3DHCA

1.3 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homocysteine bound to the catalytic metal center
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
molecule keywords N-Acyl Homoserine Lactone Hydrolase
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhcA01
5KIKA 4C1FA 3ZWFA 2Y8BA 4HL1A 5EVBA 3Q6VA 4F6HA 2YNTB 2I7TA 1YCGA 2GKLA 2XF4A 4DILA 4C1DA 2AIOA 3IELA 2BG2A 1BVTA 5K0WA 4AX1B 2Q9UA 3X2ZA 3BK2A 5B3RA 3I0VA 5AXOA 4AWYB 5EW0A 4J5HA 2I7XA 5A0VA 1DXKA 4ZO2A 4UWPB 5KILA 1KR3A 1ZKPA 1VJNA 4UWSB 2QINA 2UYXA 2M5CA 4Z67A 4BP0A 3TP9A 3SPUA 4FEKA 2BC2A 1MQOA 3F9OA 4XWWA 3VPEA 3IDZA 4AWZA 4TZBA 4B87A 3BV6A 3FCZA 2A7MA 1WRAA 1BMCA 5HH5A 1ZNBA 1KO2A 5AXRA 2GMNA 5LS3A 2E7YA 3AF5A 1M2XA 4J5FA 2YCBA 4UA4A 3SRXA 5FQBA 4AD9A 4C1GA 2DKFA 2FHXB 5A5ZA 4NQ6A 2BGAA 5HH4A 4NQ2A 3X2YA 5LLDA 2FM6A 4AX0B 2WYLA 2H6AA 4NQ5A 2VW8A 4XWTA 2WRSA 2P18A 1QH5A 4HL2A 2P4ZA 5EWAA 1XM8A 3BK1A 5HH6A 2ZWRA 1A8TA 5HISA 2YNVB 4PVOA 1SMLA 1YCHA 5HIQA 3SW3A 2BR6A 2ZZIA 4Z5ZA 2FU6A 4C1CA 4TZEA 3R2UA 5EH9A 4D1VA 3AF6A 5LCAA 4UWRB 5IQKA 4TZFA 5A87A 5EV6A 4GYUA 5ACTA 3KNSA 1X8IA 1VGNA 1YCFA 2GCUA 2P97A 3RKKA 2FU7A 4TYTA 1JJTA 4YSKA 4KEQA 3KNRA 3A4YA 4LE6A 4RM5A 2AZ4A 4FR7A 4EXSA 3WXCA 3IOGA 5LE1A 2FHXA 5ACPA 4U4LA 3VQZA 3X2XA 1HLKA 4JO0A 2OHIA 2BFKA 5EVDA 2QDSA 3H3EA 4HKYA 2NZEA 2OHHA 1DDKA 3AJ3A 5DPXA 3JXPA 3T3OA 2Y87A 3DH8A 2GFJA 4O98A 2BMIA 1X8GA 5LCHA 2FU9A 2YNVA 2BFLA 3PG4A 3DHAA 5EV8A 3ZR9A 5B15A 2GFKA 3QH8A 3LVZA 3IEMA 4ZNBA 3FAIA 4P62A 4XUKA 5FQAA 3L6NA 2Q42A 3ZNBA 5AHRA 5ACQA 3KL7A 5EHTA 2BG8B 3I15A 1X8HA 5HIOA 1WUOA 4Z60A 4GCWA 3DHCA 2YZ3A 3IE2A 2BG7A 5LM6A 1E5DA 1ZTCA 1DD6A 5K4KA 5ACUA 4RBSA 1Y44A 2CBNA 2I7VA 4YSBA 4C09A 2NZFA 3SD9A 2YNTA 2YNUA 5EVKA 1JJEA 4KEPA 3SBLA 2NXAA 3IEKA 4Z7RA 4FSBA 1P9EA 1VMEA 2BIBA 2XR1A 4GYQA 4EYFA 3ZQ4A 5A0TA 4EYBA 3RPCA 3RKJA 4D1TA 1JT1A 5K4MA 5ACWA 1XTOA 3IE1A 3I14A 2QJSA 3SFPA 4YSLA 5AEBA 1K07A 5ACVA 2R2DA 2ZNBA 4Z5YA 2BFZA 2WHGA 4D02A 3IE0A 2P1EA 4EFZA 5LSCA 4PVTA 3T9MA 2QEDA 3X30A 4Z6XA 3T3NA 1WUPA 4WD6A 4RL0A 2BG6A 2DOOA 3PY5A 4ZEJA 3S0ZA 2OHJA 5LMCA 3ESHA 2YNWA 2FK6A 4DIKA 4D1UA 1L9YA 3MD7A 4C1HA 4EY2A 3PY6A 1WW1A 2M5DA 2WYMA 