3DHCA

1.3 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homocysteine bound to the catalytic metal center
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acyl Homoserine Lactone Hydrolase
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhcA01
4YSBA 4GCWA 3MD7A 2FU8A 2P18A 5AHRA 5AEBA 3F9OA 2GFJA 3DHCA 1WUOA 4KEPA 3ZR9A 5K4NA 2H6AA 5K4KA 2QDTA 2YZ3A 3TP9A 1DD6A 3X2ZA 3AF5A 4HKYA 2GKLA 3ZWFA 3BC2A 2BG7A 4D02A 3SFPA 2Q0IA 1KO2A 2P4ZA 4D1UA 4H0DA 3PG4A 4RAMA 5ACUA 4Z5YA 3DH8A 5ACTA 1JT1A 5ACVA 4GYUA 1VJNA 1Y44A 5FQBA 4EXYA 5LCFA 2NZEA 4DIKA 2BG8A 3KNSA 2M5DA 2FHXB 2OHIA 3I15A 2ZO4A 3AJ3A 4RL0A 1BVTA 4C1HA 2WYMA 4UWPB 5LCAA 3LVZA 4C1DA 2A7MA 2WRSA 5LSCA 4UWRB 1XM8A 2DKFA 4V0HA 5EVDA 4WD6A 3X2XA 5EV6A 1VMEA 1QH5A 2Q42A 2BG6A 4C1EA 4AX1B 4NQ2A 2QJSA 1VGNA 3S0ZA 3IELA 4J5HA 4F6HA 2WYLA 1HLKA 5DPXA 2YNTA 4NQ4A 4J5FA 5EWAA 4Z6XA 5K0WA 5B1UA 3IEMA 5FQAA 2FU7A 2FU9A 5EVBA 4AWYB 4KEQA 3BK1A 4ZNBA 4EFZA 3ESHA 4UWOB 4TZFA 2AZ4A 3SRXA 1BC2A 5LM6A 1K07A 5LE1A 2FHXA 4FR7A 2BTNA 1KO3A 5KIKA 3KL7A 5AYAA 4JO0A 2BMIA 3JXPA 1SMLA 2QEDA 4TZ9A 2FK6A 2QDSA 4HL2A 5EV8A 4AWZA 5K4MA 2OHHA 3AF6A 4Z7RA 4F6ZA 4UWSB 3Q6VA 1X8HA 1ZTCA 3I13A 1E5DA 4C1FA 3IE2A 4ZEJA 5B15A 4XWWA 3IE1A 4YSKA 1JJTA 3VQZA 5FQCA 2YNVA 5HISA 1BMCA 4Z60A 4LE6A 5HH4A 1ZKPA 5ACRA 1YCGA 3RKJA 3VPEA 3X30A 3IEKA 5B3RA 5EVKA 1P9EA 2P97A 5LLDA 3SW3A 3RKKA 3QH8A 4CHLA 2GMNA 3IE0A 5ACQA 5EHTA 4XUKA 4TZBA 3I0VA 3T3OA 4D1VA 2ZWRA 1L9YA 3T3NA 2BGAA 2BR6A 3FAIA 2BG8B 2I7VA 5AHOA 4GYQA 4TYFA 5EW0A 5HIQA 4PVTA 4U4LA 2ZZIA 4EXSA 4UAMA 2BFKA 4UBQA 5KILA 5LMCA 2ZNBA 3PY6A 5LCHA 1A8TA 1WRAA 2GCUA 2NYPA 5HIPA 2HB9A 4EY2A 5HIOA 3SPUA 5ACPA 2CBNA 2XR1A 2M5CA 5HH6A 4B87A 2BIBA 2DOOA 3ZQ4A 2I7TA 3I11A 4FSBA 2BG2A 4NQ5A 3SD9A 3L6NA 2YNTB 3I14A 1MQOA 1M2XA 3IOFA 4RM5A 2BFZB 2Y87A 3T9MA 2UYXA 2Q9UA 2WYMC 2BC2A 5LS3A 1DXKA 5ACWA 1JJEA 4C1CA 1YCFA 1DDKA 2BFLA 5AXRA 2I7XA 1WUPA 4RL2A 2YCBA 3SBLA 5AXOA 2Y8AA 2P1EA 4D1WA 4YSLA 2NZFA 5A5ZA 4BP0A 5IQKA 3IDZA 4EYBA 4ZO3A 3WXCA 2FM6A 1YCHA 4XWTA 4TZEA 1ZNBA 4O98A 4Z67A 4EYLA 4AD9A 3ADRA 2YNWA 2XF4A 5EH9A 2WHGA 1X8IA 3R2UA 2Q0JA 3BK2A 3X2YA 3RPCA 4HL1A 4EYFA 5A0TA 4D1TA 5ACXA 1QH3A 2YNUA 4C09A 2GFKA 1X8GA 2R2DA 3G1PA 4RAWA 5HH5A 5A0VA 1KR3A 2QINA 1A7TA 4UA4A 4RBSA 1XTOA 3P2UA 1WW1A 2AIOA 5ACSA 2Y8BA 4PVOA 2YNVB 3FCZA 3A4YA 3BV6A 2VW8A 4AX0B 5A87A 3H3EA 3IOGA 4P62A 3KNRA 2FU6A 4Z5ZA 2OHJA 4C1GA 2NXAA 4ZO2A 3PY5A 3DHAA 4NQ6A 4TYTA 2E7YA 3ZNBA 2BFZA 4FEKA 4DILA 3DHBA 4BZ3A
