3DHCA

1.3 angstrom structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homocysteine bound to the catalytic metal center
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
b'MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acyl Homoserine Lactone Hydrolase
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhcA01
4B87A 2ZZIA 5LLDA 2E7YA 2QINA 5ACSA 4TZEA 3A4YA 3G1PA 4C1FA 5IQKA 4XUKA 2XR1A 3KNSA 5LS3A 1YCFA 4D1VA 1VMEA 4YSLA 4EXSA 2BG6A 3DHBA 1JJTA 2FM6A 4RAWA 5LSCA 2NZFA 3I0VA 2YNTB 4AX0B 4KEQA 2GKLA 5A5ZA 4C1DA 2M5CA 2WYLA 5LCHA 4XWWA 5EV8A 1JT1A 2BG7A 3ZQ4A 2A7MA 4YSKA 3H3EA 3ADRA 4NQ5A 4BP0A 3IEKA 4TZFA 5LE1A 1KO2A 4NQ4A 5ACQA 4J5HA 1BVTA 3MD7A 5HH4A 2OHIA 4J5FA 4UWSB 4JO0A 3VQZA 2BMIA 4UBQA 4Z6XA 2GFKA 5EW0A 2GFJA 2GCUA 5FQBA 4FSBA 4DIKA 3IOGA 3IE1A 2QJSA 2NYPA 4FR7A 3X2ZA 1WW1A 4LE6A 4YSBA 1SMLA 1YCHA 3IE0A 2Y87A 3BK2A 2BIBA 5ACXA 5ACVA 2FU9A 2Q0IA 3SRXA 1BMCA 2R2DA 2I7XA 5LCFA 2UYXA 4F6HA 1VGNA 1ZNBA 5LM6A 5AEBA 3JXPA 4UWPB 5EVDA 4D1WA 3DH8A 4EFZA 1ZTCA 5KIKA 3SW3A 2NXAA 3T3OA 4HL2A 1KR3A 4GCWA 3BK1A 4DILA 4C1GA 2H6AA 1A8TA 3RPCA 1VJNA 4C09A 5EWAA 2WYMC 5AXOA 3BC2A 1X8HA 4PVOA 1P9EA 2I7VA 1X8GA 3S0ZA 5ACPA 4ZO3A 2M5DA 4D1UA 3PG4A 4UWOB 2P97A 2BFZB 2I7TA 5K0WA 2BG8B 2YNUA 4V0HA 2FHXA 3ZNBA 2QDTA 4EYFA 3RKJA 4C1EA 1ZKPA 4KEPA 3SPUA 4PVTA 3X30A 4EYBA 3T3NA 5EH9A 5B3RA 5AHOA 3SBLA 3ESHA 2BR6A 4FEKA 5HIQA 5HISA 1WUOA 3QH8A 2P18A 1QH5A 1XTOA 1DD6A 3X2XA 4BZ3A 4NQ6A 5B1UA 2OHHA 4TZBA 3DHCA 4TYTA 3P2UA 3LVZA 3VPEA 4C1CA 1K07A 4Z7RA 2YNWA 4UWRB 4AWZA 4RL2A 2BFZA 3WXCA 4RAMA 4Z5YA 3FAIA 2BG8A 4H0DA 5AHRA 4ZO2A 2YNTA 4NQ2A 2P4ZA 2BC2A 5DPXA 4AX1B 1QH3A 2BG2A 1YCGA 3SD9A 1BC2A 2YZ3A 1A7TA 4GYUA 3AJ3A 2DKFA 3KL7A 2FK6A 2QEDA 3SFPA 5LCAA 4CHLA 3RKKA 5EVBA 1KO3A 2BFKA 3AF6A 5LMCA 4HKYA 1E5DA 3T9MA 3ZWFA 4RL0A 1WRAA 1DDKA 4O98A 1WUPA 5HIPA 2WRSA 4TZ9A 4U4LA 4TYFA 3IE2A 1X8IA 2ZO4A 5B15A 4HL1A 3IDZA 3KNRA 3I11A 4ZEJA 3Q6VA 4Z5ZA 3PY6A 3ZR9A 3F9OA 5ACUA 3R2UA 5A0VA 1JJEA 2FU8A 3PY5A 4Z60A 2VW8A 3X2YA 1Y44A 5KILA 2Y8AA 2BGAA 4WD6A 1XM8A 2Y8BA 5A0TA 3I14A 2WHGA 5FQCA 3IEMA 2HB9A 3I13A 3FCZA 4RBSA 3IOFA 5K4NA 4EYLA 2P1EA 5EVKA 5K4KA 4GYQA 2NZEA 4D1TA 2AIOA 