4UBQA 5AYAA 1BC2A 1QH3A 2WYMC 5ACSA 3G1PA 2BTNA 3BC2A 4EYLA 5B1UA 5ACXA 2NYPA 4RAMA 4D1WA 2QDTA 3DHBA 5ACRA 2BFZB 4ZO3A 3P2UA 5FQCA 1A7TA 4UAMA 4H0DA 2Y8AA 4RL2A 4UWOB 1KO3A 4EXYA 3I13A 4V0HA 2Q0IA 4TZ9A 5AHOA 2ZO4A 4TYFA 3IOFA 4BZ3A 4F6ZA 3ADRA 3I11A 4C1EA 5LCFA 4CHLA 2Q0JA 4NQ4A 4RAWA 5HIPA 2FU8A 2HB9A 5K4NA 2BG8A
chains in the Genus database with same CATH superfamily
5KIKA 4C1FA 3ZWFA 2Y8BA 2YHEA 4HL1A 5EVBA 3Q6VA 4F6HA 2YNTB 2I7TA 1YCGA 2GKLA 2XF4A 4DILA 4C1DA 4NURA 2AIOA 3IELA 2BG2A 1BVTA 5K0WA 4AX1B 2Q9UA 3X2ZA 4AV7A 3BK2A 5B3RA 3I0VA 5AXOA 4AWYB 5EW0A 4J5HA 2I7XA 5A0VA 1DXKA 4ZO2A 4UWPB 5KILA 1KR3A 1ZKPA 1VJNA 4UWSB 2QINA 2UYXA 2M5CA 2CG2A 4Z67A 4BP0A 3TP9A 3SPUA 4FEKA 2BC2A 1MQOA 3F9OA 4XWWA 3VPEA 3IDZA 4AWZA 4TZBA 4B87A 3BV6A 3FCZA 5A23A 2A7MA 1WRAA 1BMCA 5HH5A 1ZNBA 1KO2A 5AXRA 2GMNA 5LS3A 2E7YA 3AF5A 1M2XA 4J5FA 2YCBA 4UA4A 3SRXA 5FQBA 4AD9A 4C1GA 2DKFA 5A5ZA 2FHXB 4NQ6A 2BGAA 5HH4A 5AJLA 4NQ2A 3X2YA 5LLDA 2FM6A 4AX0B 2WYLA 2H6AA 4NQ5A 2VW8A 4XWTA 2WRSA 2P18A 1QH5A 4HL2A 2P4ZA 5EWAA 1XM8A 3BK1A 5HH6A 2ZWRA 1A8TA 5HISA 2YNVB 4PVOA 1SMLA 1YCHA 5HIQA 3SW3A 2BR6A 2ZZIA 4Z5ZA 2FU6A 4C1CA 4TZEA 3R2UA 5EH9A 4D1VA 3AF6A 5LCAA 4PDXA 4UWRB 5IQKA 4TZFA 5A87A 5EV6A 4GYUA 5ACTA 3KNSA 1X8IA 1VGNA 1YCFA 2GCUA 2P97A 3RKKA 2FU7A 4TYTA 1JJTA 4YSKA 4KEQA 3KNRA 3A4YA 4LE6A 4RM5A 2AZ4A 4FR7A 4EXSA 3WXCA 3IOGA 5LE1A 2FHXA 5ACPA 4U4LA 3VQZA 3X2XA 1HLKA 4JO0A 2OHIA 2BFKA 5EVDA 2QDSA 3H3EA 4HKYA 2NZEA 2OHHA 1DDKA 3AJ3A 5DPXA 3JXPA 3T3OA 2Y87A 3DH8A 2GFJA 4O98A 2BMIA 1X8GA 5LCHA 2FU9A 2YNVA 2BFLA 3PG4A 3DHAA 5EV8A 3ZR9A 5B15A 2GFKA 3QH8A 3LVZA 3IEMA 4ZNBA 5AIJA 3FAIA 4P62A 4XUKA 5FQAA 3L6NA 2Q42A 3ZNBA 5AHRA 5ACQA 3KL7A 5EHTA 2BG8B 3I15A 1X8HA 5HIOA 1WUOA 4Z60A 4GCWA 3DHCA 2YZ3A 3IE2A 2BG7A 5LM6A 1E5DA 1ZTCA 1DD6A 5K4KA 5ACUA 4RBSA 1Y44A 2CBNA 2I7VA 4YSBA 4C09A 2NZFA 3SD9A 2YNTA 2YNUA 5EVKA 1JJEA 4KEPA 3SBLA 2NXAA 3IEKA 4Z7RA 4FSBA 1P9EA 1VMEA 2BIBA 2XR1A 4GYQA 4EYFA 3ZQ4A 5A0TA 4EYBA 3RPCA 3RKJA 2CFZA 4D1TA 1JT1A 5K4MA 5ACWA 1XTOA 3IE1A 2CFUA 3I14A 2QJSA 3SFPA 4YSLA 5AEBA 1K07A 5ACVA 2R2DA 2ZNBA 4Z5YA 2BFZA 2WHGA 4D02A 3IE0A 2P1EA 4EFZA 5LSCA 4PVTA 3T9MA 2QEDA 3X30A 