chains in the Genus database with same CATH superfamily
4YSBA 4GCWA 3MD7A 2FU8A 2P18A 5AHRA 5AEBA 3F9OA 2GFJA 3DHCA 1WUOA 4KEPA 3ZR9A 5K4NA 2H6AA 5K4KA 2QDTA 2YZ3A 3TP9A 1DD6A 3X2ZA 3AF5A 4HKYA 2GKLA 3ZWFA 3BC2A 2BG7A 4D02A 2CFUA 3SFPA 2YHEA 2Q0IA 1KO2A 2P4ZA 4D1UA 4H0DA 4PDXA 3PG4A 4RAMA 5ACUA 4Z5YA 3DH8A 5ACTA 1JT1A 5ACVA 4GYUA 1VJNA 1Y44A 5FQBA 4EXYA 5LCFA 2NZEA 4DIKA 2BG8A 3KNSA 2M5DA 2FHXB 2OHIA 3I15A 2ZO4A 3AJ3A 4RL0A 5AIJA 1BVTA 4C1HA 2WYMA 4UWPB 5LCAA 3LVZA 4C1DA 2A7MA 2WRSA 5LSCA 4UWRB 1XM8A 2DKFA 4V0HA 5EVDA 4WD6A 3X2XA 5EV6A 1VMEA 1QH5A 2Q42A 2BG6A 4C1EA 2CFZA 4NQ2A 4AX1B 2QJSA 1VGNA 3S0ZA 3IELA 4J5HA 4F6HA 2WYLA 1HLKA 5DPXA 2YNTA 4NQ4A 4J5FA 5EWAA 4Z6XA 5K0WA 5B1UA 3IEMA 5FQAA 2FU7A 2FU9A 4AXHA 5EVBA 4AWYB 4KEQA 3BK1A 4ZNBA 4EFZA 3ESHA 4UWOB 4TZFA 2AZ4A 3SRXA 1BC2A 5LM6A 1K07A 5LE1A 2FHXA 4FR7A 2BTNA 1KO3A 5KIKA 3KL7A 5AYAA 4JO0A 2BMIA 3JXPA 1SMLA 2QEDA 4TZ9A 2FK6A 2QDSA 4HL2A 5EV8A 4AWZA 5K4MA 2OHHA 3AF6A 4Z7RA 4F6ZA 4UWSB 3Q6VA 1X8HA 1ZTCA 3I13A 1E5DA 4C1FA 3IE2A 4ZEJA 5B15A 4XWWA 3IE1A 4YSKA 1JJTA 3VQZA 5FQCA 2YNVA 5HISA 1BMCA 4Z60A 4LE6A 5HH4A 1ZKPA 5ACRA 1YCGA 3RKJA 3VPEA 3X30A 3IEKA 5B3RA 5EVKA 4NURA 1P9EA 2P97A 5LLDA 3SW3A 3RKKA 3QH8A 4CHLA 2GMNA 3IE0A 5ACQA 5EHTA 4XUKA 4TZBA 3I0VA 3T3OA 4D1VA 2ZWRA 4AV7A 1L9YA 3T3NA 2BGAA 2BR6A 5AJLA 3FAIA 2BG8B 2I7VA 5AHOA 4GYQA 4TYFA 5EW0A 5HIQA 4PVTA 4U4LA 2ZZIA 4EXSA 4UAMA 2BFKA 4UBQA 5KILA 5LMCA 2ZNBA 3PY6A 5LCHA 1A8TA 1WRAA 2GCUA 2NYPA 5HIPA 2HB9A 4EY2A 5HIOA 3SPUA 5ACPA 2CBNA 2XR1A 2M5CA 5HH6A 4B87A 2BIBA 2DOOA 3ZQ4A 2I7TA 3I11A 4FSBA 2BG2A 4NQ5A 3SD9A 3L6NA 2YNTB 3I14A 1MQOA 1M2XA 3IOFA 4RM5A 2BFZB 2Y87A 3T9MA 2UYXA 2Q9UA 2WYMC 2BC2A 5LS3A 1DXKA 5ACWA 1JJEA 4C1CA 1YCFA 1DDKA 2BFLA 2CG2A 5AXRA 2I7XA 1WUPA 4RL2A 2YCBA 3SBLA 5AXOA 2Y8AA 2P1EA 4D1WA 4YSLA 2NZFA 5A5ZA 4BP0A 5IQKA 3IDZA 4EYBA 4ZO3A 3WXCA 