2GMNA 5HIOA 1DXKA 4XWTA 4ZNBA 5FQAA 2CBNA 2QDSA 5AXRA 2Q9UA 4Z67A 2Q0JA 4UAMA 5EV6A 5HH6A 4F6ZA 2XF4A 2YNVB 5EHTA 4C1HA 3I15A 1M2XA 5AYAA 2BTNA 4UA4A 5ACRA 4AD9A 2YCBA 3AF5A 2ZNBA 4D02A 3BV6A 2Q42A 4RM5A 2FU7A 5A87A 2BFLA 2OHJA 4EXYA 2WYMA 4AWYB 5HH5A 5ACTA 2FHXB 4P62A 1HLKA 3L6NA 1MQOA 5K4MA 2YNVA 3IELA 4EY2A 2FU6A 2AZ4A 1L9YA 5ACWA 3TP9A 2ZWRA 2DOOA 3DHAA
chains in the Genus database with same CATH superfamily
4B87A 2ZZIA 5LLDA 2E7YA 2QINA 5ACSA 4TZEA 3A4YA 3G1PA 4C1FA 5IQKA 4XUKA 2XR1A 3KNSA 5LS3A 1YCFA 4D1VA 1VMEA 4YSLA 4EXSA 2BG6A 3DHBA 1JJTA 2FM6A 4RAWA 5LSCA 2NZFA 3I0VA 2CG3A 2YNTB 4AX0B 4KEQA 2GKLA 5A5ZA 4PDXA 2M5CA 2WYLA 4C1DA 5LCHA 4XWWA 5EV8A 1JT1A 2BG7A 3ZQ4A 2A7MA 4YSKA 3H3EA 3ADRA 4NQ5A 4BP0A 3IEKA 4TZFA 5LE1A 1KO2A 4NQ4A 5ACQA 4J5HA 1BVTA 3MD7A 5HH4A 2OHIA 4J5FA 4UWSB 4JO0A 3VQZA 2BMIA 4UBQA 4Z6XA 2GFKA 5EW0A 2GCUA 2GFJA 5FQBA 4FSBA 4DIKA 3IOGA 3IE1A 2QJSA 2NYPA 4FR7A 3X2ZA 1WW1A 4LE6A 4YSBA 1SMLA 1YCHA 2CG2A 3IE0A 2Y87A 3BK2A 2BIBA 5ACXA 5ACVA 2FU9A 2Q0IA 3SRXA 1BMCA 2R2DA 2I7XA 5LCFA 2UYXA 4F6HA 1VGNA 1ZNBA 5LM6A 5AEBA 3JXPA 4UWPB 5EVDA 4D1WA 3DH8A 4EFZA 1ZTCA 5KIKA 3SW3A 2NXAA 3T3OA 4HL2A 1KR3A 4GCWA 3BK1A 4DILA 4C1GA 2H6AA 1A8TA 3RPCA 1VJNA 4C09A 5EWAA 2WYMC 5AXOA 3BC2A 1X8HA 4PVOA 1P9EA 2I7VA 1X8GA 3S0ZA 5ACPA 4ZO3A 2M5DA 4D1UA 3PG4A 4UWOB 2P97A 2BFZB 2I7TA 5K0WA 2BG8B 2YNUA 4V0HA 2FHXA 3ZNBA 2QDTA 4EYFA 3RKJA 4C1EA 1ZKPA 4KEPA 3SPUA 4PVTA 3X30A 4EYBA 3T3NA 5EH9A 5B3RA 5AHOA 3SBLA 3ESHA 2BR6A 4FEKA 5HIQA 5HISA 1WUOA 3QH8A 2P18A 1QH5A 1XTOA 1DD6A 3X2XA 4BZ3A 4NQ6A 5B1UA 2OHHA 4TZBA 3DHCA 4TYTA 3P2UA 3LVZA 3VPEA 4C1CA 1K07A 4Z7RA 2YNWA 4UWRB 4AWZA 4RL2A 2BFZA 3WXCA 4RAMA 4Z5YA 3FAIA 2BG8A 5A23A 4H0DA 5AHRA 4ZO2A 2YNTA 4NQ2A 2P4ZA 2BC2A 5DPXA 4AX1B 1QH3A 2BG2A 1YCGA 3SD9A 1BC2A 2YZ3A 1A7TA 4GYUA 3AJ3A 2DKFA 3KL7A 2CFZA 2FK6A 2QEDA 3SFPA 5LCAA 4CHLA 3RKKA 5EVBA 4NURA 1KO3A 2BFKA 3AF6A 5LMCA 4HKYA 1E5DA 3T9MA 3ZWFA 4RL0A 1WRAA 1DDKA 4O98A 1WUPA 5HIPA 2WRSA 4TZ9A 4U4LA 4TYFA 3IE2A 1X8IA 2ZO4A 5B15A 4HL1A 3IDZA 3KNRA 3I11A 4ZEJA 2CFUA 3Q6VA 4Z5ZA 3PY6A 4AXHA 3ZR9A 3F9OA 5ACUA 3R2UA 5A0VA 4AV7A 1JJEA 2FU8A 3PY5A 4Z60A 2VW8A 3X2YA 1Y44A 5KILA 2Y8AA 