4Z6XA 3T3NA 1WUPA 4WD6A 4RL0A 2BG6A 2DOOA 3PY5A 4ZEJA 3S0ZA 2OHJA 5LMCA 3ESHA 2YNWA 2FK6A 4DIKA 4D1UA 1L9YA 3MD7A 4C1HA 4EY2A 3PY6A 1WW1A 2M5DA 2WYMA 4UBQA 5AYAA 2CG3A 1BC2A 1QH3A 2WYMC 5ACSA 3G1PA 4AXHA 2BTNA 3BC2A 4EYLA 5B1UA 5ACXA 2NYPA 4RAMA 4D1WA 2QDTA 3DHBA 5ACRA 2BFZB 4ZO3A 3P2UA 5FQCA 1A7TA 4UAMA 4H0DA 2Y8AA 4RL2A 4UWOB 1KO3A 4EXYA 3I13A 4V0HA 2Q0IA 4TZ9A 5AHOA 2ZO4A 4TYFA 3IOFA 4BZ3A 4F6ZA 3ADRA 3I11A 4C1EA 5LCFA 4CHLA 2Q0JA 4NQ4A 4RAWA 5HIPA 2FU8A 2HB9A 5K4NA 2BG8A
chains in the Genus database with same CATH topology
5KIKA 4C1FA 3ZWFA 2Y8BA 4HL1A 5EVBA 3Q6VA 4F6HA 2YNTB 2I7TA 1YCGA 2GKLA 2XF4A 4DILA 4C1DA 2AIOA 3IELA 2BG2A 1BVTA 5K0WA 4AX1B 2Q9UA 3X2ZA 3BK2A 5B3RA 3I0VA 5AXOA 4AWYB 5EW0A 4J5HA 2I7XA 5A0VA 1DXKA 4ZO2A 4UWPB 5KILA 1KR3A 1ZKPA 1VJNA 4UWSB 2QINA 2UYXA 2M5CA 4Z67A 4BP0A 3TP9A 3SPUA 4FEKA 2BC2A 1MQOA 3F9OA 4XWWA 3VPEA 3IDZA 4AWZA 4TZBA 4B87A 3BV6A 3FCZA 2A7MA 1WRAA 1BMCA 5HH5A 1ZNBA 1KO2A 5AXRA 2GMNA 5LS3A 2E7YA 3AF5A 1M2XA 4J5FA 2YCBA 4UA4A 3SRXA 5FQBA 4AD9A 4C1GA 2DKFA 2FHXB 5A5ZA 4NQ6A 2BGAA 5HH4A 4NQ2A 3X2YA 5LLDA 2FM6A 4AX0B 2WYLA 2H6AA 4NQ5A 2VW8A 4XWTA 2WRSA 2P18A 1QH5A 4HL2A 2P4ZA 5EWAA 1XM8A 3BK1A 5HH6A 2ZWRA 1A8TA 5HISA 2YNVB 4PVOA 1SMLA 1YCHA 5HIQA 3SW3A 2BR6A 2ZZIA 4Z5ZA 2FU6A 4C1CA 4TZEA 3R2UA 5EH9A 4D1VA 3AF6A 5LCAA 4UWRB 5IQKA 4TZFA 5A87A 5EV6A 4GYUA 5ACTA 3KNSA 1X8IA 1VGNA 1YCFA 2GCUA 2P97A 3RKKA 2FU7A 4TYTA 1JJTA 4YSKA 4KEQA 3KNRA 3A4YA 4LE6A 4RM5A 2AZ4A 4FR7A 4EXSA 3WXCA 3IOGA 5LE1A 2FHXA 5ACPA 4U4LA 3VQZA 3X2XA 1HLKA 4JO0A 2OHIA 2BFKA 5EVDA 2QDSA 3H3EA 4HKYA 2NZEA 2OHHA 1DDKA 3AJ3A 5DPXA 3JXPA 3T3OA 2Y87A 3DH8A 2GFJA 4O98A 2BMIA 1X8GA 5LCHA 2FU9A 2YNVA 2BFLA 3PG4A 3DHAA 5EV8A 3ZR9A 5B15A 2GFKA 3QH8A 3LVZA 3IEMA 4ZNBA 3FAIA 4P62A 4XUKA 5FQAA 3L6NA 2Q42A 3ZNBA 5AHRA 5ACQA 3KL7A 5EHTA 2BG8B 3I15A 1X8HA 5HIOA 1WUOA 4Z60A 4GCWA 3DHCA 2YZ3A 3IE2A 2BG7A 5LM6A 1E5DA 1ZTCA 1DD6A 5K4KA 5ACUA 4RBSA 1Y44A 2CBNA 2I7VA 4YSBA 4C09A 2NZFA 3SD9A 2YNTA 2YNUA 5EVKA 1JJEA 4KEPA 3SBLA 2NXAA 3IEKA 4Z7RA 4FSBA 1P9EA 1VMEA 2BIBA 2XR1A 4GYQA 4EYFA 3ZQ4A 5A0TA 4EYBA 3RPCA 3RKJA 4D1TA 1JT1A 5K4MA 5ACWA 1XTOA 3IE1A 3I14A 2QJSA 3SFPA 4YSLA 