2FM6A 1YCHA 4XWTA 4TZEA 1ZNBA 4O98A 4Z67A 4EYLA 4AD9A 2CG3A 3ADRA 2YNWA 2XF4A 5EH9A 2WHGA 1X8IA 3R2UA 2Q0JA 3BK2A 3X2YA 3RPCA 4HL1A 4EYFA 5A0TA 4D1TA 5ACXA 1QH3A 2YNUA 4C09A 2GFKA 1X8GA 2R2DA 3G1PA 4RAWA 5HH5A 5A0VA 1KR3A 2QINA 1A7TA 4UA4A 4RBSA 1XTOA 3P2UA 1WW1A 2AIOA 5ACSA 5A23A 2Y8BA 4PVOA 2YNVB 3FCZA 3A4YA 3BV6A 2VW8A 4AX0B 5A87A 3H3EA 3IOGA 4P62A 3KNRA 2FU6A 4Z5ZA 2OHJA 4C1GA 2NXAA 4ZO2A 3PY5A 3DHAA 4NQ6A 4TYTA 2E7YA 3ZNBA 2BFZA 4FEKA 4DILA 3DHBA 4BZ3A
chains in the Genus database with same CATH topology
4YSBA 4GCWA 3MD7A 2FU8A 2P18A 5AHRA 5AEBA 3F9OA 2GFJA 3DHCA 1WUOA 4KEPA 3ZR9A 5K4NA 2H6AA 5K4KA 2QDTA 2YZ3A 3TP9A 1DD6A 3X2ZA 3AF5A 4HKYA 2GKLA 3ZWFA 3BC2A 2BG7A 4D02A 3SFPA 2Q0IA 1KO2A 2P4ZA 4D1UA 4H0DA 3PG4A 4RAMA 5ACUA 4Z5YA 3DH8A 5ACTA 1JT1A 5ACVA 4GYUA 1VJNA 1Y44A 5FQBA 4EXYA 5LCFA 2NZEA 4DIKA 2BG8A 3KNSA 2M5DA 2FHXB 2OHIA 3I15A 2ZO4A 3AJ3A 4RL0A 1BVTA 4C1HA 2WYMA 4UWPB 5LCAA 3LVZA 4C1DA 2A7MA 2WRSA 5LSCA 4UWRB 1XM8A 2DKFA 4V0HA 5EVDA 4WD6A 3X2XA 5EV6A 1VMEA 1QH5A 2Q42A 2BG6A 4C1EA 4AX1B 4NQ2A 2QJSA 1VGNA 3S0ZA 3IELA 4J5HA 4F6HA 2WYLA 1HLKA 5DPXA 2YNTA 4NQ4A 4J5FA 5EWAA 4Z6XA 5K0WA 5B1UA 3IEMA 5FQAA 2FU7A 2FU9A 5EVBA 4AWYB 4KEQA 3BK1A 4ZNBA 4EFZA 3ESHA 4UWOB 4TZFA 2AZ4A 3SRXA 1BC2A 5LM6A 1K07A 5LE1A 2FHXA 4FR7A 2BTNA 1KO3A 5KIKA 3KL7A 5AYAA 4JO0A 2BMIA 3JXPA 1SMLA 2QEDA 4TZ9A 2FK6A 2QDSA 4HL2A 5EV8A 4AWZA 5K4MA 2OHHA 3AF6A 4Z7RA 4F6ZA 4UWSB 3Q6VA 1X8HA 1ZTCA 3I13A 1E5DA 4C1FA 3IE2A 4ZEJA 5B15A 4XWWA 3IE1A 4YSKA 1JJTA 3VQZA 5FQCA 2YNVA 5HISA 1BMCA 4Z60A 4LE6A 5HH4A 1ZKPA 5ACRA 1YCGA 3RKJA 3VPEA 3X30A 3IEKA 5B3RA 5EVKA 1P9EA 2P97A 5LLDA 3SW3A 3RKKA 3QH8A 4CHLA 2GMNA 3IE0A 5ACQA 5EHTA 4XUKA 4TZBA 3I0VA 3T3OA 4D1VA 2ZWRA 1L9YA 3T3NA 2BGAA 2BR6A 3FAIA 2BG8B 2I7VA 5AHOA 4GYQA 4TYFA 5EW0A 5HIQA 4PVTA 4U4LA 2ZZIA 4EXSA 4UAMA 2BFKA 4UBQA 5KILA 5LMCA 2ZNBA 3PY6A 5LCHA 1A8TA 1WRAA 2GCUA 2NYPA 5HIPA 2HB9A 4EY2A 5HIOA 3SPUA 5ACPA 2CBNA 2XR1A 2M5CA 5HH6A 4B87A 2BIBA 2DOOA 3ZQ4A 2I7TA 3I11A 4FSBA 2BG2A 4NQ5A 3SD9A 3L6NA 2YNTB 3I14A 1MQOA 1M2XA 3IOFA 4RM5A 2BFZB 2Y87A 3T9MA 2UYXA 2Q9UA 2WYMC 2BC2A 5LS3A 1DXKA 5ACWA 1JJEA 4C1CA 1YCFA 1DDKA 2BFLA 5AXRA 2I7XA 