2BGAA 4WD6A 1XM8A 2Y8BA 5A0TA 3I14A 2WHGA 5FQCA 3IEMA 2HB9A 3I13A 3FCZA 4RBSA 3IOFA 5K4NA 4EYLA 2P1EA 5EVKA 5K4KA 4GYQA 2NZEA 4D1TA 2AIOA 2GMNA 5HIOA 1DXKA 4XWTA 4ZNBA 5FQAA 2CBNA 5AJLA 2QDSA 5AXRA 2Q9UA 4Z67A 2Q0JA 4UAMA 5EV6A 5HH6A 4F6ZA 2XF4A 2YNVB 5EHTA 4C1HA 3I15A 1M2XA 5AYAA 2BTNA 4UA4A 5ACRA 4AD9A 2YCBA 5AIJA 2YHEA 3AF5A 2ZNBA 4D02A 3BV6A 2Q42A 4RM5A 2FU7A 5A87A 2BFLA 2OHJA 4EXYA 2WYMA 4AWYB 5HH5A 5ACTA 2FHXB 4P62A 1HLKA 3L6NA 1MQOA 5K4MA 2YNVA 3IELA 4EY2A 2FU6A 2AZ4A 1L9YA 5ACWA 3TP9A 2ZWRA 2DOOA 3DHAA
chains in the Genus database with same CATH topology
4B87A 2ZZIA 5LLDA 2E7YA 2QINA 5ACSA 4TZEA 3A4YA 3G1PA 4C1FA 5IQKA 4XUKA 2XR1A 3KNSA 5LS3A 1YCFA 4D1VA 1VMEA 4YSLA 4EXSA 2BG6A 3DHBA 1JJTA 2FM6A 4RAWA 5LSCA 2NZFA 3I0VA 2YNTB 4AX0B 4KEQA 2GKLA 5A5ZA 4C1DA 2M5CA 2WYLA 5LCHA 4XWWA 5EV8A 1JT1A 2BG7A 3ZQ4A 2A7MA 4YSKA 3H3EA 3ADRA 4NQ5A 4BP0A 3IEKA 4TZFA 5LE1A 1KO2A 4NQ4A 5ACQA 4J5HA 1BVTA 3MD7A 5HH4A 2OHIA 4J5FA 4UWSB 4JO0A 3VQZA 2BMIA 4UBQA 4Z6XA 2GFKA 5EW0A 2GFJA 2GCUA 5FQBA 4FSBA 4DIKA 3IOGA 3IE1A 2QJSA 2NYPA 4FR7A 3X2ZA 1WW1A 4LE6A 4YSBA 1SMLA 1YCHA 3IE0A 2Y87A 3BK2A 2BIBA 5ACXA 5ACVA 2FU9A 2Q0IA 3SRXA 1BMCA 2R2DA 2I7XA 5LCFA 2UYXA 4F6HA 1VGNA 1ZNBA 5LM6A 5AEBA 3JXPA 4UWPB 5EVDA 4D1WA 3DH8A 4EFZA 1ZTCA 5KIKA 3SW3A 2NXAA 3T3OA 4HL2A 1KR3A 4GCWA 3BK1A 4DILA 4C1GA 2H6AA 1A8TA 3RPCA 1VJNA 4C09A 5EWAA 2WYMC 5AXOA 3BC2A 1X8HA 4PVOA 1P9EA 2I7VA 1X8GA 3S0ZA 5ACPA 4ZO3A 2M5DA 4D1UA 3PG4A 4UWOB 2P97A 2BFZB 2I7TA 5K0WA 2BG8B 2YNUA 4V0HA 2FHXA 3ZNBA 2QDTA 4EYFA 3RKJA 4C1EA 1ZKPA 4KEPA 3SPUA 4PVTA 3X30A 4EYBA 3T3NA 5EH9A 5B3RA 5AHOA 3SBLA 3ESHA 2BR6A 4FEKA 5HIQA 5HISA 1WUOA 3QH8A 2P18A 1QH5A 1XTOA 1DD6A 3X2XA 4BZ3A 4NQ6A 5B1UA 2OHHA 4TZBA 3DHCA 4TYTA 3P2UA 3LVZA 3VPEA 4C1CA 1K07A 4Z7RA 2YNWA 4UWRB 4AWZA 4RL2A 2BFZA 3WXCA 4RAMA 4Z5YA 3FAIA 2BG8A 4H0DA 5AHRA 4ZO2A 2YNTA 4NQ2A 2P4ZA 2BC2A 5DPXA 4AX1B 1QH3A 2BG2A 1YCGA 3SD9A 1BC2A 2YZ3A 1A7TA 4GYUA 3AJ3A 2DKFA 3KL7A 2FK6A 2QEDA 3SFPA 5LCAA 4CHLA 3RKKA 5EVBA 1KO3A 2BFKA 3AF6A 5LMCA 4HKYA 1E5DA 3T9MA 3ZWFA 4RL0A 1WRAA 1DDKA 4O98A 1WUPA 5HIPA 2WRSA 4TZ9A 4U4LA 4TYFA 3IE2A 1X8IA 2ZO4A 5B15A 4HL1A 3IDZA 3KNRA 3I11A 4ZEJA 