3DHBA

1.4 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at the catalytic metal center
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
molecule keywords N-Acyl Homoserine Lactone Hydrolase
total genus 81
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhbA01
5LLDA 4ZO3A 3ZWFA 3BV6A 5HH5A 3SD9A 3KNSA 4ZEJA 5EWAA 2BIBA 2WYLA 2VW8A 1X8HA 3IDZA 5EW0A 4EXSA 1VJNA 4Z5ZA 2FU7A 2OHIA 4C1DA 2QDSA 2YNVA 4HL1A 2GMNA 3I13A 4NQ2A 5LM6A 4UBQA 4Z6XA 2FU6A 4GYUA 4YSBA 3T3OA 4RBSA 2AIOA 4EXYA 4Z60A 3ZR9A 4UA4A 4XWTA 1XTOA 1X8IA 4TZ9A 4RAMA 2Y87A 4BP0A 2I7TA 1VGNA 1JJTA 1A8TA 3VQZA 4V0HA 2WYMC 5IQKA 3DH8A 5B3RA 1YCGA 2FU9A 2QDTA 2HB9A 4J5HA 3IE1A 3BK2A 4DILA 2QEDA 2M5DA 3SBLA 4O98A 5FQBA 3DHBA 2BFLA 1ZNBA 2BG2A 2YNWA 2BR6A 4RL0A 5LS3A 2BG7A 3SRXA 2DKFA 3QH8A 5B15A 5EHTA 4JO0A 2YNUA 3WXCA 3ESHA 5LCAA 3FAIA 4YSKA 3BC2A 4RAWA 4F6HA 4EYLA 2Q0JA 5HH4A 3KL7A 5EH9A 1M2XA 5K4NA 4XUKA 5AEBA 4WD6A 4PVOA 5K4KA 2GFJA 2R2DA 3FCZA 2UYXA 4ZO2A 4TZEA 2Y8AA 5LCFA 2NZFA 4Z7RA 4Z5YA 4LE6A 1JJEA 2P4ZA 2Q0IA 5EVBA 3ZNBA 3IOFA 3X2XA 4FEKA 5HIOA 3IEMA 4EY2A 4GCWA 3IOGA 3I11A 1WW1A 3R2UA 1BVTA 2ZZIA 5FQAA 1ZKPA 5A5ZA 5LMCA 5ACXA 4C1GA 2QINA 3I14A 1MQOA 3JXPA 5LSCA 4RM5A 4TYFA 2WHGA 5A87A 1QH5A 5K4MA 5A0VA 4GYQA 2FK6A 3BK1A 4AX0B 4AD9A 3IEKA 1ZTCA 4HL2A 4D1TA 2BG6A 4BZ3A 4UWPB 5EV6A 5ACQA 2P18A 3G1PA 2XF4A 5B1UA 2OHJA 5EVKA 1WUOA 3P2UA 3X30A 4DIKA 1KR3A 5AYAA 2YNTA 3SFPA 2FHXB 3MD7A 5HIQA 3RKKA 4EFZA 5ACVA 3IELA 2NYPA 3X2ZA 3SW3A 2FU8A 5AXOA 1L9YA 4AX1B 4NQ5A 2I7VA 4UWOB 5ACSA 3S0ZA 3Q6VA 4AWZA 3A4YA 4AWYB 3IE2A 1QH3A 3ADRA 5KILA 4TZFA 1P9EA 2ZWRA 3DHCA 4KEQA 1BMCA 4C1CA 2BTNA 3IE0A 1KO2A 2GKLA 2YCBA 5HIPA 4UWRB 1JT1A 4D1WA 4UAMA 1E5DA 3F9OA 2OHHA 2YNVB 1DXKA 4TZBA 5ACUA 2AZ4A 4UWSB 4NQ4A 4C09A 1A7TA 2XR1A 2A7MA 2I7XA 4FSBA 3LVZA 2GCUA 4KEPA 2BC2A 3T3NA 1XM8A 2P1EA 2M5CA 3SPUA 5ACPA 5EV8A 2NXAA 2FHXA 2BFZA 2GFKA 1WRAA 4NQ6A 2CBNA 2BFKA 4C1HA 4ZNBA 4P62A 4H0DA 3VPEA 4D1VA 5KIKA 5ACTA 2BG8A 5DPXA 5A0TA 4HKYA 4RL2A 5HH6A 4TYTA 4F6ZA 4D1UA 1Y44A 3PY5A 4B87A 2BGAA 5EVDA 2BMIA 3T9MA 4D02A 4EYBA 2H6AA 5AHOA 3PG4A 1X8GA 2QJSA 2BFZB 3DHAA 2YNTB 3AF5A 3RKJA 3L6NA 5LCHA 4YSLA 5LE1A 2ZNBA 4U4LA 2E7YA 2FM6A 2WYMA 1DDKA 5AXRA 5HISA 4C1EA 3TP9A 1YCFA 1HLKA 1VMEA 5AHRA 5ACWA 1DD6A 2NZEA 3I0VA 4C1FA 3I15A 3KNRA 3X2YA 1YCHA 3AF6A 3RPCA 4PVTA 4CHLA 2DOOA 4FR7A 1WUPA 3AJ3A 2P97A 3H3EA 3ZQ4A 2WRSA 4Z67A 2ZO4A 2Y8BA 1K07A 2Q9UA 3PY6A 1KO3A 2BG8B 2Q42A 1BC2A 4EYFA 5K0WA 4XWWA 5ACRA 4J5FA 1SMLA 2YZ3A 5FQCA