1WUPA 4RL2A 2YCBA 3SBLA 5AXOA 2Y8AA 2P1EA 4D1WA 4YSLA 2NZFA 5A5ZA 4BP0A 5IQKA 3IDZA 4EYBA 4ZO3A 3WXCA 2FM6A 1YCHA 4XWTA 4TZEA 1ZNBA 4O98A 4Z67A 4EYLA 4AD9A 3ADRA 2YNWA 2XF4A 5EH9A 2WHGA 1X8IA 3R2UA 2Q0JA 3BK2A 3X2YA 3RPCA 4HL1A 4EYFA 5A0TA 4D1TA 5ACXA 1QH3A 2YNUA 4C09A 2GFKA 1X8GA 2R2DA 3G1PA 4RAWA 5HH5A 5A0VA 1KR3A 2QINA 1A7TA 4UA4A 4RBSA 1XTOA 3P2UA 1WW1A 2AIOA 5ACSA 2Y8BA 4PVOA 2YNVB 3FCZA 3A4YA 3BV6A 2VW8A 4AX0B 5A87A 3H3EA 3IOGA 4P62A 3KNRA 2FU6A 4Z5ZA 2OHJA 4C1GA 2NXAA 4ZO2A 3PY5A 3DHAA 4NQ6A 4TYTA 2E7YA 3ZNBA 2BFZA 4FEKA 4DILA 3DHBA 4BZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSB A;  4GCW A;  3MD7 A;  2FU8 A;  2P18 A;  5AHR A;  5AEB A;  3F9O A;  2GFJ A;  3DHC A;  1WUO A;  4KEP A;  3ZR9 A;  5K4N A;  2H6A A;  5K4K A;  2QDT A;  2YZ3 A;  3TP9 A;  1DD6 A;  3X2Z A;  3AF5 A;  4HKY A;  2GKL A;  3ZWF A;  3BC2 A;  2BG7 A;  4D02 A;  3SFP A;  2Q0I A;  1KO2 A;  2P4Z A;  4D1U A;  4H0D A;  3PG4 A;  4RAM A;  5ACU A;  4Z5Y A;  3DH8 A;  5ACT A;  1JT1 A;  5ACV A;  4GYU A;  1VJN A;  1Y44 A;  5FQB A;  4EXY A;  5LCF A;  2NZE A;  4DIK A;  2BG8 A;  3KNS A;  2M5D A;  2FHX B;  2OHI A;  3I15 A;  2ZO4 A;  3AJ3 A;  4RL0 A;  1BVT A;  4C1H A;  2WYM A;  4UWP B;  5LCA A;  3LVZ A;  4C1D A;  2A7M A;  2WRS A;  5LSC A;  4UWR B;  1XM8 A;  2DKF A;  4V0H A;  5EVD A;  4WD6 A;  3X2X A;  5EV6 A;  1VME A;  1QH5 A;  2Q42 A;  2BG6 A;  4C1E A;  4AX1 B;  4NQ2 A;  2QJS A;  1VGN A;  3S0Z A;  3IEL A;  4J5H A;  4F6H A;  2WYL A;  1HLK A;  5DPX A;  2YNT A;  4NQ4 A;  4J5F A;  5EWA A;  4Z6X A;  5K0W A;  5B1U A;  3IEM A;  5FQA A;  2FU7 A;  2FU9 A;  5EVB A;  4AWY B;  4KEQ A;  3BK1 A;  4ZNB A;  4EFZ A;  3ESH A;  4UWO B;  4TZF A;  2AZ4 A;  3SRX A;  1BC2 A;  5LM6 A;  1K07 A;  5LE1 A;  2FHX A;  4FR7 A;  2BTN A;  1KO3 A;  5KIK A;  3KL7 A;  5AYA A;  4JO0 A;  2BMI A;  3JXP A;  1SML A;  2QED A;  4TZ9 A;  2FK6 A;  2QDS A;  4HL2 A;  5EV8 A;  4AWZ A;  5K4M A;  2OHH A;  3AF6 A;  4Z7R A;  4F6Z A;  4UWS B;  3Q6V A;  1X8H A;  1ZTC A;  3I13 A;  1E5D A;  4C1F A;  3IE2 A;  4ZEJ A;  5B15 A;  4XWW A;  3IE1 A;  4YSK A;  1JJT A;  3VQZ A;  5FQC A;  2YNV A;  5HIS A;  1BMC A;  4Z60 A;  4LE6 A;  5HH4 A;  1ZKP