5AEBA 1K07A 5ACVA 2R2DA 2ZNBA 4Z5YA 2BFZA 2WHGA 4D02A 3IE0A 2P1EA 4EFZA 5LSCA 4PVTA 3T9MA 2QEDA 3X30A 4Z6XA 3T3NA 1WUPA 4WD6A 4RL0A 2BG6A 2DOOA 3PY5A 4ZEJA 3S0ZA 2OHJA 5LMCA 3ESHA 2YNWA 2FK6A 4DIKA 4D1UA 1L9YA 3MD7A 4C1HA 4EY2A 3PY6A 1WW1A 2M5DA 2WYMA 4UBQA 5AYAA 1BC2A 1QH3A 2WYMC 5ACSA 3G1PA 2BTNA 3BC2A 4EYLA 5B1UA 5ACXA 2NYPA 4RAMA 4D1WA 2QDTA 3DHBA 5ACRA 2BFZB 4ZO3A 3P2UA 5FQCA 1A7TA 4UAMA 4H0DA 2Y8AA 4RL2A 4UWOB 1KO3A 4EXYA 3I13A 4V0HA 2Q0IA 4TZ9A 5AHOA 2ZO4A 4TYFA 3IOFA 4BZ3A 4F6ZA 3ADRA 3I11A 4C1EA 5LCFA 4CHLA 2Q0JA 4NQ4A 4RAWA 5HIPA 2FU8A 2HB9A 5K4NA 2BG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIK A;  4C1F A;  3ZWF A;  2Y8B A;  4HL1 A;  5EVB A;  3Q6V A;  4F6H A;  2YNT B;  2I7T A;  1YCG A;  2GKL A;  2XF4 A;  4DIL A;  4C1D A;  2AIO A;  3IEL A;  2BG2 A;  1BVT A;  5K0W A;  4AX1 B;  2Q9U A;  3X2Z A;  3BK2 A;  5B3R A;  3I0V A;  5AXO A;  4AWY B;  5EW0 A;  4J5H A;  2I7X A;  5A0V A;  1DXK A;  4ZO2 A;  4UWP B;  5KIL A;  1KR3 A;  1ZKP A;  1VJN A;  4UWS B;  2QIN A;  2UYX A;  2M5C A;  4Z67 A;  4BP0 A;  3TP9 A;  3SPU A;  4FEK A;  2BC2 A;  1MQO A;  3F9O A;  4XWW A;  3VPE A;  3IDZ A;  4AWZ A;  4TZB A;  4B87 A;  3BV6 A;  3FCZ A;  2A7M A;  1WRA A;  1BMC A;  5HH5 A;  1ZNB A;  1KO2 A;  5AXR A;  2GMN A;  5LS3 A;  2E7Y A;  3AF5 A;  1M2X A;  4J5F A;  2YCB A;  4UA4 A;  3SRX A;  5FQB A;  4AD9 A;  4C1G A;  2DKF A;  2FHX B;  5A5Z A;  4NQ6 A;  2BGA A;  5HH4 A;  4NQ2 A;  3X2Y A;  5LLD A;  2FM6 A;  4AX0 B;  2WYL A;  2H6A A;  4NQ5 A;  2VW8 A;  4XWT A;  2WRS A;  2P18 A;  1QH5 A;  4HL2 A;  2P4Z A;  5EWA A;  1XM8 A;  3BK1 A;  5HH6 A;  2ZWR A;  1A8T A;  5HIS A;  2YNV B;  4PVO A;  1SML A;  1YCH A;  5HIQ A;  3SW3 A;  2BR6 A;  2ZZI A;  4Z5Z A;  2FU6 A;  4C1C A;  4TZE A;  3R2U A;  5EH9 A;  4D1V A;  3AF6 A;  5LCA A;  4UWR B;  5IQK A;  4TZF A;  5A87 A;  5EV6 A;  4GYU A;  5ACT A;  3KNS A;  1X8I A;  1VGN A;  1YCF A;  2GCU A;  2P97 A;  3RKK A;  2FU7 A;  4TYT A;  1JJT A;  4YSK A;  4KEQ A;  3KNR A;  3A4Y A;  4LE6 A;  4RM5 A;  2AZ4 A;  4FR7 A;  4EXS A;  3WXC A;  3IOG A;  5LE1 A;  2FHX A;  5ACP A;  4U4L A;  3VQZ A;  3X2X A;  1HLK A;  4JO0 A;  2OHI A;  2BFK A;  5EVD A;  2QDS A;  3H3E