chains in the Genus database with same CATH superfamily
5LLDA 4ZO3A 3ZWFA 3BV6A 5HH5A 3SD9A 3KNSA 4ZEJA 5EWAA 2BIBA 2WYLA 2VW8A 1X8HA 3IDZA 5EW0A 4EXSA 1VJNA 4Z5ZA 2FU7A 2OHIA 4C1DA 2QDSA 2YNVA 4HL1A 2GMNA 3I13A 4NQ2A 5LM6A 4UBQA 4Z6XA 2FU6A 4GYUA 4YSBA 3T3OA 4RBSA 2CG2A 2AIOA 4EXYA 4Z60A 3ZR9A 4UA4A 4XWTA 1XTOA 1X8IA 4TZ9A 4RAMA 2Y87A 4BP0A 2I7TA 1VGNA 1JJTA 1A8TA 3VQZA 4V0HA 2WYMC 5IQKA 3DH8A 5B3RA 1YCGA 2FU9A 2QDTA 2HB9A 4J5HA 3IE1A 3BK2A 4DILA 2QEDA 2M5DA 3SBLA 4O98A 5FQBA 3DHBA 2BFLA 1ZNBA 2BG2A 2YNWA 2BR6A 4RL0A 5LS3A 2BG7A 3SRXA 2DKFA 3QH8A 5B15A 5EHTA 2CFUA 4JO0A 2YNUA 3WXCA 3ESHA 5LCAA 3FAIA 4YSKA 3BC2A 4RAWA 4AXHA 4F6HA 2CG3A 4EYLA 2Q0JA 5HH4A 3KL7A 4PDXA 5EH9A 1M2XA 5K4NA 4XUKA 5AEBA 4WD6A 4PVOA 5K4KA 2GFJA 2R2DA 3FCZA 2UYXA 4ZO2A 4TZEA 2Y8AA 5LCFA 2NZFA 4Z7RA 4Z5YA 4LE6A 1JJEA 2P4ZA 2Q0IA 5EVBA 3ZNBA 3IOFA 3X2XA 4FEKA 5HIOA 3IEMA 4EY2A 4GCWA 3IOGA 3I11A 4NURA 1WW1A 3R2UA 1BVTA 2ZZIA 5FQAA 1ZKPA 5A5ZA 5LMCA 5ACXA 4C1GA 2QINA 3I14A 1MQOA 3JXPA 5LSCA 4RM5A 4TYFA 2WHGA 5A87A 1QH5A 5K4MA 5A0VA 4GYQA 2FK6A 3BK1A 4AX0B 4AD9A 3IEKA 1ZTCA 4HL2A 4D1TA 2BG6A 4BZ3A 4UWPB 5EV6A 5ACQA 2P18A 3G1PA 2XF4A 5B1UA 2OHJA 5EVKA 1WUOA 3P2UA 3X30A 4DIKA 1KR3A 5AYAA 2YNTA 3SFPA 2FHXB 3MD7A 5HIQA 3RKKA 4EFZA 5ACVA 5AIJA 3IELA 2NYPA 3X2ZA 3SW3A 2FU8A 5AXOA 1L9YA 4AX1B 4NQ5A 2I7VA 4UWOB 5ACSA 3S0ZA 3Q6VA 4AWZA 3A4YA 4AWYB 3IE2A 1QH3A 3ADRA 5KILA 4TZFA 1P9EA 2ZWRA 3DHCA 4KEQA 1BMCA 4C1CA 2BTNA 3IE0A 1KO2A 2GKLA 2YCBA 5HIPA 4UWRB 1JT1A 4D1WA 4UAMA 1E5DA 3F9OA 2OHHA 2YNVB 1DXKA 4TZBA 2YHEA 5ACUA 2AZ4A 4UWSB 5A23A 4NQ4A 4C09A 1A7TA 2XR1A 2A7MA 2I7XA 4FSBA 3LVZA 2GCUA 4KEPA 2CFZA 2BC2A 3T3NA 1XM8A 2P1EA 2M5CA 3SPUA 5ACPA 5EV8A 2NXAA 2FHXA 2BFZA 2GFKA 1WRAA 4NQ6A 2CBNA 2BFKA 4C1HA 4ZNBA 4P62A 4H0DA 3VPEA 4D1VA 5KIKA 5ACTA 2BG8A 5DPXA 5A0TA 4HKYA 5AJLA 4RL2A 5HH6A 4TYTA 