A;  5ACR A;  1YCG A;  3RKJ A;  3VPE A;  3X30 A;  3IEK A;  5B3R A;  5EVK A;  1P9E A;  2P97 A;  5LLD A;  3SW3 A;  3RKK A;  3QH8 A;  4CHL A;  2GMN A;  3IE0 A;  5ACQ A;  5EHT A;  4XUK A;  4TZB A;  3I0V A;  3T3O A;  4D1V A;  2ZWR A;  1L9Y A;  3T3N A;  2BGA A;  2BR6 A;  3FAI A;  2BG8 B;  2I7V A;  5AHO A;  4GYQ A;  4TYF A;  5EW0 A;  5HIQ A;  4PVT A;  4U4L A;  2ZZI A;  4EXS A;  4UAM A;  2BFK A;  4UBQ A;  5KIL A;  5LMC A;  2ZNB A;  3PY6 A;  5LCH A;  1A8T A;  1WRA A;  2GCU A;  2NYP A;  5HIP A;  2HB9 A;  4EY2 A;  5HIO A;  3SPU A;  5ACP A;  2CBN A;  2XR1 A;  2M5C A;  5HH6 A;  4B87 A;  2BIB A;  2DOO A;  3ZQ4 A;  2I7T A;  3I11 A;  4FSB A;  2BG2 A;  4NQ5 A;  3SD9 A;  3L6N A;  2YNT B;  3I14 A;  1MQO A;  1M2X A;  3IOF A;  4RM5 A;  2BFZ B;  2Y87 A;  3T9M A;  2UYX A;  2Q9U A;  2WYM C;  2BC2 A;  5LS3 A;  1DXK A;  5ACW A;  1JJE A;  4C1C A;  1YCF A;  1DDK A;  2BFL A;  5AXR A;  2I7X A;  1WUP A;  4RL2 A;  2YCB A;  3SBL A;  5AXO A;  2Y8A A;  2P1E A;  4D1W A;  4YSL A;  2NZF A;  5A5Z A;  4BP0 A;  5IQK A;  3IDZ A;  4EYB A;  4ZO3 A;  3WXC A;  2FM6 A;  1YCH A;  4XWT A;  4TZE A;  1ZNB A;  4O98 A;  4Z67 A;  4EYL A;  4AD9 A;  3ADR A;  2YNW A;  2XF4 A;  5EH9 A;  2WHG A;  1X8I A;  3R2U A;  2Q0J A;  3BK2 A;  3X2Y A;  3RPC A;  4HL1 A;  4EYF A;  5A0T A;  4D1T A;  5ACX A;  1QH3 A;  2YNU A;  4C09 A;  2GFK A;  1X8G A;  2R2D A;  3G1P A;  4RAW A;  5HH5 A;  5A0V A;  1KR3 A;  2QIN A;  1A7T A;  4UA4 A;  4RBS A;  1XTO A;  3P2U A;  1WW1 A;  2AIO A;  5ACS A;  2Y8B A;  4PVO A;  2YNV B;  3FCZ A;  3A4Y A;  3BV6 A;  2VW8 A;  4AX0 B;  5A87 A;  3H3E A;  3IOG A;  4P62 A;  3KNR A;  2FU6 A;  4Z5Z A;  2OHJ A;  4C1G A;  2NXA A;  4ZO2 A;  3PY5 A;  3DHA A;  4NQ6 A;  4TYT A;  2E7Y A;  3ZNB A;  2BFZ A;  4FEK A;  4DIL A;  3DHB A;  4BZ3 A; 
#chains in the Genus database with same CATH topology
 4YSB A;  4GCW A;  3MD7 A;  2FU8 A;  2P18 A;  5AHR A;  5AEB A;  3F9O A;  2GFJ A;  3DHC A;  1WUO A;  4KEP A;  3ZR9 A;  5K4N A;  2H6A A;  5K4K A;  2QDT A;  2YZ3 A;  3TP9 A;  1DD6 A;  3X2Z A;  3AF5 A;  4HKY A;  2GKL A;  3ZWF A;  3BC2 A;  2BG7 A;  4D02 A;  2CFU A;  3SFP A;  2YHE A;  2Q0I A;  1KO2 A;  2P4Z A;  4D1U A;  4H0D A;  4PDX