3Q6VA 4Z5ZA 3PY6A 3ZR9A 3F9OA 5ACUA 3R2UA 5A0VA 1JJEA 2FU8A 3PY5A 4Z60A 2VW8A 3X2YA 1Y44A 5KILA 2Y8AA 2BGAA 4WD6A 1XM8A 2Y8BA 5A0TA 3I14A 2WHGA 5FQCA 3IEMA 2HB9A 3I13A 3FCZA 4RBSA 3IOFA 5K4NA 4EYLA 2P1EA 5EVKA 5K4KA 4GYQA 2NZEA 4D1TA 2AIOA 2GMNA 5HIOA 1DXKA 4XWTA 4ZNBA 5FQAA 2CBNA 2QDSA 5AXRA 2Q9UA 4Z67A 2Q0JA 4UAMA 5EV6A 5HH6A 4F6ZA 2XF4A 2YNVB 5EHTA 4C1HA 3I15A 1M2XA 5AYAA 2BTNA 4UA4A 5ACRA 4AD9A 2YCBA 3AF5A 2ZNBA 4D02A 3BV6A 2Q42A 4RM5A 2FU7A 5A87A 2BFLA 2OHJA 4EXYA 2WYMA 4AWYB 5HH5A 5ACTA 2FHXB 4P62A 1HLKA 3L6NA 1MQOA 5K4MA 2YNVA 3IELA 4EY2A 2FU6A 2AZ4A 1L9YA 5ACWA 3TP9A 2ZWRA 2DOOA 3DHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B87 A;  2ZZI A;  5LLD A;  2E7Y A;  2QIN A;  5ACS A;  4TZE A;  3A4Y A;  3G1P A;  4C1F A;  5IQK A;  4XUK A;  2XR1 A;  3KNS A;  5LS3 A;  1YCF A;  4D1V A;  1VME A;  4YSL A;  4EXS A;  2BG6 A;  3DHB A;  1JJT A;  2FM6 A;  4RAW A;  5LSC A;  2NZF A;  3I0V A;  2YNT B;  4AX0 B;  4KEQ A;  2GKL A;  5A5Z A;  4C1D A;  2M5C A;  2WYL A;  5LCH A;  4XWW A;  5EV8 A;  1JT1 A;  2BG7 A;  3ZQ4 A;  2A7M A;  4YSK A;  3H3E A;  3ADR A;  4NQ5 A;  4BP0 A;  3IEK A;  4TZF A;  5LE1 A;  1KO2 A;  4NQ4 A;  5ACQ A;  4J5H A;  1BVT A;  3MD7 A;  5HH4 A;  2OHI A;  4J5F A;  4UWS B;  4JO0 A;  3VQZ A;  2BMI A;  4UBQ A;  4Z6X A;  2GFK A;  5EW0 A;  2GFJ A;  2GCU A;  5FQB A;  4FSB A;  4DIK A;  3IOG A;  3IE1 A;  2QJS A;  2NYP A;  4FR7 A;  3X2Z A;  1WW1 A;  4LE6 A;  4YSB A;  1SML A;  1YCH A;  3IE0 A;  2Y87 A;  3BK2 A;  2BIB A;  5ACX A;  5ACV A;  2FU9 A;  2Q0I A;  3SRX A;  1BMC A;  2R2D A;  2I7X A;  5LCF A;  2UYX A;  4F6H A;  1VGN A;  1ZNB A;  5LM6 A;  5AEB A;  3JXP A;  4UWP B;  5EVD A;  4D1W A;  3DH8 A;  4EFZ A;  1ZTC A;  5KIK A;  3SW3 A;  2NXA A;  3T3O A;  4HL2 A;  1KR3 A;  4GCW A;  3BK1 A;  4DIL A;  4C1G A;  2H6A A;  1A8T A;  3RPC A;  1VJN A;  4C09 A;  5EWA A;  2WYM C;  5AXO A;  3BC2 A;  1X8H A;  4PVO A;  1P9E A;  2I7V A;  1X8G A;  3S0Z A;  5ACP A;  4ZO3 A;  2M5D A;  4D1U A;  3PG4 A;  4UWO B;  2P97 A;  2BFZ B;  2I7T A;  5K0W A;  2BG8 B;  2YNU A;  4V0H A;  2FHX A;  3ZNB A;  2QDT A;  4EYF A;  3RKJ A;  4C1E A;  1ZKP A;  4KEP A;  3SPU A;  4PVT A;  3X30 A;  4EYB A;  3T3N