4F6ZA 4D1UA 1Y44A 3PY5A 4B87A 2BGAA 5EVDA 2BMIA 3T9MA 4D02A 4EYBA 2H6AA 5AHOA 3PG4A 1X8GA 2QJSA 2BFZB 3DHAA 2YNTB 3AF5A 3RKJA 3L6NA 5LCHA 4YSLA 5LE1A 2ZNBA 4U4LA 2E7YA 2FM6A 2WYMA 1DDKA 5AXRA 5HISA 4C1EA 3TP9A 1YCFA 1HLKA 1VMEA 5AHRA 5ACWA 1DD6A 2NZEA 3I0VA 4C1FA 3I15A 3KNRA 3X2YA 1YCHA 3AF6A 3RPCA 4AV7A 4PVTA 4CHLA 2DOOA 4FR7A 1WUPA 3AJ3A 2P97A 3H3EA 3ZQ4A 2WRSA 4Z67A 2ZO4A 2Y8BA 1K07A 2Q9UA 3PY6A 1KO3A 2BG8B 2Q42A 1BC2A 4EYFA 5K0WA 4XWWA 5ACRA 4J5FA 1SMLA 2YZ3A 5FQCA
chains in the Genus database with same CATH topology
5LLDA 4ZO3A 3ZWFA 3BV6A 5HH5A 3SD9A 3KNSA 4ZEJA 5EWAA 2BIBA 2WYLA 2VW8A 1X8HA 3IDZA 5EW0A 4EXSA 1VJNA 4Z5ZA 2FU7A 2OHIA 4C1DA 2QDSA 2YNVA 4HL1A 2GMNA 3I13A 4NQ2A 5LM6A 4UBQA 4Z6XA 2FU6A 4GYUA 4YSBA 3T3OA 4RBSA 2AIOA 4EXYA 4Z60A 3ZR9A 4UA4A 4XWTA 1XTOA 1X8IA 4TZ9A 4RAMA 2Y87A 4BP0A 2I7TA 1VGNA 1JJTA 1A8TA 3VQZA 4V0HA 2WYMC 5IQKA 3DH8A 5B3RA 1YCGA 2FU9A 2QDTA 2HB9A 4J5HA 3IE1A 3BK2A 4DILA 2QEDA 2M5DA 3SBLA 4O98A 5FQBA 3DHBA 2BFLA 1ZNBA 2BG2A 2YNWA 2BR6A 4RL0A 5LS3A 2BG7A 3SRXA 2DKFA 3QH8A 5B15A 5EHTA 4JO0A 2YNUA 3WXCA 3ESHA 5LCAA 3FAIA 4YSKA 3BC2A 4RAWA 4F6HA 4EYLA 2Q0JA 5HH4A 3KL7A 5EH9A 1M2XA 5K4NA 4XUKA 5AEBA 4WD6A 4PVOA 5K4KA 2GFJA 2R2DA 3FCZA 2UYXA 4ZO2A 4TZEA 2Y8AA 5LCFA 2NZFA 4Z7RA 4Z5YA 4LE6A 1JJEA 2P4ZA 2Q0IA 5EVBA 3ZNBA 3IOFA 3X2XA 4FEKA 5HIOA 3IEMA 4EY2A 4GCWA 3IOGA 3I11A 1WW1A 3R2UA 1BVTA 2ZZIA 5FQAA 1ZKPA 5A5ZA 5LMCA 5ACXA 4C1GA 2QINA 3I14A 1MQOA 3JXPA 5LSCA 4RM5A 4TYFA 2WHGA 5A87A 1QH5A 5K4MA 5A0VA 4GYQA 2FK6A 3BK1A 4AX0B 4AD9A 3IEKA 1ZTCA 4HL2A 4D1TA 2BG6A 4BZ3A 4UWPB 5EV6A 5ACQA 2P18A 3G1PA 2XF4A 5B1UA 2OHJA 5EVKA 1WUOA 3P2UA 3X30A 4DIKA 1KR3A 5AYAA 2YNTA 3SFPA 2FHXB 3MD7A 5HIQA 3RKKA 4EFZA 5ACVA 3IELA 2NYPA 3X2ZA 3SW3A 2FU8A 5AXOA 1L9YA 4AX1B 4NQ5A 2I7VA 4UWOB 5ACSA 3S0ZA 3Q6VA 4AWZA 3A4YA 4AWYB 3IE2A 1QH3A 3ADRA 5KILA 4TZFA 1P9EA 2ZWRA 3DHCA 4KEQA 1BMCA 4C1CA 2BTNA 3IE0A 1KO2A 2GKLA 2YCBA 5HIPA 4UWRB 1JT1A 4D1WA 4UAMA 1E5DA 3F9OA 2OHHA 2YNVB 1DXKA 4TZBA 5ACUA 2AZ4A 4UWSB 4NQ4A 4C09A 1A7TA 2XR1A 2A7MA 2I7XA 4FSBA 3LVZA 2GCUA 4KEPA 2BC2A 3T3NA 1XM8A 2P1EA 2M5CA 3SPUA 5ACPA 5EV8A 2NXAA 2FHXA 2BFZA 2GFKA 1WRAA 4NQ6A 2CBNA 