYF A;  4XWW A;  1KO3 A;  4HL1 A;  1SML A;  4UWS B;  2YNW A;  5ACU A;  3KNS A;  5LCH A;  1E5D A;  4TYF A;  2I7V A;  3SD9 A;  4YSB A;  3X2Y A;  4PVO A;  3IEL A;  3VQZ A;  3JXP A;  2YNU A;  2FU7 A;  3FCZ A;  5HIQ A;  2P4Z A;  2FHX B;  2Q0I A;  3DHB A;  2WYM C;  3BV6 A;  5HH4 A;  5K4K A;  4C09 A;  4TYT A;  3I11 A;  3I13 A;  5AHR A;  2BFZ A;  3T3N A;  2GCU A;  2M5C A;  1WW1 A;  1VME A;  2AIO A;  5EVB A;  3F9O A;  1QH3 A;  4CHL A;  4F6H A;  2ZNB A;  4Z60 A;  4FEK A;  3T9M A;  5AHO A;  4RL2 A;  1M2X A;  3AF5 A;  4UWO B;  5LSC A;  4NQ6 A;  1YCF A;  1YCG A;  3ZR9 A;  2P1E A;  3ZWF A;  4O98 A;  4UAM A;  3IEK A;  4ZEJ A;  1A8T A;  5HIP A;  2P97 A;  1MQO A;  1X8G A;  1JT1 A;  2QDT A;  2DOO A;  2FU9 A;  2BG7 A;  2E7Y A;  5K4M A;  3A4Y A;  3WXC A;  2QIN A;  5K0W A;  2XR1 A;  4ZNB A;  5ACP A;  2GFJ A;  5AYA A;  3BC2 A;  4EXS A;  4J5F A;  4AX1 B;  2R2D A;  1WRA A;  4Z6X A;  5LE1 A;  5ACX A;  2FU8 A;  4DIL A;  5IQK A;  1BVT A;  4XWT A;  4P62 A;  3IDZ A;  2HB9 A;  2YCB A;  1DDK A;  3DH8 A;  5FQA A;  4HL2 A;  3FAI A;  3I15 A;  3TP9 A;  1WUO A;  4RAW A;  3G1P A;  2NXA A;  2YZ3 A;  2OHI A;  4ZO3 A;  3R2U A;  2BG6 A;  1HLK A;  2Y8A A;  4C1E A;  1ZTC A;  2VW8 A;  3MD7 A;  2Q42 A;  3IEM A;  2BG8 B;  2UYX A;  3T3O A;  3SRX A;  3SPU A;  3QH8 A;  2FU6 A;  1Y44 A;  2BC2 A;  1JJE A;  3VPE A;  2Q0J A;  4XUK A;  5HIO A;  2WRS A;  3LVZ A;  4TZB A;  4RAM A;  2QJS A;  4PVT A;  5HH6 A;  3IE0 A;  2WYL A;  3DHA A;  4D1U A;  4AWY B;  5ACS A;  3SBL A;  2NZE A;  5EWA A;  5LM6 A;  3IOG A;  5KIL A;  5A0T A;  1XTO A;  2FK6 A;  5LCA A;  5ACW A;  4ZO2 A;  4C1F A;  3IOF A;  2YNV B;  5DPX A;  5LS3 A;  2YNT B;  3PG4 A;  1P9E A;  4UWR B;  5EHT A;  5EH9 A;  5HIS A;  1QH5 A;  1L9Y A;  3S0Z A;  5ACT A;  2FHX A;  2QDS A;  4EY2 A;  4BZ3 A;  4WD6 A;  1KO2 A;  5K4N A;  3ZQ4 A;  4AWZ A;  4GYU A;  4TZ9 A;  3RKJ A;  4F6Z A;  4U4L A;  4C1H A;  4C1G A;  2OHJ A;  2Y87 A;  3PY5 A;  3SFP A;  4EYB A;  2GMN A;  3RPC A;  3IE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...