A;  5EH9 A;  5B3R A;  5AHO A;  3SBL A;  3ESH A;  2BR6 A;  4FEK A;  5HIQ A;  5HIS A;  1WUO A;  3QH8 A;  2P18 A;  1QH5 A;  1XTO A;  1DD6 A;  3X2X A;  4BZ3 A;  4NQ6 A;  5B1U A;  2OHH A;  4TZB A;  3DHC A;  4TYT A;  3P2U A;  3LVZ A;  3VPE A;  4C1C A;  1K07 A;  4Z7R A;  2YNW A;  4UWR B;  4AWZ A;  4RL2 A;  2BFZ A;  3WXC A;  4RAM A;  4Z5Y A;  3FAI A;  2BG8 A;  4H0D A;  5AHR A;  4ZO2 A;  2YNT A;  4NQ2 A;  2P4Z A;  2BC2 A;  5DPX A;  4AX1 B;  1QH3 A;  2BG2 A;  1YCG A;  3SD9 A;  1BC2 A;  2YZ3 A;  1A7T A;  4GYU A;  3AJ3 A;  2DKF A;  3KL7 A;  2FK6 A;  2QED A;  3SFP A;  5LCA A;  4CHL A;  3RKK A;  5EVB A;  1KO3 A;  2BFK A;  3AF6 A;  5LMC A;  4HKY A;  1E5D A;  3T9M A;  3ZWF A;  4RL0 A;  1WRA A;  1DDK A;  4O98 A;  1WUP A;  5HIP A;  2WRS A;  4TZ9 A;  4U4L A;  4TYF A;  3IE2 A;  1X8I A;  2ZO4 A;  5B15 A;  4HL1 A;  3IDZ A;  3KNR A;  3I11 A;  4ZEJ A;  3Q6V A;  4Z5Z A;  3PY6 A;  3ZR9 A;  3F9O A;  5ACU A;  3R2U A;  5A0V A;  1JJE A;  2FU8 A;  3PY5 A;  4Z60 A;  2VW8 A;  3X2Y A;  1Y44 A;  5KIL A;  2Y8A A;  2BGA A;  4WD6 A;  1XM8 A;  2Y8B A;  5A0T A;  3I14 A;  2WHG A;  5FQC A;  3IEM A;  2HB9 A;  3I13 A;  3FCZ A;  4RBS A;  3IOF A;  5K4N A;  4EYL A;  2P1E A;  5EVK A;  5K4K A;  4GYQ A;  2NZE A;  4D1T A;  2AIO A;  2GMN A;  5HIO A;  1DXK A;  4XWT A;  4ZNB A;  5FQA A;  2CBN A;  2QDS A;  5AXR A;  2Q9U A;  4Z67 A;  2Q0J A;  4UAM A;  5EV6 A;  5HH6 A;  4F6Z A;  2XF4 A;  2YNV B;  5EHT A;  4C1H A;  3I15 A;  1M2X A;  5AYA A;  2BTN A;  4UA4 A;  5ACR A;  4AD9 A;  2YCB A;  3AF5 A;  2ZNB A;  4D02 A;  3BV6 A;  2Q42 A;  4RM5 A;  2FU7 A;  5A87 A;  2BFL A;  2OHJ A;  4EXY A;  2WYM A;  4AWY B;  5HH5 A;  5ACT A;  2FHX B;  4P62 A;  1HLK A;  3L6N A;  1MQO A;  5K4M A;  2YNV A;  3IEL A;  4EY2 A;  2FU6 A;  2AZ4 A;  1L9Y A;  5ACW A;  3TP9 A;  2ZWR A;  2DOO A;  3DHA A; 
#chains in the Genus database with same CATH topology