2BFKA 4C1HA 4ZNBA 4P62A 4H0DA 3VPEA 4D1VA 5KIKA 5ACTA 2BG8A 5DPXA 5A0TA 4HKYA 4RL2A 5HH6A 4TYTA 4F6ZA 4D1UA 1Y44A 3PY5A 4B87A 2BGAA 5EVDA 2BMIA 3T9MA 4D02A 4EYBA 2H6AA 5AHOA 3PG4A 1X8GA 2QJSA 2BFZB 3DHAA 2YNTB 3AF5A 3RKJA 3L6NA 5LCHA 4YSLA 5LE1A 2ZNBA 4U4LA 2E7YA 2FM6A 2WYMA 1DDKA 5AXRA 5HISA 4C1EA 3TP9A 1YCFA 1HLKA 1VMEA 5AHRA 5ACWA 1DD6A 2NZEA 3I0VA 4C1FA 3I15A 3KNRA 3X2YA 1YCHA 3AF6A 3RPCA 4PVTA 4CHLA 2DOOA 4FR7A 1WUPA 3AJ3A 2P97A 3H3EA 3ZQ4A 2WRSA 4Z67A 2ZO4A 2Y8BA 1K07A 2Q9UA 3PY6A 1KO3A 2BG8B 2Q42A 1BC2A 4EYFA 5K0WA 4XWWA 5ACRA 4J5FA 1SMLA 2YZ3A 5FQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LLD A;  4ZO3 A;  3ZWF A;  3BV6 A;  5HH5 A;  3SD9 A;  3KNS A;  4ZEJ A;  5EWA A;  2BIB A;  2WYL A;  2VW8 A;  1X8H A;  3IDZ A;  5EW0 A;  4EXS A;  1VJN A;  4Z5Z A;  2FU7 A;  2OHI A;  4C1D A;  2QDS A;  2YNV A;  4HL1 A;  2GMN A;  3I13 A;  4NQ2 A;  5LM6 A;  4UBQ A;  4Z6X A;  2FU6 A;  4GYU A;  4YSB A;  3T3O A;  4RBS A;  2AIO A;  4EXY A;  4Z60 A;  3ZR9 A;  4UA4 A;  4XWT A;  1XTO A;  1X8I A;  4TZ9 A;  4RAM A;  2Y87 A;  4BP0 A;  2I7T A;  1VGN A;  1JJT A;  1A8T A;  3VQZ A;  4V0H A;  2WYM C;  5IQK A;  3DH8 A;  5B3R A;  1YCG A;  2FU9 A;  2QDT A;  2HB9 A;  4J5H A;  3IE1 A;  3BK2 A;  4DIL A;  2QED A;  2M5D A;  3SBL A;  4O98 A;  5FQB A;  3DHB A;  2BFL A;  1ZNB A;  2BG2 A;  2YNW A;  2BR6 A;  4RL0 A;  5LS3 A;  2BG7 A;  3SRX A;  2DKF A;  3QH8 A;  5B15 A;  5EHT A;  4JO0 A;  2YNU A;  3WXC A;  3ESH A;  5LCA A;  3FAI A;  4YSK A;  3BC2 A;  4RAW A;  4F6H A;  4EYL A;  2Q0J A;  5HH4 A;  3KL7 A;  5EH9 A;  1M2X A;  5K4N A;  4XUK A;  5AEB A;  4WD6 A;  4PVO A;  5K4K A;  2GFJ A;  2R2D A;  3FCZ A;  2UYX A;  4ZO2 A;  4TZE A;  2Y8A A;  5LCF A;  2NZF A;  4Z7R A;  4Z5Y A;  4LE6 A;  1JJE A;  2P4Z A;  2Q0I A;  5EVB A;  3ZNB A;  3IOF A;  3X2X A;  4FEK A;  5HIO A;  3IEM A;  4EY2 A;  4GCW A;  3IOG A;  3I11 A;  1WW1 A;  3R2U A;  1BVT A;  2ZZI A;  5FQA A;  1ZKP A;  5A5Z A;  5LMC A;  5ACX A;  4C1G A;  2QIN A;  3I14 A;  1MQO A;  3JXP A;  5LSC A;  4RM5 A;  4TYF A;  2WHG A;  5A87 A;  1QH5 A;  5K4M A;  5A0V A;  4GYQ A;  2FK6 A;  3BK1 A;  4AX0 B;  4AD9 A;  3IEK A;  1ZTC A;  4HL2 A;  4D1T A;  2BG6 