A;  4HKY A;  2NZE A;  2OHH A;  1DDK A;  3AJ3 A;  5DPX A;  3JXP A;  3T3O A;  2Y87 A;  3DH8 A;  2GFJ A;  4O98 A;  2BMI A;  1X8G A;  5LCH A;  2FU9 A;  2YNV A;  2BFL A;  3PG4 A;  3DHA A;  5EV8 A;  3ZR9 A;  5B15 A;  2GFK A;  3QH8 A;  3LVZ A;  3IEM A;  4ZNB A;  3FAI A;  4P62 A;  4XUK A;  5FQA A;  3L6N A;  2Q42 A;  3ZNB A;  5AHR A;  5ACQ A;  3KL7 A;  5EHT A;  2BG8 B;  3I15 A;  1X8H A;  5HIO A;  1WUO A;  4Z60 A;  4GCW A;  3DHC A;  2YZ3 A;  3IE2 A;  2BG7 A;  5LM6 A;  1E5D A;  1ZTC A;  1DD6 A;  5K4K A;  5ACU A;  4RBS A;  1Y44 A;  2CBN A;  2I7V A;  4YSB A;  4C09 A;  2NZF A;  3SD9 A;  2YNT A;  2YNU A;  5EVK A;  1JJE A;  4KEP A;  3SBL A;  2NXA A;  3IEK A;  4Z7R A;  4FSB A;  1P9E A;  1VME A;  2BIB A;  2XR1 A;  4GYQ A;  4EYF A;  3ZQ4 A;  5A0T A;  4EYB A;  3RPC A;  3RKJ A;  4D1T A;  1JT1 A;  5K4M A;  5ACW A;  1XTO A;  3IE1 A;  3I14 A;  2QJS A;  3SFP A;  4YSL A;  5AEB A;  1K07 A;  5ACV A;  2R2D A;  2ZNB A;  4Z5Y A;  2BFZ A;  2WHG A;  4D02 A;  3IE0 A;  2P1E A;  4EFZ A;  5LSC A;  4PVT A;  3T9M A;  2QED A;  3X30 A;  4Z6X A;  3T3N A;  1WUP A;  4WD6 A;  4RL0 A;  2BG6 A;  2DOO A;  3PY5 A;  4ZEJ A;  3S0Z A;  2OHJ A;  5LMC A;  3ESH A;  2YNW A;  2FK6 A;  4DIK A;  4D1U A;  1L9Y A;  3MD7 A;  4C1H A;  4EY2 A;  3PY6 A;  1WW1 A;  2M5D A;  2WYM A;  4UBQ A;  5AYA A;  1BC2 A;  1QH3 A;  2WYM C;  5ACS A;  3G1P A;  2BTN A;  3BC2 A;  4EYL A;  5B1U A;  5ACX A;  2NYP A;  4RAM A;  4D1W A;  2QDT A;  3DHB A;  5ACR A;  2BFZ B;  4ZO3 A;  3P2U A;  5FQC A;  1A7T A;  4UAM A;  4H0D A;  2Y8A A;  4RL2 A;  4UWO B;  1KO3 A;  4EXY A;  3I13 A;  4V0H A;  2Q0I A;  4TZ9 A;  5AHO A;  2ZO4 A;  4TYF A;  3IOF A;  4BZ3 A;  4F6Z A;  3ADR A;  3I11 A;  4C1E A;  5LCF A;  4CHL A;  2Q0J A;  4NQ4 A;  4RAW A;  5HIP A;  2FU8 A;  2HB9 A;  5K4N A;  2BG8 A; 
#chains in the Genus database with same CATH topology
 5KIK A;  4C1F A;  3ZWF A;  2Y8B A;  2YHE A;  4HL1 A;  5EVB A;  3Q6V A;  4F6H A;  2YNT B;  2I7T A;  1YCG A;  2GKL A;  2XF4 A;  4DIL A;  4C1D A;  4NUR A;  2AIO A;  3IEL A;  2BG2 A;  1BVT A;  5K0W A;  4AX1 B;  2Q9U A;  3X2Z A;  4AV7 A;  3BK2 A;  5B3R A;  3I0V A;  5AXO A;  4AWY B;  5EW0 A;  4J5H A;  2I7X A;  5A0V A;  1DXK