A;  3PG4 A;  4RAM A;  5ACU A;  4Z5Y A;  3DH8 A;  5ACT A;  1JT1 A;  5ACV A;  4GYU A;  1VJN A;  1Y44 A;  5FQB A;  4EXY A;  5LCF A;  2NZE A;  4DIK A;  2BG8 A;  3KNS A;  2M5D A;  2FHX B;  2OHI A;  3I15 A;  2ZO4 A;  3AJ3 A;  4RL0 A;  5AIJ A;  1BVT A;  4C1H A;  2WYM A;  4UWP B;  5LCA A;  3LVZ A;  4C1D A;  2A7M A;  2WRS A;  5LSC A;  4UWR B;  1XM8 A;  2DKF A;  4V0H A;  5EVD A;  4WD6 A;  3X2X A;  5EV6 A;  1VME A;  1QH5 A;  2Q42 A;  2BG6 A;  4C1E A;  2CFZ A;  4NQ2 A;  4AX1 B;  2QJS A;  1VGN A;  3S0Z A;  3IEL A;  4J5H A;  4F6H A;  2WYL A;  1HLK A;  5DPX A;  2YNT A;  4NQ4 A;  4J5F A;  5EWA A;  4Z6X A;  5K0W A;  5B1U A;  3IEM A;  5FQA A;  2FU7 A;  2FU9 A;  4AXH A;  5EVB A;  4AWY B;  4KEQ A;  3BK1 A;  4ZNB A;  4EFZ A;  3ESH A;  4UWO B;  4TZF A;  2AZ4 A;  3SRX A;  1BC2 A;  5LM6 A;  1K07 A;  5LE1 A;  2FHX A;  4FR7 A;  2BTN A;  1KO3 A;  5KIK A;  3KL7 A;  5AYA A;  4JO0 A;  2BMI A;  3JXP A;  1SML A;  2QED A;  4TZ9 A;  2FK6 A;  2QDS A;  4HL2 A;  5EV8 A;  4AWZ A;  5K4M A;  2OHH A;  3AF6 A;  4Z7R A;  4F6Z A;  4UWS B;  3Q6V A;  1X8H A;  1ZTC A;  3I13 A;  1E5D A;  4C1F A;  3IE2 A;  4ZEJ A;  5B15 A;  4XWW A;  3IE1 A;  4YSK A;  1JJT A;  3VQZ A;  5FQC A;  2YNV A;  5HIS A;  1BMC A;  4Z60 A;  4LE6 A;  5HH4 A;  1ZKP A;  5ACR A;  1YCG A;  3RKJ A;  3VPE A;  3X30 A;  3IEK A;  5B3R A;  5EVK A;  4NUR A;  1P9E A;  2P97 A;  5LLD A;  3SW3 A;  3RKK A;  3QH8 A;  4CHL A;  2GMN A;  3IE0 A;  5ACQ A;  5EHT A;  4XUK A;  4TZB A;  3I0V A;  3T3O A;  4D1V A;  2ZWR A;  4AV7 A;  1L9Y A;  3T3N A;  2BGA A;  2BR6 A;  5AJL A;  3FAI A;  2BG8 B;  2I7V A;  5AHO A;  4GYQ A;  4TYF A;  5EW0 A;  5HIQ A;  4PVT A;  4U4L A;  2ZZI A;  4EXS A;  4UAM A;  2BFK A;  4UBQ A;  5KIL A;  5LMC A;  2ZNB A;  3PY6 A;  5LCH A;  1A8T A;  1WRA A;  2GCU A;  2NYP A;  5HIP A;  2HB9 A;  4EY2 A;  5HIO A;  3SPU A;  5ACP A;  2CBN A;  2XR1 A;  2M5C A;  5HH6 A;  4B87 A;  2BIB A;  2DOO A;  3ZQ4 A;  2I7T A;  3I11 A;  4FSB A;  2BG2 A;  4NQ5 A;  3SD9 A;  3L6N A;  2YNT B;  3I14 A;  1MQO A;  1M2X A;  3IOF A;  4RM5 A;  2BFZ B;  2Y87 A;  3T9M A;  2UYX A;  2Q9U A;  2WYM C;  2BC2 A;  5LS3 A;  1DXK A;  5ACW A;  1JJE A;  4C1C A;  1YCF A;  1DDK A;  