A;  4BZ3 A;  4UWP B;  5EV6 A;  5ACQ A;  2P18 A;  3G1P A;  2XF4 A;  5B1U A;  2OHJ A;  5EVK A;  1WUO A;  3P2U A;  3X30 A;  4DIK A;  1KR3 A;  5AYA A;  2YNT A;  3SFP A;  2FHX B;  3MD7 A;  5HIQ A;  3RKK A;  4EFZ A;  5ACV A;  3IEL A;  2NYP A;  3X2Z A;  3SW3 A;  2FU8 A;  5AXO A;  1L9Y A;  4AX1 B;  4NQ5 A;  2I7V A;  4UWO B;  5ACS A;  3S0Z A;  3Q6V A;  4AWZ A;  3A4Y A;  4AWY B;  3IE2 A;  1QH3 A;  3ADR A;  5KIL A;  4TZF A;  1P9E A;  2ZWR A;  3DHC A;  4KEQ A;  1BMC A;  4C1C A;  2BTN A;  3IE0 A;  1KO2 A;  2GKL A;  2YCB A;  5HIP A;  4UWR B;  1JT1 A;  4D1W A;  4UAM A;  1E5D A;  3F9O A;  2OHH A;  2YNV B;  1DXK A;  4TZB A;  5ACU A;  2AZ4 A;  4UWS B;  4NQ4 A;  4C09 A;  1A7T A;  2XR1 A;  2A7M A;  2I7X A;  4FSB A;  3LVZ A;  2GCU A;  4KEP A;  2BC2 A;  3T3N A;  1XM8 A;  2P1E A;  2M5C A;  3SPU A;  5ACP A;  5EV8 A;  2NXA A;  2FHX A;  2BFZ A;  2GFK A;  1WRA A;  4NQ6 A;  2CBN A;  2BFK A;  4C1H A;  4ZNB A;  4P62 A;  4H0D A;  3VPE A;  4D1V A;  5KIK A;  5ACT A;  2BG8 A;  5DPX A;  5A0T A;  4HKY A;  4RL2 A;  5HH6 A;  4TYT A;  4F6Z A;  4D1U A;  1Y44 A;  3PY5 A;  4B87 A;  2BGA A;  5EVD A;  2BMI A;  3T9M A;  4D02 A;  4EYB A;  2H6A A;  5AHO A;  3PG4 A;  1X8G A;  2QJS A;  2BFZ B;  3DHA A;  2YNT B;  3AF5 A;  3RKJ A;  3L6N A;  5LCH A;  4YSL A;  5LE1 A;  2ZNB A;  4U4L A;  2E7Y A;  2FM6 A;  2WYM A;  1DDK A;  5AXR A;  5HIS A;  4C1E A;  3TP9 A;  1YCF A;  1HLK A;  1VME A;  5AHR A;  5ACW A;  1DD6 A;  2NZE A;  3I0V A;  4C1F A;  3I15 A;  3KNR A;  3X2Y A;  1YCH A;  3AF6 A;  3RPC A;  4PVT A;  4CHL A;  2DOO A;  4FR7 A;  1WUP A;  3AJ3 A;  2P97 A;  3H3E A;  3ZQ4 A;  2WRS A;  4Z67 A;  2ZO4 A;  2Y8B A;  1K07 A;  2Q9U A;  3PY6 A;  1KO3 A;  2BG8 B;  2Q42 A;  1BC2 A;  4EYF A;  5K0W A;  4XWW A;  5ACR A;  4J5F A;  1SML A;  2YZ3 A;  5FQC A; 
#chains in the Genus database with same CATH topology
 5LLD A;  4ZO3 A;  3ZWF A;  3BV6 A;  5HH5 A;  3SD9 A;  3KNS A;  4ZEJ A;  5EWA A;  2BIB A;  2WYL A;  2VW8 A;  1X8H A;  3IDZ A;  5EW0 A;  4EXS A;  1VJN A;  4Z5Z A;  2FU7 A;  2OHI A;  4C1D A;  2QDS A;  2YNV A;  4HL1 A;  2GMN A;  3I13 A;  4NQ2 A;  5LM6 A;  4UBQ A;  4Z6X A;  2FU6 A;  4GYU A;  4YSB A;  3T3O A;  4RBS A;  2CG2 