 4B87 A;  2ZZI A;  5LLD A;  2E7Y A;  2QIN A;  5ACS A;  4TZE A;  3A4Y A;  3G1P A;  4C1F A;  5IQK A;  4XUK A;  2XR1 A;  3KNS A;  5LS3 A;  1YCF A;  4D1V A;  1VME A;  4YSL A;  4EXS A;  2BG6 A;  3DHB A;  1JJT A;  2FM6 A;  4RAW A;  5LSC A;  2NZF A;  3I0V A;  2CG3 A;  2YNT B;  4AX0 B;  4KEQ A;  2GKL A;  5A5Z A;  4PDX A;  2M5C A;  2WYL A;  4C1D A;  5LCH A;  4XWW A;  5EV8 A;  1JT1 A;  2BG7 A;  3ZQ4 A;  2A7M A;  4YSK A;  3H3E A;  3ADR A;  4NQ5 A;  4BP0 A;  3IEK A;  4TZF A;  5LE1 A;  1KO2 A;  4NQ4 A;  5ACQ A;  4J5H A;  1BVT A;  3MD7 A;  5HH4 A;  2OHI A;  4J5F A;  4UWS B;  4JO0 A;  3VQZ A;  2BMI A;  4UBQ A;  4Z6X A;  2GFK A;  5EW0 A;  2GCU A;  2GFJ A;  5FQB A;  4FSB A;  4DIK A;  3IOG A;  3IE1 A;  2QJS A;  2NYP A;  4FR7 A;  3X2Z A;  1WW1 A;  4LE6 A;  4YSB A;  1SML A;  1YCH A;  2CG2 A;  3IE0 A;  2Y87 A;  3BK2 A;  2BIB A;  5ACX A;  5ACV A;  2FU9 A;  2Q0I A;  3SRX A;  1BMC A;  2R2D A;  2I7X A;  5LCF A;  2UYX A;  4F6H A;  1VGN A;  1ZNB A;  5LM6 A;  5AEB A;  3JXP A;  4UWP B;  5EVD A;  4D1W A;  3DH8 A;  4EFZ A;  1ZTC A;  5KIK A;  3SW3 A;  2NXA A;  3T3O A;  4HL2 A;  1KR3 A;  4GCW A;  3BK1 A;  4DIL A;  4C1G A;  2H6A A;  1A8T A;  3RPC A;  1VJN A;  4C09 A;  5EWA A;  2WYM C;  5AXO A;  3BC2 A;  1X8H A;  4PVO A;  1P9E A;  2I7V A;  1X8G A;  3S0Z A;  5ACP A;  4ZO3 A;  2M5D A;  4D1U A;  3PG4 A;  4UWO B;  2P97 A;  2BFZ B;  2I7T A;  5K0W A;  2BG8 B;  2YNU A;  4V0H A;  2FHX A;  3ZNB A;  2QDT A;  4EYF A;  3RKJ A;  4C1E A;  1ZKP A;  4KEP A;  3SPU A;  4PVT A;  3X30 A;  4EYB A;  3T3N A;  5EH9 A;  5B3R A;  5AHO A;  3SBL A;  3ESH A;  2BR6 A;  4FEK A;  5HIQ A;  5HIS A;  1WUO A;  3QH8 A;  2P18 A;  1QH5 A;  1XTO A;  1DD6 A;  3X2X A;  4BZ3 A;  4NQ6 A;  5B1U A;  2OHH A;  4TZB A;  3DHC A;  4TYT A;  3P2U A;  3LVZ A;  3VPE A;  4C1C A;  1K07 A;  4Z7R A;  2YNW A;  4UWR B;  4AWZ A;  4RL2 A;  2BFZ A;  3WXC A;  4RAM A;  4Z5Y A;  3FAI A;  2BG8 A;  5A23 A;  4H0D A;  5AHR A;  4ZO2 A;  2YNT A;  4NQ2 A;  2P4Z A;  2BC2 A;  5DPX A;  4AX1 B;  1QH3 A;  2BG2 A;  1YCG A;  3SD9 A;  1BC2 A;  2YZ3 A;  1A7T A;  4GYU A;  3AJ3 A;  2DKF A;  3KL7 A;  2CFZ A;  2FK6 A;  2QED A;  3SFP A;  5LCA A;  4CHL A;  3RKK A;  5EVB A;  4NUR A;  1KO3 A;  2BFK A;  3AF6 A;  5LMC A;  4HKY A;  1E5D A;  3T9M A;  3ZWF A;  4RL0 A;  1WRA A;  1DDK A;  4O98 A;  1WUP A;  5HIP A;  2WRS A;  4TZ9 A;  4U4L A;  4TYF A;  3IE2 A;  1X8I A;  2ZO4 A;  5B15 A;  4HL1 A;  3IDZ A;  3KNR A;  3I11 A;  4ZEJ A;  2CFU A;  3Q6V A;  4Z5Z A;  3PY6 A;  4AXH A;  3ZR9 A;  