A;  4ZO2 A;  4UWP B;  5KIL A;  1KR3 A;  1ZKP A;  1VJN A;  4UWS B;  2QIN A;  2UYX A;  2M5C A;  2CG2 A;  4Z67 A;  4BP0 A;  3TP9 A;  3SPU A;  4FEK A;  2BC2 A;  1MQO A;  3F9O A;  4XWW A;  3VPE A;  3IDZ A;  4AWZ A;  4TZB A;  4B87 A;  3BV6 A;  3FCZ A;  5A23 A;  2A7M A;  1WRA A;  1BMC A;  5HH5 A;  1ZNB A;  1KO2 A;  5AXR A;  2GMN A;  5LS3 A;  2E7Y A;  3AF5 A;  1M2X A;  4J5F A;  2YCB A;  4UA4 A;  3SRX A;  5FQB A;  4AD9 A;  4C1G A;  2DKF A;  5A5Z A;  2FHX B;  4NQ6 A;  2BGA A;  5HH4 A;  5AJL A;  4NQ2 A;  3X2Y A;  5LLD A;  2FM6 A;  4AX0 B;  2WYL A;  2H6A A;  4NQ5 A;  2VW8 A;  4XWT A;  2WRS A;  2P18 A;  1QH5 A;  4HL2 A;  2P4Z A;  5EWA A;  1XM8 A;  3BK1 A;  5HH6 A;  2ZWR A;  1A8T A;  5HIS A;  2YNV B;  4PVO A;  1SML A;  1YCH A;  5HIQ A;  3SW3 A;  2BR6 A;  2ZZI A;  4Z5Z A;  2FU6 A;  4C1C A;  4TZE A;  3R2U A;  5EH9 A;  4D1V A;  3AF6 A;  5LCA A;  4PDX A;  4UWR B;  5IQK A;  4TZF A;  5A87 A;  5EV6 A;  4GYU A;  5ACT A;  3KNS A;  1X8I A;  1VGN A;  1YCF A;  2GCU A;  2P97 A;  3RKK A;  2FU7 A;  4TYT A;  1JJT A;  4YSK A;  4KEQ A;  3KNR A;  3A4Y A;  4LE6 A;  4RM5 A;  2AZ4 A;  4FR7 A;  4EXS A;  3WXC A;  3IOG A;  5LE1 A;  2FHX A;  5ACP A;  4U4L A;  3VQZ A;  3X2X A;  1HLK A;  4JO0 A;  2OHI A;  2BFK A;  5EVD A;  2QDS A;  3H3E A;  4HKY A;  2NZE A;  2OHH A;  1DDK A;  3AJ3 A;  5DPX A;  3JXP A;  3T3O A;  2Y87 A;  3DH8 A;  2GFJ A;  4O98 A;  2BMI A;  1X8G A;  5LCH A;  2FU9 A;  2YNV A;  2BFL A;  3PG4 A;  3DHA A;  5EV8 A;  3ZR9 A;  5B15 A;  2GFK A;  3QH8 A;  3LVZ A;  3IEM A;  4ZNB A;  5AIJ A;  3FAI A;  4P62 A;  4XUK A;  5FQA A;  3L6N A;  2Q42 A;  3ZNB A;  5AHR A;  5ACQ A;  3KL7 A;  5EHT A;  2BG8 B;  3I15 A;  1X8H A;  5HIO A;  1WUO A;  4Z60 A;  4GCW A;  3DHC A;  2YZ3 A;  3IE2 A;  2BG7 A;  5LM6 A;  1E5D A;  1ZTC A;  1DD6 A;  5K4K A;  5ACU A;  4RBS A;  1Y44 A;  2CBN A;  2I7V A;  4YSB A;  4C09 A;  2NZF A;  3SD9 A;  2YNT A;  2YNU A;  5EVK A;  1JJE A;  4KEP A;  3SBL A;  2NXA A;  3IEK A;  4Z7R A;  4FSB A;  1P9E A;  1VME A;  2BIB A;  2XR1 A;  4GYQ A;  4EYF A;  3ZQ4 A;  5A0T A;  4EYB A;  3RPC A;  3RKJ A;  2CFZ A;  4D1T A;  1JT1 A;  5K4M A;  5ACW A;  1XTO A;  3IE1 A;  2CFU A;  3I14 A;  2QJS A;  3SFP