A;  2AIO A;  4EXY A;  4Z60 A;  3ZR9 A;  4UA4 A;  4XWT A;  1XTO A;  1X8I A;  4TZ9 A;  4RAM A;  2Y87 A;  4BP0 A;  2I7T A;  1VGN A;  1JJT A;  1A8T A;  3VQZ A;  4V0H A;  2WYM C;  5IQK A;  3DH8 A;  5B3R A;  1YCG A;  2FU9 A;  2QDT A;  2HB9 A;  4J5H A;  3IE1 A;  3BK2 A;  4DIL A;  2QED A;  2M5D A;  3SBL A;  4O98 A;  5FQB A;  3DHB A;  2BFL A;  1ZNB A;  2BG2 A;  2YNW A;  2BR6 A;  4RL0 A;  5LS3 A;  2BG7 A;  3SRX A;  2DKF A;  3QH8 A;  5B15 A;  5EHT A;  2CFU A;  4JO0 A;  2YNU A;  3WXC A;  3ESH A;  5LCA A;  3FAI A;  4YSK A;  3BC2 A;  4RAW A;  4AXH A;  4F6H A;  2CG3 A;  4EYL A;  2Q0J A;  5HH4 A;  3KL7 A;  4PDX A;  5EH9 A;  1M2X A;  5K4N A;  4XUK A;  5AEB A;  4WD6 A;  4PVO A;  5K4K A;  2GFJ A;  2R2D A;  3FCZ A;  2UYX A;  4ZO2 A;  4TZE A;  2Y8A A;  5LCF A;  2NZF A;  4Z7R A;  4Z5Y A;  4LE6 A;  1JJE A;  2P4Z A;  2Q0I A;  5EVB A;  3ZNB A;  3IOF A;  3X2X A;  4FEK A;  5HIO A;  3IEM A;  4EY2 A;  4GCW A;  3IOG A;  3I11 A;  4NUR A;  1WW1 A;  3R2U A;  1BVT A;  2ZZI A;  5FQA A;  1ZKP A;  5A5Z A;  5LMC A;  5ACX A;  4C1G A;  2QIN A;  3I14 A;  1MQO A;  3JXP A;  5LSC A;  4RM5 A;  4TYF A;  2WHG A;  5A87 A;  1QH5 A;  5K4M A;  5A0V A;  4GYQ A;  2FK6 A;  3BK1 A;  4AX0 B;  4AD9 A;  3IEK A;  1ZTC A;  4HL2 A;  4D1T A;  2BG6 A;  4BZ3 A;  4UWP B;  5EV6 A;  5ACQ A;  2P18 A;  3G1P A;  2XF4 A;  5B1U A;  2OHJ A;  5EVK A;  1WUO A;  3P2U A;  3X30 A;  4DIK A;  1KR3 A;  5AYA A;  2YNT A;  3SFP A;  2FHX B;  3MD7 A;  5HIQ A;  3RKK A;  4EFZ A;  5ACV A;  5AIJ A;  3IEL A;  2NYP A;  3X2Z A;  3SW3 A;  2FU8 A;  5AXO A;  1L9Y A;  4AX1 B;  4NQ5 A;  2I7V A;  4UWO B;  5ACS A;  3S0Z A;  3Q6V A;  4AWZ A;  3A4Y A;  4AWY B;  3IE2 A;  1QH3 A;  3ADR A;  5KIL A;  4TZF A;  1P9E A;  2ZWR A;  3DHC A;  4KEQ A;  1BMC A;  4C1C A;  2BTN A;  3IE0 A;  1KO2 A;  2GKL A;  2YCB A;  5HIP A;  4UWR B;  1JT1 A;  4D1W A;  4UAM A;  1E5D A;  3F9O A;  2OHH A;  2YNV B;  1DXK A;  4TZB A;  2YHE A;  5ACU A;  2AZ4 A;  4UWS B;  5A23 A;  4NQ4 A;  4C09 A;  1A7T A;  2XR1 A;  2A7M A;  2I7X A;  4FSB A;  3LVZ A;  2GCU A;  4KEP A;  2CFZ A;  2BC2 A;  3T3N A;  1XM8 A;  2P1E A;  2M5C A;  3SPU A;  5ACP A;  5EV8 A;  2NXA A;  2FHX A;  2BFZ A;  2GFK A;  1WRA