3F9O A;  5ACU A;  3R2U A;  5A0V A;  4AV7 A;  1JJE A;  2FU8 A;  3PY5 A;  4Z60 A;  2VW8 A;  3X2Y A;  1Y44 A;  5KIL A;  2Y8A A;  2BGA A;  4WD6 A;  1XM8 A;  2Y8B A;  5A0T A;  3I14 A;  2WHG A;  5FQC A;  3IEM A;  2HB9 A;  3I13 A;  3FCZ A;  4RBS A;  3IOF A;  5K4N A;  4EYL A;  2P1E A;  5EVK A;  5K4K A;  4GYQ A;  2NZE A;  4D1T A;  2AIO A;  2GMN A;  5HIO A;  1DXK A;  4XWT A;  4ZNB A;  5FQA A;  2CBN A;  5AJL A;  2QDS A;  5AXR A;  2Q9U A;  4Z67 A;  2Q0J A;  4UAM A;  5EV6 A;  5HH6 A;  4F6Z A;  2XF4 A;  2YNV B;  5EHT A;  4C1H A;  3I15 A;  1M2X A;  5AYA A;  2BTN A;  4UA4 A;  5ACR A;  4AD9 A;  2YCB A;  5AIJ A;  2YHE A;  3AF5 A;  2ZNB A;  4D02 A;  3BV6 A;  2Q42 A;  4RM5 A;  2FU7 A;  5A87 A;  2BFL A;  2OHJ A;  4EXY A;  2WYM A;  4AWY B;  5HH5 A;  5ACT A;  2FHX B;  4P62 A;  1HLK A;  3L6N A;  1MQO A;  5K4M A;  2YNV A;  3IEL A;  4EY2 A;  2FU6 A;  2AZ4 A;  1L9Y A;  5ACW A;  3TP9 A;  2ZWR A;  2DOO A;  3DHA A; 
#chains in the Genus database with same CATH homology
 4B87 A;  2ZZI A;  5LLD A;  2E7Y A;  2QIN A;  5ACS A;  4TZE A;  3A4Y A;  3G1P A;  4C1F A;  5IQK A;  4XUK A;  2XR1 A;  3KNS A;  5LS3 A;  1YCF A;  4D1V A;  1VME A;  4YSL A;  4EXS A;  2BG6 A;  3DHB A;  1JJT A;  2FM6 A;  4RAW A;  5LSC A;  2NZF A;  3I0V A;  2YNT B;  4AX0 B;  4KEQ A;  2GKL A;  5A5Z A;  4C1D A;  2M5C A;  2WYL A;  5LCH A;  4XWW A;  5EV8 A;  1JT1 A;  2BG7 A;  3ZQ4 A;  2A7M A;  4YSK A;  3H3E A;  3ADR A;  4NQ5 A;  4BP0 A;  3IEK A;  4TZF A;  5LE1 A;  1KO2 A;  4NQ4 A;  5ACQ A;  4J5H A;  1BVT A;  3MD7 A;  5HH4 A;  2OHI A;  4J5F A;  4UWS B;  4JO0 A;  3VQZ A;  2BMI A;  4UBQ A;  4Z6X A;  2GFK A;  5EW0 A;  2GFJ A;  2GCU A;  5FQB A;  4FSB A;  4DIK A;  3IOG A;  3IE1 A;  2QJS A;  2NYP A;  4FR7 A;  3X2Z A;  1WW1 A;  4LE6 A;  4YSB A;  1SML A;  1YCH A;  3IE0 A;  2Y87 A;  3BK2 A;  2BIB A;  5ACX A;  5ACV A;  2FU9 A;  2Q0I A;  3SRX A;  1BMC A;  2R2D A;  2I7X A;  5LCF A;  2UYX A;  4F6H A;  1VGN A;  1ZNB A;  5LM6 A;  5AEB A;  3JXP A;  4UWP B;  5EVD A;  4D1W A;  3DH8 A;  4EFZ A;  1ZTC A;  5KIK A;  3SW3 A;  2NXA A;  3T3O A;  4HL2 A;  1KR3 A;  4GCW A;  3BK1 A;  4DIL A;  4C1G A;  2H6A A;  1A8T A;  3RPC A;  1VJN A;  4C09 A;  5EWA A;  2WYM C;  