A;  4YSL A;  5AEB A;  1K07 A;  5ACV A;  2R2D A;  2ZNB A;  4Z5Y A;  2BFZ A;  2WHG A;  4D02 A;  3IE0 A;  2P1E A;  4EFZ A;  5LSC A;  4PVT A;  3T9M A;  2QED A;  3X30 A;  4Z6X A;  3T3N A;  1WUP A;  4WD6 A;  4RL0 A;  2BG6 A;  2DOO A;  3PY5 A;  4ZEJ A;  3S0Z A;  2OHJ A;  5LMC A;  3ESH A;  2YNW A;  2FK6 A;  4DIK A;  4D1U A;  1L9Y A;  3MD7 A;  4C1H A;  4EY2 A;  3PY6 A;  1WW1 A;  2M5D A;  2WYM A;  4UBQ A;  5AYA A;  2CG3 A;  1BC2 A;  1QH3 A;  2WYM C;  5ACS A;  3G1P A;  4AXH A;  2BTN A;  3BC2 A;  4EYL A;  5B1U A;  5ACX A;  2NYP A;  4RAM A;  4D1W A;  2QDT A;  3DHB A;  5ACR A;  2BFZ B;  4ZO3 A;  3P2U A;  5FQC A;  1A7T A;  4UAM A;  4H0D A;  2Y8A A;  4RL2 A;  4UWO B;  1KO3 A;  4EXY A;  3I13 A;  4V0H A;  2Q0I A;  4TZ9 A;  5AHO A;  2ZO4 A;  4TYF A;  3IOF A;  4BZ3 A;  4F6Z A;  3ADR A;  3I11 A;  4C1E A;  5LCF A;  4CHL A;  2Q0J A;  4NQ4 A;  4RAW A;  5HIP A;  2FU8 A;  2HB9 A;  5K4N A;  2BG8 A; 
#chains in the Genus database with same CATH homology
 5KIK A;  4C1F A;  3ZWF A;  2Y8B A;  4HL1 A;  5EVB A;  3Q6V A;  4F6H A;  2YNT B;  2I7T A;  1YCG A;  2GKL A;  2XF4 A;  4DIL A;  4C1D A;  2AIO A;  3IEL A;  2BG2 A;  1BVT A;  5K0W A;  4AX1 B;  2Q9U A;  3X2Z A;  3BK2 A;  5B3R A;  3I0V A;  5AXO A;  4AWY B;  5EW0 A;  4J5H A;  2I7X A;  5A0V A;  1DXK A;  4ZO2 A;  4UWP B;  5KIL A;  1KR3 A;  1ZKP A;  1VJN A;  4UWS B;  2QIN A;  2UYX A;  2M5C A;  4Z67 A;  4BP0 A;  3TP9 A;  3SPU A;  4FEK A;  2BC2 A;  1MQO A;  3F9O A;  4XWW A;  3VPE A;  3IDZ A;  4AWZ A;  4TZB A;  4B87 A;  3BV6 A;  3FCZ A;  2A7M A;  1WRA A;  1BMC A;  5HH5 A;  1ZNB A;  1KO2 A;  5AXR A;  2GMN A;  5LS3 A;  2E7Y A;  3AF5 A;  1M2X A;  4J5F A;  2YCB A;  4UA4 A;  3SRX A;  5FQB A;  4AD9 A;  4C1G A;  2DKF A;  2FHX B;  5A5Z A;  4NQ6 A;  2BGA A;  5HH4 A;  4NQ2 A;  3X2Y A;  5LLD A;  2FM6 A;  4AX0 B;  2WYL A;  2H6A A;  4NQ5 A;  2VW8 A;  4XWT A;  2WRS A;  2P18 A;  1QH5 A;  4HL2 A;  2P4Z A;  5EWA A;  1XM8 A;  3BK1 A;  5HH6 A;  2ZWR A;  1A8T A;  5HIS A;  2YNV B;  4PVO A;  1SML A;  1YCH A;  5HIQ A;  3SW3 A;  2BR6 A;  2ZZI A;  4Z5Z A;  2FU6 A;  4C1C A;  4TZE A;  3R2U A;  5EH9 A;  4D1V A;  3AF6 A;  5LCA A;  4UWR B;  5IQK A;  4TZF A;  5A87 A;  5EV6 