A;  4NQ6 A;  2CBN A;  2BFK A;  4C1H A;  4ZNB A;  4P62 A;  4H0D A;  3VPE A;  4D1V A;  5KIK A;  5ACT A;  2BG8 A;  5DPX A;  5A0T A;  4HKY A;  5AJL A;  4RL2 A;  5HH6 A;  4TYT A;  4F6Z A;  4D1U A;  1Y44 A;  3PY5 A;  4B87 A;  2BGA A;  5EVD A;  2BMI A;  3T9M A;  4D02 A;  4EYB A;  2H6A A;  5AHO A;  3PG4 A;  1X8G A;  2QJS A;  2BFZ B;  3DHA A;  2YNT B;  3AF5 A;  3RKJ A;  3L6N A;  5LCH A;  4YSL A;  5LE1 A;  2ZNB A;  4U4L A;  2E7Y A;  2FM6 A;  2WYM A;  1DDK A;  5AXR A;  5HIS A;  4C1E A;  3TP9 A;  1YCF A;  1HLK A;  1VME A;  5AHR A;  5ACW A;  1DD6 A;  2NZE A;  3I0V A;  4C1F A;  3I15 A;  3KNR A;  3X2Y A;  1YCH A;  3AF6 A;  3RPC A;  4AV7 A;  4PVT A;  4CHL A;  2DOO A;  4FR7 A;  1WUP A;  3AJ3 A;  2P97 A;  3H3E A;  3ZQ4 A;  2WRS A;  4Z67 A;  2ZO4 A;  2Y8B A;  1K07 A;  2Q9U A;  3PY6 A;  1KO3 A;  2BG8 B;  2Q42 A;  1BC2 A;  4EYF A;  5K0W A;  4XWW A;  5ACR A;  4J5F A;  1SML A;  2YZ3 A;  5FQC A; 
#chains in the Genus database with same CATH homology
 5LLD A;  4ZO3 A;  3ZWF A;  3BV6 A;  5HH5 A;  3SD9 A;  3KNS A;  4ZEJ A;  5EWA A;  2BIB A;  2WYL A;  2VW8 A;  1X8H A;  3IDZ A;  5EW0 A;  4EXS A;  1VJN A;  4Z5Z A;  2FU7 A;  2OHI A;  4C1D A;  2QDS A;  2YNV A;  4HL1 A;  2GMN A;  3I13 A;  4NQ2 A;  5LM6 A;  4UBQ A;  4Z6X A;  2FU6 A;  4GYU A;  4YSB A;  3T3O A;  4RBS A;  2AIO A;  4EXY A;  4Z60 A;  3ZR9 A;  4UA4 A;  4XWT A;  1XTO A;  1X8I A;  4TZ9 A;  4RAM A;  2Y87 A;  4BP0 A;  2I7T A;  1VGN A;  1JJT A;  1A8T A;  3VQZ A;  4V0H A;  2WYM C;  5IQK A;  3DH8 A;  5B3R A;  1YCG A;  2FU9 A;  2QDT A;  2HB9 A;  4J5H A;  3IE1 A;  3BK2 A;  4DIL A;  2QED A;  2M5D A;  3SBL A;  4O98 A;  5FQB A;  3DHB A;  2BFL A;  1ZNB A;  2BG2 A;  2YNW A;  2BR6 A;  4RL0 A;  5LS3 A;  2BG7 A;  3SRX A;  2DKF A;  3QH8 A;  5B15 A;  5EHT A;  4JO0 A;  2YNU A;  3WXC A;  3ESH A;  5LCA A;  3FAI A;  4YSK A;  3BC2 A;  4RAW A;  4F6H A;  4EYL A;  2Q0J A;  5HH4 A;  3KL7 A;  5EH9 A;  1M2X A;  5K4N A;  4XUK A;  5AEB A;  4WD6 A;  4PVO A;  5K4K A;  2GFJ A;  2R2D A;  3FCZ A;  2UYX A;  4ZO2 A;  4TZE A;  2Y8A A;  5LCF A;  2NZF A;  4Z7R A;  4Z5Y A;  4LE6 A;  1JJE A;  2P4Z A;  2Q0I A;  5EVB A;  3ZNB A;  3IOF A;  3X2X A;  4FEK A;  5HIO A;  3IEM