2BFL A;  2CG2 A;  5AXR A;  2I7X A;  1WUP A;  4RL2 A;  2YCB A;  3SBL A;  5AXO A;  2Y8A A;  2P1E A;  4D1W A;  4YSL A;  2NZF A;  5A5Z A;  4BP0 A;  5IQK A;  3IDZ A;  4EYB A;  4ZO3 A;  3WXC A;  2FM6 A;  1YCH A;  4XWT A;  4TZE A;  1ZNB A;  4O98 A;  4Z67 A;  4EYL A;  4AD9 A;  2CG3 A;  3ADR A;  2YNW A;  2XF4 A;  5EH9 A;  2WHG A;  1X8I A;  3R2U A;  2Q0J A;  3BK2 A;  3X2Y A;  3RPC A;  4HL1 A;  4EYF A;  5A0T A;  4D1T A;  5ACX A;  1QH3 A;  2YNU A;  4C09 A;  2GFK A;  1X8G A;  2R2D A;  3G1P A;  4RAW A;  5HH5 A;  5A0V A;  1KR3 A;  2QIN A;  1A7T A;  4UA4 A;  4RBS A;  1XTO A;  3P2U A;  1WW1 A;  2AIO A;  5ACS A;  5A23 A;  2Y8B A;  4PVO A;  2YNV B;  3FCZ A;  3A4Y A;  3BV6 A;  2VW8 A;  4AX0 B;  5A87 A;  3H3E A;  3IOG A;  4P62 A;  3KNR A;  2FU6 A;  4Z5Z A;  2OHJ A;  4C1G A;  2NXA A;  4ZO2 A;  3PY5 A;  3DHA A;  4NQ6 A;  4TYT A;  2E7Y A;  3ZNB A;  2BFZ A;  4FEK A;  4DIL A;  3DHB A;  4BZ3 A; 
#chains in the Genus database with same CATH homology
 4YSB A;  4GCW A;  3MD7 A;  2FU8 A;  2P18 A;  5AHR A;  5AEB A;  3F9O A;  2GFJ A;  3DHC A;  1WUO A;  4KEP A;  3ZR9 A;  5K4N A;  2H6A A;  5K4K A;  2QDT A;  2YZ3 A;  3TP9 A;  1DD6 A;  3X2Z A;  3AF5 A;  4HKY A;  2GKL A;  3ZWF A;  3BC2 A;  2BG7 A;  4D02 A;  3SFP A;  2Q0I A;  1KO2 A;  2P4Z A;  4D1U A;  4H0D A;  3PG4 A;  4RAM A;  5ACU A;  4Z5Y A;  3DH8 A;  5ACT A;  1JT1 A;  5ACV A;  4GYU A;  1VJN A;  1Y44 A;  5FQB A;  4EXY A;  5LCF A;  2NZE A;  4DIK A;  2BG8 A;  3KNS A;  2M5D A;  2FHX B;  2OHI A;  3I15 A;  2ZO4 A;  3AJ3 A;  4RL0 A;  1BVT A;  4C1H A;  2WYM A;  4UWP B;  5LCA A;  3LVZ A;  4C1D A;  2A7M A;  2WRS A;  5LSC A;  4UWR B;  1XM8 A;  2DKF A;  4V0H A;  5EVD A;  4WD6 A;  3X2X A;  5EV6 A;  1VME A;  1QH5 A;  2Q42 A;  2BG6 A;  4C1E A;  4AX1 B;  4NQ2 A;  2QJS A;  1VGN A;  3S0Z A;  3IEL A;  4J5H A;  4F6H A;  2WYL A;  1HLK A;  5DPX A;  2YNT A;  4NQ4 A;  4J5F A;  5EWA A;  4Z6X A;  5K0W A;  5B1U A;  3IEM A;  5FQA A;  2FU7 A;  2FU9 A;  5EVB A;  4AWY B;  4KEQ A;  3BK1 A;  4ZNB A;  4EFZ A;  3ESH A;  4UWO B;  4TZF A;  2AZ4 A;  3SRX A;  1BC2 A;  5LM6 A;  1K07 A;  5LE1 A;  2FHX A;  4FR7 A;  2BTN A;  1KO3 A;  5KIK A;  3KL7 A;  5AYA A;  4JO0 A;  2BMI A;  