5AXO A;  3BC2 A;  1X8H A;  4PVO A;  1P9E A;  2I7V A;  1X8G A;  3S0Z A;  5ACP A;  4ZO3 A;  2M5D A;  4D1U A;  3PG4 A;  4UWO B;  2P97 A;  2BFZ B;  2I7T A;  5K0W A;  2BG8 B;  2YNU A;  4V0H A;  2FHX A;  3ZNB A;  2QDT A;  4EYF A;  3RKJ A;  4C1E A;  1ZKP A;  4KEP A;  3SPU A;  4PVT A;  3X30 A;  4EYB A;  3T3N A;  5EH9 A;  5B3R A;  5AHO A;  3SBL A;  3ESH A;  2BR6 A;  4FEK A;  5HIQ A;  5HIS A;  1WUO A;  3QH8 A;  2P18 A;  1QH5 A;  1XTO A;  1DD6 A;  3X2X A;  4BZ3 A;  4NQ6 A;  5B1U A;  2OHH A;  4TZB A;  3DHC A;  4TYT A;  3P2U A;  3LVZ A;  3VPE A;  4C1C A;  1K07 A;  4Z7R A;  2YNW A;  4UWR B;  4AWZ A;  4RL2 A;  2BFZ A;  3WXC A;  4RAM A;  4Z5Y A;  3FAI A;  2BG8 A;  4H0D A;  5AHR A;  4ZO2 A;  2YNT A;  4NQ2 A;  2P4Z A;  2BC2 A;  5DPX A;  4AX1 B;  1QH3 A;  2BG2 A;  1YCG A;  3SD9 A;  1BC2 A;  2YZ3 A;  1A7T A;  4GYU A;  3AJ3 A;  2DKF A;  3KL7 A;  2FK6 A;  2QED A;  3SFP A;  5LCA A;  4CHL A;  3RKK A;  5EVB A;  1KO3 A;  2BFK A;  3AF6 A;  5LMC A;  4HKY A;  1E5D A;  3T9M A;  3ZWF A;  4RL0 A;  1WRA A;  1DDK A;  4O98 A;  1WUP A;  5HIP A;  2WRS A;  4TZ9 A;  4U4L A;  4TYF A;  3IE2 A;  1X8I A;  2ZO4 A;  5B15 A;  4HL1 A;  3IDZ A;  3KNR A;  3I11 A;  4ZEJ A;  3Q6V A;  4Z5Z A;  3PY6 A;  3ZR9 A;  3F9O A;  5ACU A;  3R2U A;  5A0V A;  1JJE A;  2FU8 A;  3PY5 A;  4Z60 A;  2VW8 A;  3X2Y A;  1Y44 A;  5KIL A;  2Y8A A;  2BGA A;  4WD6 A;  1XM8 A;  2Y8B A;  5A0T A;  3I14 A;  2WHG A;  5FQC A;  3IEM A;  2HB9 A;  3I13 A;  3FCZ A;  4RBS A;  3IOF A;  5K4N A;  4EYL A;  2P1E A;  5EVK A;  5K4K A;  4GYQ A;  2NZE A;  4D1T A;  2AIO A;  2GMN A;  5HIO A;  1DXK A;  4XWT A;  4ZNB A;  5FQA A;  2CBN A;  2QDS A;  5AXR A;  2Q9U A;  4Z67 A;  2Q0J A;  4UAM A;  5EV6 A;  5HH6 A;  4F6Z A;  2XF4 A;  2YNV B;  5EHT A;  4C1H A;  3I15 A;  1M2X A;  5AYA A;  2BTN A;  4UA4 A;  5ACR A;  4AD9 A;  2YCB A;  3AF5 A;  2ZNB A;  4D02 A;  3BV6 A;  2Q42 A;  4RM5 A;  2FU7 A;  5A87 A;  2BFL A;  2OHJ A;  4EXY A;  2WYM A;  4AWY B;  5HH5 A;  5ACT A;  2FHX B;  4P62 A;  1HLK A;  3L6N A;  1MQO A;  5K4M A;  2YNV A;  3IEL A;  4EY2 A;  2FU6 A;  2AZ4 A;  1L9Y A;  5ACW A;  3TP9 A;  2ZWR A;  2DOO A;  3DHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...