A;  4EY2 A;  4GCW A;  3IOG A;  3I11 A;  1WW1 A;  3R2U A;  1BVT A;  2ZZI A;  5FQA A;  1ZKP A;  5A5Z A;  5LMC A;  5ACX A;  4C1G A;  2QIN A;  3I14 A;  1MQO A;  3JXP A;  5LSC A;  4RM5 A;  4TYF A;  2WHG A;  5A87 A;  1QH5 A;  5K4M A;  5A0V A;  4GYQ A;  2FK6 A;  3BK1 A;  4AX0 B;  4AD9 A;  3IEK A;  1ZTC A;  4HL2 A;  4D1T A;  2BG6 A;  4BZ3 A;  4UWP B;  5EV6 A;  5ACQ A;  2P18 A;  3G1P A;  2XF4 A;  5B1U A;  2OHJ A;  5EVK A;  1WUO A;  3P2U A;  3X30 A;  4DIK A;  1KR3 A;  5AYA A;  2YNT A;  3SFP A;  2FHX B;  3MD7 A;  5HIQ A;  3RKK A;  4EFZ A;  5ACV A;  3IEL A;  2NYP A;  3X2Z A;  3SW3 A;  2FU8 A;  5AXO A;  1L9Y A;  4AX1 B;  4NQ5 A;  2I7V A;  4UWO B;  5ACS A;  3S0Z A;  3Q6V A;  4AWZ A;  3A4Y A;  4AWY B;  3IE2 A;  1QH3 A;  3ADR A;  5KIL A;  4TZF A;  1P9E A;  2ZWR A;  3DHC A;  4KEQ A;  1BMC A;  4C1C A;  2BTN A;  3IE0 A;  1KO2 A;  2GKL A;  2YCB A;  5HIP A;  4UWR B;  1JT1 A;  4D1W A;  4UAM A;  1E5D A;  3F9O A;  2OHH A;  2YNV B;  1DXK A;  4TZB A;  5ACU A;  2AZ4 A;  4UWS B;  4NQ4 A;  4C09 A;  1A7T A;  2XR1 A;  2A7M A;  2I7X A;  4FSB A;  3LVZ A;  2GCU A;  4KEP A;  2BC2 A;  3T3N A;  1XM8 A;  2P1E A;  2M5C A;  3SPU A;  5ACP A;  5EV8 A;  2NXA A;  2FHX A;  2BFZ A;  2GFK A;  1WRA A;  4NQ6 A;  2CBN A;  2BFK A;  4C1H A;  4ZNB A;  4P62 A;  4H0D A;  3VPE A;  4D1V A;  5KIK A;  5ACT A;  2BG8 A;  5DPX A;  5A0T A;  4HKY A;  4RL2 A;  5HH6 A;  4TYT A;  4F6Z A;  4D1U A;  1Y44 A;  3PY5 A;  4B87 A;  2BGA A;  5EVD A;  2BMI A;  3T9M A;  4D02 A;  4EYB A;  2H6A A;  5AHO A;  3PG4 A;  1X8G A;  2QJS A;  2BFZ B;  3DHA A;  2YNT B;  3AF5 A;  3RKJ A;  3L6N A;  5LCH A;  4YSL A;  5LE1 A;  2ZNB A;  4U4L A;  2E7Y A;  2FM6 A;  2WYM A;  1DDK A;  5AXR A;  5HIS A;  4C1E A;  3TP9 A;  1YCF A;  1HLK A;  1VME A;  5AHR A;  5ACW A;  1DD6 A;  2NZE A;  3I0V A;  4C1F A;  3I15 A;  3KNR A;  3X2Y A;  1YCH A;  3AF6 A;  3RPC A;  4PVT A;  4CHL A;  2DOO A;  4FR7 A;  1WUP A;  3AJ3 A;  2P97 A;  3H3E A;  3ZQ4 A;  2WRS A;  4Z67 A;  2ZO4 A;  2Y8B A;  1K07 A;  2Q9U A;  3PY6 A;  1KO3 A;  2BG8 B;  2Q42 A;  1BC2 A;  4EYF A;  5K0W A;  4XWW A;  5ACR A;  4J5F A;  1SML A;  2YZ3 A;  5FQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...