3JXP A;  1SML A;  2QED A;  4TZ9 A;  2FK6 A;  2QDS A;  4HL2 A;  5EV8 A;  4AWZ A;  5K4M A;  2OHH A;  3AF6 A;  4Z7R A;  4F6Z A;  4UWS B;  3Q6V A;  1X8H A;  1ZTC A;  3I13 A;  1E5D A;  4C1F A;  3IE2 A;  4ZEJ A;  5B15 A;  4XWW A;  3IE1 A;  4YSK A;  1JJT A;  3VQZ A;  5FQC A;  2YNV A;  5HIS A;  1BMC A;  4Z60 A;  4LE6 A;  5HH4 A;  1ZKP A;  5ACR A;  1YCG A;  3RKJ A;  3VPE A;  3X30 A;  3IEK A;  5B3R A;  5EVK A;  1P9E A;  2P97 A;  5LLD A;  3SW3 A;  3RKK A;  3QH8 A;  4CHL A;  2GMN A;  3IE0 A;  5ACQ A;  5EHT A;  4XUK A;  4TZB A;  3I0V A;  3T3O A;  4D1V A;  2ZWR A;  1L9Y A;  3T3N A;  2BGA A;  2BR6 A;  3FAI A;  2BG8 B;  2I7V A;  5AHO A;  4GYQ A;  4TYF A;  5EW0 A;  5HIQ A;  4PVT A;  4U4L A;  2ZZI A;  4EXS A;  4UAM A;  2BFK A;  4UBQ A;  5KIL A;  5LMC A;  2ZNB A;  3PY6 A;  5LCH A;  1A8T A;  1WRA A;  2GCU A;  2NYP A;  5HIP A;  2HB9 A;  4EY2 A;  5HIO A;  3SPU A;  5ACP A;  2CBN A;  2XR1 A;  2M5C A;  5HH6 A;  4B87 A;  2BIB A;  2DOO A;  3ZQ4 A;  2I7T A;  3I11 A;  4FSB A;  2BG2 A;  4NQ5 A;  3SD9 A;  3L6N A;  2YNT B;  3I14 A;  1MQO A;  1M2X A;  3IOF A;  4RM5 A;  2BFZ B;  2Y87 A;  3T9M A;  2UYX A;  2Q9U A;  2WYM C;  2BC2 A;  5LS3 A;  1DXK A;  5ACW A;  1JJE A;  4C1C A;  1YCF A;  1DDK A;  2BFL A;  5AXR A;  2I7X A;  1WUP A;  4RL2 A;  2YCB A;  3SBL A;  5AXO A;  2Y8A A;  2P1E A;  4D1W A;  4YSL A;  2NZF A;  5A5Z A;  4BP0 A;  5IQK A;  3IDZ A;  4EYB A;  4ZO3 A;  3WXC A;  2FM6 A;  1YCH A;  4XWT A;  4TZE A;  1ZNB A;  4O98 A;  4Z67 A;  4EYL A;  4AD9 A;  3ADR A;  2YNW A;  2XF4 A;  5EH9 A;  2WHG A;  1X8I A;  3R2U A;  2Q0J A;  3BK2 A;  3X2Y A;  3RPC A;  4HL1 A;  4EYF A;  5A0T A;  4D1T A;  5ACX A;  1QH3 A;  2YNU A;  4C09 A;  2GFK A;  1X8G A;  2R2D A;  3G1P A;  4RAW A;  5HH5 A;  5A0V A;  1KR3 A;  2QIN A;  1A7T A;  4UA4 A;  4RBS A;  1XTO A;  3P2U A;  1WW1 A;  2AIO A;  5ACS A;  2Y8B A;  4PVO A;  2YNV B;  3FCZ A;  3A4Y A;  3BV6 A;  2VW8 A;  4AX0 B;  5A87 A;  3H3E A;  3IOG A;  4P62 A;  3KNR A;  2FU6 A;  4Z5Z A;  2OHJ A;  4C1G A;  2NXA A;  4ZO2 A;  3PY5 A;  3DHA A;  4NQ6 A;  4TYT A;  2E7Y A;  3ZNB A;  2BFZ A;  4FEK A;  4DIL A;  3DHB A;  4BZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...