A;  4GYU A;  5ACT A;  3KNS A;  1X8I A;  1VGN A;  1YCF A;  2GCU A;  2P97 A;  3RKK A;  2FU7 A;  4TYT A;  1JJT A;  4YSK A;  4KEQ A;  3KNR A;  3A4Y A;  4LE6 A;  4RM5 A;  2AZ4 A;  4FR7 A;  4EXS A;  3WXC A;  3IOG A;  5LE1 A;  2FHX A;  5ACP A;  4U4L A;  3VQZ A;  3X2X A;  1HLK A;  4JO0 A;  2OHI A;  2BFK A;  5EVD A;  2QDS A;  3H3E A;  4HKY A;  2NZE A;  2OHH A;  1DDK A;  3AJ3 A;  5DPX A;  3JXP A;  3T3O A;  2Y87 A;  3DH8 A;  2GFJ A;  4O98 A;  2BMI A;  1X8G A;  5LCH A;  2FU9 A;  2YNV A;  2BFL A;  3PG4 A;  3DHA A;  5EV8 A;  3ZR9 A;  5B15 A;  2GFK A;  3QH8 A;  3LVZ A;  3IEM A;  4ZNB A;  3FAI A;  4P62 A;  4XUK A;  5FQA A;  3L6N A;  2Q42 A;  3ZNB A;  5AHR A;  5ACQ A;  3KL7 A;  5EHT A;  2BG8 B;  3I15 A;  1X8H A;  5HIO A;  1WUO A;  4Z60 A;  4GCW A;  3DHC A;  2YZ3 A;  3IE2 A;  2BG7 A;  5LM6 A;  1E5D A;  1ZTC A;  1DD6 A;  5K4K A;  5ACU A;  4RBS A;  1Y44 A;  2CBN A;  2I7V A;  4YSB A;  4C09 A;  2NZF A;  3SD9 A;  2YNT A;  2YNU A;  5EVK A;  1JJE A;  4KEP A;  3SBL A;  2NXA A;  3IEK A;  4Z7R A;  4FSB A;  1P9E A;  1VME A;  2BIB A;  2XR1 A;  4GYQ A;  4EYF A;  3ZQ4 A;  5A0T A;  4EYB A;  3RPC A;  3RKJ A;  4D1T A;  1JT1 A;  5K4M A;  5ACW A;  1XTO A;  3IE1 A;  3I14 A;  2QJS A;  3SFP A;  4YSL A;  5AEB A;  1K07 A;  5ACV A;  2R2D A;  2ZNB A;  4Z5Y A;  2BFZ A;  2WHG A;  4D02 A;  3IE0 A;  2P1E A;  4EFZ A;  5LSC A;  4PVT A;  3T9M A;  2QED A;  3X30 A;  4Z6X A;  3T3N A;  1WUP A;  4WD6 A;  4RL0 A;  2BG6 A;  2DOO A;  3PY5 A;  4ZEJ A;  3S0Z A;  2OHJ A;  5LMC A;  3ESH A;  2YNW A;  2FK6 A;  4DIK A;  4D1U A;  1L9Y A;  3MD7 A;  4C1H A;  4EY2 A;  3PY6 A;  1WW1 A;  2M5D A;  2WYM A;  4UBQ A;  5AYA A;  1BC2 A;  1QH3 A;  2WYM C;  5ACS A;  3G1P A;  2BTN A;  3BC2 A;  4EYL A;  5B1U A;  5ACX A;  2NYP A;  4RAM A;  4D1W A;  2QDT A;  3DHB A;  5ACR A;  2BFZ B;  4ZO3 A;  3P2U A;  5FQC A;  1A7T A;  4UAM A;  4H0D A;  2Y8A A;  4RL2 A;  4UWO B;  1KO3 A;  4EXY A;  3I13 A;  4V0H A;  2Q0I A;  4TZ9 A;  5AHO A;  2ZO4 A;  4TYF A;  3IOF A;  4BZ3 A;  4F6Z A;  3ADR A;  3I11 A;  4C1E A;  5LCF A;  4CHL A;  2Q0J A;  4NQ4 A;  4RAW A;  5HIP A;  2FU8 A;  2HB9 A;  5K4N A;  2BG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...